Thermoelectric properties of one-dimensional graphene antidot arrays
International Nuclear Information System (INIS)
Yan, Yonghong; Liang, Qi-Feng; Zhao, Hui; Wu, Chang-Qin; Li, Baowen
2012-01-01
We investigate the thermoelectric properties of one-dimensional (1D) graphene antidot arrays by nonequilibrium Green's function method. We show that by introducing antidots to the pristine graphene nanoribbon the thermal conductance can be reduced greatly while keeping the power factor still high, thus leading to an enhanced thermoelectric figure of merit (ZT). Our numerical results indicate that ZT values of 1D antidot graphene arrays can be up to unity, which means the 1D graphene antidot arrays may be promising for thermoelectric applications. -- Highlights: ► We study thermoelectric properties of one-dimensional (1D) graphene antidot arrays. ► Thermoelectric figure of merit (ZT) of 1D antidot arrays can exceed unity. ► ZT of 1D antidot arrays is larger than that of two-dimensional arrays.
Graphene antidot lattice waveguides
DEFF Research Database (Denmark)
Pedersen, Jesper Goor; Gunst, Tue; Markussen, Troels
2012-01-01
We introduce graphene antidot lattice waveguides: nanostructured graphene where a region of pristine graphene is sandwiched between regions of graphene antidot lattices. The band gaps in the surrounding antidot lattices enable localized states to emerge in the central waveguide region. We model...... the waveguides via a position-dependent mass term in the Dirac approximation of graphene and arrive at analytical results for the dispersion relation and spinor eigenstates of the localized waveguide modes. To include atomistic details we also use a tight-binding model, which is in excellent agreement...... with the analytical results. The waveguides resemble graphene nanoribbons, but without the particular properties of ribbons that emerge due to the details of the edge. We show that electrons can be guided through kinks without additional resistance and that transport through the waveguides is robust against...
Electronic properties of graphene antidot lattices
DEFF Research Database (Denmark)
Fürst, Joachim Alexander; Pedersen, Jesper Goor; Flindt, C.
2009-01-01
Graphene antidot lattices constitute a novel class of nano-engineered graphene devices with controllable electronic and optical properties. An antidot lattice consists of a periodic array of holes that causes a band gap to open up around the Fermi level, turning graphene from a semimetal...... into a semiconductor. We calculate the electronic band structure of graphene antidot lattices using three numerical approaches with different levels of computational complexity, efficiency and accuracy. Fast finite-element solutions of the Dirac equation capture qualitative features of the band structure, while full...
Spectral Gaps in Graphene Antidot Lattices
DEFF Research Database (Denmark)
Barbaroux, Jean-Marie; Cornean, Decebal Horia; Stockmeyer, Edgardo
2017-01-01
We consider the gap creation problem in an antidot graphene lattice, i.e. a sheet of graphene with periodically distributed obstacles. We prove several spectral results concerning the size of the gap and its dependence on different natural parameters related to the antidot lattice....
Antidote use in a pediatric emergency department
Martínez Sánchez, L; Almario Hernández, AF; Escuredo Argullós, L; Mação, P; Trenchs Sainz de la Maza, V; Luaces Cubells, C
2014-01-01
INTRODUCTION: Poisoning is an infrequent cause of consultation in a pediatric emergency department (PED), but it can be potentially serious. Pediatricians should know how to use the available antidotes properly. OBJECTIVES: To analyze the use of antidotes in a PED and to assess the suitability of their indications. MATERIALS AND METHODS: A retrospective review of antidote use in a PED between January 2008 and June 2012. Inclusion criteria were age younger than 18 years and cons...
Appropriate Utilization and Stocking of Antidotes in Qatar Public Hospitals
Directory of Open Access Journals (Sweden)
Rawan Salameh
2017-09-01
Full Text Available Background: There are a few studies that evaluate preparedness and availability of antidotes in the emergency setting and none have been conducted in Qatar. Published studies show that timely availability of antidotes in the emergency department setting is a common issue. To address this, we conducted a study to evaluate antidote stocking and utilization in Qatar hospital pharmacies and emergency departments. Methods: In order to evaluate the appropriate use and timely administration of antidotes, research assistants prospectively collected data on ED patients. All ED patients who received any key antidote over the 6-month study period were identified through both ED and pharmacy records. In order to evaluate the stocking of the 31 most important antidotes in our main public hospitals, a survey assessing the stocking of these key antidotes was sent to the four general hospitals in Qatar, to determine their availability and whether they are stocked in the ED or only in the main pharmacy. Results: Poison exposure was evaluated in 471 cases. Antidotes were given within 30 minutes in 73% of cases, which included atropine, calcium, dextrose, flumazenil, naloxone, pralidoxime, sodium bicarbonate, thiamine, vitamin K and scorpion and snake antivenoms. Administration occurred later than 60 minutes in 2% of cases, exclusively with N-acetylcysteine and activated charcoal. Atropine, calcium, dextrose, naloxone, pralidoxime (2-PAM, sodium bicarbonate, and anti-venoms were clinically indicated 92% of the times they were ordered. N-acetylcysteine was indicated in only 51.5% of administrations. Significant variation in antidote stocking existed between hospitals, and there was no stocked hydroxocobalamin as antidotes for cyanide poisoning or fomepizole for toxic alcohol poisoning. Conclusion: Antidote stocking varied significantly between hospitals, and antidotes necessary for cyanide and toxic alcohol poisoning were deficient in all public hospitals. The
Graphene antidot lattice transport measurements
DEFF Research Database (Denmark)
Mackenzie, David; Cagliani, Alberto; Gammelgaard, Lene
2017-01-01
We investigate graphene devices patterned with a narrow band of holes perpendicular to the current flow, a few-row graphene antidot lattice (FR-GAL). Theoretical reports suggest that a FR-GAL can have a bandgap with a relatively small reduction of the transmission compared to what is typical...... for antidot arrays devices. Graphene devices were fabricated using 100 keV electron beam lithography (EBL) for nanopatterning as well as for defining electrical contacts. Patterns with hole diameter and neck widths of order 30 nm were produced, which is the highest reported pattern density of antidot lattices...... in graphene reported defined by EBL. Electrical measurements showed that devices with one and five rows exhibited field effect mobility of ∼100 cm2/Vs, while a larger number of rows, around 40, led to a significant reduction of field effect mobility (
International Nuclear Information System (INIS)
Cherkes, A.I.; Braver-Chernobul'skaya, B.S.
1977-06-01
The blockade of the sulfhydryl groups of the proteins leads to a disturbance of the normal activity of many enzymes and thus of the functioning of the organs and tissue. The search for antidotes against these substances which inactivate the enzymes led to the synthesis of a large group of thiols in the Ukrainian Scientific Research Sanitary Chemical Institute. The most active is sodium dithiol-2,3-dimercaptonpropansulphonate CH 2 SH-CHSH-CH 2 SO 3 Na x H 2 O, named unithiol. Its antidote activity is discussed in detail, especially concerning cobalt intoxication. (HK) [de
Magnetic Property in Large Array Niobium Antidot Thin Films
Tinghui, Chen; Hsiang-Hsi, Kung; Wei-Li, Lee; Institute of Physics, Academia Sinica, Taipei, Taiwan Team
2014-03-01
In a superconducting ring, the total flux inside the ring is required to be an integer number of the flux quanta. Therefore, a supercurrent current can appear within the ring in order to satisfy this quantization rule, which gives rise to certain magnetic response. By using a special monolayer polymer/nanosphere hybrid we developed previously, we fabricated a series of superconducting niobium antidot thin films with different antidot diameters. The antidots form well-ordered triangular lattice with a lattice spacing about 200 nm and extend over an area larger than 1 cm2, which enables magnetic detections simply by a SQUID magnetometer. We observed magnetization oscillation with external magnetic field due to the supercurrent screening effect, where different features for large and small antidot thin films were found. Detailed size and temperature dependencies of the magnetization in niobium antidot nanostructures will be presented.
ACUTE TOXICITY STUDIES AND ANTIDOTAL THERAPY OF ...
African Journals Online (AJOL)
ACUTE TOXICITY STUDIES AND ANTIDOTAL THERAPY OF ETHANOL EXTRACT OF JATROPHA CURCAS SEEDS IN EXPERIMENTAL ANIMALS. ... with the aim of investigating the toxicity of the ethanol seed extract of JC in rats, mice, and chicks; and also to use conventional antidotes to treat intoxication in rats due to ...
Graphene on graphene antidot lattices
DEFF Research Database (Denmark)
Gregersen, Søren Schou; Pedersen, Jesper Goor; Power, Stephen
2015-01-01
Graphene bilayer systems are known to exhibit a band gap when the layer symmetry is broken by applying a perpendicular electric field. The resulting band structure resembles that of a conventional semiconductor with a parabolic dispersion. Here, we introduce a bilayer graphene heterostructure......, where single-layer graphene is placed on top of another layer of graphene with a regular lattice of antidots. We dub this class of graphene systems GOAL: graphene on graphene antidot lattice. By varying the structure geometry, band-structure engineering can be performed to obtain linearly dispersing...
Periodic Arrays of Phosphorene Nanopores as Antidot Lattices with Tunable Properties.
Cupo, Andrew; Masih Das, Paul; Chien, Chen-Chi; Danda, Gopinath; Kharche, Neerav; Tristant, Damien; Drndić, Marija; Meunier, Vincent
2017-07-25
A tunable band gap in phosphorene extends its applicability in nanoelectronic and optoelectronic applications. Here, we propose to tune the band gap in phosphorene by patterning antidot lattices, which are periodic arrays of holes or nanopores etched in the material, and by exploiting quantum confinement in the corresponding nanoconstrictions. We fabricated antidot lattices with radii down to 13 nm in few-layer black phosphorus flakes protected by an oxide layer and observed suppression of the in-plane phonon modes relative to the unmodified material via Raman spectroscopy. In contrast to graphene antidots, the Raman peak positions in few-layer BP antidots are unchanged, in agreement with predicted power spectra. We also use DFT calculations to predict the electronic properties of phosphorene antidot lattices and observe a band gap scaling consistent with quantum confinement effects. Deviations are attributed primarily to self-passivating edge morphologies, where each phosphorus atom has the same number of bonds per atom as the pristine material so that no dopants can saturate dangling bonds. Quantum confinement is stronger for the zigzag edge nanoconstrictions between the holes as compared to those with armchair edges, resulting in a roughly bimodal band gap distribution. Interestingly, in two of the antidot structures an unreported self-passivating reconstruction of the zigzag edge endows the systems with a metallic component. The experimental demonstration of antidots and the theoretical results provide motivation to further scale down nanofabrication of antidots in the few-nanometer size regime, where quantum confinement is particularly important.
Appropriate Utilization and Stocking of Antidotes in Qatar Public Hospitals
Rawan Salameh; Waleed Awad Salem; ISMA Qureshi; Asma Al-Bukari; Eman Shaat; Jibin Moinudheen; Galal Aleassi; Robert Hoffman
2017-01-01
Background: There are a few studies that evaluate preparedness and availability of antidotes in the emergency setting and none have been conducted in Qatar. Published studies show that timely availability of antidotes in the emergency department setting is a common issue. To address this, we conducted a study to evaluate antidote stocking and utilization in Qatar hospital pharmacies and emergency departments. Methods: In order to evaluate the appropriate use and timely administration of antid...
Cyanide poisoning in Thailand before and after establishment of the National Antidote Project.
Srisuma, Sahaphume; Pradoo, Aimon; Rittilert, Panee; Wongvisavakorn, Sunun; Tongpoo, Achara; Sriapha, Charuwan; Krairojananan, Wannapa; Suchonwanich, Netnapis; Khomvilai, Sumana; Wananukul, Winai
2018-04-01
Antidote shortage is a global problem. In Thailand, the National Antidote Project (NAP) has operated since November 2010 to manage the national antidote stockpile, educate the healthcare providers on appropriate antidote use, and evaluate antidote usage. To evaluate the effect of NAP implementation on mortality rate and antidote use in cyanide poisoning cases arising from ingestion of cyanide or cyanogenic glycoside. This is a retrospective cohort of poisoning cases involving cyanide or cyanogenic glycoside ingestion reported to Ramathibodi Poison Center from 1 January 2007 to 31 December 2015. Mortality rate, antidote use, and appropriateness of antidote use (defined as correct indication, proper dosing regimen, and administration within 90 min) before and after NAP implementation were compared. Association between parameters and fatal outcomes was analyzed. A total of 343 cases involving cyanide or cyanogenic glycoside ingestion were reported to Ramathibodi Poison Center. There were 213 cases (62.1%) during NAP (Project group) and 130 cases (37.9%) pre-NAP implementation (Before group). Implementation of NAP led to increased antidote use (39.9% in Project group versus 24.6% in Before group) and a higher rate of appropriate antidote use (74.1% in Project group versus 50.0% in Before group). All 30 deaths were presented with initial severe symptoms. Cyanide chemical source and self-harm intent were associated with death (OR: 12.919, 95% CI: 4.863-39.761 and OR: 10.747, 95% CI: 3.884-28.514, respectively). No difference in overall mortality rate (13 [10.0%] deaths before versus 17 [8.0%] deaths after NAP) was found. In subgroup analysis of 80 cases with initial severe symptoms, NAP and appropriate antidote use reduced mortality (OR: 0.327, 95% CI: 0.106-0.997 and OR: 0.024, 95% CI: 0.004-0.122, respectively). In the multivariate analysis of the cases with initial severe symptoms, presence of the NAP and appropriate antidote use independently reduced the risk of
Thermoelectric properties of finite graphene antidot lattices
DEFF Research Database (Denmark)
Gunst, Tue; Markussen, Troels; Jauho, Antti-Pekka
2011-01-01
We present calculations of the electronic and thermal transport properties of graphene antidot lattices with a finite length along the transport direction. The calculations are based on the π-tight-binding model and the Brenner potential. We show that both electronic and thermal transport...... properties converge fast toward the bulk limit with increasing length of the lattice: only a few repetitions (≃6) of the fundamental unit cell are required to recover the electronic band gap of the infinite lattice as a transport gap for the finite lattice. We investigate how different antidot shapes...... and sizes affect the thermoelectric properties. The resulting thermoelectric figure of merit, ZT, can exceed 0.25, and it is highly sensitive to the atomic arrangement of the antidot edges. Specifically, hexagonal holes with pure armchair edges lead to an order-of-magnitude larger ZT as compared to pure...
Berry Curvature and Nonlocal Transport Characteristics of Antidot Graphene
Directory of Open Access Journals (Sweden)
Jie Pan
2017-09-01
Full Text Available Antidot graphene denotes a monolayer of graphene structured by a periodic array of holes. Its energy dispersion is known to display a gap at the Dirac point. However, since the degeneracy between the A and B sites is preserved, antidot graphene cannot be described by the 2D massive Dirac equation, which is suitable for systems with an inherent A/B asymmetry. From inversion and time-reversal-symmetry considerations, antidot graphene should therefore have zero Berry curvature. In this work, we derive the effective Hamiltonian of antidot graphene from its tight-binding wave functions. The resulting Hamiltonian is a 4×4 matrix with a nonzero intervalley scattering term, which is responsible for the gap at the Dirac point. Furthermore, nonzero Berry curvature is obtained from the effective Hamiltonian, owing to the double degeneracy of the eigenfunctions. The topological manifestation is shown to be robust against randomness perturbations. Since the Berry curvature is expected to induce a transverse conductance, we have experimentally verified this feature through nonlocal transport measurements, by fabricating three antidot graphene samples with a triangular array of holes, a fixed periodicity of 150 nm, and hole diameters of 100, 80, and 60 nm. All three samples display topological nonlocal conductance, with excellent agreement with the theory predictions.
Magnetic properties engineering of nanopatterned cobalt antidot arrays
International Nuclear Information System (INIS)
Kaidatzis, Andreas; Niarchos, Dimitrios; Del Real, Rafael P; Vázquez, Manuel; Alvaro, Raquel; Anguita, José; García-Martín, José Miguel; Luis Palma, Juan; Escrig, Juan
2016-01-01
We report on the study of arrays of 60 nm wide cobalt antidots, nanopatterned using focused ion beam milling. Square and hexagonal symmetry arrays have been studied, with varying antidot densities and lattice constant from 150 up to 300 nm. We find a strong increase of the arrays’ magnetic coercivity with respect to the unpatterned film, which is monotonic as the antidot density increases. Additionally, there is a strong influence of the array symmetry to the in-plane magnetic anisotropy: square arrays exhibit fourfold symmetry and hexagonal arrays exhibit sixfold symmetry. The above findings are corroborated by magnetic imaging and micromagnetic modeling, which show the magnetic structure of the arrays to depend strongly on the array morphology. (paper)
Anisotropy of magnetic properties in 2D arrays of permalloy antidots
Energy Technology Data Exchange (ETDEWEB)
Kolmychek, I.A., E-mail: irisha@shg.ru [Moscow State University, 119991 GSP-1, Leninskie Gory, Moscow (Russian Federation); Krutyanskiy, V.L.; Gusev, K.S.; Murzina, T.V. [Moscow State University, 119991 GSP-1, Leninskie Gory, Moscow (Russian Federation); Tahir, N.; Kurant, Z.; Maziewski, A. [Department of Physics, University of Bialystok (Poland); Ding, J.; Adeyeye, A.O. [Department of Electrical Computer Engineering, National University of Singapore (Singapore)
2016-12-15
Anisotropy of linear and nonlinear magnetooptical (MO) effects in a regular array of Py antidots is studied by means of the MO Kerr effect at the fundamental and second harmonic wavelengths. We have demonstrated that the value of the MO effect, coercivity, and magnetization distribution depend substantially on the azimuthal orientation of the antidots array relatively to the external magnetic field. - Highlights: • The results from the anisotropy of Py antidots are presented. • The hard magnetization axis is oriented along the side of the antidot square lattice. • The value of the saturated LMOKE effect is isotropic. • The maximum of the SHG magnetic contrast was observed along easy axis.
48 CFR 225.7005 - Restriction on certain chemical weapons antidote.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Restriction on certain chemical weapons antidote. 225.7005 Section 225.7005 Federal Acquisition Regulations System DEFENSE... on certain chemical weapons antidote. ...
A micromagnetic study of the hysteretic behavior of antidot Fe films
International Nuclear Information System (INIS)
Torres Bruna, J.M.; Bartolome, J.; Garcia Vinuesa, L.M.; Garcia Sanchez, F.; Gonzalez, J.M.; Chubykalo-Fesenko, O.A.
2005-01-01
We report on the results of a micromagnetic study of the magnetization reversal process taking place in square arrays of antidots lithographed in Fe thin films. Our study focuses on the influence on the reversal process of the antidot diameter and the distance between adjacent antidots. It is shown that the minimization of the dipolar energy term of the total system energy originates inhomogeneous moment distributions at the antidot surfaces, and that these structures and their coupling rule the reversal process. We also show that the variation of the interantidot distance in the range of a few units of the exchange length allows varying the coercive force value by a factor of four approximately
Creation of a virtual antidotes network between pharmacy departments of catalan hospitals
Directory of Open Access Journals (Sweden)
Raquel Aguilar-Salmerón
2017-05-01
Full Text Available Objetive: To design a virtual antidote network between hospitals that could help to locate on-line those hospitals that stocked those antidotes with the highest difficulty in terms of availability, and ensured that the medication was loaned in case of necessity.Methods: The application was developed by four hospital pharmacists and two clinical toxicologists with the support of a Healthcare Informatics Consultant Company.Results: The antidotes network in Catalonia, Spain, was launched in July 2015. It can be accessed through the platform: www.xarxaantidots.org. The application has an open area with overall information about the project and the option to ask toxicological questions of non-urgent nature. The private area is divided into four sections: 1 Antidotes: data of interest about the 15 antidotes included in the network and their recommended stock depending on the complexity of the hospital, 2 Antidote stock management: virtual formulary, 3 Loans: location of antidotes through the on-line map application Google Maps, and virtual loan request, and 4 Documentation: As of June, 2016, 40 public and private hospitals have joined the network, from all four provinces of Catalonia, which have accessed the private area 2 102 times, requested two loans of silibinin, one of hydroxocobalamin, three of antiophidic serum and three of botulism antitoxin. Thirteen toxicological consultations have been received.Conclusions: The implementation of this network improves the communication between centers that manage poisoned patients, adapts and standardizes the stock of antidotes in hospitals, speeds up loans if necessary, and improves the quality of care for poisoned patients.
All optical detection of picosecond spin-wave dynamics in 2D annular antidot lattice
Porwal, Nikita; Mondal, Sucheta; Choudhury, Samiran; De, Anulekha; Sinha, Jaivardhan; Barman, Anjan; Datta, Prasanta Kumar
2018-02-01
Novel magnetic structures with precisely controlled dimensions and shapes at the nanoscale have potential applications in spin logic, spintronics and other spin-based communication devices. We report the fabrication of 2D bi-structure magnonic crystal in the form of embedded nanodots in a periodic Ni80Fe20 antidot lattice structure (annular antidot) by focused ion-beam lithography. The spin-wave spectra of the annular antidot sample, studied for the first time by a time-resolved magneto-optic Kerr effect microscopy show a remarkable variation with bias field, which is important for the above device applications. The optically induced spin-wave spectra show multiple modes in the frequency range 14.7 GHz-3.5 GHz due to collective interactions between the dots and antidots as well as the annular elements within the whole array. Numerical simulations qualitatively reproduce the experimental results, and simulated mode profiles reveal the spatial distribution of the spin-wave modes and internal magnetic fields responsible for these observations. It is observed that the internal field strength increases by about 200 Oe inside each dot embedded within the hole of annular antidot lattice as compared to pure antidot lattice and pure dot lattice. The stray field for the annular antidot lattice is found to be significant (0.8 kOe) as opposed to the negligible values of the same for the pure dot lattice and pure antidot lattice. Our findings open up new possibilities for development of novel artificial crystals.
Designed defects in 2D antidot lattices for quantum information processing
DEFF Research Database (Denmark)
Pedersen, Jesper Goor; Flindt, Christian; Mortensen, Niels Asger
2008-01-01
We propose a new physical implementation of spin qubits for quantum information processing, namely defect states in antidot lattices defined in the two-dimensional electron gas (2DEG) at a semiconductor heterostructure. Calculations of the band structure of a periodic antidot lattice are presented...
Enhanced quantum interference transport in gold films with random antidot arrays
Directory of Open Access Journals (Sweden)
Zhaoguo Li
2016-09-01
Full Text Available We report on the quantum interference transport of randomly distributed antidot arrays, which were prepared on gold films via the focused ion beam direct writing method. The temperature dependence of the gold films’ resistances with and without random antidot arrays were described via electron–phonon interaction theory. Compared with the pristine gold films, we observed an unexpected enhancement of the weak localization signature in the random antidot array films. The physical mechanism behind this enhancement may originate from the enhancement of electron–electron interactions or the suppression of electron–phonon interactions; further evidence is required to determine the exact mechanism.
Magnetic edge states and magnetotransport in graphene antidot barriers
DEFF Research Database (Denmark)
Thomsen, M. R.; Power, Stephen; Jauho, Antti-Pekka
2016-01-01
Magnetic fields are often used for characterizing transport in nanoscale materials. Recent magnetotransport experiments have demonstrated that ballistic transport is possible in graphene antidot lattices (GALs). These experiments have inspired the present theoretical study of GALs in a perpendicu......Magnetic fields are often used for characterizing transport in nanoscale materials. Recent magnetotransport experiments have demonstrated that ballistic transport is possible in graphene antidot lattices (GALs). These experiments have inspired the present theoretical study of GALs...
Magnetic characteristics of CoPd and FePd antidot arrays on nanoperforated Al_2O_3 templates
International Nuclear Information System (INIS)
Maximenko, A.; Fedotova, J.; Marszałek, M.; Zarzycki, A.; Zabila, Y.
2016-01-01
Hard magnetic antidot arrays show promising results in context of designing of percolated perpendicular media. In this work the technology of magnetic FePd and CoPd antidot arrays fabrication is presented and correlation between surface morphology, structure and magnetic properties is discussed. CoPd and FePd antidot arrays were fabricated by deposition of Co/Pd and Fe/Pd multilayers (MLs) on porous anodic aluminum oxide templates with bowl-shape cell structure with inclined intercellular regions. FePd ordered L1_0 structure was obtained by successive vacuum annealing at elevated temperatures (530 °C) and confirmed by XRD analysis. Systematic analysis of magnetization curves evidenced perpendicular magnetic anisotropy of CoPd antidot arrays, while FePd antidot arrays revealed isotropic magnetic anisotropy with increased out-of-plane magnetic contribution. MFM images of antidots showed more complicated contrast, with alternating magnetic dots oriented parallel and antiparallel to tip magnetization moment. - Highlights: • CoPd and FePd antidots were fabricated on porous anodic aluminum oxide templates. • CoPd antidot arrays have perpendicular magnetic anisotropy. • FePd antidot arrays revealed isotropic magnetic behavior. • The complex morphology of nanoporous template resulted in a complex magnetic domains image.
Magnetic properties of Fe20 Ni80 antidots: Pore size and array disorder
International Nuclear Information System (INIS)
Palma, J.L.; Gallardo, C.; Spinu, L.; Vargas, J.M.; Dorneles, L.S.; Denardin, J.C.; Escrig, J.
2013-01-01
Magnetic properties of nanoscale Fe 20 Ni 80 antidot arrays with different hole sizes prepared on top of nanoporous alumina membranes have been studied by means of magnetometry and micromagnetic simulations. The results show a significant increase of the coercivity as well as a reduction of the remanence of the antidot arrays, as compared with their parent continuous film, which depends on the hole size introduced in the Fe 20 Ni 80 thin film. When the external field is applied parallel to the antidots, the reversal of magnetization is achieved by free-core vortex propagation, whereas when the external field is applied perpendicular to the antidots, the reversal occurs through a process other than the coherent rotation (a maze-like pattern). Besides, in-plane hysteresis loops varying the angle show that the degree of disorder in the sample breaks the expected hexagonal symmetry. - Highlights: • Magnetic properties are strongly influenced by the pore diameter of the samples. • Coercive fields for antidots are higher than the values for the continuous film. • Disorder breaks the hexagonal symmetry of the sample. • Each hole acts as a vortex nucleation point. • Antidots have unique properties that allow them to be used in applications
A Novel Paradigm for Assessing Efficacies of Potential Antidotes against Neurotoxins in Mice
Crankshaw, Daune L.; Goon, David J.W.; Briggs, Jacquie E.; DeLong, David; Kuskowski, Michael; Patterson, Steven E.; Nagasawa, Herbert T.
2007-01-01
Historically, antidotal potencies of cyanide antagonists were measured as increases in the experimental LD50 for cyanide elicited by the antidotes. This required the use of high doses of cyanide following pretreatment with the putative antidote. Since IACUC guidelines at our institutions strongly discourage LD50 determinations: we developed a new test paradigm that allowed for maximal survival of cyanide-treated animals with greatly reduced numbers of animals. Symptoms of cyanide toxicity inc...
An All-Hazards Approach to Antidotal Therapy in Cyanide Poisoning
International Nuclear Information System (INIS)
Borron, S. W.; Arias, J. C.
2007-01-01
In recent years in the USA, increased emphasis has been placed on utilizing an 'all-hazards approach' in the development and testing of disaster plans. Disaster plans developed in this way should prepare the community to deal with a wide variety of natural and man-made emergencies, both anticipated and unanticipated in etiology. The basic approach in each disaster remains the same, with adaptation as necessary to deal with specific threats. Such an approach 'enables communities to be prepared to manage any number or type of emergencies. It facilitates prevention, preparation, response, and recovery, based on the broad scope of what could happen within and beyond the community.' (JCAHO) An all-hazards approach appears to have merit as well in the selection of antidotes for mass casualty use. Using cyanide as an example, we examine several criteria which permit a disaster preparedness entity to choose among available cyanide antidotes to permit the broadest application possible in the context of a cyanide-related chemical emergency. These criteria include: source of exposure, efficacy, safety (in the presence and absence of poisoning), safety in adults and children, ease of administration, conditions for storage and maintenance, stock rotation, and cost. The greatest limitation to the all-hazards approach in antidote selection is geographic availability. Because of the high cost of regulatory approval and historical protectionism / preferences by governments, certain regions may have little or no choice in the selection of antidotes. Hydroxocobalamin appears to best meet the requirements of an 'all-hazards' antidote for cyanide.(author)
Optical properties of graphene antidot lattices
DEFF Research Database (Denmark)
Pedersen, Thomas Garm; Flindt, Christian; Pedersen, Jesper Goor
2008-01-01
Undoped graphene is semimetallic and thus not suitable for many electronic and optoelectronic applications requiring gapped semiconductor materials. However, a periodic array of holes (antidot lattice) renders graphene semiconducting with a controllable band gap. Using atomistic modeling, we demo...
Intox, detox, antidotes - Evidence based diagnosis and treatment of acute intoxications.
Schaper, Andreas; Ebbecke, Martin
2017-11-01
Aim of this review is to describe the role of clinical toxicology in the context of acute medicine. A special focus is put on antidotes and important aspects of diagnosis and therapy of acute intoxications. The data of the annual report of GIZ-Nord Poisons Centre is analyzed concerning the following aspects: what intoxications are relevant in acute medicine, are there special aspects in therapy, e.g. antidotes, and what antidotes are relevant? More over intoxication-related fatalities are analyzed. In 2015 the poisons centre was consulted in 33,000 cases of acute intoxications. The most important groups are drugs (e.g. antidepressants, beta blockers and calcium channel blockers), chemical products (e.g. products containing surfactant, corrosive substances and toxic alcohols like methanol), plants and recreational drugs. Intoxications are relevant in acute medicine. Some substances can cause fatal intoxications. Important antidotes are naloxone for opiods, acetylcystein for paracetamol, fomepizole and ethanol for toxic alcohols and diazepam for intoxications caused by chloroquine. Copyright © 2017 European Federation of Internal Medicine. Published by Elsevier B.V. All rights reserved.
Antidotes for Cyanide Poisoning
2013-01-01
treatment, six task forces formulated recom- mendations for a national structure of prehospital EM by family physicians, ambulance nurses , and hospital...competencies between ambulance nurses and prehospital physicians. Eur J Emerg Med 2011; 18:322 327. Antidotes for cyanide poisoning Vikhyat S. Bebarta...the study model (limited to 60 min after the start of cyanide infusion) and the hemodynamic parameters as end points, instead of long-term sequelae
Histopathological and Biochemical evaluations of the antidotal ...
African Journals Online (AJOL)
AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search · USING AJOL ... Conclusion: The study concludes that impaired liver functions and ... Keywords: Nigella sativa, dichlorvos, antidotal effect, hepatotoxicity, liver function test ...
COBALT COMPOUNDS AS ANTIDOTES FOR HYDROCYANIC ACID.
EVANS, C L
1964-12-01
The antidotal potency of a cobalt salt (acetate), of dicobalt edetate, of hydroxocobalamin and of cobinamide against hydrocyanic acid was examined mainly on mice and rabbits. All the compounds were active antidotes for up to twice the LD50; under some conditions for larger doses. The most successful was cobalt acetate for rabbits (5xLD50), which was effective at a molar cyanide/cobalt (CN/Co) ratio of 5, but had as a side-effect intense purgation. Hydroxocobalamin was irregular in action, but on the whole was most effective for mice (4.5xLD50 at a molar ratio of 1), and had no apparent side effects. Dicobalt edetate, at molar ratios of up to 2, was more effective for rabbits (3xLD50) than for mice (2xLD50), but had fewer side effects than cobalt acetate. The effect of thiosulphate was to augment the efficacy of dicobalt edetate and, in mice, that of hydroxocobalamin; but, apparently, in rabbits, to reduce that of hydroxocobalamin. Cobinamide, at a molar ratio of 1, was slightly more effective than hydroxocobalamin on rabbits and also less irregular in its action. Cobalt acetate by mouth was effective against orally administered hydrocyanic acid. The oxygen uptake of the body, reduced by cyanide, is rapidly reinstated when one of the cobalt antidotes has been successfully administered.
Vortices trapped in the damaged surroundings of antidots in Nb films - Depinning transition
International Nuclear Information System (INIS)
Nunes-Kapp, J.S.; Zadorosny, R.; Oliveira, A.A.M.; Vaz, A.R.; Moshkalev, S.A.; Lepienski, M.; Ortiz, W.A.
2010-01-01
The depinning transition of Vortex Matter in the presence of antidots in superconducting Nb films has been investigated. The antidots were fabricated using two different techniques, resulting in samples with arrays of diverse pinning efficiency. At low temperatures and fields, the spatial arrangement of Vortex Matter is governed by the presence of the antidots. Keeping the temperature fixed, an increase of the field induces a depinning transition. As the temperature approaches T c , the depinning frontier exhibits a characteristic kink at the temperature T k , above which the phase boundary exhibits a different regime. The lower-temperature regime is adequately described by a power-law expression, whose exponent n was observed to be inversely proportional to the pinning capability of the antidot, a feature that qualifies this parameter as a figure of merit to quantify the pinning strength of the defect.
Vortices trapped in the damaged surroundings of antidots in Nb films - Depinning transition
Energy Technology Data Exchange (ETDEWEB)
Nunes-Kapp, J.S. [Grupo de Supercondutividade e Magnetismo, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil); Faculdade de Tecnologia SENAI ' Antonio Adolpho Lobbe' , Sao Carlos, SP (Brazil); Zadorosny, R.; Oliveira, A.A.M. [Grupo de Supercondutividade e Magnetismo, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil); Vaz, A.R.; Moshkalev, S.A. [Centro de Componentes Semicondutores, UNICAMP, Campinas, SP (Brazil); Lepienski, M. [Departamento de Fisica, Universidade Federal do Parana, Curitiba, PR (Brazil); Ortiz, W.A., E-mail: wortiz@df.ufscar.b [Grupo de Supercondutividade e Magnetismo, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil)
2010-10-01
The depinning transition of Vortex Matter in the presence of antidots in superconducting Nb films has been investigated. The antidots were fabricated using two different techniques, resulting in samples with arrays of diverse pinning efficiency. At low temperatures and fields, the spatial arrangement of Vortex Matter is governed by the presence of the antidots. Keeping the temperature fixed, an increase of the field induces a depinning transition. As the temperature approaches T{sub c}, the depinning frontier exhibits a characteristic kink at the temperature T{sub k}, above which the phase boundary exhibits a different regime. The lower-temperature regime is adequately described by a power-law expression, whose exponent n was observed to be inversely proportional to the pinning capability of the antidot, a feature that qualifies this parameter as a figure of merit to quantify the pinning strength of the defect.
Magnetic characteristics of CoPd and FePd antidot arrays on nanoperforated Al2O3 templates
Maximenko, A.; Fedotova, J.; Marszałek, M.; Zarzycki, A.; Zabila, Y.
2016-02-01
Hard magnetic antidot arrays show promising results in context of designing of percolated perpendicular media. In this work the technology of magnetic FePd and CoPd antidot arrays fabrication is presented and correlation between surface morphology, structure and magnetic properties is discussed. CoPd and FePd antidot arrays were fabricated by deposition of Co/Pd and Fe/Pd multilayers (MLs) on porous anodic aluminum oxide templates with bowl-shape cell structure with inclined intercellular regions. FePd ordered L10 structure was obtained by successive vacuum annealing at elevated temperatures (530 °C) and confirmed by XRD analysis. Systematic analysis of magnetization curves evidenced perpendicular magnetic anisotropy of CoPd antidot arrays, while FePd antidot arrays revealed isotropic magnetic anisotropy with increased out-of-plane magnetic contribution. MFM images of antidots showed more complicated contrast, with alternating magnetic dots oriented parallel and antiparallel to tip magnetization moment.
Translational Antidote Research: A Bedside to Bench Tale
Directory of Open Access Journals (Sweden)
Jeffrey Brent
2015-03-01
Full Text Available Although antidote development should proceed in an orderly fashion from observation, to experimental and safety studies, to clinical trials, this sequence is not always precisely followed. The development of fomepizole as an antidote for toxic alcohol and glycol poisoning is an example of how this may not be the case. Interest in the development of fomepizole was spurred in the 1960s. Shortly thereafter studies characterized by administration to humans commenced. The potential value of fomepizole as an antidote for methanol poisoning was highlighted by primate experiments. Simultaneously, the utility of fomepizole was shown in an experimental model of ethylene glycol poisoning. Further studies on humans showed effectiveness of fomepizole in the treatment of disulfiram-alcohol reactions and ethylene glycol poisoning. In addition, in primate experiments, the safety of fomepizole was established as the subjects tolerated serum fomepizole concentrations over 150 times higher than therapeutic target levels. Subsequent studies have validated the efficacy of fomepizole in the treatment of ethylene glycol and methanol poisonings. Fomepizole has been found to be associated with fewer complications than the alternative alcohol dehydrogenase inhibitor, ethanol. In serious cases of methanol toxicity, fomepizole has been shown to improve survival compared to that obtained with ethanol.
Antidotes and treatments for chemical warfare/terrorism agents: an evidence-based review.
Rodgers, G C; Condurache, C T
2010-09-01
This article reviews the evidence supporting the efficacy of antidotes used or recommended for the potential chemical warfare agents of most concern. Chemical warfare agents considered include cyanide, vesicants, pulmonary irritants such as chlorine and phosgene, and nerve agents. The strength of evidence for most antidotes is weak, highlighting the need for additional research in this area.
[Theriac: medicine and antidote].
Parojcic, Dusanka; Stupar, Dragan; Mirica, Milica
2003-06-01
Theriac was an ancient multi-ingredient preparation; originating as a cure for the bites of serpents, mad dogs and wild beasts, it later became an antidote to all known poisons. The name theriac (treacle), (Greek theriake, Latin theriaca, French thériaque) was derived from the Greek for wild beast - theriakos. The first formula was created by Mithridates Vl, King of Pontus, a skillful ruler but a monster of cruelty, who, living in such a fear of being poisoned, took a great interest in toxicology. In the 1st century AD, Nero's personal physician Andromachus improved the formula of Antidotum Mithridatium by adding flesh of vipers, which was commonly believed to be the best antidote against snakebite, and by increasing the proportion of opium. It became known as Theriac of Andromachus, and contained 64 ingredients including various minerals, herbals, poisons and animal flesh and blood, all combined with honey in the form of electuarium. Later it became the cure-all medicine which, accumulating all the simples into one form, was supposed to be a universal panacea against all diseases. In the Middle Ages this famous electuarium become a patent medicine and entered official dispensaries and pharmacopoeias. The most famous and expensive Theriac in Europe was that of Venice. It was not until the l8th century that it was excluded from medical use.
Magnetic properties of Fe{sub 20} Ni{sub 80} antidots: Pore size and array disorder
Energy Technology Data Exchange (ETDEWEB)
Palma, J.L., E-mail: juan.palma.s@usach.cl [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Gallardo, C. [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Spinu, L.; Vargas, J.M. [Advanced Material Research Institute (AMRI) and Department of Physics, University of New Orleans, New Orleans, LA 70148 (United States); Dorneles, L.S. [Departamento de Fisica, Universidade Federal de Santa Maria UFSM, Av. Roraima 1000, Camobi, Santa Maria, RS 97105-900 (Brazil); Denardin, J.C.; Escrig, J. [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Center for the Development of Nanoscience and Nanotechnology (CEDENNA), Avda. Ecuador 3493, 917-0124 Santiago (Chile)
2013-10-15
Magnetic properties of nanoscale Fe{sub 20}Ni{sub 80} antidot arrays with different hole sizes prepared on top of nanoporous alumina membranes have been studied by means of magnetometry and micromagnetic simulations. The results show a significant increase of the coercivity as well as a reduction of the remanence of the antidot arrays, as compared with their parent continuous film, which depends on the hole size introduced in the Fe{sub 20}Ni{sub 80} thin film. When the external field is applied parallel to the antidots, the reversal of magnetization is achieved by free-core vortex propagation, whereas when the external field is applied perpendicular to the antidots, the reversal occurs through a process other than the coherent rotation (a maze-like pattern). Besides, in-plane hysteresis loops varying the angle show that the degree of disorder in the sample breaks the expected hexagonal symmetry. - Highlights: • Magnetic properties are strongly influenced by the pore diameter of the samples. • Coercive fields for antidots are higher than the values for the continuous film. • Disorder breaks the hexagonal symmetry of the sample. • Each hole acts as a vortex nucleation point. • Antidots have unique properties that allow them to be used in applications.
Energy Technology Data Exchange (ETDEWEB)
Maximenko, A., E-mail: Alexey.Maximenko@ifj.edu.pl [The Henryk Niewodniczanski Institute of Nuclear Physics Polish Academy of Sciences, Radzikowskiego Str. 152, 31-342 Krakow (Poland); Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya Str. 11, 220030 Minsk (Belarus); Fedotova, J. [Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya Str. 11, 220030 Minsk (Belarus); Marszałek, M.; Zarzycki, A.; Zabila, Y. [The Henryk Niewodniczanski Institute of Nuclear Physics Polish Academy of Sciences, Radzikowskiego Str. 152, 31-342 Krakow (Poland)
2016-02-15
Hard magnetic antidot arrays show promising results in context of designing of percolated perpendicular media. In this work the technology of magnetic FePd and CoPd antidot arrays fabrication is presented and correlation between surface morphology, structure and magnetic properties is discussed. CoPd and FePd antidot arrays were fabricated by deposition of Co/Pd and Fe/Pd multilayers (MLs) on porous anodic aluminum oxide templates with bowl-shape cell structure with inclined intercellular regions. FePd ordered L1{sub 0} structure was obtained by successive vacuum annealing at elevated temperatures (530 °C) and confirmed by XRD analysis. Systematic analysis of magnetization curves evidenced perpendicular magnetic anisotropy of CoPd antidot arrays, while FePd antidot arrays revealed isotropic magnetic anisotropy with increased out-of-plane magnetic contribution. MFM images of antidots showed more complicated contrast, with alternating magnetic dots oriented parallel and antiparallel to tip magnetization moment. - Highlights: • CoPd and FePd antidots were fabricated on porous anodic aluminum oxide templates. • CoPd antidot arrays have perpendicular magnetic anisotropy. • FePd antidot arrays revealed isotropic magnetic behavior. • The complex morphology of nanoporous template resulted in a complex magnetic domains image.
Quaternary and tertiary aldoxime antidotes for organophosphate exposure in a zebrafish model system
Energy Technology Data Exchange (ETDEWEB)
Schmidt, Hayden R. [Department of Biology, Whittier College, Whittier, CA 90608 (United States); Radić, Zoran; Taylor, Palmer [Department of Pharmacology, Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California at San Diego, La Jolla, CA 92093-0650 (United States); Fradinger, Erica A., E-mail: efrading@whittier.edu [Department of Biology, Whittier College, Whittier, CA 90608 (United States)
2015-04-15
The zebrafish is rapidly becoming an important model system for screening of new therapeutics. Here we evaluated the zebrafish as a potential pharmacological model for screening novel oxime antidotes to organophosphate (OP)-inhibited acetylcholinesterase (AChE). The k{sub i} values determined for chlorpyrifos oxon (CPO) and dichlorvos (DDVP) showed that CPO was a more potent inhibitor of both human and zebrafish AChE, but overall zebrafish AChE was less sensitive to OP inhibition. In contrast, aldoxime antidotes, the quaternary ammonium 2-PAM and tertiary amine RS-194B, showed generally similar overall reactivation kinetics, k{sub r}, in both zebrafish and human AChE. However, differences between the K{sub ox} and k{sub 2} constants suggest that zebrafish AChE associates more tightly with oximes, but has a slower maximal reactivation rate than human AChE. Homology modeling suggests that these kinetic differences result from divergences in the amino acids lining the entrance to the active site gorge. Although 2-PAM had the more favorable in vitro reactivation kinetics, RS-194B was more effective antidote in vivo. In intact zebrafish embryos, antidotal treatment with RS-194B rescued embryos from OP toxicity, whereas 2-PAM had no effect. Dechorionation of the embryos prior to antidotal treatment allowed both 2-PAM and RS-194B to rescue zebrafish embryos from OP toxicity. Interestingly, RS-194B and 2-PAM alone increased cholinergic motor activity in dechorionated embryos possibly due to the reversible inhibition kinetics, K{sub i} and αK{sub i}, of the oximes. Together these results demonstrate that the zebrafish at various developmental stages provides an excellent model for investigating membrane penetrant antidotes to OP exposure. - Highlights: • Zebrafish AChE shares significant structural similarities with human AChE. • OP-inhibited zebrafish and human AChE exhibit similar reactivation kinetics. • The zebrafish chorion is permeable to BBB penetrant and not
International Nuclear Information System (INIS)
Hall, A. H.
2007-01-01
Cyanide is a well-known toxic terrorism agent and is a major cause of mortality and morbidity in smoke inhalation victims. Terrorist attacks could start enclosed-space fires with cyanide-poisoned victims, even if cyanide itself was not utilized. Cyanide poisoning cannot be emergent confirmed by laboratory analysis and treatment with safe and efficacious antidotes must be administered empirically. Hydroxocobalamin has been recently approved by the US FDA and is a safe and efficacious antidote. Its efficacy is comparable to that of other, more toxic, cyanide antidotes. Its mechanism of action involves both direct cyanide chelation (forming non-toxic cyanocobalamin which is excreted in the urine) and nitric oxide scavenging. Adverse effects are usually limited to transient dark red-brown discoloration of urine, skin, sclera, and mucous membranes. Antidotal doses have not caused allergic reactions in cyanide-poisoned patients and only minor and easily-treated allergic reactions occurred in 2 of 136 normal volunteers. Transient, asymptomatic hypertension and reflex bradycardia have occurred in some normal volunteers, but not in seriously ill smoke inhalation victims not having significant cyanide poisoning. Hydroxocobalamin is a safe and efficacious antidote and can be empirically administered in pre-hospital or emergency department settings. It is therefore suitable for inclusion in national or multinational medication stockpiles and is already included in some national programs in the European Union.(author)
Energy Technology Data Exchange (ETDEWEB)
Rodríguez-Suárez, R.L., E-mail: rrodriguez@fis.puc.cl [Facultad de Física, Pontificia Universidad Católica de Chile, Av. Vicuña Mackenna 4860 Casilla 306, Santiago (Chile); Palma, J.L.; Burgos, E.O. [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Michea, S. [Facultad de Física, Pontificia Universidad Católica de Chile, Av. Vicuña Mackenna 4860 Casilla 306, Santiago (Chile); Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Escrig, J.; Denardin, J.C. [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Center for the Development of Nanoscience and Nanotechnology (CEDENNA), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Aliaga, C. [Center for the Development of Nanoscience and Nanotechnology (CEDENNA), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Facultad de Química y Biología, Universidad de Santiago de Chile, Casilla 40, Correo 33, Santiago (Chile)
2014-01-15
The magnetic properties of Ni{sub 80}Fe{sub 20} antidot arrays with hole diameters of 18 and 70 nm fabricated by a template-assisted method were investigated using the ferromagnetic resonance technique. Tuning the antidot arrays by changing the hole diameter enables control on the angular dependence of the ferromagnetic resonance field. The scanning electron microscope images reveal a quite regular hexagonal arrangement of the pores, however the angular dependence of the resonance field do not exhibit the six-fold symmetry expected for this symmetry. Micromagnetic simulations performed on a perfect hexagonal lattice, when compared with those made on our real system taken from the scanning microscope images, reveal that the presence of defects in the antidot lattice affects the ferromagnetic resonance field symmetry. - Highlights: • We use the FMR technique to investigate the magnetic properties of Py antidots. • We studied the effect of pore diameter on FMR angular measurement. • FMR field does not exhibit the six-fold symmetry. • For all angular positions there are two resonance modes always present. • Micromagnetic simulations agree with the experimental results with defects.
Chemical and metabolomic screens identify novel biomarkers and antidotes for cyanide exposure
Nath, Anjali K.; Roberts, Lee D.; Liu, Yan; Mahon, Sari B.; Kim, Sonia; Ryu, Justine H.; Werdich, Andreas; Januzzi, James L.; Boss, Gerry R.; Rockwood, Gary A.; MacRae, Calum A.; Brenner, Matthew; Gerszten, Robert E.; Peterson, Randall T.
2013-01-01
Exposure to cyanide causes a spectrum of cardiac, neurological, and metabolic dysfunctions that can be fatal. Improved cyanide antidotes are needed, but the ideal biological pathways to target are not known. To understand better the metabolic effects of cyanide and to discover novel cyanide antidotes, we developed a zebrafish model of cyanide exposure and scaled it for high-throughput chemical screening. In a screen of 3120 small molecules, we discovered 4 novel antidotes that block cyanide toxicity. The most potent antidote was riboflavin. Metabolomic profiling of cyanide-treated zebrafish revealed changes in bile acid and purine metabolism, most notably by an increase in inosine levels. Riboflavin normalizes many of the cyanide-induced neurological and metabolic perturbations in zebrafish. The metabolic effects of cyanide observed in zebrafish were conserved in a rabbit model of cyanide toxicity. Further, humans treated with nitroprusside, a drug that releases nitric oxide and cyanide ions, display increased circulating bile acids and inosine. In summary, riboflavin may be a novel treatment for cyanide toxicity and prophylactic measure during nitroprusside treatment, inosine may serve as a biomarker of cyanide exposure, and metabolites in the bile acid and purine metabolism pathways may shed light on the pathways critical to reversing cyanide toxicity.—Nath, A. K., Roberts, L. D., Liu, Y., Mahon, S. B., Kim, S., Ryu, J. H., Werdich, A., Januzzi, J. L., Boss, G. R., Rockwood, G. A., MacRae, C. A., Brenner, M., Gerszten, R. E., Peterson, R. T. Chemical and metabolomic screens identify novel biomarkers and antidotes for cyanide exposure. PMID:23345455
Al-Sohaim, Sulaiman I; Awang, Rahmat; Zyoud, Sa'ed H; Rashid, Sazaroni M D; Hashim, Sirajuddin
2012-03-01
The availability of antidotes may be considered essential and lifesaving in the management of certain poisonings. Surveys carried out in a number of countries have demonstrated inadequate availability of a variety of poisoning antidotes. The purpose of this study was to determine the availability of antidote stocking at hospitals, based on published guidelines for antidote stocking, and to evaluate the impact of hospital types on the availability of antidotes for the management of acute toxic exposures and poisonings in Malaysia. A questionnaire on the availability of antidotes was sent to all government accident and emergency departments in Malaysia. The list of commonly required antidotes and essential drugs was compiled from published guidelines. Collected data were analysed in SPSS version 16 using descriptive and comparative analysis. The response rate was 59.06%. None of the responding hospitals stocked all of the antidotes on the lists. In relation to hospital type, there was great variability in the availability of antidotes (there were significant differences between hospitals for 13 antidotes). The availabilities of most antidotes were far better in the General Hospitals and the District Hospitals with specialists compared to District Hospitals without specialists. Calcium gluconate, sodium bicarbonate, atropine sulphate, naloxone, flumazenil, vitamin K, and pyridoxine were available at all general hospitals. Atropine sulphate and naloxone were available at all district hospitals with specialists. Most Malaysian government hospitals stocked some important antidotes. Raising awareness of the importance of antidotes by education, regular review of antidote storage, distribution plans, and appropriate legislation might provide solutions. Coordination between Malaysian hospitals and the National Poison Centre at Universiti Sains Malaysia is also important.
Out-of-plane coercive field of Ni80Fe20 antidot arrays
International Nuclear Information System (INIS)
Gao Chunhong; Chen Ke; Lue Ling; Zhao Jianwei; Chen Peng
2010-01-01
The out-of-plane magnetic anisotropy and out-of-plane magnetization reversal process of nanoscale Ni 80 Fe 20 antidot arrays deposited by magnetron sputtering technique on an anodic aluminum oxide (AAO) membrane are investigated. The angular dependence of out-of-plane remanent magnetization of Ni 80 Fe 20 antidot arrays shows that the maximum remanence is in-plane and the squareness of the out-of-plane hysteresis loop follow a |cos θ| dependence. The angular dependence of out-of-plane coercivity of Ni 80 Fe 20 antidot arrays shows that the maximum coercivity lies on the surface of a cone with its symmetric axis normal to the sample plane, which indicates a transition of magnetic reversal from curling to coherent rotation when changing the angle between the applied magnetic field and the sample plane.
Out-of-plane coercive field of Ni 80Fe 20 antidot arrays
Gao, Chunhong; Chen, Ke; Lü, Ling; Zhao, Jianwei; Chen, Peng
2010-11-01
The out-of-plane magnetic anisotropy and out-of-plane magnetization reversal process of nanoscale Ni 80Fe 20 antidot arrays deposited by magnetron sputtering technique on an anodic aluminum oxide (AAO) membrane are investigated. The angular dependence of out-of-plane remanent magnetization of Ni 80Fe 20 antidot arrays shows that the maximum remanence is in-plane and the squareness of the out-of-plane hysteresis loop follow a |cos θ| dependence. The angular dependence of out-of-plane coercivity of Ni 80Fe 20 antidot arrays shows that the maximum coercivity lies on the surface of a cone with its symmetric axis normal to the sample plane, which indicates a transition of magnetic reversal from curling to coherent rotation when changing the angle between the applied magnetic field and the sample plane.
Energy spectrums of bilayer triangular phosphorene quantum dots and antidots
Directory of Open Access Journals (Sweden)
Z. T. Jiang
2017-04-01
Full Text Available We theoretically investigate the confined states of the bilayer triangular phosphorene dots and antidots by means of the tight-binding approach. The dependence of the energy levels on the size, the type of the boundary edges, and the orientation of the dots and antidots, and the influences of the electric and magnetic fields on the energy levels, are all completely analyzed. It is found that the energy level numbers of the bilayer dots and antidots are determined by the energy levels in two layers. The external electric field can effectively tune the energy levels of the edge states in both layers to move in opposite directions. With the increase of the magnetic field, the magnetic energy levels can approach the Landau levels of the phosphorene monolayer, the phosphorene bilayer, or both, depending on the specific geometry of the monolayer-bilayer hybrid phosphorene quantum dots. This research should be helpful for the overall understanding of the electronic properties of the multilayer hybrid phosphorene nanostructures and designing the corresponding phosphorene devices.
Electronic properties of disordered graphene antidot lattices
DEFF Research Database (Denmark)
Yuan, Shengjun; Roldán, Rafael; Jauho, Antti-Pekka
2013-01-01
Regular nanoscale perforations in graphene (graphene antidot lattices, GALs) are known to lead to a gap in the energy spectrum, thereby paving a possible way towards many applications. This theoretical prediction relies on a perfect placement of identical perforations, a situation not likely to o...
[Antidotes: use guidelines and minimun stock in an emergency department].
García-Martín, A; Torres Santos-Olmos, R
2012-01-01
To develop a guide for antidotes and other medications used to counteract poisoning, and define the stock in an emergency department, as a safety priority for the part-time pharmacist assigned to the unit. A search of specialist databases and web portals of the Spanish Society of Toxicology and the British National Poisons Information Service, as well as toxicology databases, TOXICONET, information from other hospitals, tertiary sources, Micromedex and Medline. The Guide contains 42 active ingredients and is accessible to the Pharmacy and Emergency departments in electronic format. A minimum emergency stock was agreed based on the daily treatment of a 100 kg patient. This information, including updated expiry dates, is available at the emergency department antidote stock facilities and in electronic format. On a monthly basis, the pharmacist reviews the need to replace any drugs, due to their expiry date or lack of use. The lack of evidence from high quality antidote studies, the variability due to the difficulties of updating sources and some geographical differences in their use means that decision-making can be difficult. It would be useful to have minimum quantity recommendations from societies of toxicology, regulatory agencies and organisations such as the Joint Commission on the Accreditation of Healthcare Organisations. It would also be useful to have a suprahospital risk assessment to optimise management and ensure the availability of antidotes which are expensive, have a limited shelf life, or of which demand is difficult to forecast. Copyright © 2011 SEFH. Published by Elsevier Espana. All rights reserved.
Spatial confinement of ferromagnetic resonances in honeycomb antidot lattices
International Nuclear Information System (INIS)
Krivoruchko, V.N.; Marchenko, A.I.
2012-01-01
We report on a theoretical investigation of the magnetic static and dynamic properties of a thin ferromagnetic film with honeycomb lattice of circular antidots using micromagnetic simulations and analytical calculations. The theoretical model is based on the Landau–Lifshitz equations and directly accounts for the effects of the magnetic state nonuniformity. A direct calculation of local dynamic susceptibility tensor yields that the resonance spectra consist of four different quasi-uniform modes of the magnetization precession related to the confinement of magnetic domains by the hole mesh. Three of four resonant modes follow a two-fold variation with respect to the in-plane orientation of the applied magnetic field. The easy axes of these modes are mutually rotated by 60° and combine to yield the apparent six-fold configurational anisotropy. Additionally, a mode with intrinsic six-fold symmetry behavior exists, as well. Micromagnetic calculations of the local dynamic susceptibility tensor allow identifying the magnetic unit cell areas/domains responsible for each resonance mode. - Highlights: ► We study the magnetic static and dynamic properties of honeycomb antidot lattices. ► Micromagnetic simulation and analytical calculation were used. ► Four quasi-uniform precession modes exist in resonance spectra. ► The antidot unit cell areas responsible for each resonance mode were identified.
Screening in graphene antidot lattices
DEFF Research Database (Denmark)
Schultz, Marco Haller; Jauho, A. P.; Pedersen, T. G.
2011-01-01
We compute the dynamical polarization function for a graphene antidot lattice in the random-phase approximation. The computed polarization functions display a much more complicated structure than what is found for pristine graphene (even when evaluated beyond the Dirac-cone approximation...... the plasmon dispersion law and find an approximate square-root dependence with a suppressed plasmon frequency as compared to doped graphene. The plasmon dispersion is nearly isotropic and the developed approximation schemes agree well with the full calculation....
Thermodynamic modeling using BINGO-ANTIDOTE: A new strategy to investigate metamorphic rocks
Lanari, Pierre; Duesterhoeft, Erik
2016-04-01
BINGO-ANTIDOTE is a new program, combing the achievements of the two petrological software packages XMAPTOOLS[1] and THERIAK-DOMINO[2]. XMAPTOOLS affords information about compositional zoning in mineral and local bulk composition of domains at the thin sections scale. THERIAK-DOMINO calculates equilibrium phase assemblages from given bulk rock composition, temperature T and pressure P. Primarily BINGO-ANTIDOTE can be described as an inverse THERIAK-DOMINO, because it uses the information provided by XMAPTOOLS to calculate the probable P-T equilibrium conditions of metamorphic rocks. Consequently, the introduced program combines the strengths of forward Gibbs free energy minimization models with the intuitive output of inverse thermobarometry models. In order to get "best" P-T equilibrium conditions of a metamorphic rock sample and thus estimating the degree of agreement between the observed and calculated mineral assemblage, it is critical to define a reliable scoring strategy. BINGO uses the THERIAKD ADD-ON[3] (Duesterhoeft and de Capitani, 2013) and is a flexible model scorer with 3+1 evaluation criteria. These criteria are the statistical agreement between the observed and calculated mineral-assemblage, -proportions (vol%) and -composition (mol). Additionally, a total likelihood, consisting of the first three criteria, allows the user an evaluation of the most probable equilibrium P-T condition. ANTIDOTE is an interactive user interface, displaying the 3+1 evaluation criteria as probability P-T-maps. It can be used with and without XMAPTOOLS. As a stand-alone program, the user is able to give the program macroscopic observations (i.e., mineral names and proportions), which ANTIDOTE converts to a readable BINGO input. In this manner, the use of BINGO-ANTIDOTE opens up thermodynamics to students and people with only a basic knowledge of phase diagrams and thermodynamic modeling techniques. This presentation introduces BINGO-ANTIDOTE and includes typical examples
Dumestre, Danielle; Nickerson, Duncan
2014-01-01
This study aimed to assess the use of cyanide antidotes and the determine the opinion on empiric administration of hydroxocobalamin in North American burn patients with suspected smoke inhalation injuries. An online cross-sectional survey was sent to directors of 90 major burn centers in North America, which were listed on the American Burn Association Web site. A multiple-choice format was used to determine the percentage of patients tested for cyanide poisoning on admission, the current administration of a cyanide antidote based solely on clinical suspicion of poisoning, and the antidote used. To ascertain views on immediate administration of hydroxocobalamin before confirmation of cyanide poisoning an option was included to expand the response in written format. Twenty-nine of 90 burn directors (32%) completed the survey. For the population of interest, the majority of burn centers (59%) do not test for cyanide poisoning on admission and do not administer an antidote based solely on clinical suspicion of cyanide poisoning (58%). The most commonly available antidote is hydroxocobalamin (50%), followed by the cyanide antidote kit (29%). The opinion regarding instant administration of hydroxocobalamin when inhalation injury is suspected is mixed: 31% support its empiric use, 17% do not, and the remaining 52% have varying degrees of confidence in its utility. In North America, most patients burnt in closed-space fires with inhalation injuries are neither tested for cyanide poisoning in a timely manner nor empirically treated with a cyanide antidote. Although studies have shown the safety and efficacy of empiric and immediate administration of hydroxocobalamin, most centers are not willing to do so.
Medical anthropology as an antidote for ethnocentrism in Jesus ...
African Journals Online (AJOL)
Medical anthropology as an antidote for ethnocentrism in Jesus research? ... for making sense of healing accounts whilst claiming to cross the cultural gap. Based on an analysis of the illness–disease distinction in medical anthropology and its ...
Electronic transport in disordered graphene antidot lattice devices
DEFF Research Database (Denmark)
Power, Stephen; Jauho, Antti-Pekka
2014-01-01
Nanostructuring of graphene is in part motivated by the requirement to open a gap in the electronic band structure. In particular, a periodically perforated graphene sheet in the form of an antidot lattice may have such a gap. Such systems have been investigated with a view towards application...
International Nuclear Information System (INIS)
Borron, S. W.; Arias, J. C.
2007-01-01
Hazardous materials paradigms call for definitive treatment of chemical victims to begin in the 'warm zone' during decontamination. This delay may result in lethal outcomes, particularly in the case of multiple victims, where rescue may be delayed due to insufficient numbers of rescue teams. It is virtually impossible for rescuers in full protective gear to establish intravenous lines. In recent years, significant advances have been made in intraosseous (IO) infusion devices. An IO device developed in our institution, the EZ-IO, is very easily placed by rescuers in typical work uniforms. IO placement takes longer while in protective gear, but is feasible. The IO is equivalent to an intravenous line, allowing more rapid administration of antidotes in the event of chemical mass casualties. Antidotes not amenable to intramuscular administration and even those often given IM may be more effective given IO. IO administration has the following possible advantages over intravenous or intramuscular antidote administration: 1. Drugs administered IO reach the vascular system virtually instantaneously. 2. IO administration may be performed in protective clothing and could theoretically be employed while awaiting rescue. 3. IO administration may be preferred over intravenous administration in the warm zone. In summary, IO administration of antidotes should be further evaluated for use in chemical disasters. The ease and speed of placement, ready access to the vascular tree, and potential for earlier intervention make it a potentially ideal means of vascular access and antidotal administration in the mass casualty situation. (author)
Vivek, T.; Bhoomeeswaran, H.; Sabareesan, P.
2018-05-01
Spin waves in ID periodic triangular array of antidots are encarved in a permalloy magnonic waveguide is investigated through micromagnetic simulation. The effect of the rotating array of antidots and in-plane rotation of the scattering centers on the band structure are investigated, to indicate new possibilities of fine tuning of spin-wave filter pass and stop bands. The results show that, the opening and closing of band gaps paves a way for band pass and stop filters on waveguide. From the results, the scattering center and strong spatial distribution field plays crucible role for controlling opening and closing bandgap width of ˜12 GHz for 0° rotation. We have obtained a single narrow bandgap of width 1GHz is obtained for 90° rotation of the antidot. Similarly, the tunability is achieved for desired microwave applications done by rotating triangular antidots with different orientation.
Out-of-plane coercive field of Ni{sub 80}Fe{sub 20} antidot arrays
Energy Technology Data Exchange (ETDEWEB)
Chunhong, Gao [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Ke, Chen [Chongqing Electric Power College, Chongqing (China); Ling, Lue; Jianwei, Zhao [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Chen Peng, E-mail: pchen@swu.edu.c [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China)
2010-11-15
The out-of-plane magnetic anisotropy and out-of-plane magnetization reversal process of nanoscale Ni{sub 80}Fe{sub 20} antidot arrays deposited by magnetron sputtering technique on an anodic aluminum oxide (AAO) membrane are investigated. The angular dependence of out-of-plane remanent magnetization of Ni{sub 80}Fe{sub 20} antidot arrays shows that the maximum remanence is in-plane and the squareness of the out-of-plane hysteresis loop follow a |cos {theta}| dependence. The angular dependence of out-of-plane coercivity of Ni{sub 80}Fe{sub 20} antidot arrays shows that the maximum coercivity lies on the surface of a cone with its symmetric axis normal to the sample plane, which indicates a transition of magnetic reversal from curling to coherent rotation when changing the angle between the applied magnetic field and the sample plane.
Energy Technology Data Exchange (ETDEWEB)
Goswami, Srijit; Aamir, Mohammed Ali; Shamim, Saquib; Ghosh, Arindam [Department of Physics, Indian Institute of Science, Bangalore 560 012 (India); Siegert, Christoph; Farrer, Ian; Ritchie, David A. [Cavendish Laboratory, University of Cambridge, J.J. Thomson Avenue, Cambridge CB3 0HE (United Kingdom); Pepper, Michael [Department of Electrical and Electronic Engineering, University College, London WC1E 7JE (United Kingdom)
2013-12-04
We use a dual gated device structure to introduce a gate-tuneable periodic potential in a GaAs/AlGaAs two dimensional electron gas (2DEG). Using only a suitable choice of gate voltages we can controllably alter the potential landscape of the bare 2DEG, inducing either a periodic array of antidots or quantum dots. Antidots are artificial scattering centers, and therefore allow for a study of electron dynamics. In particular, we show that the thermovoltage of an antidot lattice is particularly sensitive to the relative positions of the Fermi level and the antidot potential. A quantum dot lattice, on the other hand, provides the opportunity to study correlated electron physics. We find that its current-voltage characteristics display a voltage threshold, as well as a power law scaling, indicative of collective Coulomb blockade in a disordered background.
International Nuclear Information System (INIS)
Goswami, Srijit; Aamir, Mohammed Ali; Shamim, Saquib; Ghosh, Arindam; Siegert, Christoph; Farrer, Ian; Ritchie, David A.; Pepper, Michael
2013-01-01
We use a dual gated device structure to introduce a gate-tuneable periodic potential in a GaAs/AlGaAs two dimensional electron gas (2DEG). Using only a suitable choice of gate voltages we can controllably alter the potential landscape of the bare 2DEG, inducing either a periodic array of antidots or quantum dots. Antidots are artificial scattering centers, and therefore allow for a study of electron dynamics. In particular, we show that the thermovoltage of an antidot lattice is particularly sensitive to the relative positions of the Fermi level and the antidot potential. A quantum dot lattice, on the other hand, provides the opportunity to study correlated electron physics. We find that its current-voltage characteristics display a voltage threshold, as well as a power law scaling, indicative of collective Coulomb blockade in a disordered background
Anomalous giant piezoresistance in AlAs 2D electron systems with antidot lattices.
Gunawan, O; Gokmen, T; Shkolnikov, Y P; De Poortere, E P; Shayegan, M
2008-01-25
An AlAs two-dimensional electron system patterned with an antidot lattice exhibits a giant piezoresistance effect at low temperatures, with a sign opposite to the piezoresistance observed in the unpatterned region. We suggest that the origin of this anomalous giant piezoresistance is the nonuniform strain in the antidot lattice and the exclusion of electrons occupying the two conduction-band valleys from different regions of the sample. This is analogous to the well-known giant magnetoresistance effect, with valley playing the role of spin and strain the role of magnetic field.
Creativity: Performativity's Poison or Its Antidote?
Munday, Ian
2014-01-01
A common move in the study of creativity and performativity is to present the former as an antidote to the latter. Might we, therefore, see work on creativity in education as heralding an era of post-performativity? In this paper I argue that the portrayal of performativity in the literature on creativity presents an overly simplistic (vulgar?)…
wtf genes are prolific dual poison-antidote meiotic drivers.
Nuckolls, Nicole L; Bravo Núñez, María Angélica; Eickbush, Michael T; Young, Janet M; Lange, Jeffrey J; Yu, Jonathan S; Smith, Gerald R; Jaspersen, Sue L; Malik, Harmit S; Zanders, Sarah E
2017-06-20
Meiotic drivers are selfish genes that bias their transmission into gametes, defying Mendelian inheritance. Despite the significant impact of these genomic parasites on evolution and infertility, few meiotic drive loci have been identified or mechanistically characterized. Here, we demonstrate a complex landscape of meiotic drive genes on chromosome 3 of the fission yeasts Schizosaccharomyces kambucha and S. pombe . We identify S. kambucha wtf4 as one of these genes that acts to kill gametes (known as spores in yeast) that do not inherit the gene from heterozygotes. wtf4 utilizes dual, overlapping transcripts to encode both a gamete-killing poison and an antidote to the poison. To enact drive, all gametes are poisoned, whereas only those that inherit wtf4 are rescued by the antidote. Our work suggests that the wtf multigene family proliferated due to meiotic drive and highlights the power of selfish genes to shape genomes, even while imposing tremendous costs to fertility.
Energy Technology Data Exchange (ETDEWEB)
Gong, W. J.; Liu, W., E-mail: wliu@imr.ac.cn; Feng, J. N.; Zhang, Z. D. [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China); Kim, D. S.; Choi, C. J. [Functional Materials Division, Korea Institute of Materials Science, 531 Changwon- daero, Changwon 631-831 (Korea, Republic of)
2014-04-07
The effect of antiferromagnetic (AFM) layer on exchange bias (EB), training effect, and magnetotransport properties in ferromagnetic (FM) /AFM nanoscale antidot arrays and sheet films Ag(10 nm)/Co(8 nm)/NiO(t{sub NiO})/Ag(5 nm) at 10 K is studied. The AFM layer thickness dependence of the EB field shows a peak at t{sub NiO} = 2 nm that is explained by using the random field model. The misalignment of magnetic moments in the three-dimensional antidot arrays causes smaller decrease of EB field compared with that in the sheet films for training effect. The anomalous magnetotransport properties, in particular positive magnetoresistance (MR) for antidot arrays but negative MR for sheet films are found. The training effect and magnetotransport properties are strongly affected by the three-dimensional spin-alignment effects in the antidot arrays.
International Nuclear Information System (INIS)
Rodriguez-Rodriguez, G; Perez-Junquera, A; Velez, M; Anguita, J V; Martin, J I; Rubio, H; Alameda, J M
2007-01-01
Magnetic force microscopy (MFM) has been used to analyse the behaviour of domain walls in uniaxial amorphous Co x Si 1-x films patterned with diluted arrays of antidots by electron beam lithography. The walls are found to be pinned by the antidot array when the antidot density is high enough along the easy axis. The expansion of reversed nuclei under the influence of the tip stray field has been observed in several consecutive MFM images of the same area, showing how the competition between line tension effects and pinning by the patterned holes governs the creep motion of the 180 0 walls across the array of antidots
Coercivity scaling in antidot lattices in Fe, Ni, and NiFe thin films
Energy Technology Data Exchange (ETDEWEB)
Gräfe, Joachim, E-mail: graefe@is.mpg.de; Schütz, Gisela; Goering, Eberhard J., E-mail: goering@is.mpg.de
2016-12-01
Antidot lattices can be used to artificially engineer magnetic properties in thin films, however, a conclusive model that describes the coercivity enhancement in this class of magnetic nano-structures has so far not been found. We prepared Fe, Ni, and NiFe thin films and patterned each with 21 square antidot lattices with different geometric parameters and measured their hysteretic behavior. On the basis of this extensive dataset we are able to provide a model that can describe both the coercivity scaling over a wide range of geometric lattice parameters and the influence of different materials.
New Direction Treatment in Antidote Treatment of OPC Intoxications
International Nuclear Information System (INIS)
Dishovsky, C.
2007-01-01
The toxic effect of organophosphorus compounds (OPC) is based on inhibition of acetylcholinesterase (AChE), enzyme which plays an important physiological role in the cholinergic nervous system. The drug therapy on intoxication with OPC included mainly combination of cholinesterase reactivators and cholinolytics. There is no single AChE reactivator having the ability to sufficiently reactivate inhibited enzyme due to the high variability of chemical structure of the inhibitors. The classic oximes have antidote effect against intoxication with sarin, Vx and tabun, but are not effective against soman. HI-6 (Bulgarian ampoule form T oxidin ) has an effect against sarin, soman and Vx, and to a lesser degree against tabun. In order to improve the treatment of poisoning with highly toxic OPC, in ours laboratory we synthesized a variety of mono- and dioximes. We use different numbers of pyridinium or heterocyclic rings, different length and shape of the connecting chain between pyridinium or pyridinium-heterocyclic rings; different number and position of the oxime groups at the pyridinium rings and others. The investigations of some authors and our research showed that the compounds which present a combination between HI-6 and TMB-4 have a better antidote activity against tabun intoxications. The important finding of this study is that we synthesized complex compounds, reactivators of cholinesterase activity (including HI-6) with AMP / ATP and polycarboxilats, which have prolonged action in organism compared with original oximes. Pharmacokinetic studies showed that they are eliminated more slowly. The antidotal efficacy of these compounds after soman poisoning in rats was similar like that of the original oximes. The same tendency showed and the other pharmacological (blood pressure, EKG, breathing, neuromuscular transmission), and biochemical (ChE) investigations. (author)
Edge structures and properties of triangular antidots in single-layer MoS2
International Nuclear Information System (INIS)
Gan, Li-Yong; Cheng, Yingchun; Huang, Wei; Schwingenschlögl, Udo; Yao, Yingbang; Zhao, Yong; Zhang, Xi-xiang
2016-01-01
Density functional theory and experiments are employed to shed light on the edge structures of antidots in O etched single-layer MoS 2 . The equilibrium morphology is found to be the zigzag Mo edge with each Mo atom bonded to two O atoms, in a wide range of O chemical potentials. Scanning electron microscopy shows that the orientation of the created triangular antidots is opposite to the triangular shape of the single-layer MoS 2 samples, in agreement with the theoretical predictions. Furthermore, edges induced by O etching turn out to be p-doped, suggesting an effective strategy to realize p-type MoS 2 devices.
Edge structures and properties of triangular antidots in single-layer MoS2
Gan, Li Yong; Cheng, Yingchun; Schwingenschlö gl, Udo; Yao, Yingbang; Zhao, Yong; Zhang, Xixiang; Huang, Wei
2016-01-01
Density functional theory and experiments are employed to shed light on the edge structures of antidots in O etched single-layer MoS2. The equilibrium morphology is found to be the zigzag Mo edge with each Mo atom bonded to two O atoms, in a wide range of O chemical potentials. Scanning electron microscopy shows that the orientation of the created triangular antidots is opposite to the triangular shape of the single-layer MoS2 samples, in agreement with the theoretical predictions. Furthermore, edges induced by O etching turn out to be p-doped, suggesting an effective strategy to realize p-type MoS2 devices. Published by AIP Publishing.
Edge structures and properties of triangular antidots in single-layer MoS2
Gan, Li Yong
2016-08-30
Density functional theory and experiments are employed to shed light on the edge structures of antidots in O etched single-layer MoS2. The equilibrium morphology is found to be the zigzag Mo edge with each Mo atom bonded to two O atoms, in a wide range of O chemical potentials. Scanning electron microscopy shows that the orientation of the created triangular antidots is opposite to the triangular shape of the single-layer MoS2 samples, in agreement with the theoretical predictions. Furthermore, edges induced by O etching turn out to be p-doped, suggesting an effective strategy to realize p-type MoS2 devices. Published by AIP Publishing.
Kulesh, N. A.; Vázquez, M.; Lepalovskij, V. N.; Vas'kovskiy, V. O.
2018-02-01
Hysteresis properties and magnetization reversal in TbCo(30 nm) and FeNi(10 nm)/TbCo(30 nm) films with nanoscale antidot lattices are investigated to test the effect of nanoholes on the perpendicular anisotropy in the TbCo layer and the induced exchange bias in the FeNi layer. The antidots are introduced by depositing the films on top of hexagonally ordered porous anodic alumina substrates with pore diameter and interpore distance fixed to 75 nm and 105 nm, respectively. The analysis of combined vibrating sample magnetometry, Kerr microscopy and magnetic force microscopy imaging measurements has allowed us to link macroscopic and local magnetization reversal processes. For magnetically hard TbCo films, we demonstrate the tunability of magnetic anisotropy and coercive field (i.e., it increases from 0.2 T for the continuous film to 0.5 T for the antidot film). For the antidot FeNi/TbCo film, magnetization of FeNi is confirmed to be in plane. Although an exchange bias has been locally detected in the FeNi layer, the integrated hysteresis loop has increased coercivity and zero shift along the field axis due to the significantly decreased magnetic anisotropy of TbCo layer.
Edge structures and properties of triangular antidots in single-layer MoS{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Gan, Li-Yong, E-mail: ganly@swjtu.edu.cn, E-mail: iamyccheng@njtech.edu.cn, E-mail: udo.schwingenschlogl@kaust.edu.sa [Key Laboratory of Advanced Technology of Materials (Ministry of Education), Superconductivity and New Energy R& D Center, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); Cheng, Yingchun, E-mail: ganly@swjtu.edu.cn, E-mail: iamyccheng@njtech.edu.cn, E-mail: udo.schwingenschlogl@kaust.edu.sa; Huang, Wei [Key Laboratory of Flexible Electronics (KLOFE) and Institute of Advanced Materials (IAM), Jiangsu National Synergetic Innovation Center for Advanced Materials - SICAM, Nanjing Tech University - NanjingTech, 30 South Puzhu Road, Nanjing 211816 (China); Schwingenschlögl, Udo, E-mail: ganly@swjtu.edu.cn, E-mail: iamyccheng@njtech.edu.cn, E-mail: udo.schwingenschlogl@kaust.edu.sa [Physical Science and Engineering Division (PSE), King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia); Yao, Yingbang [Advanced Nanofabrication and Imaging Core Lab, King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia); School of Materials and Energy, Guangdong University of Technology, Guangdong 510006 (China); Zhao, Yong [Key Laboratory of Advanced Technology of Materials (Ministry of Education), Superconductivity and New Energy R& D Center, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); School of Physical Science and Technology, Southwest Jiaotong University, Chengdu, 610031 Sichuan (China); Zhang, Xi-xiang [Physical Science and Engineering Division (PSE), King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia); Advanced Nanofabrication and Imaging Core Lab, King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia)
2016-08-29
Density functional theory and experiments are employed to shed light on the edge structures of antidots in O etched single-layer MoS{sub 2}. The equilibrium morphology is found to be the zigzag Mo edge with each Mo atom bonded to two O atoms, in a wide range of O chemical potentials. Scanning electron microscopy shows that the orientation of the created triangular antidots is opposite to the triangular shape of the single-layer MoS{sub 2} samples, in agreement with the theoretical predictions. Furthermore, edges induced by O etching turn out to be p-doped, suggesting an effective strategy to realize p-type MoS{sub 2} devices.
Ujevic, Sebastian; Mendoza, Michel
2010-07-01
We propose numerical simulations of longitudinal magnetoconductance through a finite antidot lattice located inside an open quantum dot with a magnetic field applied perpendicular to the plane. The system is connected to reservoirs using quantum point contacts. We discuss the relationship between the longitudinal magnetoconductance and the generation of transversal couplings between the induced open quantum dots in the system. The system presents longitudinal magnetoconductance maps with crossovers (between transversal bands) and closings (longitudinal decoupling) of fundamental quantum states related to the open quantum dots induced by the antidot lattice. A relationship is observed between the distribution of antidots and the formed conductance bands, allowing a systematic follow up of the bands as a function of the applied magnetic field and quantum point-contact width. We observed a high conductance intensity [between n and (n+1) quantum of conductance, n=1,2,… ] in the regions of crossover and closing of states. This suggests transversal couplings between the induced open quantum dots of the system that can be modulated by varying both the antidots potential and the quantum point-contact width. A new continuous channel (not expected) is induced by the variation in the contact width and generate Fano resonances in the conductance. These resonances can be manipulated by the applied magnetic field.
Magnetic structure and resonance properties of hexagonal antidot lattice
International Nuclear Information System (INIS)
Marchenko, A.I.; Krivoruchko, V.N.
2012-01-01
Static and resonance properties of ferromagnetic films with an antidot lattice (pores in the film) are studied. The description of the system is based on micromagnetic modeling and analytical solution of the Landau-Lifshitz equation. The dependences of ferromagnetic resonance spectra on the in-plane direction of applied magnetic field and on the lattice parameters are investigated. The dependences of a dynamic system response on frequency at fixed magnetic field and on field at fixed frequency, when the field changes cause the static magnetic order to change are explored. It is found that the specific peculiarities of the system dynamics leave unchange for both of these experimental conditions. Namely, for low damping the resonance spectra contain three quasi-homogeneous modes which are due to the resonance of different regions (domains) of the antidot lattice cell. It is shown the angular field dependences of each mode are characterized by a twofold symmetry and the related easy axes are mutually rotated by 60 degrees. As the result, a hexagonal symmetry of the system static and dynamic magnetic characteristics is realized. The existence in the resonance spectrum of several quasi-homogeneous modes related to different regions of the unit cell could be fundamental for working elements of magnonic devices.
Enhanced imaging of magnetic structures in micropatterned arrays of Co dots and antidots
Energy Technology Data Exchange (ETDEWEB)
Chiolerio, Alessandro [Physics Department Politecnico di Torino, Corso Duca degli Abruzzi 24, 10129 Torino (Italy); Celasco, Edvige [Physics Department Politecnico di Torino, Corso Duca degli Abruzzi 24, 10129 Torino (Italy); Materials and Microsystems Laboratory (chi lab)-LATEMAR Unit, Lungo Piazza d' Armi 6, Chivasso (Torino) (Italy); Celegato, Federica [INRIM, Strada delle Cacce 91, 10138 Torino (Italy); Guastella, Salvatore; Martino, Paola [Physics Department Politecnico di Torino, Corso Duca degli Abruzzi 24, 10129 Torino (Italy); Allia, Paolo [Physics Department Politecnico di Torino, Corso Duca degli Abruzzi 24, 10129 Torino (Italy)], E-mail: paolo.allia@polito.it; Tiberto, Paola [INRIM, Strada delle Cacce 91, 10138 Torino (Italy); Pirri, Fabrizio [Physics Department Politecnico di Torino, Corso Duca degli Abruzzi 24, 10129 Torino (Italy); Materials and Microsystems Laboratory (chi lab)-LATEMAR Unit, Lungo Piazza d' Armi 6, Chivasso (Torino) (Italy)
2008-10-15
A specific technique of numerical treatment of atomic force microscopy (AFM) and magnetic force microscopy (MFM) signal has been developed to enhance the quality of raw images, in order both to improve their contrast and to gain better insight on the sample topography and on the local arrangement of the magnetisation vector. Basically, the technique consists in computing the optimum conformal transformation that allows one to superimpose two AFM images of the same area, acquired performing subsequent scans whose fast scan axis were mutually perpendicular, and applying the inverse transform to the second image. After MFM image superposition, the two datasets were either summed or subtracted, in order to improve the magnetic contrast. Computations have been done in a Matlab workspace with the help of Image Processing Toolbox 4.2. Improved MFM images obtained on both dots and antidots thin evaporated Co arrays in the demagnetised state (after performing alternate field demagnetisation parallel and perpendicular to the array plane) have been interpreted. Samples consisting of large-size patterns (1x1 mm) of circular dots/antidots with square/hexagonal lattices and minimum diameters of 1 {mu}m were prepared by optical lithography. The magnetic film thickness was chosen depending on resist thickness, and varied between 25 and 150 nm, with a fixed ratio 1:4 between metal/resist film thickness. MFM was exploited to obtain images of either intra-dot or inter-antidot magnetic structures.
Hofstadter butterflies and magnetically induced band-gap quenching in graphene antidot lattices
DEFF Research Database (Denmark)
Pedersen, Jesper Goor; Pedersen, Thomas Garm
2013-01-01
We study graphene antidot lattices (GALs) in magnetic fields. Using a tight-binding model and a recursive Green's function technique that we extend to deal with periodic structures, we calculate Hofstadter butterflies of GALs. We compare the results to those obtained in a simpler gapped graphene ...
Tunable pinning effects produced by non-uniform antidot arrays in YBCO thin films
Energy Technology Data Exchange (ETDEWEB)
George, J.; Jones, A.; Al-Qurainy, M. [Institute for Superconducting and Electronic Materials, University of Wollongong, NSW (Australia); Fedoseev, S.A. [Institute for Superconducting and Electronic Materials, University of Wollongong, NSW (Australia); Centre for Medical Radiation Physics, University of Wollongong, NSW (Australia); Rosenfeld, A. [Centre for Medical Radiation Physics, University of Wollongong, NSW (Australia); Pan, A.V. [Institute for Superconducting and Electronic Materials, University of Wollongong, NSW (Australia); National Research Nuclear University MEPhI (Moscow Engineering Physics Institute), Moscow (Russian Federation)
2017-04-15
Uniform, graded and spaced arrays of 3 μm triangular antidots in pulsed laser deposited YBa{sub 2}Cu{sub 3}O{sub 7} (YBCO) superconducting thin films are compared by examining the improvements in the critical current density J{sub c} they produced. The comparison is made to establish the role of their lithographically defined (non-)uniformity and the effectiveness to control and/or enhance the critical current density. It is found that almost all types of non-uniform arrays, including graded ones enhance J{sub c} over the broad applied magnetic field and temperature range due to the modified critical state. Whereas uniform arrays of antidots either reduce or produce no effect on J{sub c} compared to the original (as-deposited) thin films. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Nitrocobinamide, a New Cyanide Antidote That Can Be Administered by Intramuscular Injection
Chan, Adriano; Jiang, Jingjing; Fridman, Alla; Guo, Ling T.; Shelton, G. Diane; Liu, Ming-Tao; Green, Carol; Haushalter, Kristofer J.; Patel, Hemal H.; Lee, Jangwoen; Yoon, David; Burney, Tanya; Mukai, David; Mahon, Sari B.; Brenner, Matthew; Pilz, Renate B.; Boss, Gerry R.
2015-01-01
Currently available cyanide antidotes must be given by intravenous injection over 5–10 min, making them illsuited for treating many people in the field, as could occur in a major fire, an industrial accident, or a terrorist attack. These scenarios call for a drug that can be given quickly, e.g., by intramuscular injection. We have shown that aquohydroxocobinamide is a potent cyanide antidote in animal models of cyanide poisoning, but it is unstable in solution and poorly absorbed after intramuscular injection. Here we show that adding sodium nitrite to cobinamide yields a stable derivative (referred to as nitrocobinamide) that rescues cyanide-poisoned mice and rabbits when given by intramuscular injection. We also show that the efficacy of nitrocobinamide is markedly enhanced by coadministering sodium thiosulfate (reducing the total injected volume), and we calculate that ∼1.4 mL each of nitrocobinamide and sodium thiosulfate should rescue a human from a lethal cyanide exposure. PMID:25650735
One patient's search for antidotes to nihilism in psychiatry.
Sealey, Robert
2004-01-01
A prosumer who experienced problems after misdiagnosis and mistreatment, the author searched for explanations of the short cuts inflicted on him by a mental health professional. Wanting to learn from the painful experience of willful incompetence, write to achieve closure and create a teaching tale to help other patients, the author studied the literature, read about the tradition of nihilism in psychiatry, found research reports of deviations from practice guidelines and tested three antidotes to nihilism in psychiatry.
Effects of Cheap Antidotes; Sodium Bicarbonate and Magnesium Sulfate in Organophosphorous Poisoning
International Nuclear Information System (INIS)
Balali-Mood, M.; Afshari, R.
2007-01-01
Organophosphorous (OP) compounds have been used as pesticides and chemical warfare nerve agents. Despite administration of well known antidotes (atropine and oximes), morbidity and mortality of OP poisoning were still high. Besides, oximes are very expensive and not available in most developing countries. It was thus aimed to study the effects of cheap available antidotes; sodium bicarbonate and magnesium sulfate in OP poisoning. In addition to the standard antidotal treatment, out of 117 patients (63M, 47F) aged 25.2 ± 9.5 years with moderate to severe acute OP pesticide poisoning 59 were given sodium bicarbonate 5 mEq/kg in 60 min. followed by 5-6 mEq/kg/day to obtain arterial blood pH of 7.45 to 7.55. Arterial blood pH increased significantly (p less than 0.01) to 7.48 ± 0.05 compared to the controls (7.32 ± 0.06). Morbidity based on hospitalization days reduced significantly (p less than 0.05) from 5.62 ± 3.4 in the controls to 3.1 ± 2.6 days in the sodium bicarbonate group. Total atropine dose was also significantly (p less than 0.05) lower in the test group. Mortality was lower, but not significantly due to the low numbers (5 and 2 of the controls and test group, respectively). Sodium bicarbonate appeared to be effective and could be added to the treatment regime of OP poisoning. Magnesium sulfate was administered four gram intravenously only for the first 24 hr of hospitalization day for the patients with moderate to severe OP poisoning in a pilot study. The results were promising and thus further investigations are continued.(author)
Quantum confinement effect in Bi anti-dot thin films with tailored pore wall widths and thicknesses
International Nuclear Information System (INIS)
Park, Y.; Hirose, Y.; Fukumura, T.; Hasegawa, T.; Nakao, S.; Xu, J.
2014-01-01
We investigated quantum confinement effects in Bi anti-dot thin films grown on anodized aluminium oxide templates. The pore wall widths (w Bi ) and thickness (t) of the films were tailored to have values longer or shorter than Fermi wavelength of Bi (λ F = ∼40 nm). Magnetoresistance measurements revealed a well-defined weak antilocalization effect below 10 K. Coherence lengths (L ϕ ) as functions of temperature were derived from the magnetoresistance vs field curves by assuming the Hikami-Larkin-Nagaoka model. The anti-dot thin film with w Bi and t smaller than λ F showed low dimensional electronic behavior at low temperatures where L ϕ (T) exceed w Bi or t
Evaluation of processed borax as antidote for aconite poisoning.
Sarkar, Prasanta Kumar; Prajapati, Pradeep K; Shukla, Vinay J; Ravishankar, Basavaiah
2017-06-09
Aconite root is very poisonous; causes cardiac arrhythmias, ventricular fibrillation and ventricular tachycardia. There is no specific antidote for aconite poisoning. In Ayurveda, dehydrated borax is mentioned for management of aconite poisoning. The investigation evaluated antidotal effect of processed borax against acute and sub-acute toxicity, cardiac toxicity and neuro-muscular toxicity caused by raw aconite. For acute protection Study, single dose of toxicant (35mg/kg) and test drug (22.5mg/kg and 112.5mg/kg) was administered orally, and then 24h survival of animals was observed. The schedule was continued for 30 days in sub-acute protection Study with daily doses of toxicant (6.25mg/kg), test drug (22.5mg/kg and 112.5mg/kg) and vehicle. Hematological and biochemical tests of blood and serum, histopathology of vital organs were carried out. The cardiac activity Study was continued for 30 days with daily doses of toxicant (6.25mg/kg), test drug (22.5mg/kg), processed borax solution (22.5mg/kg) and vehicle; ECG was taken after 1h of drug administration on 1 TB , 15th and on 30th day. For neuro-muscular activity Study, the leech dorsal muscle response to 2.5µg of acetylcholine followed by response of toxicant at 25µg and 50µg doses and then response of test drug at 25µg dose were recorded. Protection index indicates that treated borax gave protection to 50% rats exposed to the lethal dose of toxicant in acute protection Study. Most of the changes in hematological, biochemical parameters and histopathological Study induced by the toxicant in sub-acute protection Study were reversed significantly by the test drug treatment. The ventricular premature beat and ventricular tachyarrhythmia caused by the toxicant were reversed by the test drug indicate reversal of toxicant induced cardio-toxicity. The acetylcholine induced contractions in leech muscle were inhibited by toxicant and it was reversed by test drug treatment. The processed borax solution is found as an
Energy Technology Data Exchange (ETDEWEB)
Gubbiotti, G.; Tacchi, S. [Istituto Officina dei Materiali del Consiglio Nazionale delle Ricerche (IOM-CNR), Sede di Perugia, c/o Dipartimento di Fisica e Geologia, Via A. Pascoli, I-06123 Perugia (Italy); Montoncello, F.; Giovannini, L. [Dipartimento di Fisica e Scienze della Terra, Università di Ferrara, Via G. Saragat 1, I-44122 Ferrara (Italy); Madami, M.; Carlotti, G. [Dipartimento di Fisica e Geologia, Università di Perugia, Via A. Pascoli, I-06123 Perugia (Italy); Ding, J.; Adeyeye, A. O. [Information Storage Materials Laboratory, Department of Electrical and Computer Engineering, National University of Singapore, Singapore 117576 (Singapore)
2015-06-29
The Brillouin light scattering technique has been exploited to study the angle-resolved spin wave band diagrams of squared Permalloy antidot lattice. Frequency dispersion of spin waves has been measured for a set of fixed wave vector magnitudes, while varying the wave vector in-plane orientation with respect to the applied magnetic field. The magnonic band gap between the two most dispersive modes exhibits a minimum value at an angular position, which exclusively depends on the product between the selected wave vector magnitude and the lattice constant of the array. The experimental data are in very good agreement with predictions obtained by dynamical matrix method calculations. The presented results are relevant for magnonic devices where the antidot lattice, acting as a diffraction grating, is exploited to achieve multidirectional spin wave emission.
Evolution of magnetic and transport properties in pore-modified CoAlO antidot arrays
International Nuclear Information System (INIS)
Ma, Y G; Lim, S L; Ong, C K
2007-01-01
CoAlO composite antidot arrays were fabricated on self-organized porous anodic aluminium oxide (AAO) membranes. The effects of pore size and film thickness on the magnetism and magnetotransport properties of the CoAlO films were investigated. On increasing the pore dimensions in the arrays, an anisotropic to isotropic magnetism transition was observed. The result is discussed based on the competitive contributions from the external field induced uniaxial anisotropy and the topology-induced shape anisotropy superimposed by the stray fields from the pore channels. Magnetoresistance showed corresponding variations with increasing pore sizes, as evidenced by a magnetoresistance variation from typically anisotropic to nearly isotropic behaviour. When deposited on large-pored AAO membranes, the antidot arrays showed no obvious anisotropy at different film thicknesses. It led to negligible magnetoresistive loops in the thick films of high structural continuity. The possible reasons for spin-independent electron scatterings are discussed
Quantum confinement effect in Bi anti-dot thin films with tailored pore wall widths and thicknesses
Energy Technology Data Exchange (ETDEWEB)
Park, Y., E-mail: youngok@chem.s.u-tokyo.ac.jp [Department of Chemistry, The University of Tokyo, Bunkyo, Tokyo 113-0033 (Japan); Hirose, Y.; Fukumura, T.; Hasegawa, T. [Department of Chemistry, The University of Tokyo, Bunkyo, Tokyo 113-0033 (Japan); Kanagawa Academy of Science and Technology (KAST), Kawasaki 213-0012 (Japan); CREST, JST, Bunkyo, Tokyo 113-0033 (Japan); Nakao, S. [Kanagawa Academy of Science and Technology (KAST), Kawasaki 213-0012 (Japan); CREST, JST, Bunkyo, Tokyo 113-0033 (Japan); Xu, J. [School of Engineering, Brown University, Providence, Rhode Island 02912 (United States)
2014-01-13
We investigated quantum confinement effects in Bi anti-dot thin films grown on anodized aluminium oxide templates. The pore wall widths (w{sub Bi}) and thickness (t) of the films were tailored to have values longer or shorter than Fermi wavelength of Bi (λ{sub F} = ∼40 nm). Magnetoresistance measurements revealed a well-defined weak antilocalization effect below 10 K. Coherence lengths (L{sub ϕ}) as functions of temperature were derived from the magnetoresistance vs field curves by assuming the Hikami-Larkin-Nagaoka model. The anti-dot thin film with w{sub Bi} and t smaller than λ{sub F} showed low dimensional electronic behavior at low temperatures where L{sub ϕ}(T) exceed w{sub Bi} or t.
Poplas-Susić, Tonka; Klemenc-Ketis, Zalika; Komericki-Grzinić, Marija; Kersnik, Janko
2010-01-01
Data on emergency interventions in poisonings are scarce. Objective To determine the effectiveness of antidote therapy in acute poisoning-related emergency medical services (EMS) interventions. A prospective observational study included all poisoning-related intervention cases over 3 years (1999-2001) in the Celje region, Slovenia, covering 125,000 inhabitants. Data were recorded on an EMS form. Psychoactive agents were present in 56.5% out of 244 poisoning-related EMS interventions. Prescription drugs were a cause of intoxication in 93 (39.2%) cases alone or in combination with alcohol or illegal drugs. More than one fifth of poisonings were due to the use of illegal drugs in 52 (21.9%) cases, 43 (18.1%) out of them heroin related. At the time of EMS arrival, more patients who ingested illegal drugs were in coma or comatose than the rest. 24 (45.3%) vs. 32 (17.3%) of poisoned patients were in coma (p < 0.001). Glasgow Coma Scale (GCS) at the first contact was lower in patients who ingested illegal drugs than in the remaining patients (9.0 vs. 11.6, p = 0.001). In 23.2% of the cases, an antidote was administered. In 29 (12.2%) naloxone and in 16 (6.7%) flumazenil was administered. Mean GCS after intervention was higher in all cases but significantly higher in illegal drug cases, 13.4 vs. 12.2 (p = 0.001), with a mean positive change in GCS of 4.5 vs. 0.6 (p < 0.001). In illegal drug users, mean change after antidote administration was 8.2 vs. 0.5 without antidote administration (p < 0.001). High rate of successful antidote use during the intervention indicated the importance of good EMS protocols and the presence of a skilled doctor in the EMS team.
Directory of Open Access Journals (Sweden)
Poplas-Sušić Tonka
2010-01-01
Full Text Available Introduction. Data on emergency interventions in poisonings are scarce. Objective. To determine the effectiveness of antidote therapy in acute poisoning-related emergency medical services (EMS interventions. Methods. A prospective observational study included all poisoning-related intervention cases over 3 years (1999-2001 in the Celje region, Slovenia, covering 125,000 inhabitants. Data were recorded on an EMS form. Results. Psychoactive agents were present in 56.5% out of 244 poisoning-related EMS interventions. Prescription drugs were a cause of intoxication in 93 (39.2% cases alone or in combination with alcohol or illegal drugs. More than one fifth of poisonings were due to the use of illegal drugs in 52 (21.9% cases, 43 (18.1% out of them heroin related. At the time of EMS arrival, more patients who ingested illegal drugs were in coma or comatose than the rest. 24 (45.3% vs. 32 (17.3% of poisoned patients were in coma (p<0.001. Glasgow Coma Scale (GCS at the first contact was lower in patients who ingested illegal drugs than in the remaining patients (9.0 vs. 11.6, p=0.001. In 23.2% of the cases, an antidote was administered. In 29 (12.2% naloxone and in 16 (6.7% flumazenil was administered. Mean GCS after intervention was higher in all cases but significantly higher in illegal drug cases, 13.4 vs. 12.2 (p=0.001, with a mean positive change in GCS of 4.5 vs. 0.6 (p<0.001. In illegal drug users, mean change after antidote administration was 8.2 vs. 0.5 without antidote administration (p<0.001. Conclusion. High rate of successful antidote use during the intervention indicated the importance of good EMS protocols and the presence of a skilled doctor in the EMS team.
RamaRao, Golime; Afley, Prachiti; Acharya, Jyothiranjan; Bhattacharya, Bijoy Krishna
2014-04-04
Recent alleged attacks with nerve agent sarin on civilians in Syria indicate their potential threat to both civilian and military population. Acute nerve agent exposure can cause rapid death or leads to multiple and long term neurological effects. The biochemical changes that occur following nerve agent exposure needs to be elucidated to understand the mechanisms behind their long term neurological effects and to design better therapeutic drugs to block their multiple neurotoxic effects. In the present study, we intend to study the efficacy of antidotes comprising of HI-6 (1-[[[4-(aminocarbonyl)-pyridinio]-methoxy]-methyl]-2-[(hydroxyimino) methyl] pyridinium dichloride), atropine and midazolam on soman induced neurodegeneration and the expression of c-Fos, Calpain, and Bax levels in discrete rat brain areas. Therapeutic regime consisting of HI-6 (50 mg/kg, i.m), atropine (10 mg/kg, i.m) and midazolam (5 mg/kg, i.m) protected animals against soman (2×LD50, s.c) lethality completely at 2 h and 80% at 24 h. HI-6 treatment reactivated soman inhibited plasma and RBC cholinesterase up to 40%. Fluoro-Jade B (FJ-B) staining of neurodegenerative neurons showed that soman induced significant necrotic neuronal cell death, which was reduced by this antidotal treatment. Soman increased the expression of neuronal proteins including c-Fos, Bax and Calpain levels in the hippocampus, cerebral cortex and cerebellum regions of the brain. This therapeutic regime also reduced the soman induced Bax, Calpain expression levels to near control levels in the different brain regions studied, except a mild induction of c-Fos expression in the hippocampus. Rats that received antidotal treatment after soman exposure were protected from mortality and showed reduction in the soman induced expression of c-Fos, Bax and Calpain and necrosis. Results highlight the need for timely administration of better antidotes than standard therapy in order to prevent the molecular and biochemical changes and
On the need to develop a centralized system of antidote therapy
Ivashchenko, O.V.; Ustinova, L.A.; Kurdil, N.V.; Padalka, V.M.; Andrushchenko, V.V.
2018-01-01
Current toxicological situation in Ukraine is characterized by a sharp deterioration of chemical hazards. Today, significant areas of the state are in a direct chemical threat, which requires the immediate creation of an efficient reserve of antidote therapy in accordance with the current needs of the Armed Forces of Ukraine and medical institutions of the Ministry of Health of Ukraine. Almost all regions of Ukraine are at risk of disasters, due to the presence of chemical industrial faciliti...
International Nuclear Information System (INIS)
Perez-Junquera, A.; Martin, J.I.; Anguita, J.V.; Rodriguez-Rodriguez, G.; Velez, M.; Rubio, H.; Alvarez-Prado, L.M.; Alameda, J.M.
2007-01-01
Diluted arrays of elliptical antidots have been fabricated by optical lithography, electron beam lithography and plasma etching on amorphous Co 74 Si 26 magnetic films with a well-defined uniaxial anisotropy. The magnetic behavior of two identical antidot arrays but with different hole depth in comparison with film thickness has been studied by transverse magneto-optical Kerr effect. Significant differences appear in the coercivity depending on whether the magnetic film is completely perforated or not, indicating a much more effective domain wall pinning process when the depth of the holes is smaller than the magnetic film thickness
Directory of Open Access Journals (Sweden)
Patrick Durel
2006-06-01
Full Text Available Cette étude examine les opérations mentales d'apprenants utilisant l'assistant grammatical Antidote en phase de révision de leurs productions écrites. Analysant des données obtenues à partir de la méthode des protocoles verbaux, ce travail montre comment ce type d'activité de révision assistée par ordinateur conduit l'apprenant à manipuler, construire, renforcer ou élargir le champ d'application de ses connaissances, qu'elles soient déclaratives ou procédurales. Les éléments dégagés indiquent que l'utilisation d'Antidote peut être vecteur d'apprentissage et offrent quelques pistes permettant de concevoir des activités de révision assistée par ordinateur qui s'inscrivent dans le cadre d'une didactique de la production scripturale.This study explores learners' cognitive processes when using the grammar assistant software Antidote during the revision phase of their composition. Analysing data obtained using a hybrid form of verbal protocols, it shows how computer-assisted revision activity can lead learners to manipulate, build or reinforce declarative and procedural knowledge. We argue that using grammar assistant software can be conducive to learning. The results of the analysis provide an insight into how such a tool can be integrated into classroom activities, contributing to writing quality and the acquisition of revision strategies.
Energy Technology Data Exchange (ETDEWEB)
Bothner, D.; Kemmler, M.; Cozma, R.; Kleiner, R.; Koelle, D. [Physikalisches Institut and Center for Collective Quantum Phenomena, Universitaet Tuebingen (Germany); Misko, V.; Peeters, F. [Departement Fysica, Universiteit Antwerpen (Belgium); Nori, F. [Advanced Science Institute, RIKEN (Japan)
2011-07-01
The magnetic field dependent critical current I{sub c}(H) of superconducting thin films with artificial defects strongly depends on the symmetry of the defect arrangement. Likewise the critical temperature T{sub c}(H) of superconducting wire networks is heavily influenced by the symmetry of the system. Here we present experimental data on the I{sub c}(H)-T{sub c}(H) phase boundary of Nb thin films with artificial defect lattices of different symmetries. For this purpose we fabricated 60 nm thick Nb films with antidots in periodic (triangular) and five different quasiperiodic arrangements. The parameters of the antidot arrays were varied to investigate the influence of antidot diameter and array density. Experiments were performed with high temperature stability ({delta}T<1 mK) at 0.5{<=}T/T{sub c}{<=}1. From the I-V-characteristics at variable H and T we extract I{sub c}(H) and T{sub c}(H) for different voltage and resistance criteria. The experimental data for the critical current density are compared with results from numerical molecular dynamics simulations.
Antidotal Efficacy of a New Combination in Treatment of Subacute T-2 Toxin Poisoning in Rats
International Nuclear Information System (INIS)
Jacevic, V. M.; Bocarov-Stancic, A. S.; Resanovic, R. D.; Djordjevic, S. B.; Bokonjic, D. R.
2007-01-01
Trichothecene mycotoxin, T-2 toxin is a natural metabolite of Fusarium fungi. T-2 toxin possesses several properties (significant persistence in the environment, cheap manufacture, difficult detection and absence of a specific antidote) that make it a very dangerous potential chemical warfare agent. In our previous experiments, nonsteroidal anti-inflammatory drug (NSAID) nimesulide (NIM), as a selective COX-2 inhibitor, and zeolite absorbent (Min-a-zel Plus, MINplus) administered separately showed a good protective effects against general toxicity induced by T-2 toxin (T2). The aim of this study was to evaluate the antidotal potential of the combination of these two antidotes. T2 was given in a dose of 0.15 mg/kg sc (0.1 LD50), 5 times per week, 4 weeks to adult Wistar rats. Protected animals were given NIM (20 mg/kg im) or/and MINplus (40 mg/kg po) each time immediately after T2. Mortality, general condition, body weight gain, food and water consumption and gut alterations of the animals were registered on a daily basis during 4 weeks. Treatment with NIM or/and MINplus significantly reduced mortality of the rats treated only with T2. Body weight gain, food and water consumption were significantly decreased in T2-treated animals compared to control ones (p < 0.001), what was not the case in the protected rats. In the groups treated with NIM and MINplus gut alterations were significantly less severe than those observed in animals receiving T2 alone (p less than 0.001). These results imply that combined treatment with nimesulide and zeolite absorbent affords a significant protection against subacute T-2 toxin poisoning in rats.(author)
The use of intravenous lipid emulsion as an antidote in veterinary toxicology.
Fernandez, Alberto L; Lee, Justine A; Rahilly, Louisa; Hovda, Lynn; Brutlag, Ahna G; Engebretsen, Kristin
2011-08-01
To review the use of IV lipid emulsion (ILE) for the treatment of toxicities related to fat-soluble agents; evaluate current human and veterinary literature; and to provide proposed guidelines for the use of this emerging therapy in veterinary medicine and toxicology. Human and veterinary medical literature. Human data are composed mostly of case reports describing the response to treatment with ILE as variant from mild improvement to complete resolution of clinical signs, which is suspected to be due to the variability of lipid solubility of the drugs. The use of ILE therapy has been advocated as an antidote in cases of local anesthetic and other lipophilic drug toxicoses, particularly in the face of cardiopulmonary arrest and unsuccessful cardiopulmonary cerebral resuscitation. The use of ILE therapy in veterinary medicine has recently been advocated by animal poison control centers for toxicoses associated with fat-soluble agents, but there are only few clinical reports documenting successful use of this therapy. Evidence for the use of ILE in both human and veterinary medicine is composed primarily from experimental animal data. The use of ILE appears to be a safe therapy for the poisoned animal patient, but is warranted only with certain toxicoses. Adverse events associated with ILE in veterinary medicine are rare and anecdotal. Standard resuscitation protocols should be exhausted before considering this therapy and the potential side effects should be evaluated before administration of ILE as a potential antidote in cases of lipophilic drug toxicoses. Further research is waranted. © Veterinary Emergency and Critical Care Society 2011.
Humanistic Antidotes to Social Media/Cell Phone Addiction in the College Classroom
Directory of Open Access Journals (Sweden)
Elliot Benjamin
2016-08-01
Full Text Available This article describes “humanistic antidotes” to offset the widespread social media/cell phone addiction prevalent in current US college classrooms. The inappropriate use of cell phones to engage in social media in college classrooms is a pervasive problem that many college instructors have complained about. The dominant focus of this article is in humanistic education, in which the author's efforts at getting psychology college students to put away their cell phones, “talk with each other,” and gain awareness of the detrimental effects of social media addiction and narcissism is illustrated. The methodology utilized in this article is based upon autoethnographic research, where relevant experiences of the researcher are considered to be an informative and fundamental part of the research. The author describes in narrative form his relevant experiences in formulating humanistic antidotes to the excessive and inappropriate use of cell phones to engage in social media, that he encountered in his college psychology teaching. These humanistic antidotes are described as a three-step process: 1 take necessary actions to eliminate as much as possible the inappropriate use of cell phones in the classroom; 2 engage students in required personal/academic small group discussions every class period; 3 include small discussions about the excessive and inappropriate use of cell phones and social media, and require them to write and present project papers of their own choosing, which will likely include some papers on the topic of cell phone/social media addiction, demonstrating their awareness of the detrimental aspects of this pervasive problem.
Valiakos, E; Marselos, M; Sakellaridis, N; Constantinidis, Th; Skaltsa, H
2015-04-02
This paper focuses on the plants quoted in the recipes of the first chapter entitled "About the Antidotes" belonging to the first and largest section "Element Alpha" of Nikolaos Myrepsos׳ Dynameron, a medieval medical manuscript. Nikolaos Myrepsos was a Byzantine physician at the court of John III Doukas Vatatzes at Nicaea (13th century). He wrote in Greek a rich collection of 2667 recipes, the richest number known in late Byzantine era, conventionally known as Dynameron and divided into 24 sections, the "Elements". The only existing translation of this work is in Latin, released in 1549 in Basel by Leonhart Fuchs. Since no other translation has ever been made in any language, this work still remains poorly known. Our primary source material was the codex written in 1339 and kept in the National Library of France (in Paris) under the number grec. 2243. For comparison, all the other codices, which contain the entire manuscript, have also been studied, namely the codices EBE 1478 (National Library of Greece, Athens), grec. 2237 and grec. 2238 (both in Paris), Lavra Ε 192 (Mont Athos, Monastery of Megisti Lavra), Barocci 171 (Oxford) and Revilla 83 (Escorial). The exhaustive study of the "About the Antidotes" led us to the interpretation of 293 plant names among which we recognized 39 medicinal plants listed by the European Medicines Agency, (Herbal Medicines, www.ema.eu); the therapeutic indications of some of them provided by Myrepsos were similar or related to their current ones, as given in their monographs. The plants belong to various families of which the most frequent are: Apiaceae 10.6%; Lamiaceae 9.2%; Asteraceae 8.9%; Fabaceae 6.8% and Rosaceae 5.1%. The most frequently mentioned plants even under several different names are the following: Apium graveolens L., Crocus sativus L., Nardostachys jatamansi (D. Don) DC., Zingiber officinale Roscoe, Rosa centifolia L., Syzygium aromaticum (L.) Merr. & L.M. Perry, Papaver somniferum L., Costus sp., Petroselinum
International Nuclear Information System (INIS)
Gutman, I.; Goldberg, S.; Segev, Y.; Tamegai, T.
2010-01-01
This work focuses on differential magneto-optical two-dimensional imaging of the current distribution in a high-T c superconducting Bi 2 Sr 2 CaCu 2 O 8 crystal having a region of 170 x 170 μm 2 patterned with periodic blind antidots. By measuring the self-induced field of an applied current, we can map the current flow distribution within and at the edges of the patterned region. We detected three separate types of current flow within the patterned region, which correspond to three different arrangements of pancake vortices within and at the edges of the patterned region. At high temperatures the vortices delocalize from the antidots, presumably due to thermal fluctuations. However, at lower temperatures vortex pinning mechanisms become prominent, lowering the vortex mobility in the patterned region. There are two contributing mechanisms: bulk pinning by the patterned antidots and interface pinning due to an entry barrier into the patterned region. Each mechanism is dominant at different temperatures. From our experiments we see that the T-H transition line from the bulk to the interface pinning and the vortex melting line in the pristine region coincide.
Parity effect of bipolar quantum Hall edge transport around graphene antidots.
Matsuo, Sadashige; Nakaharai, Shu; Komatsu, Katsuyoshi; Tsukagoshi, Kazuhito; Moriyama, Takahiro; Ono, Teruo; Kobayashi, Kensuke
2015-06-30
Parity effect, which means that even-odd property of an integer physical parameter results in an essential difference, ubiquitously appears and enables us to grasp its physical essence as the microscopic mechanism is less significant in coarse graining. Here we report a new parity effect of quantum Hall edge transport in graphene antidot devices with pn junctions (PNJs). We found and experimentally verified that the bipolar quantum Hall edge transport is drastically affected by the parity of the number of PNJs. This parity effect is universal in bipolar quantum Hall edge transport of not only graphene but also massless Dirac electron systems. These results offer a promising way to design electron interferometers in graphene.
Zyoud, Sa'ed H; Waring, W Stephen; Al-Jabi, Samah W; Sweileh, Waleed M; Rahhal, Belal; Awang, Rahmat
2016-11-01
In recent years, there has been increasing interest in the role of intravenous lipid formulations as potential antidotes in patients with severe cardiotoxicity caused by drug toxicity. The aim of this study was to conduct a comprehensive bibliometric analysis of all human and animal studies featuring lipid emulsion as an antidote for the treatment of acute poisoning. The Scopus database search was performed on 5 February 2016 to analyse the research output related to intravenous lipid emulsion as an antidote for the treatment of acute poisoning. Research indicators used for analysis included total number of articles, date (year) of publication, total citations, value of the h-index, document types, countries of publication, journal names, collaboration patterns and institutions. A total of 594 articles were retrieved from Scopus database for the period of 1955-2015. The percentage share of global intravenous lipid emulsion research output showed that research output was 85.86% in 2006-2015 with yearly average growth in this field of 51 articles per year. The USA, United Kingdom (UK), France, Canada, New Zealand, Germany, Australia, China, Turkey and Japan accounted for 449 (75.6%) of all the publications. The total number of citations for all documents was 9,333, with an average of 15.7 citations per document. The h-index of the retrieved documents for lipid emulsion research as antidote for the treatment of acute poisoning was 49. The USA and the UK achieved the highest h-indices, 34 and 14, respectively. New Zealand produced the greatest number of documents with international collaboration (51.9%) followed by Australia (50%) and Canada (41.4%) out of the total number of publications for each country. In summary, we found an increase in the number of publications in the field of lipid emulsion after 2006. The results of this study demonstrate that the majority of publications in the field of lipid emulsion were published by high-income countries. Researchers from
Construction of a Bivalent Thrombin Binding Aptamer and Its Antidote with Improved Properties
Directory of Open Access Journals (Sweden)
Quintin W. Hughes
2017-10-01
Full Text Available Aptamers are short synthetic DNA or RNA oligonucleotides that adopt secondary and tertiary conformations based on Watson–Crick base-pairing interactions and can be used to target a range of different molecules. Two aptamers, HD1 and HD22, that bind to exosites I and II of the human thrombin molecule, respectively, have been extensively studied due to their anticoagulant potentials. However, a fundamental issue preventing the clinical translation of many aptamers is degradation by nucleases and reduced pharmacokinetic properties requiring higher dosing regimens more often. In this study, we have chemically modified the design of previously described thrombin binding aptamers targeting exosites I, HD1, and exosite II, HD22. The individual aptamers were first modified with an inverted deoxythymidine nucleotide, and then constructed bivalent aptamers by connecting the HD1 and HD22 aptamers either through a triethylene glycol (TEG linkage or four consecutive deoxythymidines together with an inverted deoxythymidine nucleotide at the 3′-end. The anticoagulation potential, the reversal of coagulation with different antidote sequences, and the nuclease stability of the aptamers were then investigated. The results showed that a bivalent aptamer RNV220 containing an inverted deoxythymidine and a TEG linkage chemistry significantly enhanced the anticoagulation properties in blood plasma and nuclease stability compared to the existing aptamer designs. Furthermore, a bivalent antidote sequence RNV220AD efficiently reversed the anticoagulation effect of RNV220 in blood plasma. Based on our results, we believe that RNV220 could be developed as a potential anticoagulant therapeutic molecule.
Energy Technology Data Exchange (ETDEWEB)
Ulfvarson, U
1973-01-01
The results of investigations of the distribution and excretion of organic and inorganic mercury compounds in albino rats and white leghorn hens conducted over a period of ten years are surveyed. The storage of mercury in eggs as well as its effects on the egg-lay-frequency and hatchability of the eggs have also been studied. All investigated mercury compounds were labelled with the radioactive mercury isotope /sup 203/Hg and the mercury level was measured with a scintillation technique. Since antidotes used in the treatment of mercury poisoning influence not only the excretion of mercury, but also its distribution in the body, the effects of nine antidotes on the metabolism of different mercury compounds were also investigated. The results of the survey are presented graphically. 6 references, 15 figures, 1 table.
Vimieiro Gomes, Ana Carolina
2012-01-01
This article examines an international controversy over the most visible scientific event of Brazilian physiology in the nineteenth century. In 1881, Brazilian scientist João Baptista Lacerda stated that he had found an efficient antidote to the poison of Brazilian snakes: permanganate of potash (nowadays, potassium permanganate). His findings were given great publicity in Brazil and traveled rapidly around the world. Scientists, especially in France, contradicted Lacerda's claims. They argued that permanganate of potash could not be a genuine antidote to snake bites since it could not neutralize snake venom when diffused in the body. Lacerda turned down such criticism, claiming that clinical observation provided solid evidence for the drug's local action, on the spot surrounding the bite. The controversy over the use of permanganate of potash as an antidote to snake bite illustrates different regimes of proof that could be mobilized in favor of a physiological discovery.
Coïsson, Marco; Celegato, Federica; Barrera, Gabriele; Conta, Gianluca; Magni, Alessandro; Tiberto, Paola
2017-08-23
A bi-component nanostructured system composed by a Co dot array embedded in a Ni 80 Fe 20 antidot matrix has been prepared by means of the self-assembling polystyrene nanospheres lithography technique. Reference samples constituted by the sole Co dots or Ni 80 Fe 20 antidots have also been prepared, in order to compare their properties with those of the bi-component material. The coupling between the two ferromagnetic elements has been studied by means of magnetic and magneto-transport measurements. The Ni 80 Fe 20 matrix turned out to affect the vortex nucleation field of the Co dots, which in turn modifies the magneto-resistance behaviour of the system and its spinwave properties.
Directory of Open Access Journals (Sweden)
Mohamed Salaheldeen
2018-04-01
Full Text Available In this article, the magnetic properties of hexagonally ordered antidot arrays made of Dy13Fe87 alloy are studied and compared with corresponding ones of continuous thin films with the same compositions and thicknesses, varying between 20 nm and 50 nm. Both samples, the continuous thin films and antidot arrays, were prepared by high vacuum e-beam evaporation of the alloy on the top-surface of glass and hexagonally self-ordered nanoporous alumina templates, which serve as substrates, respectively. By using a highly sensitive magneto-optical Kerr effect (MOKE and vibrating sample magnetometer (VSM measurements an interesting phenomenon has been observed, consisting in the easy magnetization axis transfer from a purely in-plane (INP magnetic anisotropy to out-of-plane (OOP magnetization. For the 30 nm film thickness we have measured the volume hysteresis loops by VSM with the easy magnetization axis lying along the OOP direction. Using magnetic force microscopy measurements (MFM, there is strong evidence to suggest that the formation of magnetic domains with OOP magnetization occurs in this sample. This phenomenon can be of high interest for the development of novel magnetic and magneto-optic perpendicular recording patterned media based on template-assisted deposition techniques.
Pride and Purpose as Antidotes to Black Homicidal Violence
Thomas, Charles W.
1987-01-01
The incidence of black male homicide is a major public menace. The lowest incidence of black male homicide was when the black power movement was visible and flourishing. Psychohistorical data support the contention that racial pride is an effective means for regulating intragroup tensions. In the absence of an Afrocentric orientation that promotes community power and self-determination, the need for self-reliance is eroded by value illnesses. The value orientation of the black movement supplied the pride used to obtain academic success, to reduce juvenile delinquency, and to help Afro-Americans to structure their lives for personal satisfactions. Blackness has always been about personal power and social control, but society does not allow much access to either for Afro-Americans. As a consequence, stress from racism is severe, asymptomatic, and multi-faceted. The best antidote to black homicidal violence comes from a pro-social effort based upon a self-image that gives a feeling of positive accomplishment and appreciation. Afrocentric pride promotes or enhances pro-social behavior. PMID:3560242
International Nuclear Information System (INIS)
Poschl, M.; Borkovec, V.; Zelenka, J.; Prochazka, J.
1994-01-01
The post-Chernobyl 137 Cs contamination caused gut uptake of this nuclide by ruminants, pigs and laying hens. The application of several clay minerals, stable caesium as well as hexacyanoferrate and related compounds has shown to be effective in reducing the gut uptake. The aim of this study was focused on a possibility of the suppression of gut uptake of 13 '7Cs from the contaminated feed mixture to broiler chicken and/or increasing the rate of excretion of 137 Cs from tissues of broiler chicken by a special food additive (RADECONT, i.e. 98% of clinoptilolite + 2% of FeHCF, made by BIOPOR, CZ). The antidote material RADECONT was added to the feed mixture 2 hours after application of artificially contaminated feed (5kBq of 137 Cs per chicken). The dose of the material was 0.5g per kg body weight and it was repeated daily. The control chickens were given 137 Cs but not antidote in the feed. Lower radiocaesium activities in breast and leg muscles (statistically significant, P 137 Cs administration. The biological half-lives of 137 Cs in the controls treated animals were similar. Application of RADECONT decreased the uptake of radiocaesium in tissues (by up to 20% in muscles) but did not enhance the excretion rate of 137 Cs. (author)
Energy Technology Data Exchange (ETDEWEB)
Zhdanov, E. Yu., E-mail: zhdanov@isp.nsc.ru; Pogosov, A. G.; Budantsev, M. V.; Pokhabov, D. A.; Bakarov, A. K. [Siberian Branch of the Russian Academy of Sciences, Rzhanov Institute of Semiconductor Physics (Russian Federation)
2017-01-15
The magnetoresistance of suspended semiconductor nanostructures with a two-dimensional electron gas structured by periodic square antidot lattices is studied. It is shown that the ballistic regime of electron transport is retained after detaching the sample from the substrate. Direct comparative analysis of commensurability oscillations of magnetoresistance and their temperature dependences in samples before and after suspension is performed. It is found that the temperature dependences are almost identical for non-suspended and suspended samples, whereas significant differences are observed in the nonlinear regime, caused by direct current passage. Commensurability oscillations in the suspended samples are more stable with respect to exposure to direct current, which can be presumably explained by electron–electron interaction enhancement after detaching nanostructures from the high-permittivity substrate.
Bogan, Reinhard; Koller, Marianne; Klaubert, Bernd
2012-01-01
As reactivators of inhibited acetylcholinesterase, oximes are essential antidotes in poisoning by organophosphorus compounds. Due to its superior efficacy in cases of soman, cyclosarin, and sarin poisoning, the oxime HI-6 represents a promising option for an active pharmaceutical ingredient (API) in the further development of antidote therapy for nerve agent poisoning. Developmental lots of HI-6 DMS (dimethanesulfonate) provided by different manufacturers were examined with respect to their content and purity with a view to their future use as an API. There are distinct differences in the HI-6 content from three manufacturers. With respect to purity, gradual differences arise with the known synthetic by-products as well as with unknown accompanying compounds. It became apparent that in the case of a modified synthesis using protective groups, the proportion of some synthesis by-products decreases considerably. With one exception, they are thus below the reporting threshold for API in accordance with pertinent regulatory guidelines. In HI-6, an unknown impurity always occurs, whose percentage necessitates identification due to regulations. This unknown impurity, which has not been described so far, could be identified as an isomer. These findings supply data required for the description of pharmaceutical quality in accordance with module 3 of a Common Technical Document (CTD). They thus contribute to the marketing authorization of this substance as an API for auto-injectors and infusions. Copyright © 2012 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Motahareh Soltani
2016-08-01
Full Text Available Objectives: Aluminium phosphide (AlP is a fumigant pesticide which protects stored grains from insects and rodents. When it comes into contact with moisture, AlP releases phosphine (PH3, a highly toxic gas. No efficient antidote has been found for AlP poisoning so far and most people who are poisoned do not survive. Boric acid is a Lewis acid with an empty p orbital which accepts electrons. This study aimed to investigate the neutralisation of PH3 gas with boric acid. Methods: This study was carried out at the Baharlou Hospital, Tehran University of Medical Sciences, Tehran, Iran, between December 2013 and February 2014. The volume of released gas, rate of gas evolution and changes in pH were measured during reactions of AlP tablets with water, acidified water, saturated boric acid solution, acidified saturated boric acid solution, activated charcoal and acidified activated charcoal. Infrared spectroscopy was used to study the resulting probable adduct between PH3 and boric acid. Results: Activated charcoal significantly reduced the volume of released gas (P <0.01. Although boric acid did not significantly reduce the volume of released gas, it significantly reduced the rate of gas evolution (P <0.01. A gaseous adduct was formed in the reaction between pure AlP and boric acid. Conclusion: These findings indicate that boric acid may be an efficient and non-toxic antidote for PH3 poisoning.
International Nuclear Information System (INIS)
Budantsev, M. V.; Lavrov, R. A.; Pogosov, A. G.; Zhdanov, E. Yu.; Pokhabov, D. A.
2011-01-01
Extraordinary piecewise parabolic behavior of the magnetoresistance has been experimentally detected in the two-dimensional electron gas with a dense triangular lattice of antidots, where commensurability magnetoresistance oscillations are suppressed. The magnetic field range of 0–0.6 T can be divided into three wide regions, in each of which the magnetoresistance is described by parabolic dependences with high accuracy (comparable to the experimental accuracy) and the transition regions between adjacent regions are much narrower than the regions themselves. In the region corresponding to the weakest magnetic fields, the parabolic behavior becomes almost linear. The observed behavior is reproducible as the electron gas density changes, which results in a change in the resistance by more than an order of magnitude. Possible physical mechanisms responsible for the observed behavior, including so-called “memory effects,” are discussed.
Energy Technology Data Exchange (ETDEWEB)
Kurosu, Y.; Yokoyama, M.; Kuwasawa, Y.; Matsuda, S.; Nojima, T
2003-05-01
We have examined the vortex dynamics in W/Si multilayers with the arrays of antidots in the form of square and triangular lattices. In the measurements of I-V characteristics as a function of temperature T and magnetic field H, we find a specific feature that the V(I) curves coincide irrespective of T. Especially the V(I) curves with a negative slope are observed in the multilayer with triangular arrays.
International Nuclear Information System (INIS)
Hla Myo Min; Mya Aye
2004-06-01
The structure of a new coumarin type compound isolated from the entitled species was elucidated by the full spectral analysis consisting of FTIR, 1H NMR, DQF COSY, 13C NMR, DEPT, EIMS (HR-EIMS), HMQC and HMBC. The antidote activities of the fresh juice and the ethanolic extract of the plant, and the isolated compound alternamin were also determined
Density functional study of graphene antidot lattices: Roles of geometrical relaxation and spin
DEFF Research Database (Denmark)
Fürst, Joachim Alexander; Pedersen, Thomas Garm; Brandbyge, Mads
2009-01-01
thereof. We find from DFT that all structures investigated have band gaps ranging from 0.2 to 1.5 eV. Band gap sizes and general trends are well captured by DFTB with band gaps agreeing within about 0.2 eV even for very small structures. A combination of the two methods is found to offer a good trade...... properties. In this work, we perform calculations of the band structure for various hydrogen-passivated hole geometries using both spin-polarized density functional theory (DFT) and DFT based tight-binding (DFTB) and address the importance of relaxation of the structures using either method or a combination......-off between computational cost and accuracy. Both methods predict nondegenerate midgap states for certain antidot hole symmetries. The inclusion of spin results in a spin-splitting of these states as well as magnetic moments obeying the Lieb theorem. The local-spin texture of both magnetic and nonmagnetic...
Photoinduced transport in an H64Q neuroglobin antidote for carbon monoxide poisoning
Rydzewski, J.; Nowak, W.
2018-03-01
Carbon monoxide (CO) is a leading cause of poisoning deaths worldwide, without available antidotal therapy. Recently, a potential treatment for CO poisoning was introduced, based on binding of CO by neuroglobin (Ngb) with a mutated distal histidine (H64Q). Here, we present an atomistic mechanism of CO trapping by H64Q Ngb revealed by nonadiabatic molecular dynamics. We focused on CO photodissociation and recombination of CO to wild type (WT) and H64Q Ngb. Our results demonstrate that the distribution of CO within the proteins differs substantially due to rearrangement of amino acids surrounding the distal heme pocket. This leads to the decrease of the distal pocket volume in H64Q Ngb in comparison to WT Ngb, trapping migrating CO molecules in the distal pocket. We show that the mutation implicates the shortening of the time scale of CO geminate recombination, making H64Q Ngb 2.7 times more frequent binder than WT Ngb.
Zoghi, Milad; Yazdanpanah Goharrizi, Arash; Mirjalili, Seyed Mohammad; Kabir, M. Z.
2018-06-01
Electronic and transport properties of Carbon nanotubes (CNTs) are affected by the presence of physical or chemical defects in their structures. In this paper, we present novel platforms of defected zigzag CNTs (Z-CNTs) in which two topologies of antidot and Boron/Nitride (BN) doping defects are periodically imposed throughout the length of perfect tubes. Using the tight binding model and the non-equilibrium Green’s function method, it is realized that the quantum confinement of Z-CNTs is modified by the presence of such defects. This new quantum confinement results in the appearance of mini bands and mini gaps in the transmission spectra, as well as a modified band structure and band gap size. The modified band gap could be either larger or smaller than the intrinsic band gap of a perfect tube, which is determined by the category of Z-CNT. The in-depth analysis shows that the size of the modified band gap is the function of several factors consisting of: the radii of tube (D r), the distance between adjacent defects (d d), the utilized defect topology, and the kind of defect (antidot or BN doping). Furthermore, taking advantage of the tunable band gap size of Z-CNT with the presence of periodical defects, new platforms of defect-based Z-CNT resonant tunneling diode (RTD) are proposed for the first time. Our calculations demonstrate the apparition of resonances in transmission spectra and the negative differential resistance in the I-V characteristics for such RTD platforms.
Xue, C.; Ge, J.-Y.; He, A.; Zharinov, V. S.; Moshchalkov, V. V.; Zhou, Y. H.; Silhanek, A. V.; Van de Vondel, J.
2017-07-01
We investigate the degeneracy of the superconducting vortex matter ground state by directly visualizing the vortex configurations in a kagome lattice of elongated antidots via scanning Hall probe microscopy. The observed vortex patterns, at specific applied magnetic fields, are in good agreement with the configurations obtained using time-dependent Ginzburg-Landau simulations. Both results indicate that the long-range interaction in this nanostructured superconductor is unable to lift the degeneracy between different vortex states and the pattern formation is mainly ruled by the nearest-neighbor interaction. This simplification makes it possible to identify a set of simple rules characterizing the vortex configurations. We demonstrate that these rules can explain both the observed vortex distributions and the magnetic-field-dependent degree of degeneracy.
Antidotes for poisoning by alcohols that form toxic metabolites.
McMartin, Kenneth; Jacobsen, Dag; Hovda, Knut Erik
2016-03-01
The alcohols, methanol, ethylene glycol and diethylene glycol, have many features in common, the most important of which is the fact that the compounds themselves are relatively non-toxic but are metabolized, initially by alcohol dehydrogenase, to various toxic intermediates. These compounds are readily available worldwide in commercial products as well as in homemade alcoholic beverages, both of which lead to most of the poisoning cases, from either unintentional or intentional ingestion. Although relatively infrequent in overall occurrence, poisonings by metabolically-toxic alcohols do unfortunately occur in outbreaks and can result in severe morbidity and mortality. These poisonings have traditionally been treated with ethanol since it competes for the active site of alcohol dehydrogenase and decreases the formation of toxic metabolites. Although ethanol can be effective in these poisonings, there are substantial practical problems with its use and so fomepizole, a potent competitive inhibitor of alcohol dehydrogenase, was developed for a hopefully better treatment for metabolically-toxic alcohol poisonings. Fomepizole has few side effects and is easy to use in practice and it may obviate the need for haemodialysis in some, but not all, patients. Hence, fomepizole has largely replaced ethanol as the toxic alcohol antidote in many countries. Nevertheless, ethanol remains an important alternative because access to fomepizole can be limited, the cost may appear excessive, or the physician may prefer ethanol due to experience. © 2015 The British Pharmacological Society.
Ouk, Minae; Beach, Geoffrey S. D.
2017-12-01
A method is presented for directed transport of superparamagnetic microbeads (SPBs) on magnetic antidot patterned substrates by applying a rotating elliptical magnetic field. We find a critical frequency for transport, beyond which the bead dynamics transitions from stepwise locomotion to local oscillation. We also find that the out-of-plane (HOOP) and in-plane (HIP) field magnitudes play crucial roles in triggering bead motion. Namely, we find threshold values in HOOP and HIP that depend on bead size, which can be used to independently and remotely address specific bead populations in a multi-bead mixture. These behaviors are explained in terms of the dynamic potential energy lansdscapes computed from micromagnetic simulations of the substrate magnetization configuration. Finally, we show that large-area magnetic patterns suitable for particle transport and sorting can be fabricated through a self-assembly lithography technique, which provides a simple, cost-effective means to integrate magnetic actuation into microfluidic systems.
Nanometric MIL-125-NH₂ Metal-Organic Framework as a Potential Nerve Agent Antidote Carrier.
Vilela, Sérgio M F; Salcedo-Abraira, Pablo; Colinet, Isabelle; Salles, Fabrice; de Koning, Martijn C; Joosen, Marloes J A; Serre, Christian; Horcajada, Patricia
2017-10-12
The three-dimensional (3D) microporous titanium aminoterephthalate MIL-125-NH₂ (MIL: Material of Institut Lavoisier) was successfully isolated as monodispersed nanoparticles, which are compatible with intravenous administration, by using a simple, safe and low-cost synthetic approach (100 °C/32 h under atmospheric pressure) so that for the first time it could be considered for encapsulation and the release of drugs. The nerve agent antidote 2-[(hydroxyimino)methyl]-1-methyl-pyridinium chloride (2-PAM or pralidoxime) was effectively encapsulated into the pores of MIL-125-NH₂ as a result of the interactions between 2-PAM and the pore walls being mediated by π-stacking and hydrogen bonds, as deduced from infrared spectroscopy and Monte Carlo simulation studies. Finally, colloidal solutions of MIL-125-NH₂ nanoparticles exhibited remarkable stability in different organic media, aqueous solutions at different pH and under relevant physiological conditions over time (24 h). 2-PAM was rapidly released from the pores of MIL-125-NH₂ in vitro.
Rapid Complexation of Aptamers by Their Specific Antidotes
Directory of Open Access Journals (Sweden)
Heidi Stoll
2017-06-01
Full Text Available Nucleic acid ligands, aptamers, harbor the unique characteristics of small molecules and antibodies. The specificity and high affinity of aptamers enable their binding to different targets, such as small molecules, proteins, or cells. Chemical modifications of aptamers allow increased bioavailability. A further great benefit of aptamers is the antidote (AD-mediated controllability of their effect. In this study, the AD-mediated complexation and neutralization of the thrombin binding aptamer NU172 and Toll-like receptor 9 (TLR9 binding R10-60 aptamer were determined. Thereby, the required time for the generation of aptamer/AD-complexes was analyzed at 37 °C in human serum using gel electrophoresis. Afterwards, the blocking of aptamers’ effects was analyzed by determining the activated clotting time (ACT in the case of the NU172 aptamer, or the expression of immune activation related genes IFN-1β, IL-6, CXCL-10, and IL-1β in the case of the R10-60 aptamer. Gel electrophoresis analyses demonstrated the rapid complexation of the NU172 and R10-60 aptamers by complementary AD binding after just 2 min of incubation in human serum. A rapid neutralization of anticoagulant activity of NU172 was also demonstrated in fresh human whole blood 5 min after addition of AD. Furthermore, the TLR9-mediated activation of PMDC05 cells was interrupted after the addition of the R10-60 AD. Using these two different aptamers, the rapid antagonizability of the aptamers was demonstrated in different environments; whole blood containing numerous proteins, cells, and different small molecules, serum, or cell culture media. Thus, nucleic acid ADs are promising molecules, which offer several possibilities for different in vivo applications, such as antagonizing aptamer-based drugs, immobilization, or delivery of oligonucleotides to defined locations.
International Nuclear Information System (INIS)
Mallick, Sougata; Mallik, Srijani; Bedanta, Subhankar
2015-01-01
Microdimensional triangular magnetic antidot lattice arrays were prepared by varying the speed of substrate rotation. The pre-deposition patterning has been performed using photolithography technique followed by a post-deposition lift-off. Surface morphology taken by atomic force microscopy depicted that the growth mechanism of the grains changes from chain like formation to island structures due to the substrate rotation. Study of magnetization reversal via magneto optic Kerr effect based microscopy revealed reduction of uniaxial anisotropy and increase in domain size with substrate rotation. The relaxation measured under constant magnetic field becomes faster with rotation of the substrate during deposition. The nature of relaxation for the non-rotating sample can be described by a double exponential decay. However, the relaxation for the sample with substrate rotation is well described either by a double exponential or a Fatuzzo-Labrune like single exponential decay, which increases in applied field
Oxidative stress in organophosphate poisoning: role of standard antidotal therapy.
Vanova, Nela; Pejchal, Jaroslav; Herman, David; Dlabkova, Alzbeta; Jun, Daniel
2018-08-01
Despite the main mechanism of organophosphate (OP) toxicity through inhibition of acetylcholinesterase (AChE) being well known over the years, some chronic adverse health effects indicate the involvement of additional pathways. Oxidative stress is among the most intensively studied. Overstimulation of cholinergic and glutamatergic nervous system is followed by intensified generation of reactive species and oxidative damage in many tissues. In this review, the role of oxidative stress in pathophysiology of OP poisoning and the influence of commonly used medical interventions on its levels are discussed. Current standardized therapy of OP intoxications comprises live-saving administration of the anticholinergic drug atropine accompanied by oxime AChE reactivator and diazepam. The capability of these antidotes to ameliorate OP-induced oxidative stress varies between both therapeutic groups and individual medications within the drug class. Regarding oxidative stress, atropine does not seem to have a significant effect on oxidative stress parameters in OP poisoning. In a case of AChE reactivators, pro-oxidative and antioxidative properties could be found. It is assumed that the ability of oximes to trigger oxidative stress is rather associated with their chemical structure than reactivation efficacy. The data indicating the potency of diazepam in preventing OP-induced oxidative stress are not available. Based on current knowledge on the mechanism of OP-mediated oxidative stress, alternative approaches (including antioxidants or multifunctional drugs) in therapy of OP poisoning are under consideration. Copyright © 2018 John Wiley & Sons, Ltd.
Memory load as a cognitive antidote to performance decrements in data entry.
Chapman, Mary J; Healy, Alice F; Kole, James A
2016-10-01
In two experiments, subjects trained in data entry, typing one 4-digit number at a time. At training, subjects either typed the numbers immediately after they appeared (immediate) or typed the previous number from memory while viewing the next number (delayed). In Experiment 2 stimulus presentation time was limited and either nothing or a space (gap) was inserted between the second and third digits. In both experiments after training, all subjects completed a test with no gap and typed numbers immediately. Training with a memory load improved speed across training blocks (Experiment 1) and eliminated the decline in accuracy across training blocks (Experiment 2), thus serving as a cognitive antidote to performance decrements. An analysis of each keystroke revealed different underlying processes and strategies for the two training conditions, including when encoding took place. Chunking (in which the first and last two digits are treated separately) was more evident in the immediate than in the delayed condition and was exaggerated with a gap, even at test when there was no gap. These results suggest that such two-digit chunking is due to stimulus encoding and motor planning processes as well as memory, and those processes transferred from training to testing.
Nanometric MIL-125-NH2 Metal–Organic Framework as a Potential Nerve Agent Antidote Carrier
Directory of Open Access Journals (Sweden)
Sérgio M. F. Vilela
2017-10-01
Full Text Available The three-dimensional (3D microporous titanium aminoterephthalate MIL-125-NH2 (MIL: Material of Institut Lavoisier was successfully isolated as monodispersed nanoparticles, which are compatible with intravenous administration, by using a simple, safe and low-cost synthetic approach (100 °C/32 h under atmospheric pressure so that for the first time it could be considered for encapsulation and the release of drugs. The nerve agent antidote 2-[(hydroxyiminomethyl]-1-methyl-pyridinium chloride (2-PAM or pralidoxime was effectively encapsulated into the pores of MIL-125-NH2 as a result of the interactions between 2-PAM and the pore walls being mediated by π-stacking and hydrogen bonds, as deduced from infrared spectroscopy and Monte Carlo simulation studies. Finally, colloidal solutions of MIL-125-NH2 nanoparticles exhibited remarkable stability in different organic media, aqueous solutions at different pH and under relevant physiological conditions over time (24 h. 2-PAM was rapidly released from the pores of MIL-125-NH2 in vitro.
Directory of Open Access Journals (Sweden)
Dawson Andrew H
2010-06-01
Full Text Available Abstract Background Cardiac toxicity due to ingestion of oleander plant seeds in Sri Lanka and some other South Asian countries is very common. At present symptomatic oleander seed poisoning carries a mortality of 10% in Sri Lanka and treatment of yellow oleander poisoning is limited to gastric decontamination and atropine administration. The only proven effective antidote is digoxin antibodies but these are not available for routine use because of the high cost. The main objective of this study is to investigate the effectiveness of a new and inexpensive antidote for patients with life threatening arrhythmias due oleander poisoning. Method/design We set up a randomised double blind clinical trial to assess the effectiveness of Fructose 1, 6 diphosphate (FDP in acute yellow oleander poisoning patients admitted to the adult medical wards of a tertiary hospital in Sri Lanka. Patients will be initially resuscitated following the national guidelines and eligible patients will be randomised to receive either FDP or an equal amount of normal saline. The primary outcome measure for this study is the sustained reversion to sinus rhythm with a heart rate greater than 50/min within 2 hours of completion of FDP/placebo bolus. Secondary outcomes include death, reversal of hyperkalaemia on the 6, 12, 18 and 24 hour samples and maintenance of sinus rhythm on the holter monitor. Analysis will be on intention-to-treat. Discussion This trial will provide information on the effectiveness of FDP in yellow oleander poisoning. If FDP is effective in cardiac glycoside toxicity, it would provide substantial benefit to the patients in rural Asia. The drug is inexpensive and thus could be made available at primary care hospitals if proven to be effective. Trial Registration Current Controlled trial ISRCTN71018309
Energy Technology Data Exchange (ETDEWEB)
Fang, H.; Akinoglu, E. M.; Fumagalli, P., E-mail: paul.fumagalli@fu-berlin.de [Institut für Experimentalphysik, Freie Universität Berlin, 14195 Berlin (Germany); Caballero, B.; García-Martín, A. [IMM-Instituto de Microelectrónica de Madrid (CNM-CSIC), Isaac Newton 8, PTM, Tres Cantos, E-28760 Madrid (Spain); Papaioannou, E. Th. [Fachbereich Physik and Landesforschungszentrum OPTIMAS, Technische Universität Kaiserslautern, 67663 Kaiserslautern (Germany); Cuevas, J. C. [Departamento de Física Teórica de la Materia Condensada and Condensed Matter Physics Center (IFIMAC), Universidad Autónoma de Madrid, E-28049 Madrid (Spain); Giersig, M. [Institut für Experimentalphysik, Freie Universität Berlin, 14195 Berlin (Germany); Helmholtz Zentrum Berlin, Institute of Nanoarchitectures for Energy Conversion, 14195 Berlin (Germany)
2015-04-13
A combined experimental and theoretical study of the magneto-optic properties of a series of nickel antidot thin films is presented. The hole diameter varies from 869 down to 636 nm, while the lattice periodicity is fixed at 920 nm. This results in an overall increase of the polar Kerr rotation with decreasing hole diameter due to the increasing surface coverage with nickel. In addition, at photon energies of 2.7 and 3.3 eV, where surface-plasmon excitations are expected, we observe distinct features in the polar Kerr rotation not present in continuous nickel films. The spectral position of the peaks exhibits a red shift with decreasing hole size. This is explained within the context of an effective medium theory by a change in the effective dielectric function of the Ni thin films.
International Nuclear Information System (INIS)
Buts, Lieven; De Jonge, Natalie; Loris, Remy; Wyns, Lode; Dao-Thi, Minh-Hoa
2005-01-01
The CcdA C-terminal domain was crystallized in complex with CcdB in two crystal forms that diffract to beyond 2.0 Å resolution. CcdA and CcdB are the antidote and toxin of the ccd addiction module of Escherichia coli plasmid F. The CcdA C-terminal domain (CcdA C36 ; 36 amino acids) was crystallized in complex with CcdB (dimer of 2 × 101 amino acids) in three different crystal forms, two of which diffract to high resolution. Form II belongs to space group P2 1 2 1 2 1 , with unit-cell parameters a = 37.6, b = 60.5, c = 83.8 Å and diffracts to 1.8 Å resolution. Form III belongs to space group P2 1 , with unit-cell parameters a = 41.0, b = 37.9, c = 69.6 Å, β = 96.9°, and diffracts to 1.9 Å resolution
Xue, C.; Ge, J.-Y.; He, A.; Zharinov, V. S.; Moshchalkov, V. V.; Zhou, Y. H.; Silhanek, A. V.; Van de Vondel, J.
2018-04-01
Theoretical proposals for spin-ice analogs based on nanostructured superconductors have suggested larger flexibility for probing the effects of fluctuations and disorder than in the magnetic systems. In this paper, we unveil the particularities of a vortex ice system by direct observation of the vortex distribution in a kagome lattice of paired antidots using scanning Hall probe microscopy. The theoretically suggested vortex ice distribution, lacking long-range order, is observed at half matching field (H1/2 ). Moreover, the vortex ice state formed by the pinned vortices is still preserved at 2 H1/3 . This unexpected result is attributed to the introduction of interstitial vortices at these magnetic-field values. Although the interstitial vortices increase the number of possible vortex configurations, it is clearly shown that the vortex ice state observed at 2 H1/3 is less prone to defects than at H1/2 . In addition, the nonmonotonic variations of the vortex ice quality on the lattice spacing indicates that a highly ordered vortex ice state cannot be attained by simply reducing the lattice spacing. The optimal design to observe defect-free vortex ice is discussed based on the experimental statistics. The direct observations of a tunable vortex ice state provides new opportunities to explore the order-disorder transition in artificial ice systems.
Cao, B J; Chen, Z K; Chi, Z Q
1990-03-01
Sodium dimercaptopropanesulphonate (DMPS) and sodium dimercaptosuccinate (DMS) were discovered to be effective antidotes for acute poisoning of insecticides SCD [sodium ammonium dimethyl-2-(propane-1,3-dithiosulfate) monohydrate], nereistoxin (4-N,N-dimethylamino-1,2-dithiolane) and cartap (dihydronereistoxin dicarbamate). In mice, DMPS (250 mg/kg) or DMS (1000 mg/kg) ip 20 min before SCD increased LD50 of ig SCD from 97 to 374 or 251 mg/kg, respectively. The prophylactic effect of DMPS was better than that of DMS. Administration of DMPS prior to cartap increased LD50 of ig cartap from 130 to 375 mg/kg. The therapeutic effect of DMPS was also demonstrated in SCD-poisoned conscious rabbits. DMPS 62.5 mg/kg or DMS 500 mg/kg iv completely antagonized the neuromuscular blockade and respiratory depression caused by SCD, nereistoxin and cartap in anesthetized rabbits. The antagonism of SCD-induced neuromuscular blockade by cysteine (400 mg/kg, iv) was less effective and of shorter duration than that by DMPS and DMS. Dimercaprol 50 mg/kg im showed little effect on SCD-induced paralysis. The antagonistic actions of sulfhydryl compounds on neuromuscular blockade induced by these insecticides probably belong to chemical antagonism.
John, Harald; Blum, Marc-Michael
2012-01-01
Pralidoxime (2-PAM) belongs to the class of monopyridinium oximes with reactivating potency on cholinesterases inhibited by phosphylating organophosphorus compounds (OPC), for example, pesticides and nerve agents. 2-PAM represents an established antidote for the therapy of anticholinesterase poisoning since the late 1950s. Quite high therapeutic concentrations in human plasma (about 13 µg/ml) lead to concentrations in urine being about 100 times higher allowing the use of less sensitive analytical techniques that were used especially in the early years after 2-PAM was introduced. In this time (mid-1950s until the end of the 1970s) 2-PAM was most often analyzed by either paper chromatography or simple UV spectroscopic techniques omitting any sample separation step. These methods were displaced completely after the establishment of column liquid chromatography in the early 1980s. Since then, diverse techniques including cation exchange, size-exclusion, reversed-phase, and ligand-exchange chromatography have been introduced. Today, the most popular method for 2-PAM quantification is ion pair chromatography often combined with UV detection representing more than 50% of all column chromatographic procedures published. Furthermore, electrophoretic approaches by paper and capillary zone electrophoresis have been successfully used but are seldom applied. This review provides a commentary and exhaustive summary of analytical techniques applied to detect 2-PAM in pharmaceutical formulations and biological samples to characterize stability and pharmacokinetics as well as decomposition and biotransformation products. Separation techniques as well as diverse detectors are discussed in appropriate detail allowing comparison of individual preferences and limitations. In addition, novel data on mass spectrometric fragmentation of 2-PAM are provided. Copyright © 2011 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Chidi Uzoma Igwe
2016-11-01
Full Text Available Objective: To investigate the effects of coconut water intake on lipid profile and atherogenic predictor indices of albino rabbits overdosed with paracetamol using standard methods. Methods: Thirty-five albino rabbits weighing between 800–1200 g and aged between 2 and 3 months, were divided into 7 groups (I–VII of 5 animals each. Groups I, II and III were orally administered distilled water (20 mL/kg body weight, coconut water (20 mL/kg body weight and paracetamol (1000 mg/kg body weight respectively, for 7 days. Groups IV and V were administered coconut water (20 mL/kg body weight and silymarin (35 mg/kg body weight, respectively, for 6 days, then paracetamol (1000 mg/kg body weight on the 7th day. Groups VI and VII were administered distilled water for 6 days, paracetamol on the 7th day, then coconut water and silymarin, respectively, after 3 h. Results: The results showed that paracetamol overdose significantly reduced (P < 0.05 the mean body weight of the animals, increased the concentrations of serum total cholesterol, triacylglycerol, very low density lipoprotein cholesterol, low density lipoprotein cholesterol and the atherogenic predictor indices but reduced the serum high density lipoprotein cholesterol concentration of the animals relative to the control. The observed changes in the lipid profile and atherogenic predictor indices were countered more by post- than pre-treatment with coconut water and silymarin. Conclusions: The results indicated that coconut water acted as an effective antidote to paracetamol overdose-induced lipid abnormality in animals.
Robust band gap and half-metallicity in graphene with triangular perforations
DEFF Research Database (Denmark)
Gregersen, Søren Schou; Power, Stephen; Jauho, Antti-Pekka
2016-01-01
Ideal graphene antidot lattices are predicted to show promising band gap behavior (i.e., EG ≅ 500 meV) under carefully specified conditions. However, for the structures studied so far this behavior is critically dependent on superlattice geometry and is not robust against experimentally realistic...... disorders. Here we study a rectangular array of triangular antidots with zigzag edge geometries and show that their band gap behavior qualitatively differs from the standard behavior which is exhibited, e.g., by rectangular arrays of armchair-edged triangles. In the spin unpolarized case, zigzag......-edged antidots give rise to large band gaps compared to armchair-edged antidots, irrespective of the rules which govern the existence of gaps in armchair-edged antidot lattices. In addition the zigzag-edged antidots appear more robust than armchair-edged antidots in the presence of geometrical disorder...
Munro, N B; Watson, A P; Ambrose, K R; Griffin, G D
1990-01-01
Current treatment protocols for exposure to nerve and vesicant agents found in the U.S. stockpile of unitary chemical weapons are summarized, and the toxicities of available antidotes are evaluated. The status of the most promising of the new nerve agent antidotes is reviewed. In the U.S. atropine and pralidoxime compose the only approved antidote regimen for organophosphate nerve agent poisoning. Diazepam may also be used if necessary to control convulsions. To avoid death, administration must occur within minutes of substantial exposure together with immediate decontamination. Continuous observation and repeated administration of antidotes are necessary as symptoms warrant. Available antidotes do not necessarily prevent respiratory failure or incapacitation. The toxicity of the antidotes themselves and the individualized nature of medical care preclude recommending that autoinjectors be distributed to the general public. In addition, precautionary administration of protective drugs to the general population would not be feasible or desirable. No antidote exists for poisoning by the vesicant sulfur mustard (H, HD, HT); effective intervention can only be accomplished by rapid decontamination followed by palliative treatment of symptoms. British anti-Lewisite (BAL) (2,3-dimercapto-1-propanolol) is the antidote of choice for treatment of exposure to Lewisite, another potent vesicant. Experimental water-soluble BAL analogues have been developed that are less toxic than BAL. Treatment protocols for each antidote are summarized in tabular form for use by health care providers. PMID:2088748
Robust band gap and half-metallicity in graphene with triangular perforations
Gregersen, Søren Schou; Power, Stephen R.; Jauho, Antti-Pekka
2016-06-01
Ideal graphene antidot lattices are predicted to show promising band gap behavior (i.e., EG≃500 meV) under carefully specified conditions. However, for the structures studied so far this behavior is critically dependent on superlattice geometry and is not robust against experimentally realistic disorders. Here we study a rectangular array of triangular antidots with zigzag edge geometries and show that their band gap behavior qualitatively differs from the standard behavior which is exhibited, e.g., by rectangular arrays of armchair-edged triangles. In the spin unpolarized case, zigzag-edged antidots give rise to large band gaps compared to armchair-edged antidots, irrespective of the rules which govern the existence of gaps in armchair-edged antidot lattices. In addition the zigzag-edged antidots appear more robust than armchair-edged antidots in the presence of geometrical disorder. The inclusion of spin polarization within a mean-field Hubbard approach gives rise to a large overall magnetic moment at each antidot due to the sublattice imbalance imposed by the triangular geometry. Half-metallic behavior arises from the formation of spin-split dispersive states near the Fermi energy, reducing the band gaps compared to the unpolarized case. This behavior is also found to be robust in the presence of disorder. Our results highlight the possibilities of using triangular perforations in graphene to open electronic band gaps in systems with experimentally realistic levels of disorder, and furthermore, of exploiting the strong spin dependence of the system for spintronic applications.
Cambal, Leah K.; Swanson, Megan R.; Yuan, Quan; Weitz, Andrew C.; Li, Hui-Hua; Pitt, Bruce R.; Pearce, Linda L.; Peterson, Jim
2011-01-01
Sodium nitrite alone is shown to ameliorate sub-lethal cyanide toxicity in mice when given from ~1 hour before until 20 minutes after the toxic dose as demonstrated by the recovery of righting ability. An optimum dose (12 mg/kg) was determined to significantly relieve cyanide toxicity (5.0 mg/kg) when administered to mice intraperitoneally. Nitrite so administered was shown to rapidly produce NO in the bloodsteam as judged by the dose dependent appearance of EPR signals attributable to nitrosylhemoglobin and methemoglobin. It is argued that antagonism of cyanide inhibition of cytochrome c oxidase by NO is the crucial antidotal activity rather than the methemoglobin-forming action of nitrite. Concomitant addition of sodium thiosulfate to nitrite-treated blood resulted in the detection of sulfidomethemoblobin by EPR spectroscopy. Sulfide is a product of thiosulfate hydrolysis and, like cyanide, is known to be a potent inhibitor of cytochrome c oxidase; the effects of the two inhibitors being essentially additive under standard assay conditions, rather than dominated by either one. The findings afford a plausible explanation for an observed detrimental effect in mice associated with the use of the standard nitrite-thiosulfate combination therapy at sub-lethal levels of cyanide intoxication. PMID:21534623
International Nuclear Information System (INIS)
Kalantari, H.; Siahapoosh, A.; Farsani, K. M.
2009-01-01
The organophosphates (ORPs) or war fare agents toxicity results from inhibition of acetylcholinesterase (AchE). phosphylation of the active serin of AchE leads to accumulation of acetylcholine in synaptic clefts leading to generalized cholinergic over-stimulation. Standard treatment of ORP poisoning includes a muscarinic antagonist such as Atropine, and acetylcholinesterase reactivator (oxime). Presently, oximes like abidoxime and pralidoxime are approved as antidotes against ORP poisoning but are considered to be rather ineffective against certain ORP. Like Soman. In this study, the protective effect of Varthemia persica DC extract on acetylcholinesterase was examined in rats. Animals in weight range of 200-225 g were divided in 8 groups. The negative control group received only 0.4 ml normal saline, reference group, received ethylparaoxone in dose of 50 percent of LD50, positive control group, received ethylparaoxone (50% LD50) and one minute later 50 mol of pralidoxime. Test group 1: received ethylparaoxone and one minute later single dose of methanolic extract of Varthemia persica (250 mg/kg), Test Group 2: daily received methanolic extract of V.persica (250 mg/kg) in six days and one minute after last dose of extract, ethylparaoxone (50% LD50) were injected, Test Group 3: received ethylparaoxone (50% LD50) and then six doses of methanolic extract of V.persica (250 mg/kg) in six continuous days. Test Group 4: received ethylparaoxone and then single dose of dichloromethane extract of V.persica (250 mg/kg). Test Group 5: received ethylparaoxone and one minute later single high dose of methanolic extract of V.persica (1000 mg/kg). Then blood withdrawn and acetylcholinesterase activity was measured according to modified Ellman's method. Only in groups which received extract of V. persica before and after injection of ethylparaoxone, the mean of acetylcholinesterase activity was significantly different with reference group (p 0.05) but no significant difference with
Directory of Open Access Journals (Sweden)
Patricia Saravia-Otten
2015-07-01
Full Text Available Many plants are reported to be used in Guatemalan traditional medicine as antidotes against various effects of the snakebite; however, very few attempts have been made to evaluate their neutralizing capacity in controlled experiments. Six plants (Acacia hindsii, Cissampelos pareira; Hamelia patens, Piper peltatum, Sansevieria hyacinthoides and Aristolochia maxima were evaluated in vitro for their ability to neutralize phospholipase A2(PLA2 and proteolytic effects of the venom of Bothrops asper, the snake responsible for approximately half of the snakebite envenomations in Central America. These effects are indicatives of the ability of B. asper venom to produce myotoxicity, hemorrhage and inflammation. Plants were collected, dried and extracted by maceration with ethanol. After pre-incubation of several amounts of each extract with a challenge dose of venom, S. hyacinthoides demonstrated a low neutralizing capacity (< DE 50 of the PLA2 effect (13.90 ± 6.41%; C. pareira (32.98 ± 5.51% and P. peltatum (24.52 ± 7.45% neutralized less than 50% of the proteolytic effect. The results suggest that neither of the tested plants should be used individually to treat the main effects of B. asper envenomation. However, the three low-active extracts might be potentiated when used in mixtures composed of several plants, as prepared by traditional healers. Given the complexity of the venom components and the multiple pathologic effects produced by B. asper envenomation, more tests are required to fully investigate the ability of this plants to neutralize the coagulant, fibrin(ogenolytic, edematizing and myotoxic effects of the venom.
Meillier, Andrew; Heller, Cara
2015-01-01
Cyanide is rapidly reacting and causes arrest of aerobic metabolism. The symptoms are diffuse and lethal and require high clinical suspicion. Remediation of symptoms and mortality is highly dependent on quick treatment with a cyanide antidote. Presently, there are two widely accepted antidotes: sodium thiosulfate and hydroxocobalamin. These treatments act on different components of cyanide's metabolism. Here, we present two cases resulting from the same source of cyanide poisoning and the use of both antidotes separately used with differing outcomes.
Directory of Open Access Journals (Sweden)
Andrew Meillier
2015-01-01
Full Text Available Cyanide is rapidly reacting and causes arrest of aerobic metabolism. The symptoms are diffuse and lethal and require high clinical suspicion. Remediation of symptoms and mortality is highly dependent on quick treatment with a cyanide antidote. Presently, there are two widely accepted antidotes: sodium thiosulfate and hydroxocobalamin. These treatments act on different components of cyanide’s metabolism. Here, we present two cases resulting from the same source of cyanide poisoning and the use of both antidotes separately used with differing outcomes.
Zyoud, Sa'ed H; Al-Jabi, Samah W; Bali, Yara I; Al-Sayed, Afnan M; Sweileh, Waleed M; Awang, Rahmat
2014-02-21
Poisoning exposures continue to be a significant cause of morbidity and mortality worldwide. The lack of facilities, treatment resources, and antidotes in hospitals may affect the treatments provided and outcomes. This study aimed to determine the availability of gastrointestinal (GI) decontamination, stabilisation, elimination enhancement resources, and antidotes for the management of acute toxic exposures and poisonings in emergency departments (EDs) among various types of governmental and private hospitals in Palestine. A cross-sectional study using semi-structured questionnaire was performed. Data were collected based on hospital resources; GI decontamination, stabilisation, elimination enhancement resources and antidotes from Palestinian hospitals. Eighteen hospitals (94.7%) have responded. Among them, paracetamol poisoning was the most frequently reported cases by EDs (mean frequency score = 7.6 ± 2.1), followed by bee stings (mean = 6.9 ± 2.7) and organophosphate poisoning (mean = 6.7 ± 2.7). The availabilities of most resources related to GI decontamination items varied substantially with hospital type, but these differences were not statistical significant. The availability of stabilisation resources was not significantly different between hospitals types. For the availability of techniques used to enhance the elimination of toxic substances, there were variations between the hospitals types. However, these differences were not statistical significant, except for haemodialysis (p = 0.003) which was more available in governmental hospitals. For the availability of antidotes, none of the hospitals had sufficient stock of all antidotes listed. In relation to hospital type, there was variability in the availability of antidotes, but this did not reach statistical significance, except for deferoxamine (p management of acute toxic exposure and poisoning. The implementation of a minimum list of antidotes and treatment resources would be useful to increase the
Directory of Open Access Journals (Sweden)
Yusuke Kato
2015-09-01
Full Text Available Biological containment is a genetic technique that programs dangerous organisms to grow only in the laboratory and to die in the natural environment. Auxotrophy for a substance not found in the natural environment is an ideal biological containment. Here, we constructed an Escherichia coli strain that cannot survive in the absence of the unnatural amino acid 3-iodo-L-tyrosine. This synthetic auxotrophy was achieved by conditional production of the antidote protein against the highly toxic enzyme colicin E3. An amber stop codon was inserted in the antidote gene. The translation of the antidote mRNA was controlled by a translational switch using amber-specific 3-iodo-L-tyrosine incorporation. The antidote is synthesized only when 3-iodo-L-tyrosine is present in the culture medium. The viability of this strain rapidly decreased with less than a 1 h half-life after removal of 3-iodo-L-tyrosine, suggesting that the decay of the antidote causes the host killing by activated colicin E3 in the absence of this unnatural amino acid. The contained strain grew 1.5 times more slowly than the parent strains. The escaper frequency was estimated to be 1.4 mutations (95% highest posterior density 1.1–1.8 per 105 cell divisions. This containment system can be constructed by only plasmid introduction without genome editing, suggesting that this system may be applicable to other microbes carrying toxin-antidote systems similar to that of colicin E3.
Khan, Md Abdul Shafeeuulla; Lo, Rabindranath; Bandyopadhyay, Tusar; Ganguly, Bishwajit
2011-08-01
Inactivation of acetylcholinesterase (AChE) due to inhibition by organophosphorus (OP) compounds is a major threat to human since AChE is a key enzyme in neurotransmission process. Oximes are used as potential reactivators of OP-inhibited AChE due to their α-effect nucleophilic reactivity. In search of more effective reactivating agents, model studies have shown that α-effect is not so important for dephosphylation reactions. We report the importance of α-effect of nucleophilic reactivity towards the reactivation of OP-inhibited AChE with hydroxylamine anion. We have demonstrated with DFT [B3LYP/6-311G(d,p)] calculations that the reactivation process of sarin-serine adduct 2 with hydroxylamine anion is more efficient than the other nucleophiles reported. The superiority of hydroxylamine anion to reactivate the sarin-inhibited AChE with sarin-serine adducts 3 and 4 compared to formoximate anion was observed in the presence and absence of hydrogen bonding interactions of Gly121 and Gly122. The calculated results show that the rates of reactivation process of adduct 4 with hydroxylamine anion are 261 and 223 times faster than the formoximate anion in the absence and presence of such hydrogen bonding interactions. The DFT calculated results shed light on the importance of the adjacent carbonyl group of Glu202 for the reactivation of sarin-serine adduct, in particular with formoximate anion. The reverse reactivation reaction between hydroxylamine anion and sarin-serine adduct was found to be higher in energy compared to the other nucleophiles, which suggests that this α-nucleophile can be a good antidote agent for the reactivation process. Copyright © 2011 Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Lawson-Smith, P; Olsen, Niels Vidiendal; Hyldegaard, O
2011-01-01
Cyanide (CN) intoxication inhibits cellular oxidative metabolism and may result in brain damage. Hydroxycobalamin (OHCob) is one among other antidotes that may be used following intoxication with CN. Hyperbaric oxygen (HBO2) is recommended when supportive measures or antidotes fail. However...
Universal, class-specific and drug-specific reversal agents for the new oral anticoagulants.
Ansell, Jack E
2016-02-01
Although there is controversy about the absolute need for a reversal agent for the new direct oral anticoagulants (DOACs), the absence of such an agent is a barrier to more widespread use of these agents. For the management of major life-threatening bleeding with the DOACs, most authorities recommend the use of four factor prothrombin complex concentrates, although the evidence to support their use in terms of improving outcomes is meager. At the present time, there are three antidotes in development and poised to enter the market. Idarucizumab is a drug-specific antidote targeted to reverse the direct thrombin inhibitor, dabigatran. Andexanet alfa is a class-specific antidote targeted to reverse the oral direct factor Xa inhibitors as well as the indirect inhibitor, enoxaparin. Ciraparantag is a universal antidote targeted to reverse the direct thrombin and factor Xa inhibitors as well as the indirect inhibitor, enoxaparin.
Petrikovics, Ilona; Budai, Marianna; Kovacs, Kristof; Thompson, David E
2015-06-26
This paper reviews milestones in antidotal therapies for cyanide (CN) spanning early remedies, current antidotal systems and research towards next generation therapies. CN has been a part of plant defense mechanisms for millions of years. It became industrially important in the nineteenth century with the advent of CN assisted gold mining and the use of CN as a pest control agent. The biochemical basis of CN poisoning was actively studied and key mechanisms were understood as early as 1929. These fundamental studies led to a variety of antidotes, including indirect CN binders that generate methemoglobin, direct CN binders such as hydroxocobalamin, and sulfur donors that convert CN to the less toxic thiocyanate. Research on blood gases at the end of the twentieth century shed new light on the role of nitric oxide (NO) in the body. The discovery of NO's ability to compete with CN for enzymatic binding sites provided a previously missed explanation for the rapid efficacy of NO generating antidotes such as the nitrites. Presently used CN therapies include: methemoglobin/NO generators (e.g., sodium nitrite, amyl nitrite, and dimethyl aminophenol), sulfur donors (e.g., sodium thiosulfate and glutathione), and direct binding agents [(e.g., hydroxocobalamin and dicobalt salt of ethylenediaminetetraacetic acid (dicobalt edetate)]. A strong effort is being made to explore novel antidotal systems and to formulate them for rapid administration at the point of intoxication in mass casualty scenarios. New antidotes, formulations, and delivery systems are enhancing bioavailability and efficacy and hold promise for a new generation of improved CN countermeasures.
Quantum information processing using designed defect states in
DEFF Research Database (Denmark)
Pedersen, Jesper; Flindt, Christian; Mortensen, Niels Asger
2007-01-01
We propose a new physical implementation of spin qubits for quantum information processing, namely defect states in antidot lattices de¯ned in the two-dimensional electron gas at a semiconductor heterostructure. Calculations of the band structure of the periodic antidot lattice are presented...
Directory of Open Access Journals (Sweden)
F. Valdés-Bango
2017-05-01
Full Text Available Hexagonal antidot arrays have been patterned on weak perpendicular magnetic anisotropy NdCo films by e-beam lithography and lift off. Domain structure has been characterized by Magnetic Force Microscopy at remanence. On a local length scale, of the order of stripe pattern period, domain configuration is controlled by edge effects within the stripe pattern: stripe domains meet the hole boundary at either perpendicular or parallel orientation. On a longer length scale, in-plane magnetostatic effects dominate the system: clear superdomains are observed in the patterned film with average in-plane magnetization along the easy directions of the antidot array, correlated over several antidot array cells.
Valdés-Bango, F.; Vélez, M.; Alvarez-Prado, L. M.; Alameda, J. M.; Martín, J. I.
2017-05-01
Hexagonal antidot arrays have been patterned on weak perpendicular magnetic anisotropy NdCo films by e-beam lithography and lift off. Domain structure has been characterized by Magnetic Force Microscopy at remanence. On a local length scale, of the order of stripe pattern period, domain configuration is controlled by edge effects within the stripe pattern: stripe domains meet the hole boundary at either perpendicular or parallel orientation. On a longer length scale, in-plane magnetostatic effects dominate the system: clear superdomains are observed in the patterned film with average in-plane magnetization along the easy directions of the antidot array, correlated over several antidot array cells.
Interventions for paracetamol (acetaminophen) overdoses. Protocol for a Cochrane Review
DEFF Research Database (Denmark)
Brok, J; Buckley, N; Gluud, C
2001-01-01
Poisoning with paracetamol (acetaminophen) is a common cause of hepatotoxicity in the Western World. Inhibition of absorption, removal from the vascular system, antidotes, and liver transplantation are interventions for paracetamol poisoning.......Poisoning with paracetamol (acetaminophen) is a common cause of hepatotoxicity in the Western World. Inhibition of absorption, removal from the vascular system, antidotes, and liver transplantation are interventions for paracetamol poisoning....
Czech Academy of Sciences Publication Activity Database
Strnad, Martin; Hönig, Václav; Růžek, Daniel; Grubhoffer, Libor; Rego, Ryan O. M.
2017-01-01
Roč. 83, č. 15 (2017), č. článku e00609-17. ISSN 0099-2240 EU Projects: European Commission(XE) 278976 - ANTIGONE; European Commission(XE) 602272 - ANTIDotE Institutional support: RVO:60077344 Keywords : Borrelia burgdorferi sensu lato * tick * Ixodes ricinus * genospecies * meta-analysis * Lyme borreliosis * Lyme disease Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.807, year: 2016
Directory of Open Access Journals (Sweden)
Ilona Petrikovics
2011-01-01
Full Text Available Present studies have focused on a novel cyanide antidotal system, on the coencapsulation of a new sulfur donor DTO with rhodanese within sterically stabilized liposomes. The optimal lipid composition for coencapsulation of DTO with rhodanese is the combination of 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine, cholesterol, cationic lipid (DOTAP, and 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol-2000] ammonium salt (with molar ratios of 82.7 : 9.2 : 3.0 : 5.1. With the optimized compositions, prophylactic and therapeutic in vivo efficacy studies were carried out in a mice model. When DTO was coencapsulated with rhodanese and thiosulfate the prophylactic antidotal protection was 4.9×LD50. Maximum antidotal protection against cyanide intoxication (15×LD50 was achieved with coencapsulated rhodanese and DTO/thiosulfate in combination with sodium nitrite. When applied therapeutically, 100% survival rate (6/6 was achieved at 20 mg/kg cyanide doses with the encapsulated DTO-rhodanese-thiosulfate antidotal systems with and without sodium nitrite. These data are indicating that the appropriately formulated DTO is a promising sulfur donor for cyanide antagonism.
Pharmacological treatment of organophosphorus insecticide poisoning: the old and the (possible) new.
Eddleston, Michael; Chowdhury, Fazle Rabbi
2016-03-01
Despite being a major clinical and public health problem across the developing world, responsible for at least 5 million deaths over the last three decades, the clinical care of patients with organophosphorus (OP) insecticide poisoning has little improved over the last six decades. We are still using the same two antidotes - atropine and oximes - that first came into clinical use in the late 1950s. Clinical research in South Asia has shown how improved regimens of atropine can prevent deaths. However, we are still unsure about which patients are most likely to benefit from the use of oximes. Supplemental antidotes, such as magnesium, clonidine and sodium bicarbonate, have all been proposed and studied in small trials without production of definitive answers. Novel antidotes such as nicotinic receptor antagonists, beta-adrenergic agonists and lipid emulsions are being studied in large animal models and in pilot clinical trials. Hopefully, one or more of these affordable and already licensed antidotes will find their place in routine clinical care. However, the large number of chemically diverse OP insecticides, the varied poisoning they produce and their varied response to treatment might ultimately make it difficult to determine definitively whether these antidotes are truly effective. In addition, the toxicity of the varied solvents and surfactants formulated with the OP active ingredients complicates both treatment and studies. It is possible that the only effective way to reduce deaths from OP insecticide poisoning will be a steady reduction in their agricultural use worldwide. © 2015 The British Pharmacological Society.
Interventions for paracetamol (acetaminophen) overdoses
DEFF Research Database (Denmark)
Brok, J; Buckley, N; Gluud, C
2002-01-01
Self-poisoning with paracetamol (acetaminophen) is a common cause of hepatotoxicity in the Western World. Interventions for paracetamol poisoning encompass inhibition of absorption, removal from the vascular system, antidotes, and liver transplantation.......Self-poisoning with paracetamol (acetaminophen) is a common cause of hepatotoxicity in the Western World. Interventions for paracetamol poisoning encompass inhibition of absorption, removal from the vascular system, antidotes, and liver transplantation....
Zyoud, Sa’ed H; Al-Jabi, Samah W; Bali, Yara I; Al-Sayed, Afnan M; Sweileh, Waleed M; Awang, Rahmat
2014-01-01
Background Poisoning exposures continue to be a significant cause of morbidity and mortality worldwide. The lack of facilities, treatment resources, and antidotes in hospitals may affect the treatments provided and outcomes. This study aimed to determine the availability of gastrointestinal (GI) decontamination, stabilisation, elimination enhancement resources, and antidotes for the management of acute toxic exposures and poisonings in emergency departments (EDs) among various types of govern...
ANTIDotE: anti-tick vaccines to prevent tick-borne diseases in Europe
Czech Academy of Sciences Publication Activity Database
Sprong, H.; Trentelman, J.; Seemann, I.; Grubhoffer, Libor; Rego, Ryan O. M.; Hajdušek, Ondřej; Kopáček, Petr; Šíma, Radek; Nijhof, A.M.; Anguita, J.; Winter, P.; Rotter, B.; Havlíková, S.; Klempa, B.; Schetters, T.P.; Hovius, J.W.R.
2014-01-01
Roč. 7, FEB 2014 (2014), s. 77 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Ixodes ricinus * vaccine * Lyme borreliosis * tick-borne encephalitis * babesiosis * public health Subject RIV: EC - Immunology Impact factor: 3.430, year: 2014
Goldberg, Rose Carmen
2016-01-01
This Note is an examination of mentally ill inmates' constitutional right to treatment. It has significant doctrinal and practical implications. In terms of doctrine, the Supreme Court has created distinct standards for the minimum levels of care for inmates (Estelle) and the civilly committed mentally ill (Youngberg). Under this framework mentally ill inmates are constitutionally equivalent to inmates generally, but are entitled to less care than the civilly committed even if they suffer the same illness. This Note explores this gap through the lens of equal protection and argues that mentally ill inmates are similarly situated to the civilly committed. It further contends that inmates constitute a "discrete and insular minority" and thus the standard establishing their right to care should be subject to strict scrutiny. This Note finds that Estelle fails this test. Practically, this Note brings visibility to a consequential area of the law neglected by scholarship. Over half of inmates are mentally ill and yet treatment in prisons is inadequate. The literature at the intersection of health, criminal justice, and constitutional rights has not constructively considered how doctrine should be changed to protect the wellbeing of this vulnerable population. Scholars have also provided little oversight of the judicial administration of justice in this field; there are few reviews of how judges actually apply treatment rights standards. This Note lessens this blind spot by exposing how courts fail to properly distinguish between different standards. This Note proposes that the most promising antidote to the Estelle-Youngberg double standard, counterintuitively, is not the creation of a uniform standard. A standard that puts mentally ill inmates on equal footing with the civilly committed would solve the doctrinal puzzle, but would be subject to Youngberg's inherent flaws and the judicial malpractice in this area. Recognizing the deficiencies of a purely judicial remedy
Directory of Open Access Journals (Sweden)
Straus MM
2013-09-01
, it is important for federal government research agencies to initiate and support independent and rigorous evaluation of these programs to inform policymakers how effective these programs can be to save lives and curb the opioid overdose public health crisis. Keywords: prescription drug abuse, fatal opioid overdose, naloxone antidote, Good Samaritan laws, naloxone take-home program
Vortex lattice in effective type-I superconducting films with periodic arrays of submicron holes
International Nuclear Information System (INIS)
Berdiyorov, G.R.; Milosevic, M.V.; Peeters, F.M.
2006-01-01
The vortex matter and related phenomena in superconducting films with periodic arrays of microholes (antidots) are studied within the nonlinear Ginzburg-Landau (GL) theory. By varying the GL parameter κ, the vortex-vortex interaction is fine tuned, from repulsive to attractive behavior. This interaction is of crucial importance for equilibrium vortex structures, the saturation number of the antidots, and the related quantities, such as critical current. Due to vortex attraction in effectively type-I samples, the giant-vortex state becomes energetically favorable (contrary to the type-II behavior). For the same reason, the number of vortices which can be captured by antidots, increases with decreasing κ. As a result, for given magnetic field, the critical current is larger for effectively type-I superconductors than in conventional type-II cases
Dynamics of vortices in planar and tubular microstructured superconductors
International Nuclear Information System (INIS)
Fomin, V. M.
2011-01-01
Full text: Nucleation and denucleation of vortices as well as their guided motion between antidots are key issues to design methods for controlling the vortex manipulation in micro patterned thin films and self-assembled micro tubes. The vortex dynamics in micro structured superconductors is modelled using an adaptive numerical approach on the basis of the time dependent Ginzburg-Landau equations. Evolution of the order parameter and the current density is analyzed for superconducting YBCO films with different patterns of antidots. The resulting picture of the accumulated vortex trajectories clearly reveals a guided motion between the antidots. Dynamics of correlated vortices in superconductor tubes in a magnetic field, which is perpendicular to their axes, is governed by the curvature. I acknowledge fruitful collaboration with R. Woerdenweber and O. G. Schmidt. (author)
Investigation of ferromagnetic resonance and magnetoresistance in anti-spin ice structures
Ribeiro, I. R. B.; Felix, J. F.; Figueiredo, L. C.; Morais, P. C.; Ferreira, S. O.; Moura-Melo, W. A.; Pereira, A. R.; Quindeau, A.; de Araujo, C. I. L.
2016-11-01
In this work, we report experimental and theoretical investigations performed in anti-spin ice structures, composed by square lattice of elongated antidots, patterned in nickel thin film. The magnetic vortex crystal state was obtained by micromagnetic simulation as the ground state magnetization, which arises due to the magnetic stray field at the antidot edges inducing chirality in the magnetization of platters among antidots. Ferromagnetic resonance (FMR) and magnetoresistance (MR) measurements were utilized to investigate the vortex crystal magnetization dynamics and magnetoelectric response. By using FMR, it was possible to detect the spin wave modes and vortex crystal resonance, in good agreement with dynamic micromagnetic simulation results. The vortex crystal magnetization configuration and its response to the external magnetic field, were used to explain the isotropic MR behaviour observed.
The possible role of intravenous lipid emulsion in the treatment of chemical warfare agent poisoning
Directory of Open Access Journals (Sweden)
Arik Eisenkraft
Full Text Available Organophosphates (OPs are cholinesterase inhibitors that lead to a characteristic toxidrome of hypersecretion, miosis, dyspnea, respiratory insufficiency, convulsions and, without proper and early antidotal treatment, death. Most of these compounds are highly lipophilic. Sulfur mustard is a toxic lipophilic alkylating agent, exerting its damage through alkylation of cellular macromolecules (e.g., DNA, proteins and intense activation of pro-inflammatory pathways. Currently approved antidotes against OPs include the peripheral anticholinergic drug atropine and an oxime that reactivates the inhibited cholinesterase. Benzodiazepines are used to stop organophosphate-induced seizures. Despite these approved drugs, efforts have been made to introduce other medical countermeasures in order to attenuate both the short-term and long-term clinical effects following exposure. Currently, there is no antidote against sulfur mustard poisoning. Intravenous lipid emulsions are used as a source of calories in parenteral nutrition. In recent years, efficacy of lipid emulsions has been shown in the treatment of poisoning by fat-soluble compounds in animal models as well as clinically in humans. In this review we discuss the usefulness of intravenous lipid emulsions as an adjunct to the in-hospital treatment of chemical warfare agent poisoning. Keywords: Intravenous lipid emulsion, Organophosphates, Sulfur mustard, Antidotes, Poisoning, Chemical Warfare agents
Cholinergic effects of HI-6 in Soman poisoning
International Nuclear Information System (INIS)
Shih, T.M.; Lockwood, P.A.; Lundy, P.M.; Valdes, J.J.; Whalley, C.E.
1986-01-01
The authors conduct studies to determine the role of cholinergic mechanisms in the antidotal effects of HI-6 in soman poisoning. The effects of HI-6 were studied in discrete brain areas and elevation of acetylcholine or choline levels in vivo as well as on muscarinic receptor binding and high affinity Ch uptake (HAChT) in vitro. The effect of pralidoxime chloride was studied on the same cholinergic mechanisms to compare its effects with HI-6. Methyl-tritium-choline chloride and tritium-quinuclidinyl benzilate were used in the experiments on male Wistar rats. The influence of antidotal treatments on time to death in soman intoxicated rats is shown. The effects of soman and its antidotal treatments on regional bain ChE activity are shown. The most significant protection was afforded by simultaneous treatment with both HI-6 and ATS
Meillier, Andrew; Heller, Cara
2015-01-01
Cyanide is rapidly reacting and causes arrest of aerobic metabolism. The symptoms are diffuse and lethal and require high clinical suspicion. Remediation of symptoms and mortality is highly dependent on quick treatment with a cyanide antidote. Presently, there are two widely accepted antidotes: sodium thiosulfate and hydroxocobalamin. These treatments act on different components of cyanide’s metabolism. Here, we present two cases resulting from the same source of cyanide poisoning and the use...
Czech Academy of Sciences Publication Activity Database
Urbanová, Veronika; Hajdušek, Ondřej; Hönig Mondeková, Helena; Šíma, Radek; Kopáček, Petr
2017-01-01
Roč. 7, MAR (2017), č. článku 73. ISSN 2235-2988 R&D Projects: GA ČR GJ15-12006Y; GA ČR GA13-11043S; GA ČR GA17-27386S; GA ČR GA17-27393S EU Projects: European Commission(XE) 602272 - ANTIDotE Institutional support: RVO:60077344 Keywords : Borrelia * complement * Ixodes * phagocytosis * thioester-containing proteins Subject RIV: EC - Immunology OBOR OECD: Immunology Impact factor: 4.300, year: 2016
2012-08-01
are considered part of a cause; inessential elements are pruned . Without AC3, if dropping a lit match qualified as a cause of the forest fire, then...possession of a lethal poison, but has a last-minute change of heart and refrains from putting it in Victim’s coffee . Bodyguard puts antidote in the... coffee , which would have neutralized the poison had there been any. Victim drinks the coffee and survives. Is Bodyguard’s putting in the antidote a
Czech Academy of Sciences Publication Activity Database
Hönig Mondeková, Helena; Šíma, Radek; Urbanová, Veronika; Kovář, Vojtěch; Rego, Ryan O. M.; Grubhoffer, Libor; Kopáček, Petr; Hajdušek, Ondřej
2017-01-01
Roč. 7, DEC (2017), č. článku 509. ISSN 2235-2988 R&D Projects: GA ČR GA17-27386S; GA ČR GA17-27393S; GA ČR GJ15-12006Y; GA ČR GA13-11043S EU Projects: European Commission(XE) 602272 - ANTIDotE Institutional support: RVO:60077344 Keywords : Fibrinogen-related protein * Ixoderin * Ixodes * Lectin * RNAi * Tick Subject RIV: EC - Immunology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.300, year: 2016
DEFF Research Database (Denmark)
Husted, Steen; Verheugt, Freek; Comuth, Willemijn
2015-01-01
, coagulation factor concentrates or NOAC-specific antidotes could be used. Coagulation factor concentrates can be used in patients with haemophilia and to reverse the effect of VKAs but, in NOAC-treated patients, results are inconsistent and these agents could potentially have pro-thrombotic effects. Specific...... antidotes for NOACs are expected to be on the market soon. Phase III clinical trials with a humanized antibody fragment directed against dabigatran (idarucizumab) and recombinant, modified factor Xa (andexanet alfa) are ongoing. A molecule (aripazine) with broad activity against various anticoagulants...
Husted, Steen; Verheugt, Freek W A; Comuth, Willemijn J
2016-01-01
The non-vitamin K antagonist oral anticoagulants (NOACs) are used for thromboembolic prophylaxis of patients with atrial fibrillation and in the treatment as well as secondary prophylaxis of patients with venous thromboembolism. Even though NOACs have a better safety profile than vitamin K antagonists (VKAs), there will still be bleeding complications on NOAC treatment. In some cases, stopping the NOAC and non-drug-related management such as manual compression and interventional endoscopy will be sufficient to stop the bleeding. In more serious bleeding events and before acute surgery, coagulation factor concentrates or NOAC-specific antidotes could be used. Coagulation factor concentrates can be used in patients with haemophilia and to reverse the effect of VKAs but, in NOAC-treated patients, results are inconsistent and these agents could potentially have pro-thrombotic effects. Specific antidotes for NOACs are expected to be on the market soon. Phase III clinical trials with a humanized antibody fragment directed against dabigatran (idarucizumab) and recombinant, modified factor Xa (andexanet alfa) are ongoing. A molecule (aripazine) with broad activity against various anticoagulants including NOACs is currently undergoing phase II trials. For use of these specific antidotes, it is desirable that measurements for coagulation activity with a short response delay are widely available for the different NOACs and further research in this field is needed. Furthermore, guidelines for antidote use, including general measures for the treatment of NOAC-related bleeding, should be available.
Hydroxocobalamin: improved public health readiness for cyanide disasters.
Sauer, S W; Keim, M E
2001-06-01
The United States is under the constant threat of a mass casualty cyanide disaster from industrial accidents, hazardous material transportation incidents, and deliberate terrorist attacks. The current readiness for cyanide disaster by the emergency medical system in the United States is abysmal. We, as a nation, are simply not prepared for a significant cyanide-related event. The standard of care for cyanide intoxication is the cyanide antidote kit, which is based on the use of nitrites to induce methemoglobinemia. This kit is both expensive and ill suited for out-of-hospital use. It also has its own inherent toxicity that prevents rapid administration. Furthermore, our hospitals frequently fail to stock this life-saving antidote or decline to stock more than one. Hydroxocobalamin is well recognized as an efficacious, safe, and easily administered cyanide antidote. Because of its extremely low adverse effect profile, it is ideal for out-of-hospital use in suspected cyanide intoxication. To effectively prepare for a cyanide disaster, the United States must investigate, adopt, manufacture, and stockpile hydroxocobalamin to prevent needless morbidity and mortality.
Spin qubits in antidot lattices
DEFF Research Database (Denmark)
Pedersen, Jesper Goor; Flindt, Christian; Mortensen, Niels Asger
2008-01-01
We suggest and study designed defects in an otherwise periodic potential modulation of a two-dimensional electron gas as an alternative approach to electron spin based quantum information processing in the solid-state using conventional gate-defined quantum dots. We calculate the band structure a...
Patterned FePt nanostructures using ultrathin self-organized templates
Deng, Chen Hua; Zhang, Min; Wang, Fang; Xu, Xiao Hong
2018-02-01
Patterned magnetic thin films are both scientifically interesting and technologically useful. Ultrathin self-organized anodic aluminum oxide (AAO) template can be used to fabricate large area nanodot and antidot arrays. The magnetic properties of these nanostructures may be tuned by the morphology of the AAO template, which in turn can be controlled by synthetic parameters. In this work, ultrathin AAO templates were used as etching masks for the fabrication of both FePt nanodot and antidot arrays with high areal density. The perpendicular magnetic anisotropy of L10 FePt thin films are preserved in the nanostructures.
Zakharov, Sergey; Pelclova, Daniela; Navratil, Tomas; Belacek, Jaromir; Komarc, Martin; Eddleston, Michael; Hovda, Knut Erik
2015-01-01
Mass or cluster methanol poisonings are frequently reported from around the world. The comparative effectiveness of ethanol and fomepizole as antidotes for methanol poisoning is unknown due to the difficulty of performing a randomized controlled trial. During an outbreak of mass poisonings in the Czech Republic in 2012-2014, we compared the effects of antidotes on the frequency of health sequelae and mortality. The study was designed as a cross-sectional case series and quasi-case-control study. Patients with a diagnosis of methanol poisoning on admission to hospitals were identified for the study. Diagnosis was established when (i) a history of recent ingestion of illicit spirits was available and serum methanol was higher than 6.2 mmol/L (20 mg/dL), or (ii) there was a history/clinical suspicion of methanol poisoning, and serum methanol was above the limit of detection with at least two of the following: pH poisoning and other key parameters, was selected. Data were obtained from 100 hospitalized patients with confirmed poisoning: 25 patients treated with fomepizole were compared with 68 patients receiving ethanol (seven patients did not receive any antidote). More severely acidotic (p 12 h; p = 0.028) patients received fomepizole more often than ethanol, as reflected in the higher number of fomepizole-treated patients being intubated (p = 0.009). No association was found between the type of antidote and the survival in either the case series (p = 0.205) or the quasi-control groups (p = 0.705) in which patients were very closely matched to minimize confounding by allocation. In the multivariate analysis, positive serum ethanol (odds ratio [OR], 10.8; 95% confidence interval [CI], 2.9-39.9) and arterial blood pH (OR, 3.7; 95% CI, 1.3-10.5) on admission were the only independent variables for the survival. The median intensive care unit length of stay was 6 (range, 2-22) days in the fomepizole group and 4 (range, 1-33) days in the ethanol group (p = 0.131). There
Czech mass methanol outbreak 2012: epidemiology, challenges and clinical features.
Zakharov, Sergey; Pelclova, Daniela; Urban, Pavel; Navratil, Tomas; Diblik, Pavel; Kuthan, Pavel; Hubacek, Jaroslav A; Miovsky, Michal; Klempir, Jiri; Vaneckova, Manuela; Seidl, Zdenek; Pilin, Alexander; Fenclova, Zdenka; Petrik, Vit; Kotikova, Katerina; Nurieva, Olga; Ridzon, Petr; Rulisek, Jan; Komarc, Martin; Hovda, Knut Erik
2014-12-01
Methanol poisonings occur frequently globally, but reports of larger outbreaks where complete clinical and laboratory data are reported remain scarce. The objective of the present study was to report the data from the mass methanol poisoning in the Czech Republic in 2012 addressing the general epidemiology, treatment, and outcomes, and to present a protocol for the use of fomepizole ensuring that the antidote was provided to the most severely poisoned patients in the critical phase. A combined prospective and retrospective case series study of 121 patients with confirmed methanol poisoning. From a total of 121 intoxicated subjects, 20 died outside the hospital and 101 were hospitalized. Among them, 60 survived without, and 20 with visual/CNS sequelae, whereas 21 patients died. The total and hospital mortality rates were 34% and 21%, respectively. Multivariate regression analysis found pH 0.05). Severity of metabolic acidosis, state of consciousness, and serum ethanol on admission were the only significant parameters associated with mortality. The type of dialysis or antidote did not appear to affect mortality. Recommendations that were issued for hospital triage of fomepizole administration allowed conservation of valuable antidote in this massive poisoning outbreak for those patients most in need.
Enhanced pinning in superconducting thin films with graded pinning landscapes
Motta, M.; Colauto, F.; Ortiz, W. A.; Fritzsche, J.; Cuppens, J.; Gillijns, W.; Moshchalkov, V. V.; Johansen, T. H.; Sanchez, A.; Silhanek, A. V.
2013-05-01
A graded distribution of antidots in superconducting a-Mo79Ge21 thin films has been investigated by magnetization and magneto-optical imaging measurements. The pinning landscape has maximum density at the sample border, decreasing linearly towards the center. Its overall performance is noticeably superior than that for a sample with uniformly distributed antidots: For high temperatures and low fields, the critical current is enhanced, whereas the region of thermomagnetic instabilities in the field-temperature diagram is significantly suppressed. These findings confirm the relevance of graded landscapes on the enhancement of pinning efficiency, as recently predicted by Misko and Nori [Phys. Rev. B 85, 184506 (2012)].
Hugnet, C; Bruchon-Hugnet, C; Royer, H; Bourdoiseau, G
2001-04-01
Eight dogs with generalized demodicosis and five with sarcoptic manage were treated with 1.25% amitraz solution applied weekly and associated with an antidote treatment (atipamezol, 0.1 mg kg-1 i.m. once: and yohimbine 0.1 mg kg-1 once daily for 3 days, orally). Results of skin scrapings were used to determine whether therapy should be continued or stopped. The median number of treatments for demodicosis and sarcoptic mange was three (range 2-5) and two (range 1-3), respectively. Some side-effects were observed but all were stopped with antidote treatment; no failure or relapses occurred at 6-36 months after treatment.
[Methemoglobinemia after inhalation of poppers].
Janssens, U; Hillen, S; Janssens, T; Grafe, J
2018-04-17
This case report presents a case of symptomatic methemoglobinemia (MetHb 31.6%) after inhalation of volatile nitrites (poppers). The patient's medical history and symptoms are discussed together with pathophysiology of methemoglobinemia, diagnostics, and antidote therapy. Pulse oxymetry, arterial blood gas analysis, and CO-oximetry receive particular attention as well as antidote therapy with methylene blue. The patient was treated successfully with intravenous methylene blue. Within 60 min methemoglobinemia returned to normal values (MetHb 0.6%). Stimulating compounds such as volatile nitrites (poppers) may lead to potentially fatal methemoglobinemia. Swift and accurate diagnosis and targeted therapy with methylene blue can lead to rapid recovery.
Kim, Jae G.; Lee, Jangwoen; Mahon, Sari B.; Mukai, David; Patterson, Steven E.; Boss, Gerry R.; Tromberg, Bruce J.; Brenner, Matthew
2012-10-01
Noninvasive near infrared spectroscopy measurements were performed to monitor cyanide (CN) poisoning and recovery in the brain region and in foreleg muscle simultaneously, and the effects of a novel CN antidote, sulfanegen sodium, on tissue hemoglobin oxygenation changes were compared using a sub-lethal rabbit model. The results demonstrated that the brain region is more susceptible to CN poisoning and slower in endogenous CN detoxification following exposure than peripheral muscles. However, sulfanegen sodium rapidly reversed CN toxicity, with brain region effects reversing more quickly than muscle. In vivo monitoring of multiple organs may provide important clinical information regarding the extent of CN toxicity and subsequent recovery, and facilitate antidote drug development.
Robust band gap and half-metallicity in graphene with triangular perforations
DEFF Research Database (Denmark)
Gregersen, Søren Schou; Power, Stephen; Jauho, Antti-Pekka
2016-01-01
. The inclusion of spin polarization within a mean-field Hubbard approach gives rise to a large overall magnetic moment at each antidot due to the sublattice imbalance imposed by the triangular geometry. Half-metallic behavior arises from the formation of spin-split dispersive states near the Fermi energy...... disorders. Here we study a rectangular array of triangular antidots with zigzag edge geometries and show that their band gap behavior qualitatively differs from the standard behavior which is exhibited, e.g., by rectangular arrays of armchair-edged triangles. In the spin unpolarized case, zigzag......, and furthermore, of exploiting the strong spin dependence of the system for spintronic applications....
Directory of Open Access Journals (Sweden)
Lund Cathrine
2012-07-01
Full Text Available Abstract Objectives Changes in poisoning trends may affect both complications and outcomes in patients with acute poisoning. This study reports the treatments given and the frequency of complications, also related to treatment, mortality and sequelae related to various toxic agents. Methods All acute poisonings in adults (≥16 years admitted to the five hospitals in Oslo were included consecutively during one year (2008 to 2009 in an observational cross-sectional multicenter study. A standardized form was completed by the treating physician, which covered the study aims. Results There were 1065 admissions in 912 patients. The median length of hospital stay was one day, and 49% were observed in an intensive care unit (ICU. Active treatment was given to 83%, and consisted of supportive therapy (70%, antidote(s (38%, activated charcoal (16% and gastric lavage (9%. The most commonly used antidotes were flumazenil (19%, naloxone (17% and N-acetylcysteine (11%. The rate of treatment-related complications was 2.4% (21/884. Neither flumazenil, naloxone, nor the combination, was associated with convulsions or other complications. Among those receiving N-acetylcysteine, 5% (6/120 developed allergic reactions, one of which mandated discontinuation of treatment. Nineteen percent presented in a coma. Complications developed in 30%, compared with 18% in a 2003 study, mainly respiratory depression (12%, prolonged QTc interval (6% and hypotension (5%. Eight patients died (0.8% and five (0.5% survived with permanent sequelae, mainly anoxic brain damage. Discussion Few patients stayed more than two days. The use of the ICU was liberal, considering that only one out of five presented in a coma. Antidotes were frequently given diagnostically. Although N-acetylcysteine induced allergic reactions, most were mild and treatment discontinuation was only necessary once. The frequency of complications had almost doubled in five years, although the poisoning pattern was
2012-01-01
Objectives Changes in poisoning trends may affect both complications and outcomes in patients with acute poisoning. This study reports the treatments given and the frequency of complications, also related to treatment, mortality and sequelae related to various toxic agents. Methods All acute poisonings in adults (≥16 years) admitted to the five hospitals in Oslo were included consecutively during one year (2008 to 2009) in an observational cross-sectional multicenter study. A standardized form was completed by the treating physician, which covered the study aims. Results There were 1065 admissions in 912 patients. The median length of hospital stay was one day, and 49% were observed in an intensive care unit (ICU). Active treatment was given to 83%, and consisted of supportive therapy (70%), antidote(s) (38%), activated charcoal (16%) and gastric lavage (9%). The most commonly used antidotes were flumazenil (19%), naloxone (17%) and N-acetylcysteine (11%). The rate of treatment-related complications was 2.4% (21/884). Neither flumazenil, naloxone, nor the combination, was associated with convulsions or other complications. Among those receiving N-acetylcysteine, 5% (6/120) developed allergic reactions, one of which mandated discontinuation of treatment. Nineteen percent presented in a coma. Complications developed in 30%, compared with 18% in a 2003 study, mainly respiratory depression (12%), prolonged QTc interval (6%) and hypotension (5%). Eight patients died (0.8%) and five (0.5%) survived with permanent sequelae, mainly anoxic brain damage. Discussion Few patients stayed more than two days. The use of the ICU was liberal, considering that only one out of five presented in a coma. Antidotes were frequently given diagnostically. Although N-acetylcysteine induced allergic reactions, most were mild and treatment discontinuation was only necessary once. The frequency of complications had almost doubled in five years, although the poisoning pattern was largely
Tõnson, Margit, 1978-
2005-01-01
Uutest heliplaatidest Saint Etienne "Tales From Turnpike House", "Team Sleep", Jamiroquai "Dynamite", Life Of Agony "Broken Valley", The Wallflowers "Rebel, Sweetheart", morcheeba "The Antidote", Amerie "Touch"
Tomassoni, Anthony J; French, Robert N E; Walter, Frank G
2015-02-01
Toxidromes aid emergency care providers in the context of the patient presenting with suspected poisoning, unexplained altered mental status, unknown hazardous materials or chemical weapons exposure, or the unknown overdose. The ability to capture an adequate chemical exposure history and to recognize toxidromes may reduce dependence on laboratory tests, speed time to delivery of specific antidote therapy, and improve selection of supportive care practices tailored to the etiologic agent. This article highlights elements of the exposure history and presents selected toxidromes that may be caused by toxic industrial chemicals and chemical weapons. Specific antidotes for toxidromes and points regarding their use, and special supportive measures, are presented. Copyright © 2015 Elsevier Inc. All rights reserved.
Estudio sobre dos plantas homéricas : mandrágora y moly
Directory of Open Access Journals (Sweden)
José Manuel Cuesta Pastor
2002-01-01
Full Text Available En la Odisea, la bruja Circe envenena a ios amigos de Odiseo, convirtiéndoles en cerdos. Mermes proporciona a éste el antídoto para poder rescatarlos. Con el apoyo de manuales botánicos y la mitología se tratará de demostrar la identidad del phármacon de la maga y su antídoto.In Odyssey, the witch Circe poisons Odysseu's friends, transforming them into pigs. Hermes provides the antidote wich saves them. With the support of the botanical consultants and the mythology we will try to demónstrate the identity of phármacon of the witch and the antidote.
Directory of Open Access Journals (Sweden)
Hu TY
2016-02-01
Full Text Available Tiffany Y Hu,1 Vaibhav R Vaidya,2 Samuel J Asirvatham2,31Mayo Medical School, 2Division of Cardiovascular Diseases, Department of Internal Medicine, 3Department of Pediatrics and Adolescent Medicine, Mayo Clinic, Rochester, MN, USAAbstract: Novel oral anticoagulants (NOACs are increasingly used in clinical practice, but lack of commercially available reversal agents is a major barrier for mainstream use of these therapies. Specific antidotes to NOACs are under development. Idarucizumab (aDabi-Fab, BI 655075 is a novel humanized mouse monoclonal antibody that binds dabigatran and reverses its anticoagulant effect. In a recent Phase III study (Reversal Effects of Idarucizumab on Active Dabigatran, a 5 g intravenous infusion of idarucizumab resulted in the normalization of dilute thrombin time in 98% and 93% of the two groups studied, with normalization of ecarin-clotting time in 89% and 88% patients. Two other antidotes, andexanet alfa (PRT064445 and ciraparantag (PER977 are also under development for reversal of NOACs. In this review, we discuss commonly encountered management issues with NOACs such as periprocedural management, laboratory monitoring of anticoagulation, and management of bleeding. We review currently available data regarding specific antidotes to NOACs with respect to pharmacology and clinical trials.Keywords: novel oral anticoagulant, dabigatran, idarucizumab, reversal
Ethnomedicinal plants used for snakebite in India: a brief overview
Directory of Open Access Journals (Sweden)
Sughosh V. Upasani
2017-06-01
Full Text Available The result of human interface and assortment of the most desirable, influential, and successful plant species found in the immediate environment at a precise circumstance is attributable to indigenous knowledge of plant species. India has a rich variety of medicinal plants growing under different geographical and ecological conditions; 1500 out of 15,000 privileged plant species have been reported to have medicinal uses. Snakebite is a severe medical, social, and economic problem in many parts of the world, chiefly in tropical and subtropical nations where majority of the world’s dangerous snakes are found and where access to treatment is limited. In India, a range of medicinal plants are used as antidotes for snakebites, used either singly or in combination with other agents. The present study makes an effort to assemble information on medicinal plants that are grown and used for snakebite treatment in India. From a range of literature sources, data have been compiled with emphasis on the plants, family, parts used, etc., depending on the availability of information. This paper enumerates 523 plant species belonging to 122 families that act as antidotes against snakebites. We believe this study of herbal antidotes against snake venom is of substantial significance to society.
Protection Against Chemical Agent-Induced, Seizure-Related Neuronal Cell Death
National Research Council Canada - National Science Library
Ballough, Gerald P; Filbert, Margaret G
2002-01-01
.... While seizure-related brain damage can be prevented by administration of an anticonvulsant drug, battlefield conditions may preclude prompt administration of the convulsant antidote for nerve agents (CANA...
The Liberal Arts, Antidote for Atheism
Directory of Open Access Journals (Sweden)
Heck Joel D.
2014-12-01
Full Text Available C. S. Lewis once stated that the decline of classical learning was a contributory cause of atheism. This article explores why he made this very unusual statement, describing how Lewis saw the Classics as a literature full of gods and goddesses, providing hints of truth, giving us things to write about, and preparing for the Christian faith. Using some remarkable quotations from Virgil and Plato, Lewis demonstrated how those writers anticipated both the birth and the death of Christ. Lewis’s concept of myth, powerfully present in the Classics, shows how the Gospel story itself is a “true myth,” one with a pattern that is similar to many of the pagan myths. The personal story of Lewis himself demonstrates how the Classics, and, more broadly, the liberal arts were a testimony to the truth of God and how the Greek plays of Euripides, the philosophy of Samuel Alexander, the imagination of writer William Morris, the poetry of George Herbert, and the historical sensibility of G. K. Chesterton combined (with many other similar influences to convince Lewis that the death and resurrection of Jesus Christ were especially a “true myth,” one that happened in history, demonstrating him to be the Son of God.
Magnetic Properties of Large-Scale Nanostructured Graphene Systems
DEFF Research Database (Denmark)
Gregersen, Søren Schou
The on-going progress in two-dimensional (2D) materials and nanostructure fabrication motivates the study of altered and combined materials. Graphene—the most studied material of the 2D family—displays unique electronic and spintronic properties. Exceptionally high electron mobilities, that surpass...... those in conventional materials such as silicon, make graphene a very interesting material for high-speed electronics. Simultaneously, long spin-diffusion lengths and spin-life times makes graphene an eligible spin-transport channel. In this thesis, we explore fundamental features of nanostructured...... graphene systems using large-scale modeling techniques. Graphene perforations, or antidots, have received substantial interest in the prospect of opening large band gaps in the otherwise gapless graphene. Motivated by recent improvements of fabrication processes, such as forming graphene antidots and layer...
Copper spherical cavity arrays: Fluorescence enhancement in PFO films
Energy Technology Data Exchange (ETDEWEB)
Spada, Edna R., E-mail: edspada@gmail.com [Instituto de Física de São Carlos, Universidade de São Paulo, Caixa Postal 369, 13560-970, São Carlos, SP (Brazil); Valente, Gustavo T.; Pereira-da-Silva, Marcelo A. [Instituto de Física de São Carlos, Universidade de São Paulo, Caixa Postal 369, 13560-970, São Carlos, SP (Brazil); Sartorelli, Maria L. [Departamento de Física, Universidade Federal de Santa Catarina, Caixa Postal 476, 88040-900, Florianópolis, SC (Brazil); Guimarães, Francisco E.G.; Faria, Roberto M. [Instituto de Física de São Carlos, Universidade de São Paulo, Caixa Postal 369, 13560-970, São Carlos, SP (Brazil)
2017-01-15
This manuscript addresses the use of a well-ordered antidot copper nanostructure as a active substrate for surface enhancement fluorescence (SEF). The antidot array was produced by electrodeposition and nanosphere lithography and characterized by microscopy technique, its successful application as SEF-active substrates was verified using polyfluorene (PFO) as a probe layer. Atomic force microscopy (AFM) was used to evaluate the regularity of the metal surface as well PFO coated process and confocal laser fluorescence microscopy (CLSM) to determine the behavior exhibited by the fluorescent layer due to the existence of the nanostructured surface. No accumulation PFO in the cavities was detected and the more intense emission regions coincides with the position of the cavities and is at about one order of magnitude higher.
Pattern transfer with stabilized nanoparticle etch masks
International Nuclear Information System (INIS)
Hogg, Charles R; Majetich, Sara A; Picard, Yoosuf N; Narasimhan, Amrit; Bain, James A
2013-01-01
Self-assembled nanoparticle monolayer arrays are used as an etch mask for pattern transfer into Si and SiO x substrates. Crack formation within the array is prevented by electron beam curing to fix the nanoparticles to the substrate, followed by a brief oxygen plasma to remove excess carbon. This leaves a dot array of nanoparticle cores with a minimum gap of 2 nm. Deposition and liftoff can transform the dot array mask into an antidot mask, where the gap is determined by the nanoparticle core diameter. Reactive ion etching is used to transfer the dot and antidot patterns into the substrate. The effect of the gap size on the etching rate is modeled and compared with the experimental results. (paper)
Development of new Czech autoinjector with oxime HI-6 DMS
International Nuclear Information System (INIS)
Kuca, K; Jun, D.; Kassa, J.; Marek, J.; Stodulka, P.; Musilek, K.; Dolezal, D.; Povraznik, J.
2009-01-01
Oxime HI-6 (1-(2-(hydroxyiminomethyl)pyridinium) -3-(4-carbamoylpyridinium)-2-oxapropane) is considered to be currently the most universal oxime for the potential use as antidote against nerve agents (sarin, cyclosarin, VX, etc.). None of other commercially available oximes (pralidoxime, obidoxime, trimedoxime, MMB4) has broader antidotal effect. Due to this, development of the appropriate salt of this oxime together with its application form (eg. autoinjector) was the main aim of our departments and several private Czech companies (VAKOS XT as., Decomkov Praha sro., ChemProtect as.). In our contribution, we would like to summarize all the steps which were already done. We would like to thank to the Ministry of Industry and Trade of the Czech Republic for the Project No. FIIM2/104.(author)
Computer Simulation Lends New Insights Into Cyanide-Caused Cardiac Toxicity
National Research Council Canada - National Science Library
Zoltani, C. K; Platoff, G. E; Baskin, S. I
2004-01-01
The development of antidotes against cyanide (CN) poisoning for the protection of the warfighter is still hampered by a lack of detailed understanding of the modulation of CN-affected cellular processes...
Czech Academy of Sciences Publication Activity Database
Zakharov, S.; Navrátil, Tomáš; Salek, T.; Kurcová, I.; Pelclová, D.
2015-01-01
Roč. 159, č. 4 (2015), s. 666-676 ISSN 1213-8118 Institutional support: RVO:61388955 Keywords : methanol poisoning * ethanol * antidote Subject RIV: CG - Electrochemistry Impact factor: 0.924, year: 2015
Protein (Cyanobacteria): 440680064 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available YP_007154859.1 NC_019775 1117:3991 ... 1161:5387 ... 1162:6232 1163:4927 1165:626 272123:626 ... putative addicti...on module antidote protein Anabaena cylindrica PCC 7122 MALTKDFKETVNARIQRDPDFAIVLLDEAISLFLNGELETARLILRNMLNLSHF
Thanacoody, Ruben H K; Gilfillan, Claire; Bradberry, Sally M; Davies, Jeremy; Jackson, Gill; Vale, Allister J; Thompson, John P; Eddleston, Michael; Thomas, Simon H L
2016-01-01
Poisoning with methanol and ethylene glycol can cause serious morbidity and mortality. Specific treatment involves the use of antidotes (fomepizole or ethanol) with or without extracorporeal elimination techniques. A prospective audit of patients with methanol or ethylene glycol poisoning reported by telephone to the National Poisons Information Service (NPIS) in the UK was conducted during the 2010 calendar year and repeated during the 2012 calendar year. The study was conducted to determine the frequency of clinically significant systemic toxicity and requirement for antidote use and to compare outcomes and rates of adverse reaction and other problems in use between ethanol and fomepizole. The NPIS received 1315 enquiries involving methanol or ethylene glycol, relating to 1070 individual exposures over the 2-year period. Of the 548 enquiries originating from hospitals, 329 involved systemic exposures (enteral or parenteral as opposed to topical exposure), of which 216 (66%) received an antidote (204 for ethylene glycol and 12 for methanol), and 90 (27%) extracorporeal treatment (86 for ethylene glycol and 4 for methanol). Comparing ethanol with fomepizole, adverse reactions (16/131 vs. 2/125, p methanol results in hospitalisation at least 2-3 times per week on average in the UK. No difference in outcome was detected between ethanol and fomepizole-treated patients, but ethanol was associated with more frequent adverse reactions.
Management of novel oral anticoagulants in emergency and trauma surgery.
Pinho-Gomes, Ana-Catarina; Hague, Adam; Ghosh, Jonathan
2016-08-01
The compelling safety, efficacy and predictable effect of novel oral anticoagulants (NOACs) is driving a rapid expansion in their therapeutic indications. Management of the increasing number of patients on those new agents in the setting of emergency or trauma surgery can be challenging and the absence of specific reversal agents has been a matter of concern. This review summarises the key principles that underpin the management of those patients with a particular emphasis on the recent development of specific antidotes. As of 2015, a new line of antidotes, specific for these drugs, are at different stages of their development with their release imminent. However, as NOACs are innately reversible due to their short half-life, the use of reversal agents will probably be restricted to a few exceptional cases. Post-marketing surveillance will be paramount to better clarify the role of these promising drugs. Management of patients on NOACs in the context of emergency or trauma surgery relies on best supportive care in combination with the blood products and/or specific antidotes as required. Familiarity with the new reversal agents is essential but further evidence on their indications, safety and efficacy as well as consensus guidelines are warranted prior to widespread adoption. Copyright © 2016 Royal College of Surgeons of Edinburgh (Scottish charity number SC005317) and Royal College of Surgeons in Ireland. Published by Elsevier Ltd. All rights reserved.
Reversing the Effect of Oral Anticoagulant Drugs: Established and Newer Options.
Ansell, Jack E
2016-06-01
The vitamin K antagonists (VKAs) have been the standard (and only) oral anticoagulants used for the long-term treatment or prevention of venous thromboembolism or stroke in patients with atrial fibrillation. The coagulopathy induced by VKAs can be reversed with vitamin K, and in urgent situations, the vitamin K-dependent coagulation factors can be replaced by transfusion. In the last decade, a new class of oral anticoagulants has been developed, direct oral anticoagulants that bind to a specific coagulation factor and neutralize it. These compounds were shown to be effective and safe compared with the VKAs and were licensed for specific indications, but without a specific reversal agent. The absence of a reversal agent is a barrier to more widespread use of these agents. Currently, for the management of major life-threatening bleeding with the direct oral anticoagulants, most authorities recommend the use of four factor prothrombin complex concentrates. There are now three reversal agents in development and poised to enter the market. Idarucizumab is a specific antidote targeted to reverse the direct thrombin inhibitor, dabigatran, which was recently approved for use in the USA. Andexanet alfa is an antidote targeted to reverse the oral direct factor Xa inhibitors as well as the indirect inhibitor enoxaparin. Ciraparantag is an antidote targeted to reverse the direct thrombin and factor Xa inhibitors as well as the indirect inhibitor enoxaparin.
Quantum Computing With Quasiparticles of the Fractional Quantum Hall Effect
National Research Council Canada - National Science Library
Averin, Dmitri
2001-01-01
The focus of this project was the theoretical study of quantum computation based on controlled transfer of individual quasiparticles in systems of quantum antidots in the regime of the Fractional Quantum Hall Effect (FQHE...
... Choking Drug overdose, especially due to alcohol, narcotic painkillers, barbiturates, anesthetics, and other depressants Fluid in the ... to treat symptoms, including antidotes to reverse the effects of a poisoning or overdose Alternative Names Respiration ...
... have signs of opioid intoxication. Opioids are powerful painkillers. Symptoms may include: Bluish skin color (cyanosis) Breathing ... naloxone (Narcan), an antidote to help reverse the effect of the poison, multiple doses may be needed. ...
1 effect and management of acute dichlorvos poisoning in wistar rats
African Journals Online (AJOL)
DR. AMINU
effect and antidotal therapy of dichlorvos was studied in laboratory animals. The LD50 in rats was ... sweating, involuntary muscle contractions and burning sensations or actual burns .... by inhibiting the cholinesterase enzyme in mammalian.
International Nuclear Information System (INIS)
Bakke, K.; Furtado, C.
2012-01-01
We study the quantum dynamics of a neutral particle in the Aharonov-Casher system and in the Landau-Aharonov-Casher system confined to a two-dimensional quantum ring, a quantum dot, and a quantum anti-dot potentials described by the Tan-Inkson model [W.-C. Tan and J. C. Inkson, Semicond. Sci. Technol. 11, 1635 (1996)]. We show, in the Aharonov-Casher system, that bound states can be achieved when the neutral particle is confined to the two-dimensional quantum ring and the quantum dot and discuss the appearance of persistent currents. In the Landau-Aharonov-Casher system, we show that bound states can be achieved when the neutral particle is confined to the quantum anti-dot, quantum dot, and the two-dimensional quantum ring, but there are no persistent currents.
Acute cyanide poisoning in prehospital care: new challenges, new tools for intervention.
Guidotti, Tee
2006-01-01
Effective management of cyanide poisoning from chemical terrorism, inhalation of fire smoke, and other causes constitutes a critical challenge for the prehospital care provider. The ability to meet the challenge of managing cyanide poisoning in the prehospital setting may be enhanced by the availability of the cyanide antidote hydroxocobalamin, currently under development for potential introduction in the United States. This paper discusses the causes, recognition, and management of acute cyanide poisoning in the prehospital setting with emphasis on the emerging profile of hydroxocobalamin, an antidote that may have a risk:benefit ratio suitable for empiric, out-of-hospital treatment of the range of causes of cyanide poisoning. If introduced in the U.S., hydroxocobalamin may enhance the role of the U.S. prehospital responder in providing emergency care in a cyanide incident.
African Journals Online (AJOL)
Items 1 - 50 of 108 ... Vol 7, No 2 (2015), ACUTE TOXICITY STUDIES AND ANTIDOTAL ... From Pregnant Women with Asymptomatic Bacteriuria at Tertiary Hospital in ... in the Treatment of Uncomplicated Falciparum Malaria among Children ...
Czech Academy of Sciences Publication Activity Database
Zakharov, S.; Pelclová, D.; Navrátil, Tomáš; Běláček, J.; Komarc, M.; Edleston, M.; Hovda, K. E.
2015-01-01
Roč. 53, č. 8 (2015), s. 797-806 ISSN 1556-3650 Institutional support: RVO:61388955 Keywords : clinical effectiveness * hospital treatment * antidote administration Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.886, year: 2015
Combating Terrorism Chemical and Biological Medical Supplies Are Poorly Managed
National Research Council Canada - National Science Library
Bascetta, Cynthia
2000-01-01
.... As a result, the inventory we conducted identified a number of items, such as antidotes and antibiotics, that were stocked below required levels or had expired, as well as excesses of other items like sterile gloves...
Freller, T
1997-01-01
In the 16th, 17th and 18th century "Glossopetrae", popularly known as "Lingue di Serpi", found on the Mediterranean island of Malta, were extensively used for medical purposes as antidotes. These fossil teeth, including specimens of the "Carcharodon Megalodon" (an extinct variant of the great white shark), were ground to powder or used as amulet pendants and "credence" and exported to pharmacies and shops in various cities of Europe. In antiquity, authors like Plinius or Solinus, excluding any religious connotations, had regarded "Glossopetrae" as objects "fallen from heaven on dark moonless nights". However, from the beginning of the 16th century the miraculous antidotic power of the specimens found at Malta was very strongly connected with the Pauline cult there. This cult owed ist origin to the excerpt of the shipwreck of the Apostle of the Gentiles on this island, as recorded in the New Testament. As in so many cases found in medieval and early modern medicine and pharmacy, the renown, collection, distribution and use of the antidote "Glossopetrae" or "Lingue di Serpi" was never limited to its real chemical and pharmaceutical properties. In the period of enlightenment and secular thinking mythic medicine as "Glossopetrae" had lost ist "magical" power. Consequently, with beginning of the late 18th century also the Maltese "Glossopetrae" featured in literature merely as exotic objects of curiosity or symbols of an age bound to medical superstition.
The Toxiscape Hunt: An Escape Room-Scavenger Hunt for Toxicology Education
Directory of Open Access Journals (Sweden)
Megan Boysen-Osborn
2018-01-01
Full Text Available Audience: This scavenger hunt/escape room is a didactic activity for emergency medicine residents or fourth-year medical students rotating in emergency medicine. Introduction: Between 2008-2011, 1.1 million patients presented to U.S. emergency departments each year for poisonings,1 including acute ingestions, envenomations, occupational exposures, and overdoses. Toxicologic exposures are considered part of the core curriculum for emergency medicine (EM residents, who must understand the presentation and treatment of such patients.2 Educating residents in a unique, engaging format such as an “escape room” activity provides an alternative to the didactic format of teaching this material, which may build medical knowledge and team rapport amongst residents.3 Objectives: By the end of the activity, learners should be able to: Calculate an anion and osmolal gap. Recognize poisonings amenable to hemodialysis. Interpret EKG changes related to a variety of ingestions, including beta-blockers and calcium channel blockers, digitalis, and tricyclic antidepressants. Recognize poisonous plants and their clinical toxidromes. Calculate loading dose of N-acetylcysteine as antidote for acute acetaminophen ingestion. Collaborate as a team to arrive at solutions of problems. Recognize poisons that have available antidotes Know the clinical effect of various types of snake envenomations. Recognize the toxicity associated with at least four household chemicals. Know the antidotes for six common poisonings. Methods: This didactic exercise is a small group activity, utilizing puzzles to apply toxicology knowledge.
International Nuclear Information System (INIS)
Kumar, D.; Barman, A.; Kłos, J. W.; Krawczyk, M.
2014-01-01
We present the observation of a complete bandgap and collective spin wave excitation in two-dimensional magnonic crystals comprised of arrays of nanoscale antidots and nanodots, respectively. Considering that the frequencies dealt with here fall in the microwave band, these findings can be used for the development of suitable magnonic metamaterials and spin wave based signal processing. We also present the application of a numerical procedure, to compute the dispersion relations of spin waves for any high symmetry direction in the first Brillouin zone. The results obtained from this procedure have been reproduced and verified by the well established plane wave method for an antidot lattice, when magnetization dynamics at antidot boundaries are pinned. The micromagnetic simulation based method can also be used to obtain iso–frequency contours of spin waves. Iso–frequency contours are analogous of the Fermi surfaces and hence, they have the potential to radicalize our understanding of spin wave dynamics. The physical origin of bands, partial and full magnonic bandgaps have been explained by plotting the spatial distribution of spin wave energy spectral density. Although, unfettered by rigid assumptions and approximations, which afflict most analytical methods used in the study of spin wave dynamics, micromagnetic simulations tend to be computationally demanding. Thus, the observation of collective spin wave excitation in the case of nanodot arrays, which can obviate the need to perform simulations, may also prove to be valuable
Metal chelators and neurotoxicity: lead, mercury, and arsenic.
Bjørklund, Geir; Mutter, Joachim; Aaseth, Jan
2017-12-01
This article reviews the clinical use of the metal chelators sodium 2,3-dimercapto-1-propanesulfonate (DMPS), meso-2,3-dimercaptosuccinic acid (DMSA), and calcium disodium edetate (CaEDTA, calcium EDTA) in overexposure and poisonings with salts of lead (Pb), mercury (Hg), and arsenic (As). DMSA has considerably lower toxicity than the classic heavy metal antagonist BAL (2,3-dimercaptopropanol) and is also less toxic than DMPS. Because of its adverse effects, CaEDTA should be replaced by DMSA as the antidote of choice in treating moderate Pb poisoning. Combination therapy with BAL and CaEDTA was previously recommended in cases of severe acute Pb poisoning with encephalopathy. We suggest that BAL in such cases acted as a shuttling Pb transporter from the intra- to the extracellular space. The present paper discusses if a combination of the extracellularly distributed DMSA with the ionophore, Monensin may provide a less toxic combination for Pb mobilization by increasing both the efflux of intracellularly deposited Pb and the urinary Pb excretion. Anyhow, oral therapy with DMSA should be continued with several intermittent courses. DMPS and DMSA are also promising antidotes in Hg poisoning, whereas DMPS seems to be a more efficient agent against As poisoning. However, new insight indicates that a combination of low-dosed BAL plus DMPS could be a preferred antidotal therapy to obtain mobilization of the intracerebral deposits into the circulation for subsequent rapid urinary excretion.
Jungle Juice: Knowledge and Usage Among Kenyan Surgical Teams
African Journals Online (AJOL)
This survey aimed to evaluate knowledge and safe usage of jungle juice on patients in ... patterns and safety measures employed during use of jungle juice among ... Regarding the specific antidote for severe local anesthetic toxicity and its ...
DEFF Research Database (Denmark)
Power, Stephen; Thomsen, Morten Rishøj; Jauho, Antti-Pekka
2017-01-01
exceptional control of electron behavior, but it is hindered by the requirement to maintain ballistic transport over large length scales. Recent experiments have overcome this obstacle and observed distinct magnetoresistance commensurability peaks for perforated graphene sheets (antidot lattices...
International Nuclear Information System (INIS)
Andersen, O.; Nielsen, J.B.
1988-01-01
The antidotal efficacies of chelators during acute cadmium intoxication has previously been examined in experiments where both a soluble cadmium salt and the chelator were administered parenterally. In the present study, PA, DMSA and related compounds were studied as oral antidotes during oral CdCl 2 intoxication. According to the antagonistic effects noted on mortality, peristaltic toxicity and intestinal cadmium uptake, the relative efficacies of the compounds tested were: DMSA>PAD>DMPS>MSA>PA>NAPA. None of the chelators induced major changes in the organ distribution of absorbed cadmium, in particular no increased cerebral deposition of cadmium. This study indicates that, in oral cadmium intoxication in humans, orally administered DMSA would be likely to offer protection against the local toxicity of cadmium in the gastrointestinal tract as well as to reduce the risk of systemic toxicity of absorbed cadmium. (author)
Argument Strategies: Antidote to Tylenol's Poisoned Image.
Benoit, William L.; Lindsey, James J.
1987-01-01
Analyzes how the manufacturer dealt with the Tylenol poisonings: the link between Tylenol and the poisoning was denied, its image as a safe product was bolstered, capsules were differentiated from other products, and as a result, sales recovered. Extends the applicability of apologia as a way to analyze other media campaigns. (SKC)
Coffee as an Antidote to Knowledge Stickiness
Blackman, Deborah; Phillips, Diane
2011-01-01
This paper considers the concept of space and its role in both knowledge creation and overcoming knowledge stickiness. Aristotelian concepts of "freedom to" and "freedom from" are used to reconceptualise space. Informal and formal spaces, concepts and places are discussed as both specific locations and as gaps providing space for knowledge…
Clar sextets in square graphene antidot lattices
DEFF Research Database (Denmark)
Petersen, Rene; Pedersen, Thomas Garm; Jauho, Antti-Pekka
2011-01-01
A periodic array of holes transforms graphene from a semimetal into a semiconductor with a band gap tuneable by varying the parameters of the lattice. In earlier work only hexagonal lattices have been treated. Using atomistic models we here investigate the size of the band gap of a square lattice...
An Antidote for the Faculty-IT Divide
Fernandez, Luke
2008-01-01
Do campus IT departments harm higher education? Wall Street Journal personal-technology columnist Walt Mossberg suggested as much during a speech he gave to high-level administrators at last June's Chronicle of Higher Education presidents' forum. Mossberg caught the attention of campus CIOs when, according to the Chronicle, he described large IT…
Moral Relativism: A Philosopher's Antidote for Teachers
Jack, Henry
1977-01-01
The author identifies four main sources of moral relativism; defines cultural and ethical relativism, and social and personal moral relativism; and presents three arguments to refute moral relativism. (AV)
Plants profile of Malakand Pass Hills, District Malakand, Pakistan
African Journals Online (AJOL)
use
2011-11-21
Nov 21, 2011 ... famous Malakand fort guards the road on both sides of the pass. Malakand is a ... Underneath Malakand Hills, the waters of the River Swat ... southern sloping faces of the hills. They speak ...... Pinus roxburghii Sarg. Antidote ...
DEFF Research Database (Denmark)
Pedersen, Julie Steen; Munck, Lars Kristian
2014-01-01
Venlafaxin er en serotonin- og noradrenalingenoptagelseshæmmer, der er godkendt til behandling af depressioner og angsttilstande. Symptomer ved forgiftning er serotonergt syndrom, generaliserede krampeanfald, rabdomyolyse samt akut lever-, hjerte- og nyresvigt. Der findes ingen antidot. Med afsæt i...
Pharmacokinetics of IM,IV and IO Atropine in Normovolemic and Hypovolemic Swine
2016-06-12
nursing care is provided”.1 On and off the battlefield, highly specialized, well-educated nurses are managing complex injuries as integral member of...Rapid and complete bioavailability of antidotes for organophosphorus nerve agent and cyanide poisoning in minipigs after intraosseous
Poison centre network saves lives | IDRC - International ...
International Development Research Centre (IDRC) Digital Library (Canada)
2010-10-27
Oct 27, 2010 ... ... all are potentially fatal if the correct antidote isn't identified and applied — fast. ... Organization ( WHO ) and other sources, and made all this available to ... has crossed two continents and a number of social science fiel.
Nanostructured graphene for spintronics
DEFF Research Database (Denmark)
Gregersen, Søren Schou; Power, Stephen; Jauho, Antti-Pekka
2017-01-01
Zigzag edges of the honeycomb structure of graphene exhibit magnetic polarization, making them attractive as building blocks for spintronic devices. Here, we show that devices with zigzag-edged triangular antidots perform essential spintronic functionalities, such as spatial spin splitting or spin...
More about ... Paediatric emergency medicine
African Journals Online (AJOL)
antidote, are often used. In some ... used in children. ... used when caustic agents have been ingested, ... study6 has shown that prophylactic antibiotics ... amitraz, which is often used as a tick dip for livestock. It gives a similar clinical picture.
East and Central African Journal of Pharmaceutical Sciences - Vol 5 ...
African Journals Online (AJOL)
Investigation of Possible Antidotal Effects of Activated Charcoal, Sodium Bicarbonate, Hydrogen Peroxide and Potassium Permanganate in Zinc Phosphide Poisoning · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CK Maitai, DK Njoroge, KO Abuga, AM Mwaura, ...
Plasmon-mediated Coulomb drag between graphene waveguides
DEFF Research Database (Denmark)
Shylau, Artsem A.; Jauho, Antti-Pekka
2014-01-01
We analyze theoretically charge transport in Coulomb coupled graphene waveguides (GWGs). The GWGs are defined using antidot lattices, and the lateral geometry bypasses many technological challenges of earlier designs. The drag resistivity ρD, which is a measure of the many-particle interactions...
Antioxidant Effects of Methanol Extract of Allium cepa linn on ...
African Journals Online (AJOL)
olayemitoyin
These effects were compared to those of sodium thiosulphate (Na2S2O3), a classical antidote of cyanide toxicity. The rats ... The results indicate that onion extract reduced lipid peroxidation in the kidney and ..... Research and Health. 27 (4): ...
Directory of Open Access Journals (Sweden)
Kumar Pravin
2016-12-01
Full Text Available The available antidotal therapy against acute poisoning by organophosphates involves the use of atropine alone or in combination with one of the oximes, e.g. 2-PAM, Obidoxime, TMB-4 or HI-6. Each of these oximes has some limitation, raising the question of the universal antidotal efficacy against poisoning by all OPs/nerve agents. In the present study, newly synthesized bis quaternary 2-(hydroxyimino-N-(pyridin-3yl acetamide derivatives (HNK-series oximes were evaluated for their antidotal efficacy against DDVP intoxicated Swiss mice, in terms of the Protection Index (PI and AChE reactivation in brain and serum. The inhibition concentration (IC50 was determined in brain and serum after optimizing the time point for maximum inhibition (60 min post DDVP exposure. AChE reactivation efficacy of the HNK series was evaluated at IC50 and compared with 2-PAM. HNK-102 showed a ~2 times better Protection Index (PI as compared to 2-PAM against DDVP toxicity. IC50 at 60 min DDVP post exposure was found to be approximately one fifth and one half of the LD50 dose for brain and serum AChE, respectively. Out of three HNK oximes, HNK-102 & 106 at 0.20 LD50 dose significantly reactivated DDVP intoxicated brain AChE (p<0.05 as compared to 2-PAM at double IC50 dose of DDVP. In light of double PI and higher AChE reactivation, HNK 102 was found to be a better oxime than 2-PAM in the treatment of acute poisoning by DDVP.
Fail forward: Mitigating failure in energy research and innovation
DEFF Research Database (Denmark)
Brix, Jacob
2015-01-01
Almost three quarters of all innovation projects disappoint or fail. Instead of 'wasting' human and financial resources on energy projects that end up being terminated or ineffectual, this study offers a potential antidote coined the 'Origins of Failure in Energy Innovation' (OFEI) model. Based o...
Emerging trends in gerontology and geriatrics: implications for the self-care of the elderly
DEFF Research Database (Denmark)
Hickey, T; Dean, K; Holstein, B E
1986-01-01
people to describe a wide range of personal health behaviors encompassing lay care, self-help, enlightened consumerism, and various preventive measures as antidotes to the impairments of old age. This paper reports some of the outcomes of an international project which reviewed geriatric self...
The GOAT Effect's Impact upon Educational R and D.
Kean, Michael H.; McNamara, Thomas C.
1979-01-01
The "Goodbye To All That" (GOAT) Effect is introduced as a special research and evaluation "outcome" effect characterizing decision making unduly influenced by abandoning "write-off" tendencies. The "gradual refinement" approach offers an antidote to the GOAT Effect because it does not use the systems…
2008-12-01
restrictions exist regarding foreign travel, residency, and employment. Individuals may pursue a life of their choosing to include selecting both their...p. 590). Social capital can serve as an antidote. It helps temper the spread of egoism , and upholds the protection of civil liberties. Most
Search Results | Page 47 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2007-01-01
Results 461 - 470 of 8490 ... Democracy requires a functioning public administration. Published date. January 1, 2007. Studies. -. Democracy is the antidote against extremism. Published date. January 1, 2007. Studies. -. Applied research is important for building solid democracies. Published date. January 1, 2007. Studies. - ...
2010-04-01
... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS...) Conditions of use in dogs—(1) Amount. 20 milligrams per kilogram (mg/kg) of body weight intravenously... antidote for ethylene glycol (antifreeze) poisoning in dogs who have ingested or are suspected of having...
Rapid, Brushless Self-assembly of a PS-b-PDMS Block Copolymer for Nanolithography
DEFF Research Database (Denmark)
Rasappa, Sozaraj; Schulte, Lars; Borah, Dipu
2014-01-01
and antidot patterns after short solvo-thermal annealing. Unlike previous reports on this system, low temperature and short annealing time provide self-assembly in homogeneous thin films covering large substrate areas. This on-chip mask was then used for pattern transfer to the underlying silicon substrate...
Effect of methanolicstem-bark extract of Commiphora pedunculata ...
African Journals Online (AJOL)
Several medicinal plants have been used in Nigerian communities as antidotes for snakebite complications without scientific validation. In this study, the effect of the methanolic extract of Commiphora pedunculata on recalcification time of bovine, caprine, ovine and came lid plasma treated with Najani gricollis venom was ...
1988-12-01
tracking task reveals the magnitude Akitrihm. Spare. and Environmental Medicine • December. I$ II I ANTIDOTE EFFECTS--PEN ETAR ET AL. and duration of the... marihuana on dynamic visual acu- blood pressure following the combination of 2-PAM Cl ity: I. Threshold measurements. Perception Psychophys. 1975
International Nuclear Information System (INIS)
Hierro-Rodriguez, A; Teixeira, J M; Rodriguez-Rodriguez, G; Rubio, H; Vélez, M; Álvarez-Prado, L M; Martín, J I; Alameda, J M
2015-01-01
Hybrid 2D hard-soft composites have been fabricated by combining soft (Co 73 Si 27 ) and hard (NdCo 5 ) magnetic materials with in-plane and out-of-plane magnetic anisotropies, respectively. They have been microstructured in a square lattice of CoSi anti-dots with NdCo dots within the holes. The magnetic properties of the dots allow us to introduce a magnetostatic stray field that can be controlled in direction and sense by their last saturating magnetic field. The magnetostatic interactions between dot and anti-dot layers induce a completely tunable exchange bias-like shift in the system’s hysteresis loops. Two different regimes for this shift are present depending on the lattice parameter of the microstructures. For large parameters, dipolar magnetostatic decay is observed, while for the smaller one, the interaction between the adjacent anti-dot’s characteristic closure domain structures enhances the exchange bias-like effect as clarified by micromagnetic simulations. (paper)
A selfish genetic element confers non-Mendelian inheritance in rice.
Yu, Xiaowen; Zhao, Zhigang; Zheng, Xiaoming; Zhou, Jiawu; Kong, Weiyi; Wang, Peiran; Bai, Wenting; Zheng, Hai; Zhang, Huan; Li, Jing; Liu, Jiafan; Wang, Qiming; Zhang, Long; Liu, Kai; Yu, Yang; Guo, Xiuping; Wang, Jiulin; Lin, Qibing; Wu, Fuqing; Ren, Yulong; Zhu, Shanshan; Zhang, Xin; Cheng, Zhijun; Lei, Cailin; Liu, Shijia; Liu, Xi; Tian, Yunlu; Jiang, Ling; Ge, Song; Wu, Chuanyin; Tao, Dayun; Wang, Haiyang; Wan, Jianmin
2018-06-08
Selfish genetic elements are pervasive in eukaryote genomes, but their role remains controversial. We show that qHMS7 , a major quantitative genetic locus for hybrid male sterility between wild rice ( Oryza meridionalis ) and Asian cultivated rice ( O. sativa ), contains two tightly linked genes [ Open Reading Frame 2 ( ORF2 ) and ORF3 ]. ORF2 encodes a toxic genetic element that aborts pollen in a sporophytic manner, whereas ORF3 encodes an antidote that protects pollen in a gametophytic manner. Pollens lacking ORF3 are selectively eliminated, leading to segregation distortion in the progeny. Analysis of the genetic sequence suggests that ORF3 arose first, followed by gradual functionalization of ORF2 Furthermore, this toxin-antidote system may have promoted the differentiation and/or maintained the genome stability of wild and cultivated rice. Copyright © 2018 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.
How real are composite fermions?
International Nuclear Information System (INIS)
Kang, W.; Stormer, H.L.; Pfeiffer, L.N.; Baldwin, K.W.; West, K.W.
1995-01-01
A new picture of fractional quantum Hall effect (FQHE) in terms of a novel particle called composite fermion has emerged recently. A composite fermion is a composite of two flux quanta which are effectively bound to an electron as a result of electron-electron interaction. A system of electrons at half-filled Landau level can be transformed to an equivalent system of composite fermions at zero effective magnetic field with a distinct Fermi surface. The FQHE is then viewed as the integral quantum Hall effect of composite fermions away from half-filling. In order to test for these new particles, we have studied transport of anti-dot superlattices in a two-dimensional electron gas. At low magnetic fields electron transport exhibits well-known resonances at fields where the classical cyclotron orbit becomes commensurate with the anti-dot lattice. At half-filling we observe the same dimensional resonances. This establishes the ''semi-classical'' behavior of composite fermions. (orig.)
Therapeutic problems in cyanide poisoning
van Heijst, A. N.; Douze, J. M.; van Kesteren, R. G.; van Bergen, J. E.; van Dijk, A.
1987-01-01
In three patients with severe acute cyanide poisoning, a cyanosis was observed instead of the bright pink skin coloration often mentioned as a sign in textbooks. Treatment of cardiopulmonary insufficiency is as essential as antidotal therapy and the use of sodium nitrite and 4-DMAP is not without
Effect of Megaphrynium Macrostachyum Leaf Extract on some ...
African Journals Online (AJOL)
It can be used as an antidote against arthropod or snake poisoning and venoms. This study was designed to investigate the effects of Megaphrynium macrostachyum extract on some haematological parameters using albino rats. Materials/Method: Sixteen albino rats were divided into three groups with group 1 and 2 ...
Antidote to Learned Helplessness: Empowering Youth through Service
Mueller, Alison
2005-01-01
A powerful practical reclaiming strategy for youth at risk is to tap their potential for service to others. This counters a sense of learned helplessness. The term "learned helplessness" (Seligman, 1975) comes to mind when the author thinks about when she began working with troubled youth more than 20 years ago. Her and her co-workers often spoke…
Effects of Methionine Containing Paracetamol Formulation on ...
African Journals Online (AJOL)
Effects of Methionine Containing Paracetamol Formulation on Serum Vitamins and Trace Elements in Male Rats. AA Iyanda, JI Anetor, DP Oparinde, FAA Adeniyi. Abstract. Methionine is an effective antidote in the treatment of paracetamol-induced toxicity but at large doses it has been reported to induce or aggravate a ...
Phytochemical and Pharmacological Studies of the Genus Tacca : A ...
African Journals Online (AJOL)
Tacca is an important genus comprising of approximately 15 species of the medicinal plants (Taccaceae). The plants are used in traditional medicine to relieve pains of the body and stomach, as an antidote for food poisoning as well as for their analgesic, antipyretic and anti-inflammatory activities. Chemical studies have ...
Hendry, Leo B.; Reid, Marylou
2000-01-01
Discusses social belonging as both a health-related goal and an antidote for emotional crises. Examines how social connectedess represents both a content and process variable in Northern Scottish young people's discussion of their health concerns. Analyses reveal both the potency of all these concerns and participants' belief that skills acquired…
Antimicrobial and toxicological studies of Epa-ijebu. a “wonder – cure”
African Journals Online (AJOL)
'Epa-ijebu' is regarded as a “wonder cure” concoction used in curing many diseases and as an antidote to scorpion and snake bites among the Yoruba's in South West, Nigeria. Initial report had indicated antibacterial activity of the concoction against some common bacterial pathogens. This present study screened for ...
[A patient who refused treatment after self-poisoning with paracetamol
Kramers, C.; Jansman, F.G.A.; Droogleever Fortuyn, H.A.
2006-01-01
Two patients, a 20-year-old man and a 33-year-old woman, were admitted with paracetamol poisoning. Both patients refused treatment initially but eventually complied. The man had a paracetamol concentration of 47.5 mg/l 2.5-5.0 h after ingestion, so antidote treatment was not considered necessary.
The School Uniform Movement and What It Tells Us about American Education: A Symbolic Crusade
Brunsma, David L.
2004-01-01
This book represents the most thorough exposition on the present understanding of the impetuses, debates, legalities, and effectiveness of school uniform policies that have rapidly entered the discourse of school reform in the United States. In it, David Brunsma provides an antidote to the ungrounded, anecdotal components that define the…
Mind the Gap: Infilling Stiegler's Philosophico-Educational Approach to Social Innovation
Reveley, James; Peters, Michael A.
2016-01-01
According to Bernard Stiegler, social innovations in the educational field are an antidotical cure for social pathologies wrought by the digitalisation of society. This article explores how Stiegler's social pharmacology links to the human-technical co-constitution thesis that he first expounded in "Technics and Time, 1." Not only do we…
Vericker, Tracy C.
2013-01-01
Childhood obesity is emerging as a considerable public health problem with no clear antidote. The school food environment is a potential intervention point for policy makers, with competitive food and beverage regulation as a possible policy lever. This research examines the link between competitive food and beverage availability in school and…
Catching Up: Gender Values at a Canadian Independent School for Girls, 1978-93.
Heyward, Candace B.
1995-01-01
Examines the 15-year transformation in gender values at a Canadian independent school for girls and their effect on the students and the school structures. Gender-stereotyped, outside-world realities are still influencing the school environment and students' thinking. The author believes single-sex schools for girls are an important antidote to…
"Peer Pressure" and the Group Process: Building Cultures of Concern
Tate, Thomas F.; Copas, Randall L.
2010-01-01
Peer group treatment has been subject to two main lines of criticism. Some suggest any program which aggregates antisocial youth inevitably fosters negative peer influence. Others are concerned that certain peer programs are based on coercive peer confrontation. Positive Peer Culture [PPC] is an antidote to both of these varieties of toxic group…
Energy Technology Data Exchange (ETDEWEB)
Stillrich, H.
2007-07-01
The production and characterization of magnetic nanostructures based on Co/Ptmultilayers are described in this thesis. Nanostructure arrays of Co/Pt multilayer films are generated utilizing the self-assembly of block copolymer micelles with a few 10nm diameter. For an understanding of the magnetic properties of nanostructures the properties of Co/Pt-multilayer films are examined first. The films are grown via different sputter techniques. The structural and magnetic properties are investigated depending on the deposition technique. The sources of magnetic anisotropy are discussed based on these investigations. One major topic concerning Co/Pt-multilayers is the reorientation of the easy axis of magnetization from perpendicular to in-plane as a function of the cobalt and platinum layer thicknesses. Combining averaging magnetization measurements and high resolution magnetic imaging, the canting of magnetization within the reorientation transition and a canted domain structure were found. The basis for magnetic nanostructures are Co/Pt-multilayers that were optimized for strong magnetic anisotropy. Magnetic antidot and dot arrays are generated from Co/Pt-multilayers via novel methods utilizing block copolymer micelle masks and ion milling. The generation of nanostructure arrays is proven by the morphologic and topographic properties, combined with the evolution of magneto-optic signals. Two different approaches for the generation of antidot arrays are shown. The magnetic properties of antidot arrays with perpendicular and in-plane easy magnetization are investigated. Magnetic dot arrays are produced utilizing the cores of SiO{sub 2} filled block copolymer micelles. The dot arrays consist of single domain particles. The switching field distribution of the dot arrays is analysed and described using the size distribution of the magnetic particles. Magnetic nanostructures in the region of the superparamagnetic limit are investigated. (orig.)
Meagher, Peter J.
2009-01-01
The focus of this dissertation was the use of restorative justice practices in the collegiate setting. Some have expressed concern with the legal nature of campus conduct processes. Restorative practices have been implemented in criminal justice and K-12 settings and are seen by some as an antidote to overly legalistic campus conduct processes.…
Department of Defense In-House RDT&E Activities
1983-10-30
CAPABLE OF PERF GEN INVEST IN FLD OF HYD,SOIL MECH,CONCRETE,MOBILITY OF MIL VEH,EXPLO EFFECOLOOY,COASTAL ENGINEERING & DEY OF STIRUCT & PAVEMENT DESIGN...REAL PROP EQUIP 8! 36.426 15.345 98.429 150.200 9.246 6.160 1... .MISSION FUNDEMENTAL RES ON MECHANISMS OF ACTION (CW AGENTS,ANTIDOTES’& PRETREAT
Mario Bunge's Materialist Theory of Mind and Contemporary Cognitive Science
Slezak, Peter
2012-01-01
Bunge's writings on the mind-body problem provide a rigorous, analytical antidote to the persistent anti-materialist tendency that has characterized the history of philosophy and science. Bunge gives special attention to dualism and its shortcomings, and this attention is welcome in view of the resurgence of the doctrine today. However, I focus my…
The Fearless School Leader: Making the Right Decisions
McCabe, Cynthia
2011-01-01
This book identifies the six fearless decisions that school leaders need to make to be successful. The author analyzes the top fears that impede effective leadership and lower student achievement, then provides a step by step antidote that will change fear into intention, increase confidence, and produce positive results in your school. In this…
Distressing bacteria: structure of a prokaryotic detox program.
de la Cueva-Méndez, Guillermo
2003-04-01
MazF and MazE are components of a chromosomal toxin-antitoxin system of Escherichia coli. In this issue of Molecular Cell, Kamada et al. describe the crystal structure of a MazE/MazF heterohexamer and propose that the mechanism of toxin-antidote recognition is common to other homologous chromosomal and plasmid-borne systems.
Czech Academy of Sciences Publication Activity Database
Yurchenko, Vitaliy; Jirsa, Miloš; Stupakov, Oleksandr; Wördenweber, R.
2005-01-01
Roč. 139, 1/2 (2005), s. 331-338 ISSN 0022-2291. [NATO Advanced Research Workshop. Yalta Crimea , 13.09.2004-17.09.2004] Institutional research plan: CEZ:AV0Z1010914 Keywords : superconducting thin films * antidots * vortex dynamics * vortex pinning * relaxation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.753, year: 2005
An Essay Is Being Written: Between Aggression and "Just Words"
Farley, Lisa
2012-01-01
If education tends to be viewed as an antidote to social violence, this paper turns to Freud's study of the "beating fantasy" to consider the fictional representation of psychical aggression in scenes of schooling and being schooled. It is argued that such representations both express and fend off libidinal passions at the heart of…
Hypolipidemic effect of aqueous leaf extract of carmona microphylla ...
African Journals Online (AJOL)
1Department of Pharmacology, Hainan Medical University, School of ... Purpose: To investigate the hypolipidemic effects of the aqueous leaf extract of ... HepG2 liver cells, as well as in high-fat diet (HFD)- and triton WR-1339 ... antidote to food poisoning [14,15]. In the ..... atorvastatin (p.o. 5 mg/kg); C. microphylla aqueous.
RICE, JULIUS T.
A SHORT HISTORY OF NARCOTICS USAGE IS PRESENTED. THE TERM DRUG DEPENDENCE IS BEING SUBSTITUTED FOR DRUG ADDICTION AND DRUG HABITUATION. THE ADVANTAGES AND DISADVANTAGES OF VARIOUS ANTIDOTES FOR OPIATES ARE DESCRIBED. THE EFFECTS OF LSD AND MARIJUANA ON PHYSICAL AND MENTAL PROCESSES ARE DESCRIBED. THE USE OF LSD FOR MEDICAL PURPOSES IS DISCUSSED.…
Energy Technology Data Exchange (ETDEWEB)
Taylor, P.
1994-10-01
The interactions of substrates, inhibitors and antibodies with Torpedo and mammalian acetylcholinesterases and butyrylcholinesterases have been studied by enzyme kinetic analyses, site-specific mutagenesis, molecular modeling, and peptide and antibody titrations. The high yield expression systems we developed have enabled us to obtain sufficient wild-type and mutant enzymes for the kinetic and physical studies. These studies have benefited from the availability of a three-dimensional X-ray-derived structure of acetylcholinesterase which allows for interpretations at an atomic level of resolution. Three distinct regions in the enzyme appear responsible for conferring selectivity: the acyl pocket defined primarily by phenylalanines 295 and 297, the choline subsite primarily defined by tryptophan 86, tyrosine 337 and glutamate 202 and the peripheral anionic site defined by tryptophan 286, tyrosine 72, tyrosine 124 and aspartate 74. Through site-specific mutagenesis we have been able to modify acyl pocket specificity, selectivity toward neutral and charged substrates, substrate inhibition, organophosphate reactivity, organophosphate aging and oxime reactivation. These studies have important implications in developing superior antidotes for organophosphate poisoning and in using recombinant acetylcholinesterase as an antidote.
Directory of Open Access Journals (Sweden)
Masatake Niwa
2010-10-01
Full Text Available In our previous report, rosmarinic acid (RA was revealed to be an antidote active compound in Argusia argentea (family: Boraginaceae. The plant is locally used in Okinawa in Japan as an antidote for poisoning from snake venom, Trimeresurus flavoviridis (habu. This article presents mechanistic evidence of RA’s neutralization of the hemorrhagic effects of snake venom. Anti-hemorrhagic activity was assayed by using several kinds of snake venom. Inhibition against fibrinogen hydrolytic and collagen hydrolytic activities of T. flavoviridis venom were examined by SDS-PAGE. A histopathological study was done by microscopy after administration of venom in the presence or absence of RA. RA was found to markedly neutralize venom-induced hemorrhage, fibrinogenolysis, cytotoxicity and digestion of type IV collagen activity. Moreover, RA inhibited both hemorrhage and neutrophil infiltrations caused by T. flavoviridis venom in pathology sections. These results demonstrate that RA inhibited most of the hemorrhage effects of venom. These findings indicate that rosmarinic acid can be expected to provide therapeutic benefits in neutralization of snake venom accompanied by heat stability.
Shweder, Richard A
2015-01-01
Freely staying on the move between alternative points of view is the best antidote to dogmatism. Robert Merton's ideals for an epistemic community are sufficient to correct pseudo-empirical studies designed to confirm beliefs that liberals (or conservatives) think deserve to be true. Institutionalizing the self-proclaimed political identities of social psychologists may make things worse.
Understanding Leadership: An Experimental-Experiential Model
Hole, George T.
2014-01-01
Books about leadership are dangerous to readers who fantasize about being leaders or apply leadership ideas as if they were proven formulas. As an antidote, I offer an experimental framework in which any leadership-management model can be tested to gain experiential understanding of the model. As a result one can gain reality-based insights about…
Sozial Studies: How Travel Abroad Empowers a Global Perspective
Pearcy, Mark
2014-01-01
The personal experiences and values of individual teachers can tend to restrict the ability to promote a "global perspective" in the social studies, the subject area most suited to that concept. One antidote to this instructional myopia is the prospect of overseas travel, in the form of study tours, the type of which have been shown to…
Artocarpus heterophyllus Lam. (lackfruit tree; Hindi: Katha!) of ...
Indian Academy of Sciences (India)
The entire female inflorescence together with parts of individual flowers forms a large multiple fruit. The sepals and petals become fleshy and juicy to form the edible part of the fruit. The timber is hard and durable and usedfor making various wooden articles. The leaves are used in skin diseases and as an antidote to snake ...
Indian Academy of Sciences (India)
The tree is a host of lac insects which secrete a resinous substance that yields shellac or lac. A ruby-coloured gum known as Bengal Kino is collected from the incisions made in the bark. The wood, resistant to water, is used in water-well work. The seeds are used as anthelmintic and as an antidote for snake-bite.
Cordia dichotomoa Forst. f Syn. C. obliqua Willd. (English: Sebesten ...
Indian Academy of Sciences (India)
ropes, cordage and paper pulp. The fruit is an astringent and is used in affections o.f urinary passages, diseases o.llllngs and spleen. The decoction of bark is used infevers. The kernels are used in treating ring-worm. The leaves are used in treating ulcers and headache. The plant is used as an antidote to snake-bite.
Cavalcante, S. F. A.; de Paula, R. L.; Kitagawa, D. A. S.; Barcellos, M. C.; Simas, A. B. C.; Granjeiro, J. M.
2018-03-01
This paper deals with challenges that Brazilian Army Organic Synthesis Laboratory has been going through to access reference compounds related to the Chemical Weapons Convention in order to support verification analysis and for research of novel antidotes. Some synthetic procedures to produce the chemicals, as well as Quality Assurance issues and a brief introduction of international agreements banning chemical weapons are also presented.
[Critical haematuria after prostate biopsies with RIVAROXABAN. Case report].
Olivier, J; Yakoubi, R; Gras, S; Van Agt, G; Delepaul, B
2013-10-01
Managing patients with new oral anticoagulants in perioperative period is not yet well protocolized. We report a clinical case of a critical haematuria after prostate biopsies to a patient treated with RIVAROXABAN. Monitoring and treatment of the haematuria have been difficult due to the lack of biological control and antidote for this treatment. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
Mimusops elengi L. (Bulletwood tree; Hindi: Bakul or Maulsari) of ...
Indian Academy of Sciences (India)
tree is often cultivated in parks and as an avenue tree. The fascicled flowers are small, white and sweet-scented. The ovoid berries are edible. The bark is astringent, tonic and used in fevers. Leaves are an antidote to snake-bite. The pulp of the fruit is used in curing chronic dysentery. Powder of dried flowers is a brain tonic.
Infabric - "Dive into the fabric of opinion"
CERN. Geneva
2017-01-01
"Why should I trust this article and not that one? Why the hell do you think something sooo stupid!?" I want to build an interactive online publishing platform promoting fact-based structured argumentation designed to act as an antidote for problems of the post-truth society. I'm looking for people who would like to help me to create a prototype right now.
George Herbert Mead on consciousness: antidote to Cartesian absurdities?
DEFF Research Database (Denmark)
Willert, Søren
The article explicates George Herbert Mead's theory of consciousness as presented in Mind, Self and Society. According to Mead, the term consciousness may refer to three different sets of phenomena: (1) the environment as implied by our goal-directed action; Mead names this consciousness aspect...... experience; it is shared by humans and subhuman animals alike; (2) consciousness of environmental experience; Mead names this consciousness aspect awareness; it is exclusively human; (3) the peculiar sensed qualities attaching to consciousness, equalling what is today named qualia. Descartes......-inspired psychology makes the third consciousness aspect all-important. Within Mead's framework for a darwinistically inspired psycholgy, it becomes theoretically insignificant....
Local School Micropolitical Agency: An Antidote to New Managerialism
Johnson, Bruce
2004-01-01
This paper reports research into the micropolitical strategies used by five school leadership teams in the South Australian School-based Research and Reform Project. The research challenges many of the orthodoxies of educational managerialism. For example: the use of leadership teams made up of teachers, coordinators and senior school leaders…
Medical anthropology as an antidote for ethnocentrism in Jesus ...
African Journals Online (AJOL)
Test
2011-02-02
Feb 2, 2011 ... increases the risk of ethnocentrism and consequently distorts in many instances the healing accounts of the .... Medical anthropology exists by virtue of biomedicine. Medical ... go far beyond the reductionistic view of the 'germ theory' found in the ..... this easily happens in the case of so-called culture-bound.
SECONDARY PHYSICAL EDUCATION AVOIDANCE AND GENDER: PROBLEMS AND ANTIDOTES
Directory of Open Access Journals (Sweden)
Thomas Ryan
2012-07-01
Full Text Available Our goal was to locate and evaluate the barriers that impact and cause females to avoid secondary elective physical education courses. We sought to find answers to stop the further decline of female enrolment in secondary physical education by looking into curricula, program and instructional variables. Anecdotal evidence informed this study which was very much exploratory, building upon several key facts. First, Ontario (Canada secondary students are only required to take one credit (course in physical education in order to graduate and second, most students take the required physical education course in grade nine which is their first year of high school. Following this there is an average of 10% fewer females in every physical education class in the province of Ontario and only an average of 12% are enrolled in physical education each year. Several issues were identified and explored including self-confidence; motivation; perceived value of physical activity; opportunities for physical activity; marking scheme; competition; co-ed classes; teaching approach; and peers as possible problems and solutions.
Secondary Physical Education Avoidance and Gender: Problems and Antidotes
Ryan, Thomas; Poirier, Yves
2012-01-01
Our goal was to locate and evaluate the barriers that impact and cause females to avoid secondary elective physical education courses. We sought to find answers to stop the further decline of female enrolment in secondary physical education by looking into curricula, program and instructional variables. Anecdotal evidence informed this study which…
Nonlinear geometric scaling of coercivity in a three-dimensional nanoscale analog of spin ice
Shishkin, I. S.; Mistonov, A. A.; Dubitskiy, I. S.; Grigoryeva, N. A.; Menzel, D.; Grigoriev, S. V.
2016-08-01
Magnetization hysteresis loops of a three-dimensional nanoscale analog of spin ice based on the nickel inverse opal-like structure (IOLS) have been studied at room temperature. The samples are produced by filling nickel into the voids of artificial opal-like films. The spin ice behavior is induced by tetrahedral elements within the IOLS, which have the same arrangement of magnetic moments as a spin ice. The thickness of the films vary from a two-dimensional, i.e., single-layered, antidot array to a three-dimensional, i.e., multilayered, structure. The coercive force, the saturation, and the irreversibility field have been measured in dependence of the thickness of the IOLS for in-plane and out-of-plane applied fields. The irreversibility and saturation fields change abruptly from the antidot array to the three-dimensional IOLS and remain constant upon further increase of the number of layers n . The coercive force Hc seems to increase logarithmically with increasing n as Hc=Hc 0+α ln(n +1 ) . The logarithmic law implies the avalanchelike remagnetization of anisotropic structural elements connecting tetrahedral and cubic nodes in the IOLS. We conclude that the "ice rule" is the base of mechanism regulating this process.
Directory of Open Access Journals (Sweden)
Yang Xin
Full Text Available This study attempted to clarify the material basis for the detoxification of Rhizoma Zingiberis (RZ on aconitine, an analgesic drug, by quantitatively assessing the influence of RZ on the in vitro intestinal concentration of aconitine using an everted gut sac model and by qualitatively identifying the components in the RZ extract. To quantify aconitine in rat everted gut sacs, both an accurate processing method and a sensitive detection method were required. We developed a three-step sample processing method to protect the components from decomposition and applied ultra-performance liquid chromatography coupled with triple quadrupole mass spectrometry (UPLC/TQMS to quantify aconitine, glucose and digoxin. In addition, ultra-performance liquid chromatography coupled with linear ion trap mass spectrometry (UPLC/ITMS was applied to detect the potential antidotal components in the RZ extract. Finally, the RZ extract reduced the level of aconitine in everted gut sacs, and eleven gingerols were successfully identified, which could be considered potential antidotal components for aconitine. This study demonstrated the application of two UPLC/MS methods for analyzing the material basis for the reciprocity between Chinese medicine components in everted gut sacs.
Detoxication and removal of uranium by phenolic chelating agents
International Nuclear Information System (INIS)
Luo Meichu; Chen Guibao; Li Landi
1992-01-01
The use of phenolic chelating agents for detoxication and removal of uranyl nitrate in mice and rats is reported. Antidotal test: 8102, 7601 and 811 were given 2 mM/kg subcutaneously to mice and 1 mM/kg intramuscularly to rats when the animals were injected i.p. with different doses (100-500 mg/kg) of uranyl nitrate. The results showed that the antidotal effects of 8102 and 7601 were better than 811 in augmenting survival, survival time (day) and renal factor (kidney weight/body weight x100). 8102 was superior to 7601 against higher dose of uranyl nitrate intoxication. Removal test: five phenolic chelating agents (8102, 7601, 811, 7603 and 8307) were studied in rats. The results obtained demonstrated that 8102 and 7601 were better than 811, 7603 and 8307 in increasing U excretion in the urine after acute uranyl nitrate intoxication. The effects of different doses (300-1000 μM/kg) of 8102 was superior to 7601 in increasing U excretion in the urine and decreasing U deposition in the tissues. The toxicity and dose of 8102 in treating uranium intoxication are discussed
Sakthivel, G.; Dey, Amitabha; Nongalleima, Kh.; Chavali, Murthy; Rimal Isaac, R. S.; Singh, N. Surjit; Deb, Lokesh
2013-01-01
The present study emphasizes to reveal the antivenom activity of Aristolochia bracteolata Lam., Tylophora indica (Burm.f.) Merrill, and Leucas aspera S. which were evaluated against venoms of Daboia russelli russelli (Russell's viper) and Naja naja (Indian cobra). The aqueous extracts of leaves and roots of the above-mentioned plants and their polyherbal (1 : 1 : 1) formulation at a dose of 200 mg/kg showed protection against envenomed mice with LD50 doses of 0.44 mg/kg and 0.28 mg/kg against Russell's viper and cobra venom, respectively. In in vitro antioxidant activities sample extracts showed free radical scavenging effects in dose dependent manner. Computational drug design and docking studies were carried out to predict the neutralizing principles of type I phospholipase A2 (PLA2) from Indian common krait venom. This confirmed that aristolochic acid and leucasin can neutralize type I PLA2 enzyme. Results suggest that these plants could serve as a source of natural antioxidants and common antidote for snake bite. However, further studies are needed to identify the lead molecule responsible for antidote activity. PMID:23533518
Mustard Group Chemical War Agents from Preventive Medicine Perspective
Directory of Open Access Journals (Sweden)
Muharrem Ucar
2007-06-01
Full Text Available Although many preventive efforts and treaties, chemical warfare agents have still been a severe assault form against both military and civilian individuals. The most important chemical warfare agents sulphur mustard and others are easy to handle and cheap those the important reasons to accept sulphur mustard as a chemical warfare agent. Many individuals attacked by sulphur mustard have severe health problems such as respiratory system diseases. After ten years of sulphur mustard exposure, several health problems such as respiratory tract problems (%42.5, eye problems (%40 and other systemic diseases have been observed to insist on induviduals when examined. Exposure of even single sulphur mustard exposure has been seen to result high level of disability and early deaths. In spite of the fact that there is no available antidote and/or remedy against sulphur mustard exposure, our country has an incremental chemical assault threat for both military personels and civilians because of its jeopolitics position. Experimental studies regarding sulphur mustard toxicity will be helpful for novel preventive strategies and antidot devolepment. [TAF Prev Med Bull 2007; 6(3.000: 209-214
2010-11-01
and the resulting survey was piloted among a group of 24 physicians, nurses , and governmental officials. It was submitted to an institu- tional...appropriate antidotes. ch emical attack with nerve agents could be devastat- g. As physicians, nurses , and allied health profession- , it is our professional...state and local medical countermeasure stockpile investments through the Shelf-Life Extension Program. Biosecur Bioterror. 2009; 7(1): 101-107. 86
Transforming impostors into heroes. Metaphors for innovative nursing education.
Heinrich, K T
1997-01-01
Nurses negotiating professional transitions, whether they are entering an academic program or assuming a new role in the workplace, often feel like impostors. The metaphor of the hero can serve as an "antidote" to the impostor syndrome. The author describes an educational experience shaped around the impostor and hero metaphors that integrates feminist process with expressive methods to transform nurses' perceptions of themselves from impostors into heroes.
Overview, prevention and management of chemotherapy extravasation
Kreidieh, Firas Y; Moukadem, Hiba A; El Saghir, Nagi S
2016-01-01
Chemotherapy extravasation remains an accidental complication of chemotherapy administration and may result in serious damage to patients. We review in this article the clinical aspects of chemotherapy extravasation and latest advances in definitions, classification, prevention, management and guidelines. We review the grading of extravasation and tissue damage according to various chemotherapeutic drugs and present an update on treatment and new antidotes including dexrazoxane for anthracycl...
Energy Technology Data Exchange (ETDEWEB)
Eyer, Florian, E-mail: Florian.Eyer@mac.com [Department of Toxicology, Klinikum rechts der Isar, Munich (Germany); Steimer, Werner [Institute of Clinical Chemistry and Pathobiochemistry, Klinikum rechts der Isar, Munich (Germany); Nitzsche, Thomas [Munich Center for Integrated Protein Science (CIPS-M), Freising-Weihenstephan (Germany); Lehrstuhl für Biologische Chemie, Technische Universität München, Freising-Weihenstephan (Germany); Jung, Nicole; Neuberger, Heidi [Department of Toxicology, Klinikum rechts der Isar, Munich (Germany); Müller, Christine [Institute of Clinical Chemistry and Pathobiochemistry, Klinikum rechts der Isar, Munich (Germany); Schlapschy, Martin [Munich Center for Integrated Protein Science (CIPS-M), Freising-Weihenstephan (Germany); Lehrstuhl für Biologische Chemie, Technische Universität München, Freising-Weihenstephan (Germany); Zilker, Thomas [Department of Toxicology, Klinikum rechts der Isar, Munich (Germany); Skerra, Arne [Munich Center for Integrated Protein Science (CIPS-M), Freising-Weihenstephan (Germany); Lehrstuhl für Biologische Chemie, Technische Universität München, Freising-Weihenstephan (Germany)
2012-09-15
Lipocalins tailored with high affinity for prescribed ligands, so-called anticalins, constitute promising candidates as antidotes. Here, we present an animal study to investigate both pharmacokinetic and clinical effects of an anticalin specific for the digitalis compound digoxin. Intravenous digoxin (2.5–50 μg/kg/min) was administered to rats until first changes in the ECG occurred (dose finding study) or a priori for 30 min (kinetic study). The anticalin DigA16(H86N), dubbed DigiCal, was administered intravenously at absolute doses of 1, 5, 10 and 20 mg, while the control group received isotonic saline. Hemodynamic changes, several ECG parameters and digoxin concentration in plasma were monitored at given time intervals. After DigiCal administration free digoxin concentration in plasma ultrafiltrate declined dramatically within 1 min to the presumably non-toxic range. There was also a significant and DigiCal dose-dependent effect on longer survival, less ECG alterations, arrhythmia, and improved hemodynamics. Infusion of a lower digoxin dose (2.5 μg/kg/min) resulted in a more sustained reduction of free digoxin in plasma after DigiCal administration compared to a higher digoxin dose (25 μg/kg/min), whereas ECG and hemodynamic parameters did not markedly differ, reflecting the known relative insensitivity of rats towards digoxin toxicity. Notably, we observed a re-increase of free digoxin in plasma some time after bolus administration of DigiCal, which was presumably due to toxin redistribution from tissue in combination with the relatively fast renal clearance of the rather small protein antidote. We conclude that anticalins with appropriately engineered drug-binding activities and, possibly, prolonged plasma half-life offer prospects for next-generation antidotal therapy. -- Highlights: ► We provide an advanced model of digoxin toxicity in rats. ► We report on binding of digoxin to a novel designed anticalin. ► We report on pharmacokinetics of digoxin
Energy Technology Data Exchange (ETDEWEB)
Wilhelm, Christina M., E-mail: wilhelmc@battelle.org [Battelle, 505 King Avenue, JM-7, Columbus, OH 43201-2693 (United States); Snider, Thomas H., E-mail: snidert@battelle.org [Battelle, 505 King Avenue, JM-7, Columbus, OH 43201-2693 (United States); Babin, Michael C., E-mail: babinm@battelle.org [Battelle, 505 King Avenue, JM-7, Columbus, OH 43201-2693 (United States); Jett, David A., E-mail: jettd@ninds.nih.gov [National Institutes of Health/National Institute of Neurological Disorders and Stroke, Bethesda, MD 20892 (United States); Platoff, Gennady E., E-mail: platoffg@niaid.nih.gov [National Institutes of Health/National Institute of Allergy and Infectious Diseases, Bethesda, MD 20892 (United States); Yeung, David T., E-mail: dy70v@nih.gov [National Institutes of Health/National Institute of Neurological Disorders and Stroke, Bethesda, MD 20892 (United States)
2014-12-15
The currently fielded pre-hospital therapeutic regimen for the treatment of organophosphorus (OP) poisoning in the United States (U.S.) is the administration of atropine in combination with an oxime antidote (2-PAM Cl) to reactivate inhibited acetylcholinesterase (AChE). Depending on clinical symptoms, an anticonvulsant, e.g., diazepam, may also be administered. Unfortunately, 2-PAM Cl does not offer sufficient protection across the range of OP threat agents, and there is some question as to whether it is the most effective oxime compound available. The objective of the present study is to identify an oxime antidote, under standardized and comparable conditions, that offers protection at the FDA approved human equivalent dose (HED) of 2-PAM Cl against tabun (GA), sarin (GB), soman (GD), cyclosarin (GF), and VX, and the pesticides paraoxon, chlorpyrifos oxon, and phorate oxon. Male Hartley guinea pigs were subcutaneously challenged with a lethal level of OP and treated at approximately 1 min post challenge with atropine followed by equimolar oxime therapy (2-PAM Cl, HI-6 DMS, obidoxime Cl{sub 2}, TMB-4, MMB4-DMS, HLö-7 DMS, MINA, and RS194B) or therapeutic-index (TI) level therapy (HI-6 DMS, MMB4-DMS, MINA, and RS194B). Clinical signs of toxicity were observed for 24 h post challenge and blood cholinesterase [AChE and butyrylcholinesterase (BChE)] activity was analyzed utilizing a modified Ellman's method. When the oxime is standardized against the HED of 2-PAM Cl for guinea pigs, the evidence from clinical observations, lethality, quality of life (QOL) scores, and cholinesterase reactivation rates across all OPs indicated that MMB4 DMS and HLö-7 DMS were the two most consistently efficacious oximes. - Highlights: • First comprehensive evaluation of leading AChE oxime reactivators • All oximes are compared against current U.S. therapy 2-PAM Cl. • Relative therapeutic oxime efficacies against OP CWNA and pesticides • Contribution to more effective
1983-02-01
National Cancer institute. Performance decrements caused by ’urrent nerve agent antidotes were determined in animal models. Methods and com- pounds for...WA; and Farber Cancer Institute, Boston, MA. Thirty-three additional contractors with contracts totaling $1,735,883 Support thi effort . (U) PROJECTS...Developing, and Maintaini Unit Cohesion," and draft mama entitied "Marnen of Stress in Army Opentns" and "Soldier Performance In Continuous Operadons
Grace, Pamela J; Robinson, Ellen M; Jurchak, Martha; Zollfrank, Angelika A; Lee, Susan M
2014-12-01
The experience of unaddressed moral distress can lead to nurse attrition and/or distancing from patients, compromising patient care. Nurses who are confident in their ethical decision making abilities and moral agency have the antidote to moral distress for themselves and their colleagues and can act as local or institutional ethics resources. We describe a grant-funded model education program designed to increase ethics competence throughout the institution.
LightKone Project: Lightweight Computation for Networks at the Edge
Van Roy, Peter; TEKK Tour Digital Wallonia
2017-01-01
LightKone combines two recent advances in distributed computing to enable general-purpose computing on edge networks: * Synchronization-free programming: Large-scale applications can run efficiently on edge networks by using convergent data structures (based on Lasp and Antidote from previous project SyncFree) → tolerates dynamicity and loose coupling of edge networks * Hybrid gossip: Communication can be made highly resilient on edge networks by combining gossip with classical distributed al...
[A case of favourable outcome of the treatment of extremely severe acute poisoning with methanol].
Batotsyrenov, B V; Livanov, G A; Vasil'ev, S A; Fedorov, A V; Antrianov, A Iu
2013-01-01
A case of favourable outcome of the treatment of extremely severe acute poisoning after prolonged exposure to lethal doses of methanol is reported. The complex treatment included urgent and effective elimination of the poison (multiple gastric lavage, hemodialysis), antidote therapy (administration of ethanol), correction of decompensated metabolic acidosis (alkali therapy and infusion therapy with reamberin). These measures had beneficial effect on the clinical course of poisoning and ensured its favourable outcome.
Moving vortex matter with coexisting vortices and anti-vortices
International Nuclear Information System (INIS)
Carneiro, Gilson
2009-01-01
Moving vortex matter, driven by transport currents independent of time, in which vortices and anti-vortices coexist is investigated theoretically in thin superconducting films with nanostructured defects. A simple London model is proposed for the vortex dynamics in films with periodic arrays of nanomagnets or cylindrical holes (antidots). Common to these films is that vortex anti-vortex pairs may be created in the vicinity of the defects by relatively small transport currents, because it adds to the current generated by the defects - the nanomagnets screening current, or the antidots backflow current - and may exceed locally the critical value for vortex anti-vortex pair creation. The model assumes that vortex matter dynamics is governed by Langevin equations, modified to account for creation and annihilation of vortex anti-vortex pairs. For pair creation, it is assumed that whenever the total current at some location exceeds a critical value, equal to that needed to separate a vortex from an anti-vortex by a vortex core diameter, a pair is created instantaneously around this location. Pair annihilation occurs by vortex anti-vortex collisions. The model is applied to films at zero external magnetic field and low temperatures. It is found that several moving vortex matter steady-states with equal numbers of vortices and anti-vortices are possible.
Bebarta, Vikhyat S; Brittain, Matthew; Chan, Adriano; Garrett, Norma; Yoon, David; Burney, Tanya; Mukai, David; Babin, Michael; Pilz, Renate B; Mahon, Sari B; Brenner, Matthew; Boss, Gerry R
2017-06-01
The 2 antidotes for acute cyanide poisoning in the United States must be administered by intravenous injection. In the out-of-hospital setting, intravenous injection is not practical, particularly for mass casualties, and intramuscular injection would be preferred. The purpose of this study is to determine whether sodium nitrite and sodium thiosulfate are effective cyanide antidotes when administered by intramuscular injection. We used a randomized, nonblinded, parallel-group study design in 3 mammalian models: cyanide gas inhalation in mice, with treatment postexposure; intravenous sodium cyanide infusion in rabbits, with severe hypotension as the trigger for treatment; and intravenous potassium cyanide infusion in pigs, with apnea as the trigger for treatment. The drugs were administered by intramuscular injection, and all 3 models were lethal in the absence of therapy. We found that sodium nitrite and sodium thiosulfate individually rescued 100% of the mice, and that the combination of the 2 drugs rescued 73% of the rabbits and 80% of the pigs. In all 3 species, survival in treated animals was significantly better than in control animals (log rank test, Pcyanide poisoning in 3 clinically relevant animal models of out-of-hospital emergency care. Copyright © 2016 American College of Emergency Physicians. Published by Elsevier Inc. All rights reserved.
Acetaminophen overdose associated with double serum concentration peaks
Directory of Open Access Journals (Sweden)
Cristian Papazoglu
2015-12-01
Full Text Available Acetaminophen is the most commonly used analgesic–antipyretic medication in the United States. Acetaminophen overdose, a frequent cause of drug toxicity, has been recognized as the leading cause of fatal and non-fatal hepatic necrosis. N-Acetylcysteine is the recommended antidote for acetaminophen poisoning. Despite evidence on the efficacy of N-acetylcysteine for prevention of hepatic injury, controversy persists about the optimal duration of the therapy. Here, we describe the case of a 65-year-old male with acetaminophen overdose and opioid co-ingestion who developed a second peak in acetaminophen serum levels after completing the recommended 21-hour intravenous N-acetylcysteine protocol and when the standard criteria for monitoring drug levels was achieved. Prolongation of N-acetylcysteine infusion beyond the standard protocol, despite a significant gap in treatment, was critical for successful avoidance of hepatotoxicity. Delay in acetaminophen absorption may be associated with a second peak in serum concentration following an initial declining trend, especially in cases of concomitant ingestion of opioids. In patients with acetaminophen toxicity who co-ingest other medications that may potentially delay gastric emptying or in those with risk factors for delayed absorption of acetaminophen, we recommend close monitoring of aminotransferase enzyme levels, as well as trending acetaminophen concentrations until undetectable before discontinuing the antidote therapy.
Chang, Tzuu-Wang; Janardhanan, Pavithra; Mello, Charlene M; Singh, Bal Ram; Cai, Shuowei
2016-09-01
Botulinum neurotoxin (BoNT), a category A agent, is the most toxic molecule known to mankind. The endopeptidase activity of light chain domain of BoNT is the cause for the inhibition of the neurotransmitter release and the flaccid paralysis that leads to lethality in botulism. Currently, antidotes are not available to reverse the flaccid paralysis caused by BoNT. In the present study, a non-radioactive-based systematic evolution of ligands by exponential enrichment (SELEX) process is developed by utilizing surface plasmon resonance to monitor the binding enrichment. Two RNA aptamers have been identified as strong binders against light chain of botulinum neurotoxin type A. These two aptamers showed strong inhibition activity on LCA, with IC50 in nanomolar range. Inhibition kinetic studies reveal mid nanomolar KI and non-competitive nature of their inhibition, suggesting that they have strong potential as antidotes that can reverse the symptom caused by BoNT/A. More importantly, we observed that the 2'-fluorine-pyrimidine-modified RNA aptamers identified here do not change their binding and biological activities. This observation could lead to a cost-effective way for SELEX, by using regular nucleotide during SELEX, and 2'-fluorine-pyrimidine-modified nucleotide for final application to enhance their RNase-resistance.
A Rare but Potentially Fatal Poisoning; Aluminum Phosphide Poisoning
Directory of Open Access Journals (Sweden)
Orkun Tolunay
2017-04-01
Full Text Available Phosphide, a very toxic gas, is used in our country as aluminium phosphide tablets impregnated in clay. It is widely used since it has a very high diffusion capacity, whereby it can eradicate all living creatures in any form of their life cycle and does not leave any remnants in agricultural products. Aluminum phosphide poisoning is among intoxications for which there are still no true antidotes. Mortality rate varies between 30% and 100%. This paper presents a case of aluminum phosphide poisoning caused by the uncompleted suicide attempt. A 14-year-old girl, who swallowed aluminum phosphate tablets, was brought to the emergency department with the complaints of nausea and vomiting. The patient was treated with gastric lavage and activated charcoal. Since the patient ingested a lethal amount of aluminum phosphide, she was referred to the pediatric intensive care unit. The patient was discharged in stable condition after supportive care and monitoring. Specific antidotes are life-saving in poisonings. However, this case was presented to show how general treatment principles and quick access to health services affect the result of treatment. Also, we aimed to highlight the uncontrolled selling of aluminum phosphate, which results in high mortality rates in case of poisoning.
Evidence-Informed Practice: Antidote to Propaganda in the Helping Professions?
Gambrill, Eileen
2010-01-01
The most concerning issue affecting the quality of practices and policies in the helping professions is the play of propaganda, which misleads us regarding what is a problem, how (or if) it can be detected, its causes, and how (or if) it can be remedied. Propaganda is defined as encouraging beliefs and actions with the least thought possible.…
Stability of hydroxocobalamin in water for injection as cyanide antidote
Sánchez Ramos, J.J.
2012-01-01
Introducción: Los cianuros han sido utilizados como agentes de guerra química, y hoy se consideran una amenaza terrorista real. Son también la principal causa de muerte en la intoxicación por inhalación de humo de incendios en espacios cerrados. El éxito en el tratamiento de la intoxicación depende de la rapidez con la que se administren los antídotos, y con la que estos fijen el ión cianuro. La hidroxocobalamina parece ser un antídoto más apropiado que el nitrito sódico para el tratamiento e...
In search of meaningfulness: nostalgia as an antidote to boredom.
van Tilburg, Wijnand A P; Igou, Eric R; Sedikides, Constantine
2013-06-01
We formulated, tested, and supported, in 6 studies, a theoretical model according to which individuals use nostalgia as a way to reinject meaningfulness in their lives when they experience boredom. Studies 1-3 established that induced boredom causes increases in nostalgia when participants have the opportunity to revert to their past. Studies 4 and 5 examined search for meaning as a mediator of the effect of boredom on nostalgia. Specifically, Study 4 showed that search for meaning mediates the effect of state boredom on nostalgic memory content, whereas Study 5 demonstrated that search for meaning mediates the effect of dispositional boredom on dispositional nostalgia. Finally, Study 6 examined the meaning reestablishment potential of nostalgia during boredom: Nostalgia mediates the effect of boredom on sense of meaningfulness and presence of meaning in one's life. Nostalgia counteracts the meaninglessness that individuals experience when they are bored.
Animal Models for Testing Antidotes Against an Oral Cyanide Challenge
2016-08-01
Sources of toxicity and pathology from CN include accidental poisonings from natural or manmade products, fires, suicide, homicide, judicial execution...histotoxic- ( pathological term) hypoxia (Marrs et al., 2007; Gupta, 2009; Ballantyne and Salem, 2005). While normal blood oxygen levels may exist...Group of Taylor and Francis, 313–342. Ballantyne B, Salem, H. (2005). Experimental, clinical, occupational toxicology and forensic aspects of
Host Response to Botulinum Neurotoxins for Developing Diagnostics and Antidotes
2009-09-18
Toxin: Chemistry , Pharmacology, Toxicity, and Immunology. Muscle and Nerve Suppl. (6), S1-S23. Cai, S., Sarkar, H. K., and Singh, B. R., 1999...subsequent refolding by a multichaperone network. J. Biol. Chem. 273, 11032-11037. Vickery, L. E., Silberg , J. J., and Ta, D. T. (1997). Hsc66
Integrated Warfare Requirements Methodology (IWRM). Phase 1 - Feasibility Study
1981-05-29
effects of chemical antidotes will produce short-term reductions in effectiveness @ The psychological effects of mass destruction, fE ’, and the fa- tigue...scoreboards for each combat posture, iS necessary. K-i T ’Ri ATAR US i puu s t n d (t Uri Cu0! i~t .L voy )1 J I fy 1119 a3 Tif it’ s dL. t 1u e1 I V ver
Naloxone Administration in US Emergency Departments, 2000���2011
Frank, Joseph W.; Levy, Cari; Calcaterra, Susan L.; Hoppe, Jason A.; Binswanger, Ingrid A.
2015-01-01
Rates of opioid overdose and opioid-related emergency department (ED) visits have increased dramatically. Naloxone is an effective antidote to potentially fatal opioid overdose, but little is known about naloxone administration in ED settings. We examined trends and correlates of naloxone administration in ED visits nationally from 2000 to 2011. Using data from the National Hospital Ambulatory Medical Care Survey, we examined ED visits involving (1) the administration of naloxone or (2) a dia...
Toxin-Based Therapeutic Approaches
Itai Benhar; Assaf Shapira
2010-01-01
Protein toxins confer a defense against predation/grazing or a superior pathogenic competence upon the producing organism. Such toxins have been perfected through evolution in poisonous animals/plants and pathogenic bacteria. Over the past five decades, a lot of effort has been invested in studying their mechanism of action, the way they contribute to pathogenicity and in the development of antidotes that neutralize their action. In parallel, many research groups turned to explore the pharmac...
Directory of Open Access Journals (Sweden)
Toshiaki J. Hara
2011-11-01
Full Text Available Fish detect extremely low levels of marine toxins tetrodotoxin (TTX and saxitoxin (STX via the specialized gustatory receptor(s. Physiological and pharmacological studies show that receptor(s for TTX and STX are distinct from those which detect feeding stimulant amino acids and bile acids, and that TTX and STX do not share the same receptor populations, while interacting with quinine and strychnine in a competitive fashion suggestive of an antidotal relationship.
Magnetic Nanostructures Patterned by Self-Organized Materials
2016-01-05
Palma , J. Escrig, J. C. Denardin Angular dependence of the coercivity and remanence of ordered arrays of Co nanowires Journal of...J. L. Palma , C. Gallardo, L. Spinu, J. M. Vargas, L. S. Dorneles, J. C. Denardin, J. Escrig, Magnetic properties of Fe20 Ni80 antidots: Pore size and...array disorder, Journal of Magnetism and Magnetic Materials., 344, 2013, 8-13 7. E. Vargas, P. Toro, J.L. Palma , J. Escrig, C. Chaneac,
Bebarta, Vikhyat S; Tanen, David A; Boudreau, Susan; Castaneda, Maria; Zarzabal, Lee A; Vargas, Toni; Boss, Gerry R
2014-12-01
Hydroxocobalamin is a Food and Drug Administration-approved antidote for cyanide poisoning. Cobinamide is a potential antidote that contains 2 cyanide-binding sites. To our knowledge, no study has directly compared hydroxocobalamin with cobinamide in a severe, cyanide-toxic large-animal model. Our objective is to compare the time to return of spontaneous breathing in swine with acute cyanide-induced apnea treated with intravenous hydroxocobalamin, intravenous cobinamide, or saline solution (control). Thirty-three swine (45 to 55 kg) were intubated, anesthetized, and instrumented (continuous mean arterial pressure and cardiac output monitoring). Anesthesia was adjusted to allow spontaneous breathing with FiO2 of 21% during the experiment. Cyanide was continuously infused intravenously until apnea occurred and lasted for 1 minute (time zero). Animals were then randomly assigned to receive intravenous hydroxocobalamin (65 mg/kg), cobinamide (12.5 mg/kg), or saline solution and monitored for 60 minutes. A sample size of 11 animals per group was selected according to obtaining a power of 80%, an α of .05, and an SD of 0.17 in mean time to detect a 20% difference in time to spontaneous breathing. We assessed differences in time to death among groups, using Kaplan-Meier estimation methods, and compared serum lactate, blood pH, cardiac output, mean arterial pressure, respiratory rate, and minute ventilation time curves with repeated-measures ANOVA. Baseline weights and vital signs were similar among groups. The time to apnea and cyanide dose required to achieve apnea were similar. At time zero, mean cyanide blood and lactate concentrations and reduction in mean arterial pressure from baseline were similar. In the saline solution group, 2 of 11 animals survived compared with 10 of 11 in the hydroxocobalamin and cobinamide groups (Pcyanide concentrations became undetectable at the end of the study in both antidote-treated groups, and no statistically significant differences
Cyanide Toxidrome. A Cluster of Nonspecific Signs May Be a Clue
International Nuclear Information System (INIS)
Baud, F. J.; Megarbane, B.
2007-01-01
Introduction: One of the major concerns regarding a mass disaster is to clarify the involved class of toxicant. Hydrocyanic acid and its derivatives are considered a likelihood threat. However, cyanide-induced signs and symptoms are described as nonspecific, precluding any characterization at the scene. Chemical disaster may result in the exposure, at the same time, of a large number of casualties. In such a condition, not only the nature of signs and symptoms (qualitative knowledge), but also their frequency and magnitude of occurrence (quantitative knowledge) would be of value for a presumptive diagnosis. Therefore, we attempted at quantifying signs and symptoms of cyanide poisoning at the time of presentation in order to improve its recognition and, therefore, the rapidity of antidote supply. Methods: cases of pure cyanide poisoning published in the medical literature and on which the authors consulted were reviewed. Smoke inhalations were excluded. Clinical data were collected before any antidotal treatment except for oxygen. Results are expressed as percentage or median [extremes] Results: Data on 149 acute pure cyanide poisonings described since 1950 were extracted and summarized. Cyanide poisonings primarily resulted from suicide attempts by ingestion. Median time between exposure and onset of symptoms was 30 minutes (1-1140). An abnormal odour was looked for in only 24 out of the 149 cases and was reported in 16 cases (67%). Acute cyanide poisoning was characterized by abnormal neurological status (82%) including coma (66%), dilated pupils (78%), and abnormal respiratory pattern (93%) including hyperpnoea, polypnea, and bradypnea. Muscular tone was nonspecific. Seizures were witnessed in only 26% of poisonings, premature ventricular contractions in 16%, and pulmonary edema in 5%. Median heart rate was 95 bpm [0-176], and median systolic blood pressure was 90 mmHg [0-168]. Arterial pH was 7.20 [6.40-7.60], PaCO2 was 25.2 mmHg [9-53.6], and plasma lactate was
RAICS AS ADVANCED CLOUD BACKUP TECHNOLOGY IN TELECOMMUNICATION NETWORKS
Luntovskyy, Andriy; Vasyutynskyy, Volodymyr; Spillner, Josef
2014-01-01
Data crashes can cause unpredictable and even hard-out effects for an enterprise or authority. Backup strategies as antidote uni-fy a complex of organizational and technical measures that are necessary for data restoring, processing and transfer as well as for data security and defense against its loss, crash and tampering. High-performance modern Internet allows delivery of back-up functions and is complemented by attractive (mobile) services with a Quality of Service comparable to that in L...
Human-in-the-loop Artificial Intelligence
Zanzotto, Fabio Massimo
2017-01-01
Little by little, newspapers are revealing the bright future that Artificial Intelligence (AI) is building. Intelligent machines will help everywhere. However, this bright future has a dark side: a dramatic job market contraction before its unpredictable transformation. Hence, in a near future, large numbers of job seekers will need financial support while catching up with these novel unpredictable jobs. This possible job market crisis has an antidote inside. In fact, the rise of AI is sustai...
A maternal-effect genetic incompatibility in Caenorhabditis elegans
Burga, Alejandro; Ben-David, Eyal; Kruglyak, Leonid
2017-01-01
Selfish genetic elements spread in natural populations and have an important role in genome evolution. We discovered a selfish element causing a genetic incompatibility between strains of the nematode Caenorhabditis elegans . The element is made up of sup-35 , a maternal-effect toxin that kills developing embryos, and pha-1 , its zygotically expressed antidote. pha-1 has long been considered essential for pharynx development based on its mutant phenotype, but this phenotype in fact arises fro...
Stress among police body handlers. A long-term follow-up.
Alexander, D A
1993-12-01
Thirty-five police officers were followed up three years after they had been first assessed following their involvement in the retrieval and identification of human remains after a major disaster. Most of these officers were free from signs of psychiatric morbidity. Organisational and managerial practices appear to be powerful antidotes to adverse post-traumatic reactions. In this study the use of a longitudinal design, with a pre-disaster baseline and a control group, suggests that these are robust findings.
International Nuclear Information System (INIS)
Srivastava, P.P.
1989-04-01
National Institute of Occupational Safety and Health, U.S.A. has listed 73 industries with potential exposure to hydrogen sulphide. Though the toxicity of hydrogen sulfide is known to mankind since the beginning of seventeenth century the exact mode of its toxicity and effective therapeutic regimen remains unclear as yet. This paper presents current thoughts on the toxicity of this substance and a discussion on the role of various antidotes used in H 2 S poisoning. (autho r)
Features of Internal Audit in Pharmaceutical Industry
Tsvetanova, Yulia
2014-01-01
The review highlights the main features of internal audit by focus on distribution of medicinal products. Recent data suggest internal audit as an antidote to effects of economic recession. The present review reveals internal audit as a tool for competitiveness through implementation of good practices. The purpose of the review is to describe the advantages of internal audit in new institutional frame. The object of analysis is the distribution practice, and more concrete, the wholesale di...
Fabrication and Multiprobe Electrical Characterization of Nanostructures
DEFF Research Database (Denmark)
Klarskov, Mikkel Buster
2013-01-01
techniques, such as colloidal lithography or block copolymers lithography, which covers the entire sample. This project presents graphene devices with periodic holes fabricated by electron beam lithography. Only partial coverage of holes are fabricated by making from one to many rows of holes perpendicular......, such as nanograss and silver nanowires. Furthermore, antidot lattice of dierent sizes are made in graphene, to investigating the dependence of number of holes needed for modifying the electronic properties of graphene....
Glyphosate ingestion causing multiple organ failure: a near-fatal case report.
Picetti, Edoardo; Generali, Michela; Mensi, Francesca; Neri, Giampaolo; Damia, Roberta; Lippi, Giuseppe; Cervellin, Gianfranco
2018-01-16
A 55 years old man self-presented to our Emergency Department (ED) reporting an attempted suicide by cutting the left forearm veins and ingesting approximately 200 mL of an herbicide (Myrtos®, containing 36% of glyphosate as isopropylamine salt). Laboratory tests showed metabolic acidosis. Hydration with normal saline and alkalinization with sodium bicarbonate was started according to suggestion of the poison control center, since an antidote was unavailable. Cardiorespiratory condition gradually worsened, so that non-invasive positive pressure ventilation (NIPPV) was applied and infusion of fluids was established. Nevertheless, the patient deteriorated and he needed to be transferred to the Intensive Care Unit (ICU), where he underwent orotracheal intubation and invasive mechanical ventilation. Noradrenaline and adrenaline were infused and fluid resuscitation with crystalloids was incremented. An esophagogastroduodenoscopy (EGD) showed diffuse mucosal erosions of upper digestive tract. No signs of visceral perforation were found during ICU stay. In the following days, the clinical conditions improved and a new EGD showed marked improvement of erosive lesions. After 12 days of ICU stay, the patient was extubated and then transferred to the Psychiatric Unit, in good clinical conditions. Gliphosate ingestion is associated with rapid development of multiple organ failure (MOF). Since an effective antidote is unavailable, major attention should be placed to aggressive life-support care and careful monitoring of complications.
Insulin versus Lipid Emulsion in a Rabbit Model of Severe Propranolol Toxicity: A Pilot Study
Directory of Open Access Journals (Sweden)
Martyn Harvey
2011-01-01
Full Text Available Background and objective. Beta-blocker overdose may result in intractable cardiovascular collapse despite conventional antidotal treatments. High dose insulin/glucose (ING, and more recently intravenous lipid emulsion (ILE, have been proposed as potentially beneficial therapies in beta blocker intoxication. We compare efficacy of the novel antidotes ING, with ILE, in a rabbit model of combined enteric/intravenous propranolol toxicity. Methods. Sedated, mechanically ventilated and invasively monitored New Zealand White rabbits underwent mini-laparotomy and enterostomy formation with 40 mg/kg propranolol instilled into the proximal small bowel. At 30 minutes propranolol infusion was commenced at 4 mg/kg/hr and continued to a target mean arterial pressure (MAP of 50% baseline MAP. Animals were resuscitated with insulin at 3 U/kg plus 0.5 g/kg glucose (ING group, or 10 mL/kg 20% Intralipid (ILE group. Results. Rate pressure product (RPP; RPP = heart rate × mean arterial pressure was greatest in the ING group at 60 minutes (P<.05. A trend toward greater heart rate was observed in the ING group (P=.06. No difference was observed in survival between groups (4/5 ING versus 2/5 ILE; P=.524. Conclusions. High dose insulin resulted in greater rate pressure product compared with lipid emulsion in this rabbit model of severe enteric/intravenous propranolol toxicity.
Energy Technology Data Exchange (ETDEWEB)
Maximenko, A. [Institute of Nuclear Physics Polish Academy of Sciences, PL 31-342 Krakow (Poland); Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya str. 11, 220030 Minsk (Belarus); Marszałek, M., E-mail: marta.marszalek@ifj.edu.pl [Institute of Nuclear Physics Polish Academy of Sciences, PL 31-342 Krakow (Poland); Fedotova, J. [Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya str. 11, 220030 Minsk (Belarus); Zarzycki, A.; Zabila, Y. [Institute of Nuclear Physics Polish Academy of Sciences, PL 31-342 Krakow (Poland); Kupreeva, O.; Lazarouk, S. [Belarusian State University of Informatics and Radioelectronics, P.Brovka str. 6, 220013 Minsk (Belarus); Kasiuk, J. [Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya str. 11, 220030 Minsk (Belarus); Zavadski, S. [Belarusian State University of Informatics and Radioelectronics, P.Brovka str. 6, 220013 Minsk (Belarus)
2017-07-15
Highlights: • nanotubular templates of TiO{sub 2} were applied for fabrication of Co/Pd antidot arrays. • morphology of porous multilayers followed the features of the initial template. • the formation of Co0.4Pd0.6 alloy at the Co/Pd interface. • the conservation of perpendicular magnetic anisotropy in the CoPd porous film. • change of the magnetization reversal from domain wall motion to coherent rotation. - Abstract: We used porous nanotubular templates of TiO{sub 2} for fabrication of Co/Pd antidot arrays with strong perpendicular magnetic anisotropy. The morphology of porous multilayers followed the features of the initial template demonstrating a pronounced relief consisting of the cells with periodic pores with small inclination. We confirmed the formation of Co{sub 0.4}Pd{sub 0.6} alloy at the Co/Pd interface. We observed the conservation of perpendicular magnetic anisotropy in the Co/Pd porous film with coercive field H{sub C} = 2.7 kOe, enhanced with respect to the continuous film due to the pinning of magnetic moments on the nanopore edges. From angular dependence of the coercive field H{sub C} we deduced the change of the magnetization reversal mechanism from domain wall motion in the continuous film to the predominantly coherent rotation mechanism in the porous film.
A selfish gene chastened: Tribolium castaneum Medea M4 is silenced by a complementary gene.
Thomson, M Scott
2014-04-01
Maternal-effect dominant embryonic arrest (Medea) of Tribolium castaneum are autosomal factors that act maternally to cause the death of any progeny that do not inherit them. This selfish behavior is thought to result from a maternally expressed poison and zygotically expressed antidote. Medea factors and the hybrid incompatibility factor, H, have a negative interaction consistent with complementary genes of the Dobzhansky-Muller model for post-zygotic isolation. This negative interaction may result from H suppression of Medea zygotic antidote, leaving zygotes incompletely protected from maternal poison. I report here a test of the hypothesis that H also suppresses the Medea maternal poison. Viable F1 females were generated from a cross of Medea M4 strain males to H strain females. These females, heterozygous for both M4 and H, failed to express M4 maternal lethal activity when crossed to their male sibs. Transmission of non-M4 homologues from these females was confirmed using a dominant transgenic enhanced green fluorescent protein eye color marker, tightly linked in cis to M4. M4 beetles, lacking H, were selected from the F2 population. Female descendants of these clearly expressed M4 maternal lethal activity, indicating restoration of this activity after H was segregated away. I conclude that H, or a factor tightly linked to H, suppresses Medea M4 maternal poison.
New Direct Oral Anticoagulants (DOAC and Their Use Today
Directory of Open Access Journals (Sweden)
Heike Schwarb
2016-03-01
Full Text Available The ideal anticoagulant is oral, has a wide therapeutic range, predictable pharmacokinetics and pharmacodynamics, a rapid onset of action, an available antidote, minimal side effects and minimal interactions with other drugs or food. With the development of the novel direct oral anticoagulants (DOAC, we now have an alternative to the traditional vitamin K antagonists (VKA for the prevention and treatment of thrombosis. DOACs have limited monitoring requirements and very predictable pharmacokinetic profiles. They were shown to be non-inferior or superior to VKA in the prophylaxis or treatment of thromboembolic events. Particularly in terms of safety they were associated with less major bleeding, including intracranial bleeding, thus providing a superior benefit for the prevention of stroke in patients with atrial fibrillation. Despite these advantages, there are remaining limitations with DOACs: their dependence on renal and hepatic function for clearance and the lack of an approved reversal agent, whereas such antidotes are successively being made available. DOACs do not need regular monitoring to assess the treatment effect but, on the other hand, they interact with other drugs and interfere with functional coagulation assays. From a practical point of view, the properties of oral administration, simple dosing without monitoring, a short half-life allowing for the possibility of uncomplicated switching or bridging, and proven safety overwhelm the disadvantages, making them an attractive option for short- or long-term anticoagulation.
Energy Technology Data Exchange (ETDEWEB)
Sunderman, F.W. Jr.
1976-08-15
The toxicology and metabolism of nickel compounds (NiCl/sub 2/, Ni/sub 3/S/sub 2/, NiS, Ni powder, and Ni(CO)/sub 4/) were investigated in rats and hamsters. Triethylenetetramine (TETA) and d-penicillamine are more effective than other chelating agents (Na-diethyldithiocarbamate, CaNa/sub 2/-versenate, diglycylhistidine-N-methylamide and ..cap alpha..-lipoic acid) as antidotes for acute Ni(II)-toxicity in rats. The antidotal efficacy of triethylenetetramine (TETA) in acute Ni(II)-toxicity is mediated by rapid reduction of the plasma concentration of Ni(II), consistent with renal clearance of the TETA-Ni complex at a rate more than twenty times greater than the renal clearance of non-chelated Ni(II). Fischer rats are more susceptible than other rat strains (Wistar-Lewis, Long-Evans and NIH-Black) to induction of erythrocytosis after an intrarenal injection of Ni/sub 3/S/sub 2/, and elucidation of the serial pathologic changes that occur in rats after an intrarenal injection of Ni/sub 3/S/sub 2/. When amorphous nickel monosulfide (NiS) and nickel subsulfide (Ni/sub 3/S/sub 2/) were administered by im injection to randomly selected Fischer rats in equivalent amounts under identical conditions, NiS did not induce any tumors whereas Ni/sub 3/S/sub 2/ induced sarcomas in almost all of the rats.
Energy Technology Data Exchange (ETDEWEB)
Heinrich-Ramm, R. [Ordinariat fuer Arbeitsmedizin der Universitaet Hamburg und Zentralinstitut fuer Arbeitsmedizin, Hamburg (Germany); Schaller, K.H.; Angerer, J. [Institut und Poliklinik fuer Arbeits-, Sozial- und Umweltmedizin der Universitaet Erlangen-Nuernberg, Schillerstr. 25, 91054 Erlangen (Germany); Horn, J. [Medizinische Klinik II, Toxikologische-internistische Intensivstation, Klinikum Nuernberg, Nuernberg (Germany)
2003-02-01
We studied the urinary excretion of the different arsenic species in urine samples from a young man who tried to commit suicide by ingesting about 0.6 g arsenic trioxide. He received immediate therapy with dimercaptopropanesulfonic acid (DMPS) after his delivery into the hospital. We assessed urinary arsenite (inorganic trivalent arsenic), arsenate (inorganic pentavalent arsenic), pentavalent dimethylarsinic acid (DMA) and pentavalent monomethylarsonic acid (MMA) in urine with ion-exchange chromatography and on-line hydride-technique atomic absorption spectrometry. The predominant amount of the excreted arsenic was unchanged trivalent inorganic arsenic (37.4%), followed by pentavalent inorganic arsenic (2.6%), MMA (2.1%), DMA (0.2%) and one unidentified arsenic species (0.7%, if calculated as DMA). In the first urine voiding in the clinic, the total arsenic concentration was 215 mg/l, which fell 1000-fold after 8 days of DMPS therapy. A most striking finding was the almost complete inhibition of the second methylation step in arsenic metabolism. As mechanisms for the reduced methylation efficiency, the saturation of the enzymatic process of arsenic methylation, the high dosage of antidote DMPS, which might inhibit the activity of the methyl transferases, and analytical reasons are discussed. The high dosage of DMPS is the most likely explanation. The patient left the hospital after a 12-day treatment with antidote. (orig.)
Selling Yourself without Selling Out A Leader's Guide to Ethical Self-Promotion
(CCL), Center for Creative Leadership; McLaughlin, Cindy
2011-01-01
High-performing individuals and groups are often not adequately recognized for their contributions. The antidote to being overlooked or underestimated is self-promotion-the act of generating personal visibility in service of your work and career. In this guidebook, we discuss how you can benefit from self-promotion and maintain your integrity and authenticity. We help you reframe common beliefs that get in the way of effective self-promotion, and we provide numerous strategies and activities that can become part of your repertoire.
«Tu, solo, con la storia alle spalle». Durs Grünbein e la DDR: un bilancio critico
Directory of Open Access Journals (Sweden)
Daniele Vecchiato
2011-10-01
Full Text Available This paper analyses some of the most significant (post-GDR poems by Grünbein and traces the development of aesthetic and poetological issues that are central to the poet’s oeuvre. It provides an articulated overview of Grünbein’s poetics by examining fundamental themes like the love/hate attitude towards his hometown Dresden, the complementary concepts of history and memory, and the materialism of the body as an antidote to utopias.
Weijters, B J; Verbunt, R J A M; Hoogsteen, J; Visser, R F
2008-01-01
Intoxication with Aconitum napellus is rare in our regions. Aconite alkaloids can cause ventricular arrhythmia by a prolonged activation of sodium channels. Because the margin of safety is low between the analgesic and toxic dose, intoxication is not rare when Aconite is used in herbal medicine. We present a case in which a 39-year-old male was accidentally intoxicated with Aconite. Even though no antidote or adequate therapy is available he was successfully resuscitated. (Neth Heart J 2008;16:96-9.).
DEFF Research Database (Denmark)
Langer, Seppo W
2010-01-01
Extravasation of chemotherapy is a feared complication of anticancer therapy. The accidental leakage of cytostatic agents into the perivascular tissues may have devastating short-term and long-term consequences for patients. In recent years, the increased focus on chemotherapy extravasation has led...... to the development of international guidelines that have proven useful tools in daily clinical practice. Moreover, the tissue destruction in one of the most dreaded types of extravasation (ie, anthracycline extravasation) now can effectively be prevented with a specific antidote, dexrazoxane....
Death by acid rain: VAP or EXIT?
Thorburn, Kentigern; Darbyshire, Andrew
2009-01-01
Ventilator-associated pneumonia (VAP) is a new (nosocomial) lower respiratory tract infection diagnosed in mechanically ventilated patients 48 or more hours after intubation. There is no gold standard for establishing the diagnosis and its pathogenesis is iatrogenic and multifactorial. Gastro-oesophageal reflux is common in mechanically ventilated children, but its role in VAP remains speculative. VAP is associated with increased mortality and morbidity, prolonged duration of ventilation and hospital stay, and escalated costs of hospitalisation. VAP 'bundles' are championed as the antidote.
Plasmonic Nanostructures for Enhanced Light-Matter Interactions
DEFF Research Database (Denmark)
Zhu, Xiaolong
Plasmonics, a recent booming field, plays a major role in the fascinating research area of nanophotonics. Graphene, the newly rising star on the horizon of materials science and optoelectronics, exhibits exceptionally surprising properties. In optoelectronics, graphene (including other 2D materials...... an important platform for optoelectronic applications. Then, unprecedented large-area graphene nanodot and antidot optical arrays are fabricated by nanosphere lithography, with structural control down to the sub-100 nm regime. The interaction between graphene plasmon modes and the substrate phonons...
Magnetic-field asymmetry of nonlinear thermoelectric and heat transport
International Nuclear Information System (INIS)
Hwang, Sun-Yong; Sánchez, David; López, Rosa; Lee, Minchul
2013-01-01
Nonlinear transport coefficients do not obey, in general, reciprocity relations. We here discuss the magnetic-field asymmetries that arise in thermoelectric and heat transport of mesoscopic systems. Based on a scattering theory of weakly nonlinear transport, we analyze the leading-order symmetry parameters in terms of the screening potential response to either voltage or temperature shifts. We apply our general results to a quantum Hall antidot system. Interestingly, we find that certain symmetry parameters show a dependence on the measurement configuration. (paper)
Exogenous superoxide dismutase may lose its antidotal ability on rice leaves
Leaf diffusates of the resistant rice cultivars suppressed spore germination of blast fungus (Magnaporthe grisea). Bovine Cu-Zn superoxide dismutase (SOD) added to the diffusate abolished its toxicity. However, the enzyme added to the inoculum did not affect the toxicity of the diffusate. Even the s...
Prussian blue as an antidote for radioactive thallium and cesium poisoning
Directory of Open Access Journals (Sweden)
Altagracia-Martinez M
2012-06-01
Full Text Available Marina Altagracia-Martínez, Jaime Kravzov-Jinich, Juan Manuel Martínez-Núñez, Camilo Ríos-Castañeda, Francisco López-NaranjoDepartments of Biological Systems and Health Care, Biological and Health Sciences Division, Universidad Autónoma Metropolitana-Xochimilco, Mexico DF, MexicoBackground: Following the attacks on the US on September 11, 2001, potentially millions of people might experience contamination from radioactive metals. However, before the specter of such accidents arose, Prussian blue was known only as an investigational agent for accidental thallium and cesium poisoning. The purpose of this review is to update the state of the art concerning use of Prussian blue as an effective and safe drug against possible bioterrorism attacks and to disseminate medical information in order to contribute to the production of Prussian blue as a biodefense drug.Methods: We compiled articles from a systematic review conducted from January 1, 1960 to March 30, 2011. The electronic databases consulted were Medline, PubMed, the Cochrane Library, and Scopus.Results: Prussian blue is effective and safe for use against radioactive intoxications involving cesium-137 and thallium. The US Food and Drug Administration has approved Prussian blue as a drug, but there is only one manufacturer providing Prussian blue to the US. Based on the evidence, Prussian blue is effective for use against radioactive intoxications involving cesium-137 and thallium, but additional clinical research on and production of Prussian blue are needed.Keywords: Prussian blue, radioactive cesium, thallium, intoxication, biodefense drug
Assessment of The Emergence of E-Books As Antidotes To Paucity ...
African Journals Online (AJOL)
The increasing penetration of the internet in all areas of life has led to the evolution of Electronic Books which has significantly changed the reading patterns and reading behaviours of people across the globe. Using a self administered questionnaire, a study was undertaken in the campuses of Five (5) tertiary institutions in ...
Expression and Purification of a Potential Antidote for Organophosphate Warfare Agents
National Research Council Canada - National Science Library
Lanclos, Kenneth
2002-01-01
...) hydrolyze aliphatic and aromatic esters, and aromatic amides. Carboxylesterase may play an important role in the detoxification of xenobiotic chemicals that contain organophosphate (OP) compounds...
Forces of Nature: A Scientific Antidote to The Day After Tomorrow
Folger, Peter
2004-07-01
Do you cringe when watching the latest disaster movie? Not because of the drama, but because the science and the scientists bear little resemblance to the real thing? Would you rather watch a movie that translates the wonder and excitement of Earth's natural forces onto the silver screen, so that people other than ourselves could see those raw forces for what they are? And perhaps learn a little about why they occur?
Food, Risk and Politics: Scare, scandal and crisis - insights into the risk politics of food safety
Randall, Ed J.
2009-01-01
This book is about the risk politics of food safety. Food-related risks regularly grab the headlines in ways that threaten reasoned debate and obstruct sensible policy making. The author explains why this is the case. He goes on to make the case for a properly informed and fully open public debate about food safety issues. He argues that this is the true antidote to the politics of scare, scandal and crisis.\\ud \\ud The book skilfully weaves together the many different threads of food safety a...
Directory of Open Access Journals (Sweden)
Teuta Jashari-Kajtazi
2017-12-01
The current study aims to consider important thoughts about architectural identity and its categories in general but specific to the context of Kosovo. The history of the region has a critical story of influences toward its formation. Although several philosophies were accepted by the mass, others produced the antidote of the actual input. This study considers the importance of finding the best possible interpretation of Kosovo's architectural identity, such that Kosovo can be well known in the future as it was in the past.
Dabigatran and its reversal with recombinant factor VIIa and prothrombin complex concentrate
DEFF Research Database (Denmark)
Sølbeck, Sacha; Nilsson, Caroline U; Engström, Martin
2014-01-01
OBJECTIVE: Dabigatran is a new oral direct thrombin inhibitor. No specific antidote exists in the event of hemorrhage, but prothrombin complex concentrate (PCC) and recombinant activated factor VII (rFVIIa) are suggested therapies. Sonoclot is a bedside viscoelastic instrument for monitoring...... different Sonoclot cuvettes: Glassbead, kaolin and tissue factor (diluted) activated. RESULTS: The Sonoclot detected in vitro-induced anticoagulation due to dabigatran with the glassbead- and kaolin-activated cuvettes. There was no reversing effect of PCC, probably due to the presence of heparin in the PCC...
DEFF Research Database (Denmark)
Øberg, Emilie; Claudius, Casper
2013-01-01
Neuromuscular blockers (NMBs) provide good conditions for endotracheal intubation and surgery. NMBs have been associated with higher morbidity and mortality, mainly due to post-operative residual neuromuscular block. This may become history with the advent of sugammadex - an antidote to the NMB...... rocuronium - which within 1-3 minutes neutralizes the effects of rocuronium. High-dose rocuronium is now an alternative to suxamethonium in acute or short procedures and in a situation, where ventilation/intubating cannot be performed, sugammadex can reverse the rocuronium blockade within minutes....
[What is new in 2016 for the specialist in hospital internal medicine?
Mraihi, Hamza; Chevaux, Fabienne; Castoni, Julien; Aebischer, Oriane; Christou, Foetini; Jaccard, Evrim; Benmachiche, Malik; Tasheva, Plamena; Giroud, Sabine; Kraege, Vanessa; Lamy, Olivier
2017-01-18
The year 2016 was rich in significant advances in all areas of internal medicine. Many of them have an impact on our daily practice in general internal medicine. From the treatment of NSTEMI in population older than 80, to new sepsis and septic shock criteria to antidotes of new oral anticoagulants, this selection offers to the readers a brief overview of the major advances. The chief residents in the Service of internal medicine of the Lausanne University hospital are pleased to share their readings.
Investigation of "mysterious" disease in livestock: hydrocyanic acid poisoning.
Krishna, L; Katoch, R C
1989-12-01
An investigation of "mysterious" disease due to hydrocyanic acid (HCN) poisoning in livestock in this state was carried out. Detailed clinicopathological and pathological studies were conducted. Characteristic signs of acute tympany followed with profuse frothing, convulsions and dyspnea were recorded. Cynosis of the mucosa with characteristic anoxemic tissue changes and a high concentration of HCN in rumen content, feed and skeletal muscles were recorded. These were sufficient to establish the diagnosis. Successful treatment with a specific antidote was achieved, and further morbidity and mortality was checked.
Peters, John Archibald
While charge transport in a two-dimensional electron system (2DES) is fairly well understood, many open experimental and theoretical questions related to the spin of electrons remain. The standard 2DES embedded in Alx Ga1-xAs/GaAs heterostructures is most likely not the optimal candidate for such investigations, since spin effects as well as spin-orbit interactions are small perturbations compared to other effects. This has brought InSb- and InAs-based material systems into focus due to the possibility of large spin-orbit interactions. By utilizing elastic scattering off a lithographic barrier, we investigate the consequence of spin on different electron trajectories observed in InSb and InAs quantum wells. We focus on the physical properties of spin-dependent reflection in a 2DES and we present experimental results demonstrating a method to create spin-polarized beams of ballistic electrons in the presence of a lateral potential barrier. Spatial separation of electron spins using cyclotron motion in a weak magnetic is also achieved via transverse magnetic focusing. We also explore electrostatic gating effects in InSb/InAlSb heterostructures and demonstrate the effective use of polymethylglutarimide (PMGI) as a gate dielectric for InSb. The dependence on temperature and on front gate voltage of mobility and density are also examined, revealing a strong dependence of mobility on density. As regards front gate action, there is saturation in the density once it reaches a limiting value. Further, we investigate antidot lattices patterned on InSb/InAlSb and InAs/AlGaSb heterostructures. At higher magnetic fields, ballistic commensurability features are displayed while at smaller magnetic fields localization and quantized oscillatory phenomena appear, with marked differences between InSb and InAs. Interesting localization behavior is exhibited in InSb, with the strength of the localization peak decreasing exponentially with temperature between 0.4 K and 50 K. InAs on the
Cyanide Scavenging by a Cobalt Schiff-Base Macrocycle: A Cost-Effective Alternative to Corrinoids.
Lopez-Manzano, Elisenda; Cronican, Andrea A; Frawley, Kristin L; Peterson, Jim; Pearce, Linda L
2016-06-20
The complex of cobalt(II) with the ligand 2,12-dimethyl-3,7,11,17-tetraazabicyclo-[11.3.1]heptadeca-1(17)2,11,13,15-pentaene (CoN4[11.3.1]) has been shown to bind two molecules of cyanide in a cooperative fashion with an association constant of 2.7 (±0.2) × 10(5). In vivo, irrespective of whether it is initially administered as the Co(II) or Co(III) cation, EPR spectroscopic measurements on blood samples show that at physiological levels of reductant (principally ascorbate) CoN4[11.3.1] becomes quantitatively reduced to the Co(II) form. However, following addition of sodium cyanide, a dicyano Co(III) species is formed, both in blood and in buffered aqueous solution at neutral pH. In keeping with other cobalt-containing cyanide-scavenging macrocycles like cobinamide and cobalt(III) meso-tetra(4-N-methylpyridyl)porphine, we found that CoN4[11.3.1] exhibits rapid oxygen turnover in the presence of the physiological reductant ascorbate. This behavior could potentially render CoN4[11.3.1] cytotoxic and/or interfere with evaluations of the antidotal capability of the complex toward cyanide through respirometric measurements, particularly since cyanide rapidly inhibits this process, adding further complexity. A sublethal mouse model was used to assess the effectiveness of CoN4[11.3.1] as a potential cyanide antidote. The administration of CoN4[11.3.1] prophylactically to sodium cyanide-intoxicated mice resulted in the time required for the surviving animals to recover from "knockdown" (unconsciousness) being significantly decreased (3 ± 2 min) compared to that of the controls (22 ± 5 min). All observations are consistent with the demonstrated antidotal activity of CoN4[11.3.1] operating through a cyanide-scavenging mechanism, which is associated with a Co(II) → Co(III) oxidation of the cation. To test for postintoxication neuromuscular sequelae, the ability of mice to remain in position on a rotating cylinder (RotaRod test) was assessed during and after recovery
Directory of Open Access Journals (Sweden)
Collard, Franck
2013-06-01
Full Text Available Originating in the western world at the end of the 13th century, treatises about poisoning aim to protect patients against poisons or to heal the poisoned. They must be considered as medical writings belonging to scholasticism. But the subject of toxicatio leads the authors to speak about antidotes that seem, at fi rst sight, far from the world of learned medicine because they are linked with “marvels of nature” or with popular culture. After listing those things mentioned by doctors, the paper will try to show why and how they were intellectually integrated in the scientia venenorum.[fr] Éclos en Occident à la fin du XIIIe siècle, les traités des poisons visent à protéger ou soigner les patients des périls ou des effets du poison. Ils se rangent parmi les écritures médicales scolastiques. Mais le domaine de la toxicatio conduit les auteurs à traiter d’antidotes à première vue éloignés des sphères de la médecine savante, soit qu’ils se rattachent aux “merveilles de la nature”, soit qu’ils proviennent de la culture vulgaire. Après avoir inventorié ces anti-poisons mentionnés par les docteurs, l’article s’attachera à montrer pourquoi et comment ils sont intellectuellement intégrés à la scientia venenorum.
Directory of Open Access Journals (Sweden)
Luca Masotti
2013-12-01
Full Text Available Bleeding represents the most feared complication of the new oral anticoagulants, direct oral anticoagulants (DOACs, as well as all the antithrombotic therapies. During the acute phase of bleeding in patients taking anticoagulants, restoration of an effective hemostasis represents the cornerstone of practical management. While vitamin K antagonists are effectively and promptly reversed by specific antidotes such as prothrombin complex concentrates (PCCs, fresh frozen plasma or vitamin K, it is still not clear how to manage the urgent reversal of DOACs during life-threatening or major bleedings due to the lack of specific antidotes. However, in vitro and ex vivo studies have suggested some potential strategies to reverse DOACs in clinical practice, other than general support measures that are always recommended. Activated charcoal could be used in subjects with DOAC-related bleedings presenting to the emergency department within two hours of the last oral intake. Non-activated or activated PCCs (FEIBA and recombinant activated Factor VII (raFVII seem to be the optimal strategy for urgent reversal of dabigatran, while non-activated PCCs seem to have efficacy in reversing rivaroxaban. Due to its low plasma protein binding, dabigatran could be also dialyzed in urgent cases. Clinically relevant non-major bleedings and minor bleedings should be treated with general and local measures, respectively, and, when necessary, with dose delay or drug withdrawal. In this article, the Authors describe the practical approach to bleedings occurring during DOACs treatment.
Magnetic moment jumps in flat and nanopatterned Nb thin-walled cylinders
Energy Technology Data Exchange (ETDEWEB)
Tsindlekht, M.I., E-mail: mtsindl@vms.huji.ac.il [The Racah Institute of Physics, The Hebrew University of Jerusalem, 91904 Jerusalem (Israel); Genkin, V.M.; Felner, I.; Zeides, F.; Katz, N. [The Racah Institute of Physics, The Hebrew University of Jerusalem, 91904 Jerusalem (Israel); Gazi, Š.; Chromik, Š. [The Institute of Electrical Engineering SAS, Dúbravská cesta 9, 84104 Bratislava (Slovakia); Dobrovolskiy, O.V. [Physikalisches Institut, Goethe University, 60438 Frankfurt am Main (Germany); Physics Department, V. Karazin Kharkiv National University, 61077 Kharkiv (Ukraine); Sachser, R.; Huth, M. [Physikalisches Institut, Goethe University, 60438 Frankfurt am Main (Germany)
2017-02-15
Highlights: • Magnetization curves of as-prepared and patterned thin-walled cylinders were measured in magnetic fields applied parallel to cylinders axis. • Magnetic moment jumps were observed in magnetic fields lower and above Hc1. • Critical current density in isthmus between two antidots is higher than in a film itself. - Abstract: Penetration of magnetic flux into hollow superconducting cylinders is investigated by magnetic moment measurements. The magnetization curves of a flat and a nanopatterned thin-walled superconducting Nb cylinders with a rectangular cross section are reported for the axial field geometry. In the nanopatterned sample, a row of micron-sized antidots (holes) was milled in the film along the cylinder axis. Magnetic moment jumps are observed for both samples at low temperatures for magnetic fields not only above H{sub c1}, but also in fields lower than H{sub c1}, i. e., in the vortex-free regime. The positions of the jumps are not reproducible and they change from one experiment to another, resembling vortex lattice instabilities usually observed for magnetic fields larger than H{sub c1}. At temperatures above 0.66T{sub c} and 0.78T{sub c} the magnetization curves become smooth for the patterned and the as-prepared sample, respectively. The magnetization curve of a reference flat Nb film in the parallel field geometry does not exhibit jumps in the entire range of accessible temperatures.
Methanol toxicity secondary to inhalant abuse in adult men.
Wallace, Erik A; Green, Adam S
2009-03-01
The purpose of this report is to evaluate the presentation, treatment, and outcomes of adults with methanol toxicity from inhalation of carburetor cleaning fluid fumes. Retrospective chart review of adults with positive serum volatile screen for methanol and history of carburetor cleaning fluid fume inhalation. Sixteen patients were admitted 68 times. Eleven Native American patients accounted for 90% of admissions. Sixty-five cases presented with nausea/vomiting; 27 with intoxication or altered mental status; 21 with specific visual complaints. About 93% had a pH or=10 mOsm/L, and 69% had anion gap >16. Ten had an initial serum methanol level or=50 mg/dL. Six patients had a measurable serum ethanol level. Of the 29 patients with a methanol level of 20-49 mg/dL, 20 received intravenous antidote (ethanol or fomepizole); three received an antidote and hemodialysis. All who presented with a serum methanol level >or=50 mg/dL received intravenous ethanol or fomepizole. All visual symptoms resolved before discharge and all patients survived without sequelae. Discussion. This is the largest reported number of cases of methanol toxicity from the inhalation of carburetor cleaning fluid fumes and demonstrates a problem with recurrent abuse among some older Native American men. Intentional inhalation of methanol fumes may produce toxicity. Clinicians need to question patients, especially older Native American men, regarding the possible inhalation of carburetor cleaning fluid fumes in those who present with an unexplained metabolic anion gap acidosis.
Paraquat intoxication and associated pathological findings in three dogs in South Africa
Directory of Open Access Journals (Sweden)
June H. Williams
2016-11-01
Full Text Available Paraquat is a bipyridylium non-selective contact herbicide commonly used worldwide. When ingestion occurs by humans and animals either accidentally, intentionally or maliciously, paraquat selectively accumulates in the lungs resulting in the production of oxygen-free radicals, causing membrane damage and cell death. Intoxicated subjects typically show progressive and fatal pulmonary haemorrhage, collapse and oedema. In individuals surviving the acute phase, pulmonary fibrosis develops. Gastrointestinal-, renal- and central nervous system clinical signs may also occur. Owing to the lack of effective treatment and absence of an antidote, the prognosis is poor. The clinical presentation, clinicopathological findings and treatment are briefly described of three dogs from one South African household, intoxicated with paraquat. Macroscopic and microscopic lesions in one dog that was necropsied, as well as pulmonary ultrastructure are detailed and illustrated for academic reference. All dogs presented with tachypnoea and dyspnoea 2–3 days after accidental paraquat ingestion. Treatment was aimed at reducing gastrointestinal absorption, enhancing elimination by diuresis and avoiding further oxidative damage by administration of antioxidants. All dogs, however, became progressively hypoxic despite treatment and were euthanised. Paraquat toxicity should be a differential diagnosis in dogs with unexplained progressive respiratory and gastrointestinal signs and renal failure. The local veterinary profession should be aware of accidental or intentional paraquat toxicity of animals. Existing literature, variations possible in canine clinical signs, measured parameters, lesions, as well as possible treatments, promising experimental antidotes and management options are discussed.
Directory of Open Access Journals (Sweden)
2017-03-01
Full Text Available Chemical weapons are a major worldwide problem, since they are inexpensive, easy to produce on a large scale and difficult to detect and control. Among the chemical warfare agents, we can highlight the organophosphorus compounds (OP, which contain the phosphorus element and that have a large number of applications. They affect the central nervous system and can lead to death, so there are a lot of works in order to design new effective antidotes for the intoxication caused by them. The standard treatment includes the use of an anticholinergic combined to a central nervous system depressor and an oxime. Oximes are compounds that reactivate Acetylcholinesterase (AChE, a regulatory enzyme responsible for the transmission of nerve impulses, which is one of the molecular targets most vulnerable to neurotoxic agents. Increasingly, enzymatic treatment becomes a promising alternative; therefore, other enzymes have been studied for the OP degradation function, such as phosphotriesterase (PTE from bacteria, human serum paraoxonase 1 (HssPON1 and diisopropyl fluorophosphatase (DFPase that showed significant performances in OP detoxification. The understanding of mechanisms by which enzymes act is of extreme importance for the projection of antidotes for warfare agents, and computational chemistry comes to aid and reduce the time and costs of the process. Molecular Docking, Molecular Dynamics and QM/MM (quantum-mechanics/molecular-mechanics are techniques used to investigate the molecular interactions between ligands and proteins.
Metalloporphyrin Co(III)TMPyP ameliorates acute, sublethal cyanide toxicity in mice.
Benz, Oscar S; Yuan, Quan; Amoscato, Andrew A; Pearce, Linda L; Peterson, Jim
2012-12-17
The formation of Co(III)TMPyP(CN)(2) at pH 7.4 has been shown to be completely cooperative (α(H) = 2) with an association constant of 2.1 (±0.2) × 10(11). The kinetics were investigated by stopped-flow spectrophotometry and revealed a complicated net reaction exhibiting 4 phases at pH 7.4 under conditions where cyanide was in excess. The data suggest molecular HCN (rather than CN(-)) to be the attacking nucleophile around neutrality. The two slower phases do not seem to be present when cyanide is not in excess, and the other two phases have rates comparable to that observed for cobalamin, a known effective cyanide scavenger. Addition of bovine serum albumin (BSA) did not affect the cooperativity of cyanide binding to Co(III)TMPyP, only lowered the equilibrium constant slightly to 1.2 (±0.2) × 10(11) and had an insignificant effect on the observed rate. A sublethal mouse model was used to assess the effectiveness of Co(III)TMPyP as a potential cyanide antidote. The administration of Co(III)TMPyP to sodium cyanide intoxicated mice resulted in the time required for the surviving mice to right themselves from a supine position being significantly decreased (9 ± 2 min) compared to that of the controls (33 ± 2 min). All observations were consistent with the demonstrated antidotal activity of Co(III)TMPyP operating through a cyanide-binding (i.e., scavenging) mechanism.
Interaction of chelating agents with cadmium in mice and rats
International Nuclear Information System (INIS)
Eybl, V.; Sykora, J.; Koutensky, J.; Caisova, D.; Schwartz, A.; Mertl, F.
1984-01-01
The influence of several chelating agents (CaDTPA, ZnDTPA, CaEDTA, ZnEDTA, DMSA, D-penicillamine and DMPS, DMP and DDC) on the acute toxicity of CdCl 2 and on the whole body retention and tissue distribution of cadmium after the IV application of /sup 115mCdCl 2 was compared in mice. The chelating agents were applied immediately after the application of cadmium. CaDTPA, ZnDTPA and DMSA appeared to be the most effective antidotes. However, DMSA increased the amount of cadmium retained in kidneys. The treatement of cadmium-poisoned mice with the combination of DMSA (IP) and ZnDTPA (SC) (all the compounds were injected in equimolar dose) decreased the toxicity of cadmium more than treatment with one chelating agents (given in a 2:1 dose). However, by studying the effect of these chelating agents and their combination application of the antidotes showed little or no improvement over the results obtained with the most effective of the individual components. In the urine of rats injected with CdCl 2 and treated with the chelating agents (CaDTPA, ZnDTPA, DMSA), the presence of cadmium complexes was demonstrated. The formation of mixed ligand chelates in vivo was not proved. Experiments in mice given a single injection of /sup 115m/Cd-labeled Cd complexes of DMPS, DMSA and DTPA showed a high retention of cadmium in the organisms after the IV application of CdDMPS and CdDMSA complexes
Lifescience Database Archive (English)
Full Text Available DG01152 Chemical ... DGroup Edetate ... D00052 ... Edetic acid (NF/INN) D00571 ... Edetate calcium disodium... anhydrous (USP) D01802 ... Edetate disodium (USP); Disodium edetate hydrate (JP17) D03943 ... Edetate calcium disodium... (USP); Calcium sodium edetate hydrate (JP17); Sodium calcium edetate (INN) ... D03944 ... Ed...etate dipotassium (USAN) D03945 ... Disodium edetate D03946 ... Edetate sodium (USAN) D03947 ... Edetate trisodium... (USAN) D07934 ... Edetate calcium disodium D07935 ... Dicobalt edetate (INN) Other ... DG01692 ... Chelator ATC code: V03AB03 Antidotes, Chelating agents ...
Determination of metal ion contents of two antiemetic clays use in Geophagy
Directory of Open Access Journals (Sweden)
Solomon E. Owumi
2015-01-01
Specifically, our result indicates unacceptably high levels of aluminum in Eko and Omumu (>10-fold greater than the highest desirable levels set by the USEPA. The aluminum concentrations were influenced by the pH condition in which the samples were digested. Dietary exposure to aluminum at such high levels may be deleterious to maternal health and fetal development. Therefore consumption of Eko and Omumu as an antidote to reduce nausea during pregnancy should be discouraged. Future studies are planned to investigate specific impacts on fetal and maternal health and likely teratogenicity in rodent models.
Transdermal carbamate poisoning – a case of misuse
Directory of Open Access Journals (Sweden)
Lalit Kumar Rajbanshi
2017-01-01
Full Text Available Acute pesticide poisoning is a common mode of intentional self harm. Oral ingestion is the usual mode of poisoning. However, inhalation, accidental or occupational transdermal exposure leading to acute or chronic poisoning can be the other route of poisoning. It has been seen that the purpose of poising is suicidal intensity in most of the cases. We report an unusual case where the victim had acute pesticide poisoning through transdermal route that was intended for non suicidal purpose. The patient was managed successfully with immediate decontamination and adequate antidote.
Cell complexes of transition metals in biochemistry and medicine
International Nuclear Information System (INIS)
Voloshin, Ya.Z.; Varzatskij, O.A.; Bubnov, Yu.N.
2007-01-01
Basic directions and prospects of use of cell complexes of transition metals in medicine and biochemistry are considered: incapsulation of radioactive metal ions for radiotherapy and diagnostics; preparation of contrast compounds for magnetic resonance tomography, antidotes and pharmaceutical preparation of prolonged effect, preparations for boron-neutron-capture therapy of neoplasms, antioxidants; membrane transport of metal ions; study of interaction of cell metal complexes with nucleic acids; possibility of use of self-assembly of cell complexes for imitation of ligases and use of clathrochelates as linkers; design of inhibitors of viruses for AIDS therapy [ru
Management of pain through autogenic training.
Kanji, N
2000-08-01
Physical and emotional pain are an inevitable part of human existence and are without natural antidotes. In view of this, and in the light of increasing professional reluctance to depend on analgesics, this paper proposes the widespread application of autogenic training, a relaxation technique which has been seen to confront pain very effectively, and also to reduce substantially drugs dependency. It analyses autogenic training in respect of some of the more common pain-allied disorders such as childbirth, headaches and migraines, back pain, cancer and palliative care, and cardiology.
Chelation therapy in intoxications with mercury, lead and copper
DEFF Research Database (Denmark)
Cao, yang; Skaug, Marit Aralt; Andersen, Ole
2015-01-01
In the present review we provide an update of the appropriate use of chelating agents in the treatment of intoxications with compounds of mercury, lead and copper. The relatively new chelators meso-2,3-dimercaptosuccinic acid (DMSA) and 2,3-dimercapto-propanesulphonate (DMPS) can effectively...... mobilize deposits of mercury as well as of lead into the urine. These drugs can be administered orally and have relatively low toxicity compared to the classical antidote dimercaptopropanol (BAL). d-Penicillamine has been widely used in copper overload, although 2,3-dimercaptosuccinic acid...
Transport Properties of Nanostructured Graphene
DEFF Research Database (Denmark)
Jauho, Antti-Pekka
2017-01-01
Despite of its many wonderful properties, pristine graphene has one major drawback: it does not have a band gap, which complicates its applications in electronic devices. Many routes have been suggested to overcome this difficulty, such as cutting graphene into nanoribbons, using chemical methods...... device operation. In this talk I elaborate these ideas and review the state-of-the-art both from the theoretical and the experimental points of view. I also introduce two new ideas: (1) triangular antidots, and (2) nanobubbles formed in graphene. Both of these nanostructuring methods are predicted...
Dual-probe spectroscopic fingerprints of defects in graphene
DEFF Research Database (Denmark)
Settnes, Mikkel; Power, Stephen; Petersen, Dirch Hjorth
2014-01-01
(e.g., an extended graphene sheet). Applying this method, we study the transport anisotropies in pristine graphene sheets, and analyze the spectroscopic fingerprints arising from quantum interference around single-site defects, such as vacancies and adatoms. Furthermore, we demonstrate that the dual......-probe setup is a useful tool for characterizing the electronic transport properties of extended defects or designed nanostructures. In particular, we show that nanoscale perforations, or antidots, in a graphene sheet display Fano-type resonances with a strong dependence on the edge geometry of the perforation....
Clark, Allan
1984-01-01
This concise, readable, college-level text treats basic abstract algebra in remarkable depth and detail. An antidote to the usual surveys of structure, the book presents group theory, Galois theory, and classical ideal theory in a framework emphasizing proof of important theorems.Chapter I (Set Theory) covers the basics of sets. Chapter II (Group Theory) is a rigorous introduction to groups. It contains all the results needed for Galois theory as well as the Sylow theorems, the Jordan-Holder theorem, and a complete treatment of the simplicity of alternating groups. Chapter III (Field Theory)
Human biomonitoring in civil defense; Humanbiomonitoring im Bevoelkerungsschutz
Energy Technology Data Exchange (ETDEWEB)
Mueller, Michael; Schmiechen, Katharina [Universitaetsmedizin Goettingen (Germany). Arbeits-, Sozial- und Umweltmedizin
2012-07-01
The booklet on human biomonitoring (HBM) in civil defense covers the following issues within two sections: (1) general part: definition and importance of human biomonitoring; application in civil defense; practice in a CBRN (chemical, biological, radiation, nuclear) scenario; sampling following a CBRN assignment; HBM for antidote administration; peculiarities of sampling in case of biological agents; microbiological detection procedure; human biomonitoring of radioactive metal isotopes. (2) Special part: substance profiles; list of HBM laboratories; list of poison information centers; questionnaire for exposure assessment in case of dangerous substance accidents; agreement for human biomonitoring examination.
Strain-induced fermi contour anisotropy of GaAs 2D holes.
Shabani, J; Shayegan, M; Winkler, R
2008-03-07
We report measurements of magnetoresistance commensurability peaks, induced by a square array of antidots, in GaAs (311)A two-dimensional holes as a function of applied in-plane strain. The data directly probe the shapes of the Fermi contours of the two spin subbands that are split thanks to the spin-orbit interaction and strain. The experimental results are in quantitative agreement with the predictions of accurate energy band calculations, and reveal that the majority spin subband has a severely distorted Fermi contour whose anisotropy can be tuned with strain.
A review of pitfalls and progress in chelation treatment of metal poisonings
DEFF Research Database (Denmark)
Andersen, Ole; Aaseth, Jan
2016-01-01
to clinical settings. Intramuscular administration of dimercaptopropanol (BAL) has until now been used in acute arsenic, lead, and mercury poisonings, but repeated BAL administration increased the brain uptake of As, Pb and Hg in experimental animals. Also, diethyl dithiocarbamate (DDC) has been used...... as antidote in acute experimental animal parenteral Cd poisoning, and both DDC and tetraethylthiuram disulfide (TTD, disulfiram, Antabuse) have been used in nickel allergic patients. However, even one dose of DDC given immediately after oral Cd or Ni increased their brain uptake considerably. The calcium salt...
New edge magnetoplasmon for a two-dimensional electron gas in a ring geometry
International Nuclear Information System (INIS)
Proetto, C.R.
1992-09-01
The dynamical response of a classical two-dimensional electron gas confined in a ring geometry under a perpendicular magnetic field is analysed. Within the hydrodynamical approach and in the strong magnetic field limit, a new set of antidot edge magnetoplasmons is obtained, corresponding to density oscillations circulating along the inner boundary of the ring and whose frequency increases with magnetic field. The associated self-induced distribution of densities and currents are presented, together with an analysis of the size dependence of these perimeter waves. (author). 15 refs, 4 figs
Reflective Writing for Medical Students on the Surgical Clerkship: Oxymoron or Antidote?
Liu, Geoffrey Z; Jawitz, Oliver K; Zheng, Daniel; Gusberg, Richard J; Kim, Anthony W
2016-01-01
Reflective writing has emerged as a solution to declining empathy during clinical training. However, the role for reflective writing has not been studied in a surgical setting. The aim of this proof-of-concept study was to assess receptivity to a reflective-writing intervention among third-year medical students on their surgical clerkship. The reflective-writing intervention was a 1-hour, peer-facilitated writing workshop. This study employed a pre-post-intervention design. Subjects were surveyed on their experience 4 weeks before participation in the intervention and immediately afterwards. Surveys assessed student receptivity to reflective writing as well as self-perceived empathy, writing habits, and communication behaviors using a Likert-response scale. Quantitative responses were analyzed using paired t tests and linear regression. Qualitative responses were analyzed using an iterative consensus model. Yale-New Haven hospital, a tertiary care academic center. All medical students of Yale School of Medicine, rotating on their surgical clerkship during a 9-month period (74 in total) were eligible. In all, 25 students completed this study. The proportion of students desiring more opportunities for reflective writing increased from 32%-64%. The proportion of students receptive to a mandatory writing workshop increased from 16%-40%. These differences were both significant (p = 0.003 and p = 0.001). In all, 88% of students also reported new insight as a result of the workshop. In total, 39% of students reported a more positive impression of the surgical profession after participation. Overall, the workshop was well-received by students and improved student attitudes toward reflective writing and the surgical profession. Larger studies are required to validate the effect of this workshop on objective empathy measures. This study demonstrates how reflective writing can be incorporated into a presurgical curriculum. Copyright © 2015 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.
Managing Workplace Incivility: The Role of Conflict Management Styles--Antecedent or Antidote?
Trudel, Jeannie; Reio, Thomas G., Jr.
2011-01-01
The workforce of the 21st century is dealing with rapid changes and increased competition across industries. Such changes place stress on management and workers alike, increasing the potential for workplace conflict and deviant workplace behaviors, including incivility. The importance of effective conflict management in the workplace has been…
Monitoring the Effects and Antidotes of the Non-vitamin K Oral Anticoagulants
DEFF Research Database (Denmark)
Rahmat, Nur A; Lip, Gregory Y H
2015-01-01
In the last decade, we have witnessed the emergence of the oral non-vitamin K oral anticoagulants (NOACs), which have numerous advantages compared with the vitamin K antagonists, particularly their lack of need for monitoring; as a result their use is increasing. Nonetheless, the NOACs face two...
Humanistic Antidotes to Social Media/Cell Phone Addiction in the College Classroom
Elliot Benjamin
2016-01-01
This article describes “humanistic antidotes” to offset the widespread social media/cell phone addiction prevalent in current US college classrooms. The inappropriate use of cell phones to engage in social media in college classrooms is a pervasive problem that many college instructors have complained about. The dominant focus of this article is in humanistic education, in which the author's efforts at getting psychology college students to put away their cell phones, “talk with each other,”...
Boxes of Poison: Baroque Technique as Antidote to Simple Views of Literacy
Burnett, Cathy; Merchant, Guy
2016-01-01
Rich and complex meaning making experiences, such as those associated with virtual play, sit uneasily with the view of literacy reflected in and sustained by current systems of accountability in education. This article develops a baroque perspective as a way of destabilizing the "regime of truth" associated with simple models of…
Directory of Open Access Journals (Sweden)
Moyosore Salihu Ajao
2017-11-01
Full Text Available Background: Exposure to environmental toxins such as organophosphates poses a great threat to the health of the public. In this work, we investigated the effects of continuous exposure to dichlorvos (DDVP on kidney function and hematological parameters, and the possible antidote activity of Nigella sativa oil (NSO. Methods: This research was conducted in 2016, at The Animal Holding and Research Laboratory of Faculty Basic Medical Sciences, University of Ilorin, Ilorin, Nigeria. Twenty-four Wistar rats were randomly divided into four groups, six rats each. The four groups received: 1. phosphate buffer solution as controls, 2. DDVP, 3. DDVP+NSO and 4. NSO alone. After 2 wk of treatment, blood samples were collected and hematological profile (RBC, Hb, erythrocyte indices (MCV, MCH, MCHC, and Plt, renal function parameters (albumin, urea, total protein, chloride, sodium, and potassium ions and nonspecific immune response (WBC were measured. Results: Rat exposed to DDVP showed red blood cell count, hemoglobin, packed cell volume, albumin, and total protein levels was reduced from control, while white blood cell count and urea significantly increased as compared to controls, the change in K+ level was not significant. NSO maintained optimal levels of red blood cell count, hemoglobin, packed cell volume, albumin, white blood cell count, and urea, indicative of its protective effect against hemo-, immuno- and nephrotoxicity of DDVP. Conclusion: N. sativa (Black Caraway oil might be a potential antidote in hematotoxicity, immunosuppression and renal dysfunction in organophosphate poisoning, especially dichlorvos. The protective effect of NSO against dichlorvos toxicity can be attributed to its antioxidant capacity.
Saudi medicinal plants for the treatment of scorpion sting envenomation.
Al-Asmari, Abdulrahman; Manthiri, Rajamohamed Abbas; Abdo, Nasreddien; Al-Duaiji, Fawzi Abdullah; Khan, Haseeb Ahmad
2017-09-01
Scorpion sting envenoming poses major public health problems. The treatment modalities include antivenoms, chemical antidotes and phytotherapy, with varying degrees of effectiveness and side effects. In this investigation, we reviewed the use of Saudi medicinal plants for the treatment of scorpion sting patients. The relevant literature was collected using the online search engines including Science Direct, Google and PubMed with the help of specific keywords. We also used the printed and online resources at our institutional library to gather the relevant information on the use of medicinal plants for the treatment of scorpion sting patients. A descriptive statistics was used for data compilation and presentation. The results of this survey showed the use of at least 92 medicinal plants with beneficial effects for treating victims of stings of different scorpion species. These commonly used herbs spanned to 37 families whilst different parts of these plants were employed therapeutically for alleviation of envenomation symptoms. The application of leaves (41%) was preferred followed by roots (19%), whole plant (14%) and seeds (9%). The use of latex (4%), stem (3%), flowers (3%) and bark (3%) was also reported. In some cases, tannin (2%), rhizome (1%) and shoot (1%) were also used. In conclusion, herbal medicines are effectively used for the treatment of patients with scorpion envenomation. This type of medication is free from side effects as observed with chemical antidotes or antivenom therapy. It is important to identify the active ingredients of herbal drugs for improving their therapeutic potential in traditional medicine.
Luo, Chunyuan; Tong, Min; Maxwell, Donald M; Saxena, Ashima
2008-09-25
Non-human primates are valuable animal models that are used for the evaluation of nerve agent toxicity as well as antidotes and results from animal experiments are extrapolated to humans. It has been demonstrated that the efficacy of an oxime primarily depends on its ability to reactivate nerve agent-inhibited acetylcholinesterase (AChE). If the in vitro oxime reactivation of nerve agent-inhibited animal AChE is similar to that of human AChE, it is likely that the results of an in vivo animal study will reliably extrapolate to humans. Therefore, the goal of this study was to compare the aging and reactivation of human and different monkey (Rhesus, Cynomolgus, and African Green) AChEs inhibited by GF, GD, and VR. The oximes examined include the traditional oxime 2-PAM, two H-oximes HI-6 and HLo-7, and the new candidate oxime MMB4. Results indicate that oxime reactivation of all three monkey AChEs was very similar to human AChE. The maximum difference in the second-order reactivation rate constant between human and three monkey AChEs or between AChEs from different monkey species was 5-fold. Aging rate constants of GF-, GD-, and VR-inhibited monkey AChEs were very similar to human AChE except for GF-inhibited monkey AChEs, which aged 2-3 times faster than the human enzyme. The results of this study suggest that all three monkey species are suitable animal models for nerve agent antidote evaluation since monkey AChEs possess similar biochemical/pharmacological properties to human AChE.
Interaction of chelating agents with cadmium in mice and rats.
Eybl, V; Sýkora, J; Koutenský, J; Caisová, D; Schwartz, A; Mertl, F
1984-01-01
The influence of several chelating agents (CaDTPA, ZnDTPA, CaEDTA, ZnEDTA, DMSA, D-penicillamine and DMPS, DMP and DDC) on the acute toxicity of CdCl2 and on the whole body retention and tissue distribution of cadmium after the IV application of 115mCdCl2 was compared in mice. The chelating agents were applied immediately after the application of cadmium. CaDTPA, ZnDTPA and DMSA appeared to be the most effective antidotes. However, DMSA increased the amount of cadmium retained in kidneys. The treatment of cadmium-poisoned mice with the combination of DMSA (IP) and ZnDTPA (SC) (all the compounds were injected in equimolar dose) decreased the toxicity of cadmium more than treatment with one chelating agents (given in a 2:1 dose). However, by studying the effect of these chelating agents and their combination of the retention and distribution of Cd in mice, it was demonstrated that the combined application of the antidotes showed little or no improvement over the results obtained with the most effective of the individual components. In the urine of rats injected with CdCl2 and treated with the chelating agents (CaDTPA, ZnDTPA, DMSA), the presence of cadmium complexes was demonstrated. The formation of mixed ligand chelates in vivo was not proved. Experiments in mice given a single injection of 115mCd-labeled Cd complexes of DMPS, DMSA and DTPA showed a high retention of cadmium in the organisms after the IV application of CdDMPS and CdDMSA complexes. PMID:6734561
Acute neurotoxicology of drugs of abuse.
Traub, S J; Levine, M D
2017-01-01
Many substances can affect the central nervous system, and may cause patients to become critically ill. Acute central neurotoxicologic syndromes associated with drugs of abuse are usually caused by an overdose of sedative-hypnotic agents (including alcohol) or opioids, withdrawal from sedative-hypnotic agents, or an overdose of anticholinergic or sympathomimetic agents. Clinical findings are often syndromic, making physical examination the most important diagnostic tool in the approach to the patient with an unknown ingestion. Treatment focusses on supportive care as the most important intervention for all such patients, augmented by antidotal therapy when appropriate. © 2017 Elsevier B.V. All rights reserved.
DEFF Research Database (Denmark)
Comuth, Willemijn J; Haase, Anne-Mette; Henriksen, Linda Ø
2018-01-01
Idarucizumab, an antidote specific for dabigatran, became available recently. Dabigatran is not associated with increased risk of hepatotoxicity in comparison with warfarin, but it is seen as a rare side-effect. Cases of cholestatic liver injury due to dabigatran have not been reported previously...... and cholestatic liver injury was seen as a possible rare side-effect of dabigatran treatment........ We present a case of severe gastro-intestinal bleeding with underlying dabigatran intoxication in a patient with renal failure and the effect of reversal of dabigatran using idaruzicumab on coagulation assays. International normalized ratio (INR) and activated partial thromboplastin time (APTT...
Utilization of Bamboo Charcoal as Additives in Cakes
Directory of Open Access Journals (Sweden)
Ronald O. Ocampo
2015-12-01
Full Text Available Charcoal has been used for healing various diseases, as antidote to poisoning and as purifying agent to filtered water. This study is conducted to utilize charcoal as additives in making cakes. Specifically, it is intended to determine the acceptable level of charcoal when used as additives in the production of brownies, dark brown chocolate, and chiffon cakes. It can be concluded that an addition of 1 tablespoon of bamboo charcoal gave the highest sensory evaluation to brownies and 3 tablespoon to dark brown chocolate .The control ( no charcoal added is still the best treatment for chiffon cake.
POISONING WITH GAMMA-HYDROXYBUTYRATE, GAMMA-BUTYROLACTONE AND 1.4-BUTANDIOL
Directory of Open Access Journals (Sweden)
Miran Brvar
2002-09-01
Full Text Available Background. Gamma-hydroxybutyrate (GHB is a popular recreational drug. GHB overdose typically presents with decreased level of consciousness, miosis, bradycardia, respiratory depression and death. Typically, combativeness, confusion and vomiting occur once the patient begins to recover. Gamma-butyrolactone (GBL and 1.4-butandiol (1.4-BD are the prodrugs of GHB and have similar clinical presentation. We present the case of GHB poisoning in Ljubljana.Conclusions. Physicians should suspect GHB poisoning in young ravers who present with CNS depression. Treatment is symptomatic. There is no specific antidote. Gastric lavage is not beneficial but activated charcoal is recommended.
Identifying Dirac cones in carbon allotropes with square symmetry
Energy Technology Data Exchange (ETDEWEB)
Wang, Jinying [College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); Huang, Huaqing; Duan, Wenhui [Department of Physics, Tsinghua University, Beijing 100084 (China); Liu, Zhirong, E-mail: LiuZhiRong@pku.edu.cn [College of Chemistry and Molecular Engineering, Peking University, Beijing 100871 (China); State Key Laboratory for Structural Chemistry of Unstable and Stable Species and Beijing National Laboratory for Molecular Sciences (BNLMS), Peking University, Beijing 100871 (China)
2013-11-14
A theoretical study is conducted to search for Dirac cones in two-dimensional carbon allotropes with square symmetry. By enumerating the carbon atoms in a unit cell up to 12, an allotrope with octatomic rings is recognized to possess Dirac cones under a simple tight-binding approach. The obtained Dirac cones are accompanied by flat bands at the Fermi level, and the resulting massless Dirac-Weyl fermions are chiral particles with a pseudospin of S = 1, rather than the conventional S = 1/2 of graphene. The spin-1 Dirac cones are also predicted to exist in hexagonal graphene antidot lattices.
Nice Teams Finish Last The Secret to Unleashing Your Team's Maximum Potential
Miller, Brian Cole
2010-01-01
Don't rock the boat. Don't make waves. Don't offend anyone. There's a palpable feeling that clouds many team meetings and keeps them from being productive: over-politeness. And while the conflict that naturally exists in most organizations hasn't gone away, it manifests itself in passive-aggression, mediocrity, and a molasses-like inability to get anything done. Nice Teams Finish Last provides the antidote to this all-too-common tendency, giving managers, team leaders and members, and facilitators the practical support they need to battle "the nice trap" and start getting results! The book hel
Acute Organophosphate Poisonings: Therapeutic Dilemmas and New Potential Therapeutic Agents
International Nuclear Information System (INIS)
Vucinic, S.; Jovanovic, D.; Vucinic, Z.; Todorovic, V.; Segrt, Z.
2007-01-01
It has been six decades since synthesis of organophosphates, but this chapter has not yet come to a closure. Toxic effects of organophosphates are well known and the current therapeutic scheme includes supportive therapy and antidotes. There is a dilemma on whether and when to apply gastric lavage and activated charcoal. According to Position Statement (by EAPCCT) it should be applied only if the patient presents within one hour of ingestion, with potentially lethal ingested dose. Atropine, a competitive antagonist of acetylcholine at m-receptors, which antagonizes bronchosecretion and bronchoconstriction, is the corner stone of acute organophosphate poisoning therapy. There were many attempts to find a more efficient drug, including glycopyrrolate which has been used even in clinical trials, but it still can not replace atropine. The only dilemma about atropine usage which still exists, concerns usage of high atropine dose and scheme of application. The most efficient atropinization is achieved with bolus doses of 1-2mg of atropine i.v push, with repeating the dose on each 5 minutes until signs of atropinization are registered. Diazepam, with its GABA stabilizing effect, reduces central nervous system damage and central respiratory weakness. Oximes reactivate phosphorylated acetylcholinesterase, which still has not gone ageing, reducing acetylcholine concentration and cholinergic crisis. These effects are clearly demonstrated in experimental conditions, but the clinical significance of oximes is still unclear and there are still those who question oxime therapy. For those who approve it, oxime dosage, duration of therapy, the choice of oxime for certain OP is still an open issue. We need new, more efficient antidotes, and those that are in use are only the small part of the therapy which could be used. Experimental studies show favorable therapeutic effect of many agents, but none of them has been introduced in standard treatment of OPI poisoning in the last 30
Urgent medical response in CBR incidents
International Nuclear Information System (INIS)
Castulik, P.; Slabotinsky, J.; Kralik, L.; Bradka, S.
2009-01-01
During CBR incidents with releases of hazardous materials (HazMat), there is extremely urgent aim of first rescuing responders to safe the life for as much as possible victims and reducing health consequences from the exposure of the HazMat. Highest priority of the response is to be applied, if victims are exposed with chemicals through their airways and/or mucous membranes. There is general approach in the emergency medical services (EMS) stated that the victims being in critical status have to receive emergency medical care on-site even prior the transportation to a medical facility. However, in a case of CBR events the EMS prefer to provide the First Aid for victims to be already decontaminated as mass casualties, e.g. by the firemen and transferred to a safe zone. This approach is to be time consuming and thus creating delays in medical care not in the favor of a victim's successful survival. In order to overcome this approach, there are needs for eminent ceasing of the victims exposure, protection of breathing tract/ventilation support and administration of antidotes, if available. All this have to be done in shortest time since HazMat incident/accident occurs. This presentation is focusing on emergency provisions for saving victims directly in contaminated environment through the assistance by responders, concentrating on search and rescue of victims, their emergency decontamination, breathing protection, clothing removal, ventilation support, antidote administration, fixing and bandage of trauma injuries prior transportation and/or mass decontamination. This experience is shared based on a field exercise with the EMS volunteers (Red Cross), fire brigade volunteers and university's students.(author)
Intraosseous vascular access in disasters and mass casualty events: A review of the literature.
Burgert, James M
2016-01-01
The intraosseous (IO) route of vascular access has been increasingly used to administer resuscitative fluids and drugs to patients in whom reliable intravenous (IV) access could not be rapidly or easily obtained. It is unknown that to what extent the IO route has been used to gain vascular access during disasters and mass casualty events. The purpose of this review was to examine the existing literature to answer the research question, "What is the utility of the IO route compared to other routes for establishing vascular access in patients resulting from disasters and mass casualty events?" Keyword-based online database search of PubMed, CINAHL, and the Cochrane Database of Systematic Reviews. University-based academic research cell. Included evidence were randomized and nonrandomized trials, systematic reviews with and without meta-analysis, case series, and case reports. Excluded evidence included narrative reviews and expert opinion. Not applicable. Of 297 evidence sources located, 22 met inclusion criteria. Located evidence was organized into four categories including chemical agent poisoning, IO placement, while wearing chemical protective clothing (PPE), military trauma, and infectious disease outbreak. Evidence indicates that the IO route of infusion is pharmacokinetically equal to the IV route and superior to the intramuscular (IM) and endotracheal routes for the administration of antidotal drugs in animal models of chemical agent poisoning while wearing full chemical PPE. The IO route is superior to the IM route for antidote administration during hypovolemic shock. Civilian casualties of explosive attacks and mass shootings would likely benefit from expanded use of the IO route and military resuscitation strategies. The IO route is useful for fluid resuscitation in the management of diarrheal and hemorrhagic infectious disease outbreaks.
Antidotal activity of Averrhoa carambola (Star fruit on fluoride induced toxicity in rats
Directory of Open Access Journals (Sweden)
Vasant Rupal A.
2014-06-01
Full Text Available Consumption of fluoride leads to several physiological disturbances in carbohydrate, lipid and antioxidant metabolisms. Averrhoa carambola L. fruit (Star fruit is a commonly consumed fruit in tropical countries and is an ingredient in folklore medicines. As the fruits have high polyphenolic and antioxidant contents, the present study was undertaken to investigate the potential of star fruit as a dietary supplement in attenuating the fluoride induced hyperglycemia, hypercholesterolemia and oxidative stress in laboratory rats. A four-week exposure to fluoride caused sustained hyperglycemia, hyperlipidemia and oxidative stress and, when the diet was supplemented with star fruit powder, carbohydrate, lipid and antioxidant profiles were restored significantly. It is surmised that the antihyperglycemic, antihypercholesterolemic and antioxidant activities of star fruit in fluoride exposed rats could be due to the presence of polyphenols, flavonoids, saponins, phytosterols, ascorbic acid and fibers in the fruit, which are all well known regulators of carbohydrate, lipid and antioxidant metabolisms. These findings suggest that star fruit can be used as a dietary supplement in fluoride endemic regions to contain fluoride induced hyperglycemia, hyperlipidemia and oxidative stress
Ethylene glycol or methanol intoxication : Which antidote should be used, fomepizole or ethanol?
Rietjens, S. J.; de Lange, D. W.; Meulenbelt, J.
2014-01-01
Ethylene glycol (EG) and methanol poisoning can cause life-threatening complications. Toxicity of EG and methanol is related to the production of toxic metabolites by the enzyme alcohol dehydrogenase (ADH), which can lead to metabolic acidosis, renal failure (in EG poisoning), blindness (in methanol
Antidotal activity of Averrhoa carambola (Star fruit) on fluoride induced toxicity in rats.
Vasant, Rupal A; Narasimhacharya, A V R L
2014-06-01
Consumption of fluoride leads to several physiological disturbances in carbohydrate, lipid and antioxidant metabolisms. Averrhoa carambola L. fruit (Star fruit) is a commonly consumed fruit in tropical countries and is an ingredient in folklore medicines. As the fruits have high polyphenolic and antioxidant contents, the present study was undertaken to investigate the potential of star fruit as a dietary supplement in attenuating the fluoride induced hyperglycemia, hypercholesterolemia and oxidative stress in laboratory rats. A four-week exposure to fluoride caused sustained hyperglycemia, hyperlipidemia and oxidative stress and, when the diet was supplemented with star fruit powder, carbohydrate, lipid and antioxidant profiles were restored significantly. It is surmised that the antihyperglycemic, antihypercholesterolemic and antioxidant activities of star fruit in fluoride exposed rats could be due to the presence of polyphenols, flavonoids, saponins, phytosterols, ascorbic acid and fibers in the fruit, which are all well known regulators of carbohydrate, lipid and antioxidant metabolisms. These findings suggest that star fruit can be used as a dietary supplement in fluoride endemic regions to contain fluoride induced hyperglycemia, hyperlipidemia and oxidative stress.
Building a Consonance Between Religion and Science: an Antidote for the Seeming Conflict
Directory of Open Access Journals (Sweden)
Omomia O. Austin
2014-05-01
Full Text Available It is commonly argued by a school of thought that there is no relationship between religion and science. This extreme position has led to a lasting conflict, which has pitched religion against science and science against religion. The attempt in this paper is to articulate the fact that there can be an enduring consonance between religion and science. No doubt, the conflict and debate on the subject of religion and science has taken the front burner in both religious and philosophical discusses. Some scholars have argued that science has no role in religious or theological domain, while others contest that all religious concerns and considerations must be exposed to empirical investigations, and, proven by the dynamics of our intellect or reason. This paper, therefore, attempts to examine how religion and science complement each other. The author applied philosophical, sociological and historical methodology in his research. It is recommended that there is the need for dialogue between religion and science.
“Mai, inteso nominare”. La citazione in “Dio ne scampi dagli Orsenigo"
Directory of Open Access Journals (Sweden)
Sandra Carapezza
2015-06-01
Full Text Available In Dio ne scampi dagli Orsenigo Vittorio Imbriani grapples with the form of the novel. In a dialectical fashion, explicit quotations (frequently from French sources clarify his position towards generic paradigms. This article attempts to group these quotations on the basis of their literary genres in order to stress the complexities of an inclusive and versatile text. The intertextual network, ranging from feuilleton literature to academic preciosity, in the last instance reveals itself as an ironic antidote to Romantic identification. This trend is confirmed by the remarkable increase in the number of quotations from the first edition (1876 to the second publication in volume form in 1883.
Accidental Phosphine Gas Poisoning with Fatal Myocardial Dysfunction in Two Families
International Nuclear Information System (INIS)
Akhtar, S.; Rehman, A.; Haque, A.; Bano, S.
2015-01-01
Aluminum phosphide is commonly used as a rodenticide and insecticide and is one of the most fatal poisons. The active ingredient is Phosphine gas which inhibits cytochrome oxidase and cellular oxygen utilization. The clinical symptoms are due to multiorgan involvement including cardiac toxicity which is the most common cause of mortality. Severity of clinical manifestations depends upon the amount of the gas to which a person is exposed. There is no specific antidote available. High index of suspicion and early aggressive treatment is the key to success. We report 2 cases of aluminum phosphide toxicity in 2 families due to incidental exposure after fumigation. (author)
GUIDELINES FOR PARACETAMOL POISONING TREATMENT
Directory of Open Access Journals (Sweden)
Lucija Sarc
2014-04-01
Full Text Available Paracetamol overdose results in an accumulation of the reactive, hepatotoxic metabolite N-acetyl-p-benzoquinoneimin (NAPKQI which can cause serious liver injury. Recognition of paracetamol overdose, hepatotoxicity risk estimation and early treatment are crutial in paracetamol poisoniong management. In ingestion of potential hepatotoxic dose of paracetamol decontamination and early treatment with N-acetylcysteine (NAC are indicated. Both, 20-hours intravenous and 72-hurs oral regimes of NAC administration are successful. By antidote regime selection we should consider patient condition and time after paracetamol overdose. In severe hepatotoxicity, criteria for liver transplantation should be regularly evaluated and mechanisms for liver transplantation must be activated in time.
[Methaemoglobinaemia induced by ingestion of alkyl nitrite, "poppers"].
Kragsfeldt, Celina Thelberg; Nissen, Christoffer B; Brandt, Frans
2016-08-22
We present a case report of an 18-year-old male who was referred to the emergency department with evidence of methaemoglobinaemia. He presented with classic symptoms with peripheral cyanosis and hypoxia. Arterial blood gas showed a methaemoglobin level of 36%. This was caused by ingestion of alkyl nitrate, a widespread party drug called "poppers". When inhaled it causes euphoria, reduced pain and relaxation of the anal sphincter, but oral use may induce life-threatening methaemoglobinaemia. The treatment of choice is the antidote methylene blue. After treatment the patient regained full recovery and was discharged on the following day. We discuss classic symptoms, diagnosis and treatment of intoxication with methylene blue.
DEFF Research Database (Denmark)
Rasappa, Sozaraj; Schulte, Lars; Borah, Dipu
2018-01-01
Cylinder-forming polystyrene-block-polydimethylsiloxane (PS-b-PDMS, 27.2k-b-11.7k, SD39) block copolymer having a total molecular weight of 39 kg mol−1 was exploited to achieve in-plane morphologies of lines, dots and antidots. Brush-free self-assembly of the SD39 on silicon substrates was invest...... substrates provides a simplified method for surface nanopatterning, templated growth of nanomaterials and nanofabrication....... the pattern into the underlying substrate. Directed self-assembly and hierarchical directed self-assembly on block copolymer templates for confinement of dots was successfully demonstrated. The strategy for achieving multiple morphologies using one BCP by mere choice of the annealing solvents on unmodified...
Poisoining with Tricyclic Antidepressants and Current Treatment
Directory of Open Access Journals (Sweden)
Muge Gulen
2016-12-01
Full Text Available Poisoning with tricyclic antidepressants is one of the main causes of morbidity and mortality compared to all the antidepressants. Main toxic effects are on the cardiovascular system and central nervous system and manifests itself as anticholinergic symptoms. There is no antidote known to be used in the treatment. But sodium bicarbonate treatment is effective in preventing ventricular arrhythmias and hypotension, and resolving metabolic acidosis. There are some treatments that has been used for relief of symptoms and some of them still are in research stage. The drugs that are used can be customized according to the patients symptoms. [Archives Medical Review Journal 2016; 25(4.000: 608-621
Toxic alcohol ingestion: prompt recognition and management in the emergency department [digest].
Beauchamp, Gillian A; Valento, Matthew; Kim, Jeremy
2016-09-22
Identifying patients with potential toxic alcohol exposure and initiating appropriate management is critical to avoid significant patient morbidity. Sources of toxic alcohol exposure include ethylene glycol, methanol, diethylene glycol, propylene glycol, and isopropanol. Treatment considerations include the antidotes fomepizole and ethanol, and hemodialysis for removal of the parent compound and its toxic metabolites. Additional interventions include adjunctive therapies that may improve acidosis and enhance clearance of the toxic alcohol or metabolites. This issue reviews common sources of alcohol exposure, basic mechanisms of toxicity, physical examination and laboratory findings that may guide rapid assessment and management, and indications for treatment. [Points & Pearls is a digest of Emergency Medicine Practice].
Popov, Dmitri; Maliev, Slava
radiation toxins to induce hyperimmune serum: Group A -Toxoid form of CV ARS toxins ( SRD-1); Group B-Toxoid form of CR ARS (SRD-2)toxins ; Group C -Toxoid form of GI ARS (SRD-3); Group D -Toxoid form of HP ARS (SRD-4). After the hyperimmune serum was pooled from several animals, purified, and concentrated, the IgG fraction was separated. Enzyme-linked immunosorbent assays of the hyper-immune serum had revealed high titers of IgG with specific binding to radi-ation toxins. The antiradiation IgG preparation was injected into laboratory animals one hour before and three hours after irradiation, and was evaluated for its ability to protect inoculated animals against the development of acute radiation syndromes. Results: Animals that were inoculated with specific antiradiation antibodies before and after receiving lethal irradiation at LD 100/30 exhibited 60-75% survival rate within 30 days. Also, these animals inoculated with the Antiradiation Antitoxin had exhibited markedly reduced clinical symptoms of the ARS, even those ones that did not survive irradiation. Discussion: The results of our experiments have demonstrated that the rabbit hyperimmune IgG preparations directed against SRD toxins provide a significant protection against high doses of radiation. In comparison, the mortality rate of irradiated control animals was 100% in the same time period. The mortality rates of animals treated by the hyperimmune IgG antidote have varied in the different groups of ani-mals and different forms of the ARS. However, significant radioprotection was observed in each group treated with the IgGs. The specific antiradiation antidote IGg isolated from hyperim-mune serum of immunized horses is under study. The specific antiradiation antidote contains antibodies to neurotoxins -SAAN IgG includes 50% IgG to Cv ARS, 25% IgG to Cr ARS and 25 % IgG to Gi ARS. The other type of the Specific antiradiation antidote containes antibodies to hematotoxins -SAAH IgG -100%. A combined variant is under
In vivo hypotensive effect and in vitro inhibitory activity of some Cyperaceae species
Directory of Open Access Journals (Sweden)
Monica Lacerda Lopes Martins
2013-12-01
Full Text Available In 1820, French naturalist August Saint Hillaire, during a visit in Espírito Santo (ES, a state in southeastern Brazil, reported a popular use of Cyperaceae species as antidote to snake bites. The plant may even have a hypotensive effect, though it was never properly researched. The in vitro inhibitory of the angiotensin converting enzyme (ACE activity of eigth ethanolic extracts of Cyperaceae was evaluated by colorimetric assay. Total phenolic and flavonoids were determined using colorimetric assay. The hypotensive effect of the active specie (Rhychonospora exaltata, ERE and the in vivo ACE assay was measured in vivo using male Wistar Kyoto (ERE, 0.01-100mg/kg, with acetylcholine (ACh as positive control (5 µg/kg, i.v.. The evaluation of ACE in vivo inhibitory effect was performed comparing the mean arterial pressure before and after ERE (10 mg/kg in animals which received injection of angiotensin I (ANG I; 0,03, 03 and 300 µg/kg, i.v.. Captopril (30 mg/kg was used as positive control. Bulbostylis capillaris (86.89 ± 15.20% and ERE (74.89 ± 11.95%, ERE were considered active in the in vitro ACE inhibition assay, at 100 µg/mL concentration. ACh lead to a hypotensive effect before and after ERE's curve (-40±5% and -41±3%. ERE showed a dose-dependent hypotensive effect and a in vivo ACE inhibitory effect. Cyperaceae species showed an inhibitory activity of ACE, in vitro, as well as high content of total phenolic and flavonoids. ERE exhibited an inhibitory effect on both in vitro and in vivo ACE. The selection of species used in popular medicine as antidotes, along with the in vitro assay of ACE inhibition, might be a biomonitoring method for the screening of new medicinal plants with hypotensive properties.
Aodah, Alhussain; Bafail, Rawan S; Rawas-Qalaji, Mutasem
2017-07-01
In this study, we formulated and evaluated the effects of tablet dimensions and drug load on the characteristics of atropine sulfate (AS) fast-disintegrating sublingual tablets (FDSTs). We aim to develop AS FDSTs as an alternative non-invasive and portable dosage form for the emergency treatment of organophosphate (OP) toxicity. AS autoinjector, AtroPen®, is the only self-administered dosage form available as an antidote for-out-of-hospital emergency use, but it is associated with several limitations and drawbacks. Seven FDST formulations of two tablet sizes, 150 mg (A) and 50 mg (B), and of several AS loads, 0 mg (A1, B1), 2 mg (A2, B2), 4 mg (B3), and 8 mg (B4a, B4b), were formulated and manufactured by direct compression. AS FDST characteristics were evaluated using USP and non-USP tests. Results were statistically compared at p < 0.05. All FDSTs passed the USP content uniformity and friability tests, disintegrated and released AS in ≤30 and 60 s. B1 and B2 were significantly harder than A1 and A2. Water uptake of A1 was significantly the highest. However, B1 and B2 had shorter disintegration and wetting times and higher amounts of AS dissolved than did A1 and A2 (p < 0.05). Increasing AS negatively affected FDST tensile strength (p < 0.05 for B4a) and water uptake (p < 0.05 for B3, B4a and B4b), however, without affecting AS dissolution. Formulation of AS up to 16% into smaller FDSTs was successful. Smaller FDSTs were harder and disintegrated more quickly. These AS FDSTS have the potential for further in vivo testing to evaluate their OP antidote potential.
Directory of Open Access Journals (Sweden)
Shafat Ahmad Mir
2014-12-01
Full Text Available Background: Cardiac toxicity is one of the life-threatening effects of severe organophosphate (OP poisoning. We presented a patient with severe OP poisoning, in cardiovascular shock poorly responsive to conventional treatments, who could be resuscitated successfully with intravenous lipid emulsion (ILE therapy. Case report: A 26-year-old female was admitted to our emergency department who had ingested unquantifiable amount of parathion. On admission, she was tachycardic, tachypneic and hypotensive with pin-point pupils. Neurological examination revealed Glasgow coma scale (GCS of 6. Immediately, she was admitted to intensive care unit, and was intubated and put under mechanical ventilation. Standard treatments including atropine and pralidoxime (according to WHO protocol were given to the patient. However, the patient did not show favorable response to antidotes and supportive treatments and her condition continued to deteriorate. Because of bradycardia and hypotension, she was given noradrenaline vasopressor support. Due to failure of treatments in improvement of the patient's condition, a single 100 mL bolus (1.5 mL/kg of 20% intralipid was administered intravenously and the same dose repeated 2 minutes later. Over 15 minutes, cardiovascular condition of the patient noticeably improved. ILE was continued up to a total dose of 300 mL when extrasystoles disappeared. The patient could be extubated from ventilator with GCS score of 15 on the 5th day of admission. Discussion: OPs are lipid soluble and ILE can move these kinds of compounds away from the site of toxicity and dissolve them in the plasma which will alleviate their toxic effects. Conclusion: This is the first human case report of OP poisoning which showed efficacy of intralipids as antidotal therapy outside the accepted setting of local anesthetic toxicity.
Energy Technology Data Exchange (ETDEWEB)
Li, Tong; Meng, Zhiyun; Zhu, Xiaoxia; Gan, Hui; Gu, Ruolan; Wu, Zhuona; Li, Jian; Zheng, Ying; Liu, Taoyun; Han, Peng; Han, Su; Dou, Guifang, E-mail: douguifang@vip.sina.com
2015-11-20
Protamine sulfate (PS), the only clinically approved antidote to unfractionated heparin (UFH), is widely used for cardiopulmonary surgery or other extracorporeal circulation situations. However, the applications of PS have accompanied various severe side-effects. In this study, we presented a novel synthesized peptide compound (RRRRR-RRRRR-RRRRR-sulfate, R15S) served as a safer UFH antidote. Comparison studies were conducted between PS and R15S on efficacy and safety, aided by heparin neutralization studies, drug toxicity studies and anaphylactic analysis. Our research demonstrated that R15S contained comparable UFH neutralization activity in vitro and in rats in vivo as to active partial thromboplastin time (APTT) and anti-FXa assays. There was no cytotoxicity for R15S at 60 μg mg{sup −1} or below and the median lethal dose (LD{sub 50}) of R15S in mice was 35.4 mg kg{sup −1}, both of which were similar to that of PS. Furthermore, R15S exhibited no immunogenicity while it was obvious in guinea pigs immunized with PS. The level of cross-reactivity to anti-PS antibodies of R15S was about 30%. Both of which indicated much safer properties of R15S than PS. In conclusion, we presented a promising candidate R15S for UFH reversal, which is effective in neutralizing UFH and potentially safer in use. - Highlights: • R15 sulfate has a comparable unfractionated heparin neutralization activity to PS. • R15 sulfate avoided severe anaphylactic responses which happened to PS in clinical use. • R15 sulfate could provide a stricter quality control compared to PS which may vary with different batches.
Obeticholic acid protects against carbon tetrachloride-induced acute liver injury and inflammation
International Nuclear Information System (INIS)
Zhang, Da-Gang; Zhang, Cheng; Wang, Jun-Xian; Wang, Bi-Wei; Wang, Hua; Zhang, Zhi-Hui; Chen, Yuan-Hua; Lu, Yan; Tao, Li; Wang, Jian-Qing; Chen, Xi; Xu, De-Xiang
2017-01-01
The farnesoid X receptor (FXR) is a ligand-activated transcription factor that plays important roles in regulating bile acid homeostasis. The aim of the present study was to investigate the effects of obeticholic acid (OCA), a novel synthetic FXR agonist, carbon tetrachloride (CCl 4 )-induced acute liver injury. Mice were intraperitoneally injected with CCl 4 (0.15 ml/kg). In CCl 4 + OCA group, mice were orally with OCA (5 mg/kg) 48, 24 and 1 h before CCl 4 . As expected, hepatic FXR was activated by OCA. Interestingly, OCA pretreatment alleviated CCl 4 -induced elevation of serum ALT and hepatic necrosis. Moreover, OCA pretreatment inhibited CCl 4 -induced hepatocyte apoptosis. Additional experiment showed that OCA inhibits CCl 4 -induced hepatic chemokine gene Mcp-1, Mip-2 and Kc. Moreover, OCA inhibits CCl 4 -induced hepatic pro-inflammatory gene Tnf-α and Il-1β. By contrast, OCA pretreatment elevated hepatic anti-inflammatory gene Il-4. Further analysis showed that OCA pretreatment inhibited hepatic IκB phosphorylation and blocked nuclear translocation of NF-κB p65 and p50 subunits during CCl 4 -induced acute liver injury. In addition, OCA pretreatment inhibited hepatic Akt, ERK and p38 phosphorylation in CCl 4 -induced acute liver injury. These results suggest that OCA protects against CCl 4 -induced acute liver injury and inflammation. Synthetic FXR agonists may be effective antidotes for hepatic inflammation during acute liver injury. - Highlights: • OCA pretreatment activates hepatic FXR. • FXR activation protects against CCl 4 -induced acute liver injury. • FXR activation inhibits hepatocyte apoptosis during CCl 4 -induced liver injury. • FXR activation differentially regulates hepatic inflammatory genes. • Synthetic FXR agonists are effective antidotes for acute liver injury.
Retrospective study of cattle poisonings in California: recognition, diagnosis, and treatment
Directory of Open Access Journals (Sweden)
Puschner B
2012-11-01
Full Text Available Anita Varga,1 Birgit Puschner21William R Pritchard Veterinary Medical Teaching Hospital, Large Animal Clinic, School of Veterinary Medicine, University of California, Davis, CA, USA; 2Department of Molecular Biosciences and the California Animal Health and Food Safety Laboratory System, School of Veterinary Medicine, University of California, Davis, CA, USAAbstract: In this retrospective study all suspect bovine intoxications submitted to the California Animal Health and Food Safety Laboratory between January 1, 2000 and December 31, 2011 were reviewed. A total of 1199 cases were submitted, but a diagnosis of intoxication was only established in 13.5% of cases. In these cases, overexposures to minerals, metals, and poisonous plants were determined as the most commonly diagnosed poisonings in cattle in California. Nitrate/nitrite poisoning was the most commonly diagnosed plant-associated intoxication, followed by gossypol and oleander. This study details the diagnostic challenges and treatment options for the most commonly diagnosed intoxications. To ensure proper treatment and prevention of new cases, accurate diagnosis is necessary, and therefore this review provides an essential tool for the food animal practitioner. Available toxicological analyses are offered at select laboratories, which can be time consuming and expensive, yet the potential for residues in consumed animal products and implications for human health necessitate testing and consultation. Any potential exposure to a toxicant in cattle should be reviewed to determine whether a residue hazard exists. Therapy focuses on immediate removal of the toxicant from the environment and from the gastrointestinal tract. With few antidotes available, most are cost prohibitive to treat numerous affected cattle. In addition, most antidotes will require extra-label drug use and establishment of meat and milk withdrawal times.Keywords: toxins, toxicology, poisonous plants, bovine
Energy Technology Data Exchange (ETDEWEB)
Katalinić, Maja; Maček Hrvat, Nikolina [Institute for Medical Research and Occupational Health, POB 291, HR-10001 Zagreb (Croatia); Baumann, Krešimir; Morasi Piperčić, Sara; Makarić, Sandro; Tomić, Srđanka; Jović, Ozren; Hrenar, Tomica [Department of Chemistry, Faculty of Science, University of Zagreb, HR-10001 Zagreb (Croatia); Miličević, Ante [Institute for Medical Research and Occupational Health, POB 291, HR-10001 Zagreb (Croatia); Jelić, Dubravko [Fidelta Ltd., HR-10001 Zagreb (Croatia); Žunec, Suzana [Institute for Medical Research and Occupational Health, POB 291, HR-10001 Zagreb (Croatia); Primožič, Ines, E-mail: ines.primozic@chem.pmf.hr [Department of Chemistry, Faculty of Science, University of Zagreb, HR-10001 Zagreb (Croatia); Kovarik, Zrinka, E-mail: zkovarik@imi.hr [Institute for Medical Research and Occupational Health, POB 291, HR-10001 Zagreb (Croatia)
2016-11-01
A well-considered treatment of acute nerve agents poisoning involves the exogenous administration of butyrylcholinesterase (BChE, EC 3.1.1.8) as a stoichiometric bioscavenger efficient in preventing cholinergic crises caused by acetylcholinesterase (AChE, EC 3.1.1.7) inhibition. An additional improvement in medical countermeasures would be to use oximes that could reactivate BChE as well to upgrade bioscavenging from stoichiometric to oxime-assisted catalytic. Therefore, in this paper we investigated the potency of 39 imidazolium and benzimidazolium oximes (36 compounds synthesized for the first time) to be considered as the reactivators specifically designed for reactivation of phosphylated human BChE. Their efficiency in the reactivation of paraoxon-, VX-, and tabun-inhibited human BChE, as well as human AChE was tested and compared with the efficiencies of HI-6 and obidoxime, used in medical practice today. A comprehensive analysis was performed for the most promising oximes defining kinetic parameters of reactivation as well as interactions with uninhibited BChE. Furthermore, experimental data were compared with computational studies (docking, QSAR analysis) as a starting point in future oxime structure refinement. Considering the strict criteria set for in vivo applications, we determined the cytotoxicity of lead oximes on two cell lines. Among the tested oxime library, one imidazolium compound was selected for preliminary in vivo antidotal study in mice. The obtained protection in VX poisoning outlines its potential in development oxime-assisted OP-bioscavenging with BChE. - Highlights: • 36 new imidazolium and benzimidazolium oximes were designed and synthesized. • In vitro reactivation kinetics of phosphylated butyrylcholinesterase was studded. • The modes of actions were elucidated by QSAR and docking simulations. • Protection in VX poisoning was 6.3 × LD{sub 50} in in vivo antidotal study in mice. • Imidazolium oxime-assisted catalysis is
International Nuclear Information System (INIS)
Katalinić, Maja; Maček Hrvat, Nikolina; Baumann, Krešimir; Morasi Piperčić, Sara; Makarić, Sandro; Tomić, Srđanka; Jović, Ozren; Hrenar, Tomica; Miličević, Ante; Jelić, Dubravko; Žunec, Suzana; Primožič, Ines; Kovarik, Zrinka
2016-01-01
A well-considered treatment of acute nerve agents poisoning involves the exogenous administration of butyrylcholinesterase (BChE, EC 3.1.1.8) as a stoichiometric bioscavenger efficient in preventing cholinergic crises caused by acetylcholinesterase (AChE, EC 3.1.1.7) inhibition. An additional improvement in medical countermeasures would be to use oximes that could reactivate BChE as well to upgrade bioscavenging from stoichiometric to oxime-assisted catalytic. Therefore, in this paper we investigated the potency of 39 imidazolium and benzimidazolium oximes (36 compounds synthesized for the first time) to be considered as the reactivators specifically designed for reactivation of phosphylated human BChE. Their efficiency in the reactivation of paraoxon-, VX-, and tabun-inhibited human BChE, as well as human AChE was tested and compared with the efficiencies of HI-6 and obidoxime, used in medical practice today. A comprehensive analysis was performed for the most promising oximes defining kinetic parameters of reactivation as well as interactions with uninhibited BChE. Furthermore, experimental data were compared with computational studies (docking, QSAR analysis) as a starting point in future oxime structure refinement. Considering the strict criteria set for in vivo applications, we determined the cytotoxicity of lead oximes on two cell lines. Among the tested oxime library, one imidazolium compound was selected for preliminary in vivo antidotal study in mice. The obtained protection in VX poisoning outlines its potential in development oxime-assisted OP-bioscavenging with BChE. - Highlights: • 36 new imidazolium and benzimidazolium oximes were designed and synthesized. • In vitro reactivation kinetics of phosphylated butyrylcholinesterase was studded. • The modes of actions were elucidated by QSAR and docking simulations. • Protection in VX poisoning was 6.3 × LD 50 in in vivo antidotal study in mice. • Imidazolium oxime-assisted catalysis is feasible
Obeticholic acid protects against carbon tetrachloride-induced acute liver injury and inflammation
Energy Technology Data Exchange (ETDEWEB)
Zhang, Da-Gang [First Affiliated Hospital, Anhui Medical University, Hefei 230022 (China); Zhang, Cheng [Department of Toxicology, Anhui Medical University, Hefei 230032 (China); Wang, Jun-Xian [First Affiliated Hospital, Anhui Medical University, Hefei 230022 (China); Wang, Bi-Wei; Wang, Hua; Zhang, Zhi-Hui; Chen, Yuan-Hua [Department of Toxicology, Anhui Medical University, Hefei 230032 (China); Lu, Yan; Tao, Li; Wang, Jian-Qing [Second Affiliated Hospital, Anhui Medical University, Hefei 230601 (China); Chen, Xi [First Affiliated Hospital, Anhui Medical University, Hefei 230022 (China); Xu, De-Xiang, E-mail: xudex@126.com [Department of Toxicology, Anhui Medical University, Hefei 230032 (China)
2017-01-01
The farnesoid X receptor (FXR) is a ligand-activated transcription factor that plays important roles in regulating bile acid homeostasis. The aim of the present study was to investigate the effects of obeticholic acid (OCA), a novel synthetic FXR agonist, carbon tetrachloride (CCl{sub 4})-induced acute liver injury. Mice were intraperitoneally injected with CCl{sub 4} (0.15 ml/kg). In CCl{sub 4} + OCA group, mice were orally with OCA (5 mg/kg) 48, 24 and 1 h before CCl{sub 4}. As expected, hepatic FXR was activated by OCA. Interestingly, OCA pretreatment alleviated CCl{sub 4}-induced elevation of serum ALT and hepatic necrosis. Moreover, OCA pretreatment inhibited CCl{sub 4}-induced hepatocyte apoptosis. Additional experiment showed that OCA inhibits CCl{sub 4}-induced hepatic chemokine gene Mcp-1, Mip-2 and Kc. Moreover, OCA inhibits CCl{sub 4}-induced hepatic pro-inflammatory gene Tnf-α and Il-1β. By contrast, OCA pretreatment elevated hepatic anti-inflammatory gene Il-4. Further analysis showed that OCA pretreatment inhibited hepatic IκB phosphorylation and blocked nuclear translocation of NF-κB p65 and p50 subunits during CCl{sub 4}-induced acute liver injury. In addition, OCA pretreatment inhibited hepatic Akt, ERK and p38 phosphorylation in CCl{sub 4}-induced acute liver injury. These results suggest that OCA protects against CCl{sub 4}-induced acute liver injury and inflammation. Synthetic FXR agonists may be effective antidotes for hepatic inflammation during acute liver injury. - Highlights: • OCA pretreatment activates hepatic FXR. • FXR activation protects against CCl{sub 4}-induced acute liver injury. • FXR activation inhibits hepatocyte apoptosis during CCl{sub 4}-induced liver injury. • FXR activation differentially regulates hepatic inflammatory genes. • Synthetic FXR agonists are effective antidotes for acute liver injury.
Kupper, Jacqueline; Reichert, Cornelia
2009-05-01
Ingestions of plants rarely lead to life-threatening intoxications. Highly toxic plants, which can cause death, are monkshood (Aconitum sp.), yew (Taxus sp.) and autumn crocus (Colchicum autumnale). Lethal ingestions of monkshood and yew are usually suicides, intoxications with autumn crocus are mostly accidental ingestions of the leaves mistaken for wild garlic (Allium ursinum). Severe intoxications can occur with plants of the nightshade family like deadly nightshade (Atropa belladonna), angel's trumpet (Datura suaveolens) or jimsonweed (Datura stramonium). These plants are ingested for their psychoactive effects. Ingestion of plant material by children most often only causes minor symptoms or no symptoms at all, as children usually do not eat great quantities of the plants. They are especially attracted by the colorful berries. There are plants with mostly cardiovascular effects like monkshood, yew and Digitalis sp. Some of the most dangerous plants belong to this group. Plants of the nightshade family cause an anticholinergic syndrome. With golden chain (Laburnum anagyroides), castor bean (Ricinus communis) and raw beans (Phaseolus vulgaris) we see severe gastrointestinal effects. Autumn crocus contains a cell toxin, colchicine, which leads to multiorgan failure. Different plants are irritative or even caustic to the skin. Treatment is usually symptomatic. Activated charcoal is administered within one hour after ingestion (1 g/kg). Endoscopic removal of plant material can be considered with ingestions of great quantities of highly toxic plants. Administration of repeated doses of charcoal (1-2 g/h every 2-4 hours) may be effective in case of oleander poisoning. There exist only two antidotes: Anti-digoxin Fab fragments can be used with cardenolide glycoside-containing plants (Digitalis sp., Oleander). Physostigmine is the antidote for severe anticholinergic symptoms of the CNS. Antibodies against colchicine, having been developed in France, are not available at
Advances in toxicology and medical treatment of chemical warfare nerve agents
2012-01-01
Organophosphorous (OP) Nerve agents (NAs) are known as the deadliest chemical warfare agents. They are divided into two classes of G and V agents. Most of them are liquid at room temperature. NAs chemical structures and mechanisms of actions are similar to OP pesticides, but their toxicities are higher than these compounds. The main mechanism of action is irreversible inhibition of Acetyl Choline Esterase (AChE) resulting in accumulation of toxic levels of acetylcholine (ACh) at the synaptic junctions and thus induces muscarinic and nicotinic receptors stimulation. However, other mechanisms have recently been described. Central nervous system (CNS) depression particularly on respiratory and vasomotor centers may induce respiratory failure and cardiac arrest. Intermediate syndrome after NAs exposure is less common than OP pesticides poisoning. There are four approaches to detect exposure to NAs in biological samples: (I) AChE activity measurement, (II) Determination of hydrolysis products in plasma and urine, (III) Fluoride reactivation of phosphylated binding sites and (IV) Mass spectrometric determination of cholinesterase adducts. The clinical manifestations are similar to OP pesticides poisoning, but with more severity and fatalities. The management should be started as soon as possible. The victims should immediately be removed from the field and treatment is commenced with auto-injector antidotes (atropine and oximes) such as MARK I kit. A 0.5% hypochlorite solution as well as novel products like M291 Resin kit, G117H and Phosphotriesterase isolated from soil bacterias, are now available for decontamination of NAs. Atropine and oximes are the well known antidotes that should be infused as clinically indicated. However, some new adjuvant and additional treatment such as magnesium sulfate, sodium bicarbonate, gacyclidine, benactyzine, tezampanel, hemoperfusion, antioxidants and bioscavengers have recently been used for OP NAs poisoning. PMID:23351280
Aracava, Yasco; Pereira, Edna F R; Akkerman, Miriam; Adler, Michael; Albuquerque, Edson X
2009-12-01
Galantamine, a centrally acting cholinesterase (ChE) inhibitor and a nicotinic allosteric potentiating ligand used to treat Alzheimer's disease, is an effective and safe antidote against poisoning with nerve agents, including soman. Here, the effectiveness of galantamine was compared with that of the centrally active ChE inhibitors donepezil, rivastigmine, and (+/-)huperzine A as a pre- and/or post-treatment to counteract the acute toxicity of soman. In the first set of experiments, male prepubertal guinea pigs were treated intramuscularly with one of the test drugs and 30 min later challenged with 1.5 x LD(50) soman (42 microg/kg s.c.). All animals that were pretreated with galantamine (6-8 mg/kg), 3 mg/kg donepezil, 6 mg/kg rivastigmine, or 0.3 mg/kg (+/-)huperzine A survived the soman challenge, provided that they were also post-treated with atropine (10 mg/kg i.m.). However, only galantamine was well tolerated. In subsequent experiments, the effectiveness of specific treatment regimens using 8 mg/kg galantamine, 3 mg/kg donepezil, 6 mg/kg rivastigmine, or 0.3 mg/kg (+/-)huperzine A was compared in guinea pigs challenged with soman. In the absence of atropine, only galantamine worked as an effective and safe pretreatment in animals challenged with 1.0 x LD(50) soman. Galantamine was also the only drug to afford significant protection when given to guinea pigs after 1.0 x LD(50) soman. Finally, all test drugs except galantamine reduced the survival of the animals when administered 1 or 3 h after the challenge with 0.6 or 0.7 x LD(50) soman. Thus, galantamine emerges as a superior antidotal therapy against the toxicity of soman.
Tetrodotoxin: Chemistry, Toxicity, Source, Distribution and Detection
Directory of Open Access Journals (Sweden)
Vaishali Bane
2014-02-01
Full Text Available Tetrodotoxin (TTX is a naturally occurring toxin that has been responsible for human intoxications and fatalities. Its usual route of toxicity is via the ingestion of contaminated puffer fish which are a culinary delicacy, especially in Japan. TTX was believed to be confined to regions of South East Asia, but recent studies have demonstrated that the toxin has spread to regions in the Pacific and the Mediterranean. There is no known antidote to TTX which is a powerful sodium channel inhibitor. This review aims to collect pertinent information available to date on TTX and its analogues with a special emphasis on the structure, aetiology, distribution, effects and the analytical methods employed for its detection.
Worrying about the LHC, a lesson from astrophysics?
CERN. Geneva
2008-01-01
To worry about the LHC is a popular sport. I shall share my own worries, hopefully original, and do it via a parable (for this method, I can quote earlier authors). The parable concerns a topic in astrophysics (gamma-ray bursts) which happens to be a simple exercise --but quite an interesting one-- on elementary particle-physics and beam dynamics, topics not unrelated to the LHC. Though most of the talk will be dedicated to the physics and, in particular, to its recent developments, the allegory will allow me to detect what, I shall argue, may be dangerous 'viruses' invading science. I do not have the decisive antidotes, but I shall discuss some possible ones.
Un rimedio esasperato dal male. Ovvero i due corpi di Valéry
Directory of Open Access Journals (Sweden)
Ciro Felice Papparo
2012-05-01
Full Text Available In his Cahiers, Valéry says that writing two of his major dialogues, Eupalinos and L’âme et la danse, was an antidote to his ravaging mood: literature and spirituality are the remedy generated by a necessary and not eliminable evil, particularly the one that shows itself as ‘rage’ in love. The essay investigates thoroughly this contradictory logic and focuses on the problem of sensitiveness in Valéry’s work, pointing out a twofold presence of the ‘body’. Preserving these two presences, the writing incessantly tries to make up “une fureur intelligente et expérimentale” and to give a new form, without deleting it, to sensitiveness’ acute pain.
Kavitha, Sekar; HariKrishnan, Adhikesavan; Jeevaratnam, Kadirvelu
2017-12-22
Antibiotic-resistant food-borne Listeriosis has been rising with up to 30% mortality threat in humans since several decades. Hence, discovering antilisterial from the extracts of ethnomedicinal plants may be of value as a novel antidote. In our preceding study, we reported that ethanolic extract of Piper betle L. var Pachaikodi leaves exhibited antibacterial activity towards Listeria monocytogenes MTCC 657. Consequently in the present study, the bioactive molecule responsible for anti-Listeria activity was purified and identified as 4-allylbenzene-1,2-diol. This identified bioactive compound may have significance while used as antimicrobials and/or food additives in food processing sector as evidenced by dual action: biofilm inhibition and pore formation on cell membrane.
Electron transport in InAs/AlGaSb ballistic rectifiers
International Nuclear Information System (INIS)
Maemoto, Toshihiko; Koyama, Masatoshi; Furukawa, Masashi; Takahashi, Hiroshi; Sasa, Shigehiko; Inoue, Masataka
2006-01-01
Nonlinear transport properties of a ballistic rectifier fabricated from InAs/AlGaSb heterostructures are reported. The operation of the ballistic rectifier is based on the guidance of carriers by a square anti-dot structure. The structure was defined by electron beam lithography and wet chemical etching. The DC characteristics and magneto-transport properties of the ballistic rectifier have been measured at 77 K and 4.2 K. Rectification effects relying on the ballistic transport were observed. From the four-terminal resistance measured at low magnetic fields, we also observed magneto-resistance fluctuations corresponding to the electron trajectories and symmetry-breaking electron scattering, which are influenced by the magnetic field strength
Paracetamol overdose: the liver unit perspective.
LENUS (Irish Health Repository)
Iqbal, M
2012-09-01
Liver failure resulting from deliberate or accidental paracetamol overdose continues to be an important reason for referral to liver transplant centres. Severe hepatic dysfunction often appears 72-96 h after overdose. Liver injury can be prevented by timely administration of the specific antidote, N-acetylcysteine. Unfortunately, administration of N-acetylcysteine is frequently delayed due to late presentation or late administration. While N-acetylcysteine works best if given within 8 h of overdose, it is beneficial at any time period and should always be given if there is concern about significant overdose, irrespective of interval from time of ingestion. Early discussion with liver transplant unit is suggested if there is any doubt or evidence of liver failure.
A retirement and a reservation: a retrospective autobiography.
Lee, Sok K
2012-01-01
A retirement is a rite of passage that requires careful planning, because it forces a retiree to make a shift in the paradigm in life. For 37 years, I was a healing professional, a breadwinner, and a working spouse. I am now a jobless loner, an inactive pensioner, and a homebound spouse. In this retrospective autobiography, I suggest a few points to help my younger colleagues to better their upcoming retirement: professional, financial, social, and familial. To overcome Erikson's identity crisis, I volunteered to be a wounded healer at Warm Springs Indian Reservation. My volunteer medical service at Warm Springs Indian Reservation was a good antidote to creatively overcome my postretirement blues.
EDUCATION IN VIRTUES AND VALUES FORMING THE CHARACTER AND BUILDING FULL AND FREE CITIZENS
Directory of Open Access Journals (Sweden)
Domingo Alarcón Ortiz
2015-04-01
Full Text Available Education in virtues and values is the antidote in these times of decadence social, political and unfair distribution of economic wealth to rescue the concepts of dignity, responsibility and freedom in educational projects that Government should be implemented globally, in order to promote a series of tools for learners can pass through self-knowledge and self-confidence helping them build a personality that allows them to settle in their work, social and family environment and which also conducive to the development of ethical behavior that have social impact, and can contribute to change the reality of decline and corruption that we are living today, building to full and free citizens.
Medical intervention in case of a nuclear or radiological event - national guide, release V3.6
International Nuclear Information System (INIS)
Ammerich, M.; Giraud, J.M.; Helfer, N.; Menetrier, F.; Schoulz, D.; Blanc, J.; Vilain, D.; Boll, H.; Bourguignon, M.; Chappe, P.; Mehl-Auget, I.; Carli, P.; Telion, C.; Carosella, E.; Castagnet, X.; Romet, G.; Ducousso, R.; Challeton de Vathaire, C.; Gourmelon, P.; Herbelet, G.; Martin, J.C.; Chicorp, J.; Cosset, J.M.; Court, L.; Lallemand, J.; Facon, A.; Goldstein, P.; Fleutot, J.B.; Geneau, C.; Kolodie, H.; Vrousos, C.; Lachenaud, L.; Maison, D.; Masse, R.; Massiot, P.; Menthonnex, P.; Origny, S.; Peton Klein, D.; Pasnon, J.; Quesne, B.; Rougy, C.; Sapori, JM.; Talbot, JN.; Van Rechem, M.
2008-01-01
This guide proposes a set of thematic sheets which address the following topics: generalities (intervention strategy, categories of casualties, definitions, emergency medical care organisation), taking into care in case of irradiation (generalities, clinical observation, additions examinations, localized acute external irradiation), cross-examination and description of circumstances, behaviour in case of contamination (general principles, rescuers protection, first gestures, etc.), behaviour in case of radio-combined lesions, reception in proximity medical structures and in a hospital. Some technical sheets are also proposed. They address how to handle a radio-contaminated casualty, how to undress a lying or a valid casualty, protection means (clothes, masks, gloves), dosimetry means, detection means, specific antidotes and other medicines
Blood carboxyhaemoglobin and cyanide levels in fire survivors
Energy Technology Data Exchange (ETDEWEB)
Clark, C.J.; Campbell, D.; Reid, W.H.
1981-06-20
Blood carboxyhaemoglobin and cyanide concentrations were measured in 53 fire survivors, 36 of whom had clinical evidence of smoke inhalation. Carboxyhaemoglobin and cyanide levels were raised only in patients with smoke inhalation. Blood carboxyhaemoglobin measurement can be used to confirm the diagnosis of severe smoke inhalation in cases in which the clinical data are inconclusive, provided that the time of sampling after exposure is taken into account. A nomogram has been constructed for this purpose. There is no quick method of measuring blood cyanide levels, but the close relation between cyanide and carboxyhaemoglobin levels suggests that carboxyhaemoglobin concentrations, which can be rapidly and easily measured, could be used to identify those who might benefit from treatment with cyanide antidotes.
Mauksch, Hans O.; And Others
A study of the choice of specialty by medical students suggests that Family Medicine depends on students whose choice predates medical school; the number of those interested diminishes significantly over the four years. Interviews suggest several characteristics of the medical school that mitigate against the choice of family medicine and steer…
Bioscavengers for the protection of humans against organophosphate toxicity.
Doctor, Bhupendra P; Saxena, Ashima
2005-12-15
Current antidotes for organophosphorus compounds (OP) poisoning consist of a combination of pretreatment with carbamates (pyridostigmine bromide), to protect acetylcholinesterase (AChE) from irreversible inhibition by OP compounds, and post-exposure therapy with anti-cholinergic drugs (atropine sulfate) to counteract the effects of excess acetylcholine and oximes (e.g., 2-PAM chloride) to reactivate OP-inhibited AChE. These antidotes are effective in preventing lethality from OP poisoning, but they do not prevent post-exposure incapacitation, convulsions, seizures, performance decrements, or in many cases permanent brain damage. These symptoms are commonly observed in experimental animals and are likely to occur in humans. The problems intrinsic to these antidotes stimulated attempts to develop a single protective drug, itself devoid of pharmacological effects, which would provide protection against the lethality of OP compounds and prevent post-exposure incapacitation. One approach is the use of enzymes such as cholinesterases (ChEs), beta-esterases in general, as single pretreatment drugs to sequester highly toxic OP anti-ChEs before they reach their physiological targets. This approach turns the irreversible nature of the OP: ChE interaction from disadvantage to an advantage; instead of focusing on OP as an anti-ChE, one can use ChE as an anti-OP. Using this approach, it was shown that administration of fetal bovine serum AChE (FBSAChE) or equine serum butyrylcholinesterase (EqBChE) or human serum BChE (HuBChE) protected the animals from multiple LD50s of a variety of highly toxic OPs without any toxic effects or performance decrements. The bioscavengers that have been explored to date for the detoxification of OPs fall into three categories: (A) those that can catalytically hydrolyze OPs and thus render them non-toxic, such as OP hydrolase and OP anhydrase; (B) those that stoichiometrically bind to OPs, that is, 1 mol of enzyme neutralizes one or 2 mol of OP
Transport and dynamics of nanostructured graphene
DEFF Research Database (Denmark)
Gunst, Tue
This thesis is concerned with the heating and electronic properties of nanoscale devices based on nanostructured graphene. As electronic devices scale down to nanometer dimensions, the operation depends on the detailed atomic structure. Emerging carbon nano-materials such as graphene, carbon...... nanotubes and graphene nanoribbons, exhibit promising electronic and heat transport properties. Much research addresses the electron mobility of pristine graphene devices. However, the thermal transport properties, as well as the effects of e-ph interaction, in nanoscale devices, based on nanostructured...... graphene, have received much less attention. This thesis contributes to the understanding of the thermal properties of nanostructured graphene. The computational analysis is based on DFT/TB-NEGF. We show how a regular nanoperforation of a graphene layer - a graphene antidot lattice (GAL) - may...
[Use of hyaluronidase to correct hyaluronic acid injections in aesthetic medicine].
Lacoste, C; Hersant, B; Bosc, R; Noel, W; Meningaud, J P
2016-04-01
Hyaluronic acid (HA) is the most commonly used filler in aesthetic medicine. However, overcorrections are frequent even with experienced practitioner. Hyaluronidase is an enzyme that hydrolyzes HA. Hyaluronidase has been recently proposed to correct unsatisfactory results of HA injections in aesthetic medicine (overcorrection, asymmetry, Tyndall effect) and to treat immediate complications such as arterial or venous thrombosis. The objective of this technical note was to summarize the literature data regarding the efficacy, safety and technique of use of hyaluronidase. Hyaluronidase may be responsible for allergies. The practitioner should take this risk and the possible drug interactions into account before using this antidote in order to weigh up the risk/benefit ratio. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Reversal of target-specific oral anticoagulants
Siegal, D.M.; Cuker, Adam
2014-01-01
Target-specific oral anticoagulants (TSOACs) provide safe and effective anticoagulation for the prevention and treatment of thrombosis in a variety of clinical settings by interfering with the activity of thrombin (dabigatran) or factor Xa (rivaroxaban, apixaban, edoxaban, betrixaban). Although TSOACs have practical advantages over vitamin K antagonists (VKAs), there are currently no antidotes to reverse their anticoagulant effect. Herein we summarize the available evidence for TSOAC reversal using nonspecific and specific reversal agents. We discuss important limitations of existing evidence, which is derived from studies in human volunteers, animal models and in vitro experiments. Studies evaluating the safety and efficacy of reversal agents on clinical outcomes such as bleeding and mortality in patients with TSOAC-associated bleeding are needed. PMID:24880102
Psychoanalyse des Stinkens. Freuds Erzählung von Genese und Funktion des Ekels
Directory of Open Access Journals (Sweden)
Winfried Menninghaus
2013-12-01
Full Text Available The evolution of the upright walk is widely considered to be of decisive significance for the evolution of the human being. Freuds gives a highly original reading of this key feature. He emphasizes the distancing of the nose from the organs of sexual secretions and excrement and understands the defensive mechanism of disgust as the organon of turning the archaic pleasures related to the olfactory secretions into unpleasurable sensations. As an antidote to the evolution of morals – which subscribes to the elevation of the nose and pushes the human being in the direction of ‘higher’ values – Freud stresses the inescapability of the abject pleasures and ascribes to art a highly specific capacity to pleasurably address what is otherwise rejected as disgusting.
DEFF Research Database (Denmark)
Thorsen, Sixtus; Teisner, Ane; Jensen, Søren Astrup
2009-01-01
OBJECTIVES: The prothrombin time (PT) assay of factor II+VII+X activity is an important predictor of liver damage in paracetamol poisoned patients. It complicates interpretation of results that the antidote, acetylcysteine (NAC) depresses this activity. The aim was to investigate if NAC influences...... to plasma in vitro decreased factor II+VII+X activity at 37 degrees C in a time-dependent manner. This effect was quenched at temperatures ... to a significant additional depression of factor II+VII+X activity in plasma from subjects infused with NAC during the first 3h of infusion indicating that it contained reactive NAC. The risk that this NAC interfered with the accuracy of the PT assay was considered minimal with samples stored below 24 degrees C...
The great slippery-slope argument.
Burgess, J A
1993-09-01
Whenever some form of beneficent killing--for example, voluntary euthanasia--is advocated, the proposal is greeted with a flood of slippery-slope arguments warning of the dangers of a Nazi-style slide into genocide. This paper is an attempt systematically to evaluate arguments of this kind. Although there are slippery-slope arguments that are sound and convincing, typical formulations of the Nazi-invoking argument are found to be seriously deficient both in logical rigour and in the social history and psychology required as a scholarly underpinning. As an antidote, an attempt is made both to identify some of the likely causes of genocide and to isolate some of the more modest but legitimate fears that lie behind slippery-slope arguments of this kind.
Low-energy Bluetooth for detecting real-world penetrance of bystander naloxone kits: a pilot study.
Lai, Jeffrey T; Chapman, Brittany P; Boyle, Katherine L; Boyer, Edward W; Chai, Peter R
2018-01-03
Opioid overdose is a growing public health emergency in the United States. The antidote naloxone must be administered rapidly after opioid overdose to prevent death. Bystander or "take-home" naloxone programs distribute naloxone to opioid users and other community members to increase naloxone availability at the time of overdose. However, data describing the natural history of take-home naloxone in the hands of at-risk individuals is lacking. To understand patterns of naloxone uptake in at-risk users, we developed a smart naloxone kit that uses low-energy Bluetooth (BLE) to unobtrusively detect the transit of naloxone through a hospital campus. In this paper, we describe development of the smart naloxone kit and results from the first 10 participants in our pilot study.
Clinical Medicine and Curative Treatment for Diabetes Mellitus
Directory of Open Access Journals (Sweden)
J.R. Divya
2017-10-01
According to latest technology and facts there is a possible way to give a complete cure for this unconditional disease. Use of Nano-robots from a sprouted seeds or germinated seed of a Synsepalum dulcificum plant will take as a sample that has the main function of the antidote which has the ability to induce and control the production rate of insulin in pancreas. It has the new form of Nano-robots that are present naturally in it which is in understudies. A possible way of research through the samples will provide a clear solution with Nano-robots that will cure Diabetes. Creation of Nano-robots with onivyde in combination with the samples prepared and Nano-robot is designed with the nano-electric biosensor.
Magnetisation oscillations, boundary conditions and the Hofstadter butterfly in graphene flakes
Energy Technology Data Exchange (ETDEWEB)
Liu, Yang; Brada, Matej; Kusmartsev, Feodor V. [Department of Physics, Loughborough University (United Kingdom); Mele, Eugene J. [Department of Physics, Loughborough University (United Kingdom); Department of Physics and Astronomy, University of Pennsylvania, Philadelphia, PA (United States)
2014-10-15
New quantum oscillations in the magnetization of graphene flakes induced by magnetic fields, which depend on the shape of the flake, are described. At small values of the field they are due to the Aharonov-Bohm effect and with increasing field they are transformed into dHvA oscillations. The specific form of the dHvA oscillations is analyzed in terms of their energy spectrum, which has a form of Hofstadter's butterfly. Numerical results using a lattice tight-binding model and a continuum Dirac equation are presented and compared. Possible experiments to investigate the quantum oscillations in Moire and graphene anti-dot superlattices are discussed. (copyright 2014 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
C Caoili, Salvador Eugenio
2018-03-01
The contemporary Anthropocene is characterized by rapidly evolving complex global challenges to planetary health vis-a-vis sustainable development, yet innovation is constrained under the prevailing precautionary regime that regulates technological change. Small-molecule xenobiotic drugs are amenable to efficient large-scale industrial synthesis; but their pharmacokinetics, pharmacodynamics, interactions and ultimate ecological impact are difficult to predict, raising concerns over initial testing and environmental contamination. Antibodies and similar agents can serve as antidotes and drug buffers or vehicles to address patient safety and decrease dosing requirements. More generally, peptidic agents including synthetic peptide-based constructs exemplified by vaccines can be used together with or instead of nonpeptidic xenobiotics, thus enabling advances in planetary health based on principles of green chemistry from manufacturing through final disposition.
Micropatterned superconducting film circuitry for operation in hybrid quantum devices
International Nuclear Information System (INIS)
Bothner, Daniel
2013-01-01
This thesis discusses three aspects of the arduous way towards hybrid quantum systems consisting of superconducting circuits and ensembles of ultracold paramagnetic atoms. In the first part of the thesis, superconducting coplanar microwave resonators as used for quantum information processing with superconducting qubits are investigated in magnetic fields. In the second part of the thesis integrated atom chips are designed and fabricated, which offer the possibility to trap an ensemble of ultracold atoms close to a superconducting coplanar resonator on that chip. In the third and last part of the thesis, unconventional disordered and quasiperiodic arrangements of microfabricated holes (antidots) in superconducting films are patterned and investigated with respect to the impact of the arrangement on the superconductor transport properties in magnetic fields.
Directory of Open Access Journals (Sweden)
Wellington Barbosa da Silva
2016-06-01
Full Text Available In the second half of the nineteenth century, various documents (produced by the administrative bureaucracy and police, but also by ordinary citizens and journalists gave the impression that the Recife lived grappling with a stubborn and growing crime framework. Thefts, robberies and murders would be constant and the police could not control or at least limit the action of facinorosos. The purpose of this article is precisely to discuss this historical context so distant in time, but at the same time so close to us, at present, namely: a ubiquitous crime and the constant request made by various segments of society, of a regular and efficient policing – seen as the right antidote to the deterrence of crimes and the establishment of public security.
DEFF Research Database (Denmark)
de Vreese, Claes; Reinemann, Carsten; Esser, Frank
2017-01-01
At the outset, we asked if there is any good news about the news and, if so, where the good news is. In academic research and public discussions about news and democracy, one fi nds different interpretations of the state of current news provision. A tendency towards pessimism about current news...... is seen as having a negative impact on the quality of political life and democracy. Set against the pessimism and caution in the public debate and literature on news quality and the performance of political journalism, we were not optimistic that we would fi nd good-quality news or that we would be able...... to offer some good news as a positive antidote, so to speak, to the pervasive pessimism in the literature....
Practice Trends in the Use of Extracorporeal Treatments for Poisoning in Four Countries
DEFF Research Database (Denmark)
Ghannoum, Marc; Lavergne, Valery; Gosselin, Sophie
2016-01-01
Extracorporeal treatments (ECTRs) such as hemodialysis (HD), enhance the elimination of a small number of toxins. Changes in overdose trends, prescribing practices, antidotes, and dialysis techniques may alter the indications and rates of ECTR use over time. This study analyzed trends in ECTR...... for poisonings in four countries. A retrospective study of national poison center databases from the United States, Denmark, United Kingdom, and five regional databases within Canada was performed. All cases of patients receiving an ECTR were included. ECTR cases were totalled annually and reported as annual......; Denmark, salicylates. A high number of ECTRs were performed for atypical toxins such as acetaminophen and benzodiazepines. These data demonstrate a growing use of HD for poisoning with significant regional variations in the overall rates and indications....
Interventions for paracetamol (acetaminophen) overdose
DEFF Research Database (Denmark)
Chiew, Angela L; Gluud, Christian; Brok, Jesper
2018-01-01
BACKGROUND: Paracetamol (acetaminophen) is the most widely used non-prescription analgesic in the world. Paracetamol is commonly taken in overdose either deliberately or unintentionally. In high-income countries, paracetamol toxicity is a common cause of acute liver injury. There are various...... of paracetamol. Acetylcysteine should be given to people at risk of toxicity including people presenting with liver failure. Further randomised clinical trials with low risk of bias and adequate number of participants are required to determine which regimen results in the fewest adverse effects with the best...... was abandoned due to low numbers recruited), assessing several different interventions in 700 participants. The variety of interventions studied included decontamination, extracorporeal measures, and antidotes to detoxify paracetamol's toxic metabolite; which included methionine, cysteamine, dimercaprol...
Toxin-Based Therapeutic Approaches
Shapira, Assaf; Benhar, Itai
2010-01-01
Protein toxins confer a defense against predation/grazing or a superior pathogenic competence upon the producing organism. Such toxins have been perfected through evolution in poisonous animals/plants and pathogenic bacteria. Over the past five decades, a lot of effort has been invested in studying their mechanism of action, the way they contribute to pathogenicity and in the development of antidotes that neutralize their action. In parallel, many research groups turned to explore the pharmaceutical potential of such toxins when they are used to efficiently impair essential cellular processes and/or damage the integrity of their target cells. The following review summarizes major advances in the field of toxin based therapeutics and offers a comprehensive description of the mode of action of each applied toxin. PMID:22069564
FUNGSI SASTRA LISAN “TANDUK” MASYARAKAT GENAHARJO KABUPATEN TUBAN BAGI MASYARAKAT PENDUKUNGNYA
Directory of Open Access Journals (Sweden)
Suantoko Suantoko
2016-12-01
This study aims to investigate the function of “tanduk” oral literature for its society. In this case, the people in question are society Genaharjo of Tuban district. Through the use of the theory of functions Alan Dundes and William R. Bascom, it is understood that the “tanduk” has a function of oral literature that focuses as the teaching and interdependence among societies that emphasize the benefits of practicality. “Tanduk” oral literature function is the function of propaganda, the function of social solidarity and an antidote to individualism, and the function of education in the socialization of values. The overall function of shaping identity in order to establish harmony in social life. Keywords: function, Genaharjo society, tanduk oral literature
Mustard gas or sulfur mustard: an old chemical agent as a new terrorist threat.
Wattana, Monica; Bey, Tareg
2009-01-01
Sulfur mustard is a member of the vesicant class of chemical warfare agents that causes blistering to the skin and mucous membranes. There is no specific antidote, and treatment consists of systematically alleviating symptoms. Historically, sulfur mustard was used extensively in inter-governmental conflicts within the trenches of Belgium and France during World War I and during the Iran-Iraq conflict. Longitudinal studies of exposed victims show that sulfur mustard causes long-term effects leading to high morbidity. Given that only a small amount of sulfur mustard is necessary to potentially cause an enormous number of casualties, disaster-planning protocol necessitates the education and training of first-line healthcare responders in the recognition, decontamination, triage, and treatment of sulfur mustard-exposed victims in a large-scale scenario.
DEFF Research Database (Denmark)
Dalhoff, K; Hansen, P B; Ott, P
1991-01-01
given ethanol or saline alone only 7% and 3%, respectively, survived 96 h. 4. The data suggest that the protective effect of N-acetylcysteine on acetaminophen-induced toxicity in fed mice is reduced by concomitant administration of ethanol. This may explain the clinical observation that ingestion...
Nanometric MIL-125-NH2 metal–organic framework as a potential nerve agent antidote carrier
Vilela, S.M.F.; Salcedo-Abraira, P; Colinet, I.; Salles, F.; Koning, M.C. de; Joosen, M.J.A.; Serre, C.; Horcajada, P.
2017-01-01
The three-dimensional (3D) microporous titanium aminoterephthalate MIL-125-NH_2 (MIL: Material of Institut Lavoisier) was successfully isolated as monodispersed nanoparticles, which are compatible with intravenous administration, by using a simple, safe and low-cost synthetic approach (100 °C/32 h
2006-09-01
fibrosis is well documented (4). Not unexpectedly, HD is radiomimetic, teratogenic and mutagenic (5,6). Currently, there is no effective therapy ...available. The long term goals are to further define the mode of action of mustard gas and to develop a therapy using liposomes containing both lipid...unilamellar antioxidant liposomes containing 6.6 mole percent RRR-alpha- tocopherol (as well as 66.6, 26.5 and 0.66 mole percent of soy lecithin
The kinship or k-index as an antidote against the toxic effects of h-indices.
Molinié, Antoinette; Bodenhausen, Geoffrey
2011-01-01
In a bilingual paper entitled 'Bibliometrics as weapons of mass citation--La bibliométrie comme arme de citation massive', recently translated into English, we have argued that the current fashion of ranking people, papers and journals is anything but harmless. The point was forcefully supported by Richard Ernst in a post-face entitled 'The Follies of Citation Indices and Academic Ranking Lists. We received a surprising number of passionate responses, such as 'It's written out of my heart' (TH); 'Je soutiens cette entreprise courageuse de tout coeur' (VT); 'Impact Faktoren sind ein Marktinstrument gewisser Verlage (FS); 'II y a un combat à mener' (SB). Some thoughtful responses have been incorporated into this Essay, albeit in attenuated form. We suggest that the 'fertility' of individual scientists be appreciated in terms of kinship rather than through personalized indices.
International Nuclear Information System (INIS)
Brodsky, Berta; Erlanger-Rosengarten, Avigail; Proscura, Elena; Shapira, Elena; Wormser, Uri
2008-01-01
The primary purpose of the present study was to investigate the mechanism of the counter-irritating activity of topical iodine against skin lesions induced by chemical and thermal stimuli. The hypothesis that iodine exerts its activity by inducing an endogenous anti-inflammatory factor was confirmed by exposing guinea pig skin to heat stimulus followed by topical iodine treatment and skin extraction. Injection of the extract into naive guinea pigs reduced heat-induced irritation by 69%. The protective factor, identified as a new nonapeptide (histone H2A 36-44, H-Lys-Gly-Asn-Tyr-Ala-Glu-Arg-Ileu-Ala-OH), caused reduction of 40% in irritation score in heat-exposed guinea pigs. The murine analog (H-Lys-Gly-His-Tyr-Ala-Glu-Arg-Val-Gly-OH, termed IIIM1) reduced sulfur mustard (SM)-induced ear swelling at a dose-dependent bell-shape manner reaching peak activity of 1 mg/kg. Cultured keratinocytes transfected with the peptide were more resistant towards SM than the control cells. The peptide suppressed oxidative burst in activated neutrophils in a concentration-dependent manner. In addition, the peptide reduced glucose oxidase-induced skin edema in mice at a dose-dependent bell-shape manner. Apart from thermal and chemical-induced skin irritation this novel peptide might be of potential use in chronic dermal disorders such as psoriasis and pemphigus as well as non-dermal inflammatory diseases like multiple sclerosis, arthritis and colitis
Cd(II and Pb(II complexes of the polyether ionophorous antibiotic salinomycin
Directory of Open Access Journals (Sweden)
Tanabe Makoto
2011-09-01
Full Text Available Abstract Background The natural polyether ionophorous antibiotics are used for the treatment of coccidiosis in poultry and ruminants. They are effective agents against infections caused by Gram-positive microorganisms. On the other hand, it was found that some of these compounds selectively bind lead(II ions in in vivo experiments, despite so far no Pb(II-containing compounds of defined composition have been isolated and characterized. To assess the potential of polyether ionophores as possible antidotes in the agriculture, a detailed study on their in vitro complexation with toxic metal ions is required. In the present paper we report for the first time the preparation and the structure elucidation of salinomycin complexes with ions of cadmium(II and lead(II. Results New metal(II complexes of the polyether ionophorous antibiotic salinomycin with Cd(II and Pb(II ions were prepared and structurally characterized by IR, FAB-MS and NMR techniques. The spectroscopic information and elemental analysis data reveal that sodium salinomycin (SalNa undergoes a reaction with heavy metal(II ions to form [Cd(Sal2(H2O2] (1 and [Pb(Sal(NO3] (2, respectively. Abstraction of sodium ions from the cavity of the antibiotic is occurring during the complexation reaction. Salinomycin coordinates with cadmium(II ions as a bidentate monoanionic ligand through the deprotonated carboxylic moiety and one of the hydroxyl groups to yield 1. Two salinomycin anions occupy the equatorial plane of the Cd(II center, while two water molecules take the axial positions of the inner coordination sphere of the metal(II cation. Complex 2 consists of monoanionic salinomycin acting in polydentate coordination mode in a molar ratio of 1: 1 to the metal ion with one nitrate ion for charge compensation. Conclusion The formation of the salinomycin heavy metal(II complexes indicates a possible antidote activity of the ligand in case of chronic/acute intoxications likely to occur in the stock
Cd(II) and Pb(II) complexes of the polyether ionophorous antibiotic salinomycin
2011-01-01
Background The natural polyether ionophorous antibiotics are used for the treatment of coccidiosis in poultry and ruminants. They are effective agents against infections caused by Gram-positive microorganisms. On the other hand, it was found that some of these compounds selectively bind lead(II) ions in in vivo experiments, despite so far no Pb(II)-containing compounds of defined composition have been isolated and characterized. To assess the potential of polyether ionophores as possible antidotes in the agriculture, a detailed study on their in vitro complexation with toxic metal ions is required. In the present paper we report for the first time the preparation and the structure elucidation of salinomycin complexes with ions of cadmium(II) and lead(II). Results New metal(II) complexes of the polyether ionophorous antibiotic salinomycin with Cd(II) and Pb(II) ions were prepared and structurally characterized by IR, FAB-MS and NMR techniques. The spectroscopic information and elemental analysis data reveal that sodium salinomycin (SalNa) undergoes a reaction with heavy metal(II) ions to form [Cd(Sal)2(H2O)2] (1) and [Pb(Sal)(NO3)] (2), respectively. Abstraction of sodium ions from the cavity of the antibiotic is occurring during the complexation reaction. Salinomycin coordinates with cadmium(II) ions as a bidentate monoanionic ligand through the deprotonated carboxylic moiety and one of the hydroxyl groups to yield 1. Two salinomycin anions occupy the equatorial plane of the Cd(II) center, while two water molecules take the axial positions of the inner coordination sphere of the metal(II) cation. Complex 2 consists of monoanionic salinomycin acting in polydentate coordination mode in a molar ratio of 1: 1 to the metal ion with one nitrate ion for charge compensation. Conclusion The formation of the salinomycin heavy metal(II) complexes indicates a possible antidote activity of the ligand in case of chronic/acute intoxications likely to occur in the stock farming
Chan, Adriano; Crankshaw, Daune L.; Monteil, Alexandre; Patterson, Steven E.; Nagasawa, Herbert T.; Briggs, Jackie E.; Kozocas, Joseph A.; Mahon, Sari B.; Brenner, Matthew; Pilz, Renate B.; Bigby, Timothy D.; Boss, Gerry R.
2013-01-01
SUMMARY Context Cyanide poisoning is a major contributor to death in smoke inhalation victims and accidental exposure to cyanide occurs in a variety of industries. Moreover, cyanide has the potential to be used by terrorists, particularly in a closed space such as an airport or train station. Current therapies for cyanide poisoning must be given by intravenous administration, limiting their use in treating mass casualties. Objective We are developing two new cyanide antidotes—cobinamide, a vitamin B12 analog, and sulfanegen, a 3-mercaptopyruvate prodrug. Both drugs can be given by intramuscular administration, and therefore could be used to treat a large number of people quickly. We now asked if the two drugs would have an augmented effect when combined. Materials and Methods We used a non-lethal and two different lethal models of cyanide poisoning in mice. The non-lethal model assesses neurologic recovery by quantitatively evaluating the innate righting reflex time of a mouse. The two lethal models are a cyanide injection and a cyanide inhalation model. Results We found that the two drugs are at least additive when used together in both the non-lethal and lethal models: at doses where all animals died with either drug alone, the combination yielded 80 and 40% survival in the injection and inhalation models, respectively. Similarly, drug doses that yielded 40% survival with either drug alone yielded 80 and 100% survival in the injection and inhalatiion models, respectively. As part of the inhalation model, we developed a new paradigm in which animals are exposed to cyanide gas, injected intramuscularly with antidote, and then re-exposed to cyanide gas. This simulates cyanide exposure of a large number of people in a closed space, because people would remain exposed to cyanide, even after receiving an antidote. Conclusion The combination of cobinamide and sulfanegen shows great promise as a new approach to treating cyanide poisoning. PMID:21740135
Harmful Algal Blooms and Public Health
Grattan, Lynn M.; Holobaugh, Sailor; Morris, J. Glenn
2015-01-01
The five most commonly recognized Harmful Algal Bloom related illnesses include Ciguatera poisoning, Paralytic Shellfish poisoning, Neurotoxin Shellfish poisoning, Diarrheic Shellfish Poisoning and Amnesic Shellfish poisoning. Although they are each the product of different toxins, toxin assemblages or HAB precursors these clinical syndromes have much in common. Exposure occurs through the consumption of fish or shellfish; routine clinical tests are not available for diagnosis; there is no known antidote for exposure; and the risk of these illnesses can negatively impact local fishing and tourism industries. Thus, illness prevention is of paramount importance to minimize human and public health risks. To accomplish this, close communication and collaboration is needed among HAB scientists, public health researchers and local, state and tribal health departments at academic, community outreach, and policy levels. PMID:27616971
Drugs of abuse: the highs and lows of altered mental states in the emergency department.
Meehan, Timothy J; Bryant, Sean M; Aks, Steven E
2010-08-01
The diagnosis and management of poisoned patients presenting with alterations in mental status can be challenging, as patients are often unable (or unwilling) to provide an adequate history. Several toxidromes exist. Recognition hinges upon vital signs and the physical examination. Understanding these "toxic syndromes" may guide early therapy and management, providing insight into the patient's underlying medical problem. Despite toxidrome recognition guiding antidotal therapy, the fundamental aspect of managing these patients involves meticulous supportive care. The authors begin with a discussion of various toxidromes and then delve into the drugs responsible for each syndrome. They conclude with a discussion on drug-facilitated sexual assault ("date rape"), which is both an underrecognized problem in the emergency department (ED) and representative of the drug-related problems faced in a modern ED. Copyright 2010. Published by Elsevier Inc.
Management of a patient with thermal burns and para-chloronitrobenzene poisoning
Directory of Open Access Journals (Sweden)
Yuanhai Zhang
2014-10-01
Full Text Available Para-chloronitrobenzene (p-CNB, a hazardous and toxic substance, is widely used as an intermediary in chemical industries. p-CNB can cause methaemoglobinaemia due to electron-withdrawing properties of the nitro and chlorine groups. We present a case of a 23-year-old man suffering from thermal burns and p-CNB poisoning. In this case, severe methaemoglobinaemia was caused by the absorption of p-CNB through the burn wounds. Despite active treatment, such as the antidote of methylene blue, the patient’s methaemoglobinaemia progressed, with slowly increasing methaemoglobin (MetHb level. This case highlights the complexity and difficulty of managing this type of injury. To our knowledge, this case can be the first case report describing methaemoglobinaemia induced by p-CNB in a patient with thermal burns.
Vortex Matter dynamics in a thin film of Nb with columnar indentations
Energy Technology Data Exchange (ETDEWEB)
Nunes, J.S. [Grupo de Supercondutividade e Magnetism, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil)], E-mail: julianakapp@gmail.com; Zadorosny, R.; Oliveira, A.A.M. [Grupo de Supercondutividade e Magnetism, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil); Lepienski, C.M. [Departamento de Fisica, Universidade Federal do Parana, Curitiba, PR (Brazil); Patino, E.J.; Blamire, M.G. [Department of Materials Science, University of Cambridge, Pembroke Street, Cambridge CB2 3QZ (United Kingdom); Ortiz, W.A. [Grupo de Supercondutividade e Magnetism, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil)
2008-07-15
A superconducting film with columnar defects constitutes a rich scenario for studying Vortex Matter dynamics. This paper reports on the magnetic response of a 200 nm thick Nb film, pierced with a set of 900 columnar indentations of nearly triangular cross section, forming a square lattice. The column diameter is 1 {mu}m and the distance between columns is 10 {mu}m. To probe the interaction of Vortex Matter with the array of antidots, we have excited the sample with a significantly large AC-field, so that flux originally trapped by the columns could be unpinned and admitted into the superconducting sea surrounding the defects. The melting line of this system has a kink separating two different regimes, suggesting a crossover from the efficient pinning regime, at lower temperatures, to a temperature-induced depinning.
Mario Bunge's Materialist Theory of Mind and Contemporary Cognitive Science
Slezak, Peter
2012-10-01
Bunge's writings on the mind-body problem provide a rigorous, analytical antidote to the persistent anti-materialist tendency that has characterized the history of philosophy and science. Bunge gives special attention to dualism and its shortcomings, and this attention is welcome in view of the resurgence of the doctrine today. However, I focus my comments selectively on Bunge's more controversial, provocative claims, not to dismiss them, but to engage with them seriously. For example, a difficulty arising from Bunge's rhetorical style and its undoubted virtues is that not all the targets of his selfconfessed "bashings" (2010, xi) are equally deserving. For example, Bunge suggests "most contemporary philosophers of mind are indifferent to psychology, or are remarkably uninformed about it". This charge cannot be sustained today in light of the work of foremost philosophers today.
Harmful Algal Blooms and Public Health.
Grattan, Lynn M; Holobaugh, Sailor; Morris, J Glenn
2016-07-01
The five most commonly recognized Harmful Algal Bloom related illnesses include Ciguatera poisoning, Paralytic Shellfish poisoning, Neurotoxin Shellfish poisoning, Diarrheic Shellfish Poisoning and Amnesic Shellfish poisoning. Although they are each the product of different toxins, toxin assemblages or HAB precursors these clinical syndromes have much in common. Exposure occurs through the consumption of fish or shellfish; routine clinical tests are not available for diagnosis; there is no known antidote for exposure; and the risk of these illnesses can negatively impact local fishing and tourism industries. Thus, illness prevention is of paramount importance to minimize human and public health risks. To accomplish this, close communication and collaboration is needed among HAB scientists, public health researchers and local, state and tribal health departments at academic, community outreach, and policy levels.
Vortex Matter dynamics in a thin film of Nb with columnar indentations
International Nuclear Information System (INIS)
Nunes, J.S.; Zadorosny, R.; Oliveira, A.A.M.; Lepienski, C.M.; Patino, E.J.; Blamire, M.G.; Ortiz, W.A.
2008-01-01
A superconducting film with columnar defects constitutes a rich scenario for studying Vortex Matter dynamics. This paper reports on the magnetic response of a 200 nm thick Nb film, pierced with a set of 900 columnar indentations of nearly triangular cross section, forming a square lattice. The column diameter is 1 μm and the distance between columns is 10 μm. To probe the interaction of Vortex Matter with the array of antidots, we have excited the sample with a significantly large AC-field, so that flux originally trapped by the columns could be unpinned and admitted into the superconducting sea surrounding the defects. The melting line of this system has a kink separating two different regimes, suggesting a crossover from the efficient pinning regime, at lower temperatures, to a temperature-induced depinning
Beware the yellow slimming pill: fatal 2,4-dinitrophenol overdose.
Holborow, Alexander; Purnell, Richard M; Wong, Jenny Frederina
2016-04-04
An industrial chemical, 2,4-dinitrophenol (DNP), has found use as a weight loss drug. It is extremely toxic in overdose and has a narrow therapeutic window with significant interindividual variability in metabolism. The rise in internet-based sales and distribution of this drug has seen an increased incidence of both accidental and intentional overdose presenting to emergency departments across the UK. No antidote currently exists and overdose is often fatal despite management based on current recommendations. We report a case of intentional overdose of DNP in a young man and discuss the current treatment guidelines. The case highlights the need for an increased awareness among frontline medical staff of the effects of DNP poisoning and questions the need for a more aggressive approach in the management of acute toxicity. 2016 BMJ Publishing Group Ltd.
Toxin-Based Therapeutic Approaches
Directory of Open Access Journals (Sweden)
Itai Benhar
2010-10-01
Full Text Available Protein toxins confer a defense against predation/grazing or a superior pathogenic competence upon the producing organism. Such toxins have been perfected through evolution in poisonous animals/plants and pathogenic bacteria. Over the past five decades, a lot of effort has been invested in studying their mechanism of action, the way they contribute to pathogenicity and in the development of antidotes that neutralize their action. In parallel, many research groups turned to explore the pharmaceutical potential of such toxins when they are used to efficiently impair essential cellular processes and/or damage the integrity of their target cells. The following review summarizes major advances in the field of toxin based therapeutics and offers a comprehensive description of the mode of action of each applied toxin.
Resonant spin wave excitations in a magnonic crystal cavity
Kumar, N.; Prabhakar, A.
2018-03-01
Spin polarized electric current, injected into permalloy (Py) through a nano contact, exerts a torque on the magnetization. The spin waves (SWs) thus excited propagate radially outward. We propose an antidot magnonic crystal (MC) with a three-hole defect (L3) around the nano contact, designed so that the frequency of the excited SWs, lies in the band gap of the MC. L3 thus acts as a resonant SW cavity. The energy in this magnonic crystal cavity can be tapped by an adjacent MC waveguide (MCW). An analysis of the simulated micromagnetic power spectrum, at the output port of the MCW reveals stable SW oscillations. The quality factor of the device, calculated using the decay method, was estimated as Q > 105 for an injected spin current density of 7 ×1012 A/m2.
Directory of Open Access Journals (Sweden)
PARRAVICINI, ANDREA
2016-12-01
Full Text Available The Patchwork of human Evolution. An integrated and multi‐level Perspective beyond any unilateral and finalistic Vision Despite Darwin’s theory proposes a contingent view of life's evolution and a «tree thinking» approach to reconstruct the history of living beings, human evolution has always been generally considered as an exception with respect to the normal evolutionary phenomena. The present article examines this recurrent view of human evolution, which is often depicted as a linear and teleological story that inevitably ends with the emergence of Homo sapiens. A multi-level and pluralist view of human evolution, able to integrate the most recent empirical evidence coming from different fields within a unified theoretical framework, seems to be an excellent antidote to reflect about the human uniqueness without preconceived ideologies.
[The use of opium in Roman society and the dependence of Princeps Marcus Aurelius].
Trancas, Bruno; Borja Santos, Nuno; Patrício, Luís D
2008-01-01
Opium was known and frequently used in Roman society. Medical practice recognized its usefulness as an analgesic, soporific, anti-tussic or anti-diarrheic agent, as well as other currently unsupported uses with quasi-magical properties. It was additionally used as an ingredient in antidotes, panaceas and poisons. The authors present a non-exhaustive compilation of opium use according to medical doctors, writers and encyclopaedists of the time. Mythological and literary representations of the opium poppy reflected its diverse roles, being associated with prosperity and fertility, sleep, death and the underworld and with the art of medicine. Despite its free and routine use, there is no solid evidence of addiction, except the putative case of emperor Marcus Aurelius, consistently reported as one of the most likely cases of addiction to opium.
RamaRao, Golime; Afley, Prachiti; Acharya, Jyothiranjan; Bhattacharya, Bijoy Krishna
2014-01-01
Background Recent alleged attacks with nerve agent sarin on civilians in Syria indicate their potential threat to both civilian and military population. Acute nerve agent exposure can cause rapid death or leads to multiple and long term neurological effects. The biochemical changes that occur following nerve agent exposure needs to be elucidated to understand the mechanisms behind their long term neurological effects and to design better therapeutic drugs to block their multiple neurotoxic ef...
2015-12-01
animal model for studying cyanide poisoning. Mil Med. 2000;165: 967-972. 16. Broderick KE, Potluri P, Zhuang S, et al. Cyanide detoxification by the...cobalamin precursor cobinamide. Exp Biol Med (Maywood). 2006;231: 641-649. 17. Broderick KE, Balasubramanian M, Chan A, et al. The cobalamin precursor...vitamin B12. Methods Enzymol. 1971, 18c, 82−86. (45) Broderick , K. E.; Singh, V.; Zhuang, S.; Kambo, A.; Chen, J. C.; Sharma, V. S.; Pilz, R. B.; Boss
Directory of Open Access Journals (Sweden)
Roland Weierstall
2011-11-01
Full Text Available The cumulative exposure to life-threatening events increases the risk for posttraumatic stress disorder (PTSD. However, over the course of evolutionary adaptation, intra-species killing may have also evolved as an inborn strategy leading to greater reproductive success. Assuming that homicide has evolved as a profitable strategy in humans, a protective mechanism must prevent the perpetrator from getting traumatised by self-initiated violent acts. We thus postulate an inverse relation between a person's propensity toward violence and PTSD. We surveyed a sample of 269 Rwandan prisoners who were accused or convicted for crimes related to the 1994 genocide. In structured interviews we assessed traumatic event types, types of crimes committed, the person's appetitive violence experience with the Appetitive Aggression Scale (AAS and PTSD symptom severity with the PSS-I. Using path-analysis, we found a dose-response effect between the exposure to traumatic events and the PTSD symptom severity (PSS-I. Moreover, participants who had reported that they committed more types of crimes demonstrated a higher AAS score. In turn, higher AAS scores predicted lower PTSD symptom severity scores. This study provides first empirical support that the victim's struggling can be an essential rewarding cue for perpetrators. The results also suggest that an appetitive aggression can inhibit PTSD and trauma-related symptoms in perpetrators and prevent perpetrators from getting traumatised by their own atrocities.
Transparency and surveillance as sociotechnical accountability a house of mirrors
Johnson, Deborah G
2014-01-01
Surveillance and transparency are both significant and increasingly pervasive activities in neoliberal societies. Surveillance is taken up as a means to achieving security and efficiency; transparency is seen as a mechanism for ensuring compliance or promoting informed consumerism and informed citizenship. Indeed, transparency is often seen as the antidote to the threats and fears of surveillance. This book adopts a novel approach in examining surveillance practices and transparency practices together as parallel systems of accountability. It presents the house of mirrors as a new framework for understanding surveillance and transparency practices instrumented with information technology. The volume centers around five case studies: Campaign Finance Disclosure, Secure Flight, American Red Cross, Google, and Facebook. A series of themed chapters draw on the material and provide cross-case analysis. The volume ends with a chapter on policy implications.
Zabrodskii, P F; Maslyakov, V V; Gromov, M S
2016-01-01
It was established in experiments on noninbred albino rats that the acute intoxication with methanol (1.0 LD50) decreased cellular and humoral immune responses, Th2-lymphocyte activity (to a greater extent as compared to the function of Th1 cells), reduced the blood concentration of immunoregulatory (IFN-g, IL-2, IL-4) and proinflammatory (TNF, IL-1b, IL-6) cytokines on the average by 36.5% (p Methanol antidote 4-methylpyrazole (non-competitive inhibitor of alcohol dehydrogenase) administered upon acute intoxication with methanol at a dose of 1.0 DL50 partially reduces the intoxication-induced suppression of humoral and cellular immune response, activity of T-helper cells, and production of IL-4 and restores blood levels of TNF, IL-1b, IFN-γ, IL-4, IL-2, IL-6 to the control values.
Successful therapy with hemoperfusion and plasma exchange in acute 1,2,3-trichloropropane poisoning.
Liu, P; Liang, Y-G; Meng, Q-Y; Zhang, C-G; Wang, H-C; Zhang, X-G; Li, G; Liu, Z-Y; He, Y-Z
2012-05-01
1,2,3-trichloropropane (1,2,3-TCP) is commonly used as an intermediate in pesticide and an industrial specialty solvent. Acute 1,2,3-TCP poisoning is rare but a medical emergency. Sporadic cases of toxic hepatic injury from 1,2,3-TCP in humans have been reported. Liver is a target organ for 1,2,3-TCP toxicity, which may ensue in a short period after ingestion. A specific antidote against 1,2,3-TCP is not available. So it is important to distinguish that a patient with 1,2,3-TCP poisoning constitutes a medical emergency. In this case study, the poisoned patient's clinical condition and laboratory values improved gradually after she received hemoperfusion (HP) and plasma exchange, which indicated that the therapy with HP and plasma exchange were helpful in the treatment of 1,2,3-TCP poisoning.
Width dependent transition of quantized spin-wave modes in Ni{sub 80}Fe{sub 20} square nanorings
Energy Technology Data Exchange (ETDEWEB)
Banerjee, Chandrima; Saha, Susmita; Barman, Saswati; Barman, Anjan, E-mail: abarman@bose.res.in [Thematic Unit of Excellence on Nanodevice Technology, Department of Condensed Matter Physics and Material Sciences, S. N. Bose National Centre for Basic Sciences, Block JD, Sector III, Salt Lake, Kolkata 700098 (India); Rousseau, Olivier [CEMS-RIKEN, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Otani, YoshiChika [CEMS-RIKEN, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Institute for Solid State Physics, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8581 (Japan)
2014-10-28
We investigated optically induced ultrafast magnetization dynamics in square shaped Ni{sub 80}Fe{sub 20} nanorings with varying ring width. Rich spin-wave spectra are observed whose frequencies showed a strong dependence on the ring width. Micromagnetic simulations showed different types of spin-wave modes, which are quantized upto very high quantization number. In the case of widest ring, the spin-wave mode spectrum shows quantized modes along the applied field direction, which is similar to the mode spectrum of an antidot array. As the ring width decreases, additional quantization in the azimuthal direction appears causing mixed modes. In the narrowest ring, the spin-waves exhibit quantization solely in azimuthal direction. The different quantization is attributed to the variation in the internal field distribution for different ring width as obtained from micromagnetic analysis and supported by magnetic force microscopy.
Systematic review of the effect of intravenous lipid emulsion therapy for local anesthetic toxicity
DEFF Research Database (Denmark)
Høgberg, Lotte Christine Groth; Bania, Theodore C; Lavergne, Valéry
2016-01-01
BACKGROUND: Following national and regional recommendations, intravenous lipid emulsion (ILE) has become established in clinical practice as a treatment for acute local anesthetic (LA) toxicity, although evidence of efficacy is limited to animal studies and human case reports. A collaborative lipid......-defined inclusion and exclusion criteria. Pre-treatment experiments, pharmacokinetic studies not involving toxicity and studies that did not address antidotal use of ILE were excluded. RESULTS: We included 113 studies and reports. Of these, 76 were human and 38 animal studies. One publication included both a human...... case report and an animal study. Human studies included one randomized controlled crossover trial involving 16 healthy volunteers. The subclinical LA toxicity design did not show a difference in the effects of ILE versus saline. There was one case series and 73 case reports of ILE use in the context...
Privatisation in Nigeria: A critical analysis of the virtues and vices
Directory of Open Access Journals (Sweden)
Dare E. Arowolo
2012-12-01
Full Text Available The twin-problems of mismanagement and corruption encountered by the state-owned corporations constitute the impetus for the recent privatisation of those corporations in Nigeria. Private sector seems, however, inseparable from public sector as viable public sector serves as guide for the private sector. It goes on to reason that a decaying public sector would give rise to inefficient private sector. Also, private sector has its own inherent contradictions as privatization in itself is not an antidote to corruption and mismanagement of which the public sector is being accused. The controversy and the contradictions in this topical issue aroused the interest and concern of this paper. The focus of the paper, therefore, is to present the two sides of the arguments on the viability of privatisation. The paper adopted content analysis in driving home its points.
The economy of knowledge, collapse and depression
Directory of Open Access Journals (Sweden)
Ugo Pagano
2017-05-01
Full Text Available This paper reviews a recent strand of research emphasizing how the present institutions of the knowledge economy may be jeopardizing the very promise of growth and prosperity that the increased use of knowledge is generally reported to bring about. The excessive privatization of knowledge generates self-reinforcing vicious and virtuous circles of accumulation of intellectual property and investment in human capital, which increase global inequality. The present institutions of the global economy entail also a reduction of global investment opportunities that is one of the causes of the present global depression. Absent spontaneous antidotes to these phenomena, economic and science policies should aim at redressing the balance between public and private knowledge. Because of the distortion of incentives, stemming from uncompensated knowledge externalities at the international level, these policies should necessarily be coordinated at global level.
Schweighauser, A; Francey, T
2016-02-01
Poisoning with ethylene glycol as contained in antifreeze can rapidly lead to irreversible acute renal failure and other organ damage. It carries a grave prognosis unless diagnosed early and adequate treatment is initiated within 8 hours of ingestion. Toxicity of ethylene glycol is related to the production of toxic metabolites by the enzyme alcohol dehydrogenase (ADH), leading to early signs of severe polyuria (PU) and polydipsia (PD), gastritis, ataxia and central nervous depression, followed by progressive dehydration, and ultimately oligoanuric renal failure. In addition to general supportive care, therapeutic interventions must include either antidotes blocking ADH-mediated metabolism or blood purification techniques to remove both the parent compound and the toxic metabolites. The goal of this case report is to describe three cases of acute antifreeze intoxication in dogs, and to discuss treatment options available for this poisoning.
Directory of Open Access Journals (Sweden)
J Shashibhushan
2015-01-01
Full Text Available Paraquat (1, 1′-dimethyl-4, 4′-dipyridylium is a bipyridilium herbicide used widely in our country and is a highly toxic compound. This compound is very notorious to cause rapid development of renal, liver, and respiratory failure with very high mortality due to lack of specific antidote and dearth of high-quality evidence-based treatment. Respiratory system involvement is the most common cause of death in these people. We hereby report a fatal case of a 30-year-old male with a history of paraquat consumption. The patient developed oliguric renal failure, deterioration of liver function, and acute respiratory distress syndrome over next few days. Different treatment modalities were tried to manage patient′s condition. In this case, none of the strategies worked well, and death ensued due to multi-organ dysfunction syndrome.
Width dependent transition of quantized spin-wave modes in Ni80Fe20 square nanorings
Banerjee, Chandrima; Saha, Susmita; Barman, Saswati; Rousseau, Olivier; Otani, YoshiChika; Barman, Anjan
2014-10-01
We investigated optically induced ultrafast magnetization dynamics in square shaped Ni80Fe20 nanorings with varying ring width. Rich spin-wave spectra are observed whose frequencies showed a strong dependence on the ring width. Micromagnetic simulations showed different types of spin-wave modes, which are quantized upto very high quantization number. In the case of widest ring, the spin-wave mode spectrum shows quantized modes along the applied field direction, which is similar to the mode spectrum of an antidot array. As the ring width decreases, additional quantization in the azimuthal direction appears causing mixed modes. In the narrowest ring, the spin-waves exhibit quantization solely in azimuthal direction. The different quantization is attributed to the variation in the internal field distribution for different ring width as obtained from micromagnetic analysis and supported by magnetic force microscopy.
Atropa belladonna intoxication: a case report.
Berdai, Mohamed Adnane; Labib, Smael; Chetouani, Khadija; Harandou, Mustapha
2012-01-01
Atropa belladonna is a poisonous plant also called deadly nightshade. Its roots, leaves and fruits contain alkaloids: atropine, hyocyamine and scopolamine. The risk of poisoning in children is important because of possible confusion with other berries. Atropa belladonna acute intoxication is a severe condition, it's should be considered in the presence of anti-cholinergic toxidrome, the differential diagnosis include other plants or psychoactive drugs containing atropine. The treatment is mainly symptomatic including gastrointestinal decontamination with activated charcoal. In severe cases, physostigmine can be used as an antidote. We report the case of 11 year old girl with Atropa belladonna poisoning which was administrated in a therapeutic purpose as a remedy to jaundice. The child presented essentially a central anti-cholinergic syndrome. She was admitted in the intensive care unit, the progression was favorable with symptomatic treatment.
Changing the Scale and Efficiency of Chemical Warfare Countermeasure Discovery Using the Zebrafish
Peterson, Randall T.; MacRae, Calum A.
2013-01-01
As the scope of potential chemical warfare agents grows rapidly and as the diversity of potential threat scenarios expands with non-state actors, so a need for innovative approaches to countermeasure development has emerged. In the last few years, the utility of the zebrafish as a model organism that is amenable to high-throughput screening has become apparent and this system has been applied to the unbiased discovery of chemical warfare countermeasures. This review summarizes the in vivo screening approach that has been pioneered in the countermeasure discovery arena, and highlights the successes to date as well as the potential challenges in moving the field forward. Importantly, the establishment of a zebrafish platform for countermeasure discovery would offer a rapid response system for the development of antidotes to the continuous stream of new potential chemical warfare agents. PMID:24273586
Cardiovascular effects of saffron and its active constituents: A review article
Directory of Open Access Journals (Sweden)
B. Marjan Razavi
2014-03-01
Full Text Available (Crocus sativus L. Commonly known as saffron, is a perennial stem less herb of the iridaceae family, widely cultivated in Iran and other countries. It is used as a flavoring and coloring agent for many thousands of years. In traditional medicine, saffron has been used for various purposes including abortion, as a fever reducer, an analgesic, expectorant, antispasmodic, aphrodisiac, sedative, digestive and a carminative. Various pharmacological studies have been described that saffron and its constituents exhibit different beneficial properties, including antioxidant, anticancer, anticonvulsant, antiischemic, antigenotoxic, antidote, antiapoptotic, antitussive, antidepressive, sedative and hypnotic, hypolipidemic, antinociceptive and antiinflammatory effects. Research projects have also revealed that saffron also exhibits protective effects against cardiovascular diseases including cardiac ischemia, arrhythmia, hypertension and atherosclerosis. In this review article, the effects of saffron and its active constituents on cardiovascular system were introduced.
Understanding A.M. Iqbal’s Vision on Perfect Man
Directory of Open Access Journals (Sweden)
Imam Bahroni
2013-12-01
Full Text Available This article tries to elucidate A.M Iqbal’s vision on the concept of perfectman. Its significance is at the point that Man can transform both his being andhis surroundings according to his own desires and aspirations. He actually makesimprovements upon what is created by God. God created night, he inventedthe lamp; God created clay, and from it he made the cup; God created deserts,mountains, forests, orchards, gardens, and groves. He makes glass out of stoneand turns poison into an antidote. God created the world, but he made it morebeautiful.Iqbal’s reasoning amply justifies belief in the ascendancy of man overthe universe and his predicted perfection. The perfect man is the ultimate endof the revolutionary process, and he is developed out of the present man, justas the full moon is developed from the crescent.
John, Harald; Eddleston, Michael; Clutton, R Eddie; Worek, Franz; Thiermann, Horst
2010-05-15
Dimethoate is an organophosphorus toxicant used in agri- and horticulture as a systemic broad-spectrum insecticide. It also exhibits toxic activity towards mammalian organism provoked by catalytic desulfuration in the liver producing its oxon-derivative omethoate thus inhibiting acetylcholinesterase, initiating cholinergic crisis and ultimately leading to death by respiratory paralysis and cardiovascular collapse. Pharmaco- and toxicokinetic studies in animal models help to broaden basic understanding of medical intervention by antidotes and supportive care. Therefore, we developed and validated a LC-ESI-MS/MS method suitable for the simultaneous, selective, precise (RSD(intra-day) 1-8%; RSD(inter-day) 5-14%), accurate (intra-day: 95-107%; inter-day: 90-115%), and robust quantification of both pesticides from porcine urine and plasma after deproteinization by precipitation and extensive dilution (1:11,250 for plasma and 1:40,000 for urine). Accordingly, lower limits of quantification (0.24-0.49 microg/ml plasma and 0.78-1.56 microg/ml urine) and lower limits of detection (0.12-0.24 microg/ml plasma and 0.39-0.78 microg/ml urine) were equivalent to quite low absolute on-column amounts (1.1-2.1 pg for plasma and 2.0-3.9 pg for urine). The calibration range (0.24-250 microg/ml plasma and 0.78-200 microg/ml urine) was subdivided into two linear ranges (r(2)>or=0.998) each covering nearly two orders of magnitude. The lack of any interfering peak in 6 individual blank specimens from plasma and urine demonstrated the high selectivity of the method. Furthermore, extensive sample dilution causing lowest concentration of potentially interfering matrix ingredients prompted us to develop and validate an additional flow-injection method (FI-ESI-MS/MS). Validation characteristics were as good as for the chromatographic method but sample throughput was enhanced by a factor of 6. Effects on ionization provoked by plasma and urine matrix from 6 individuals as well as in the
Presidential address: adjusting the art and the science of surgery.
Traverso, L William
2007-10-01
Why are there so many opinions for surgical treatments? Why do surgeons not agree on the same definitions? To adjust the art and science of surgery, we should understand the reason behind this Tower of Babel and ourselves by grasping the three biological lessons of history. These lessons are instincts of man--our instincts have not changed for as long as there has been recorded history. The lessons were elucidated by Will and Ariel Durant and these are competition, selection, and reproduction. How might they be applied to improving our surgical science? First, competition has always forced individuals or small groups to strengthen themselves with cooperation. Cooperate or not survive. Cooperation increases with social development and technology. Next, we must realize that nature relishes diversity. We are all born unequal and diverse. The second biological lesson is selection; which individual among a diverse group of individuals will succeed (by improving)? Therefore, by nature, man's instincts provide diverse opinions and bias. This creates a myopic view when surgeons try to discern the truth. The results are the trendy bandwagons that divert us, like tonsillectomy. Too much diversity is bad, and a balance is required. Man's third lesson of history is reproduction. Better stated is that nature loves quantity. We naturally give priority to quantity over quality. To obtain quality rather than just quantity, we need the antidotes for competition and diversity--that would be cooperation using the Deming guidelines of leadership, profound knowledge, and technology. One example of this urge for quantity and diversity is our lack of standardized definitions. These three biological lessons can be summarized by viewing competition as an impediment for quality improvement in the complex challenges of modern healthcare. Cooperation (trust) is the antidote to the bandwagon effect of unproven treatments. Cooperation and technology can be joined to establish a successful team
Directory of Open Access Journals (Sweden)
Chantal Dion
2003-06-01
Full Text Available L’apprentissage de la correction / révision de l’écrit par les apprenants de français langue seconde peut-elle tirer profit des correcteurs orthographiques et grammaticaux des traitements de texte ou des correcticiels spécialisés ? La nature de la médiation informatique permet-elle aux apprenants de corriger de façon efficace leurs textes et comment se compare-t-elle avec la correction humaine ? Qu’est-ce qui différencie ces deux médiations ? Des textes rédigés par des anglophones ont été soumis aux deux types de corrections, humaine et informatique, soit deux enseignantes ayant vingt ans d’expérience et la correction informatique effectuée par le correcteur orthographique et grammatical de Word et les deux correcticiels canadiens, Le correcteur 101 et Antidote. Les résultats montrent que la nature de ces médiations n’est pas comparable et que la médiation informatique, pour être efficace, nécessite la participation active, intelligente et instruite de l’utilisateur et que les correcticiels ne peuvent pas corriger efficacement des textes d’étudiants de niveau intermédiaire.Can spellcheckers or grammar correctors, be they part of a word processor or stand-alone programs, help FSL students become more adept at correcting or editing the written texts they produce? Does computer-assisted mediation enable learners to correct their work efficiently and how does it compare with human mediation? What differentiates them? Texts written by anglophone students were corrected using both methods, i.e., on the one hand, by two teachers with 20 years experience and, on the other hand, using the specialized tools available with MSWord as well as two Canadian text correction programs, Le Correcteur 101 and Antidote. It turns out that the two methods are of very different natures ; computer-based correction can only give some positive results if the users have received appropriate training enabling them to actively and
Directory of Open Access Journals (Sweden)
Chiaming Fan
2011-01-01
Full Text Available The advancement and intensive use of chemotherapy in treating childhood cancers has led to a growing population of young cancer survivors who face increased bone health risks. However, the underlying mechanisms for chemotherapy-induced skeletal defects remain largely unclear. Methotrexate (MTX, the most commonly used antimetabolite in paediatric cancer treatment, is known to cause bone growth defects in children undergoing chemotherapy. Animal studies not only have confirmed the clinical observations but also have increased our understanding of the mechanisms underlying chemotherapy-induced skeletal damage. These models revealed that high-dose MTX can cause growth plate dysfunction, damage osteoprogenitor cells, suppress bone formation, and increase bone resorption and marrow adipogenesis, resulting in overall bone loss. While recent rat studies have shown that antidote folinic acid can reduce MTX damage in the growth plate and bone, future studies should investigate potential adjuvant treatments to reduce chemotherapy-induced skeletal toxicities.
Composite vortex ordering in superconducting films with arrays of blind holes
International Nuclear Information System (INIS)
Berdiyorov, G R; Milosevic, M V; Peeters, F M
2009-01-01
The pinning properties of a superconducting thin film with a square array of blind holes are studied using the nonlinear Ginzburg-Landau theory. Although blind holes provide a weaker pinning potential than holes (also called antidots), several novel vortex structures are predicted for different size and thickness of the blind holes. Orientational dimer and trimer vortex states as well as concentric vortex shells can nucleate in the blind holes. In addition, we predict the stabilization of giant vortices that may be located both in the pinning centers and/or at the interstitial sites, as well as the combination of giant vortices with sets of individual vortices. For large blind holes, local vortex shell structures inside the blind holes may transfer their symmetry to interstitial vortices as well. The subtle interplay of shell formation and traditional Abrikosov vortex lattices inside the blind holes is also studied for different numbers of trapped vortices.
Musil, Karel; Florianova, Veronika; Bucek, Pavel; Dohnal, Vlastimil; Kuca, Kamil; Musilek, Kamil
2016-01-05
Acetylcholinesterase reactivators (oximes) are compounds used for antidotal treatment in case of organophosphorus poisoning. The dissociation constants (pK(a1)) of ten standard or promising acetylcholinesterase reactivators were determined by ultraviolet absorption spectrometry. Two methods of spectra measurement (UV-vis spectrometry, FIA/UV-vis) were applied and compared. The soft and hard models for calculation of pK(a1) values were performed. The pK(a1) values were recommended in the range 7.00-8.35, where at least 10% of oximate anion is available for organophosphate reactivation. All tested oximes were found to have pK(a1) in this range. The FIA/UV-vis method provided rapid sample throughput, low sample consumption, high sensitivity and precision compared to standard UV-vis method. The hard calculation model was proposed as more accurate for pK(a1) calculation. Copyright © 2015 Elsevier B.V. All rights reserved.
Pattern formation due to non-linear vortex diffusion
Wijngaarden, Rinke J.; Surdeanu, R.; Huijbregtse, J. M.; Rector, J. H.; Dam, B.; Einfeld, J.; Wördenweber, R.; Griessen, R.
Penetration of magnetic flux in YBa 2Cu 3O 7 superconducting thin films in an external magnetic field is visualized using a magneto-optic technique. A variety of flux patterns due to non-linear vortex diffusion is observed: (1) Roughening of the flux front with scaling exponents identical to those observed in burning paper including two distinct regimes where respectively spatial disorder and temporal disorder dominate. In the latter regime Kardar-Parisi-Zhang behavior is found. (2) Fractal penetration of flux with Hausdorff dimension depending on the critical current anisotropy. (3) Penetration as ‘flux-rivers’. (4) The occurrence of commensurate and incommensurate channels in films with anti-dots as predicted in numerical simulations by Reichhardt, Olson and Nori. It is shown that most of the observed behavior is related to the non-linear diffusion of vortices by comparison with simulations of the non-linear diffusion equation appropriate for vortices.
Use of lipid emulsion therapy in local anesthetic overdose
Directory of Open Access Journals (Sweden)
Ozgur Karcioglu
2017-10-01
Full Text Available The use of intravenous lipid emulsion (ILE therapy as antidote in systemic toxicity of certain agents has gained widespread support. There are increasing data suggesting use of ILE in reversing from local anesthetic-induced systemic toxicity severe, life-threatening cardiotoxicity, although findings are contradictory. Efficiency of ILE was demonstrated in animal studies in the treatment of severe impairment of cardiac functions, via a mechanism for trapping lipophilic drugs in an expanded plasma lipid compartment (“lipid sink”. In patients with hemodynamic compromise and/or cardiovascular collapse due to lipid-soluble agents, ILE may be considered for resuscitation in the acute setting by emergency physicians. The most common adverse effects from standard ILE include hypertriglyceridemia, fat embolism, infection, vein irritation, pancreatitis, electrolyte disturbances and allergic reactions. The advantages of ILE include an apparent wide margin of safety, relatively low cost, long shelf-life, and ease of administration.
DEFF Research Database (Denmark)
Roberts, Darren M; Yates, Christopher; Megarbane, Bruno
2015-01-01
in Poisoning workgroup aimed to develop evidence-based consensus recommendations for extracorporeal treatment in methanol poisoning. DESIGN AND METHODS: Utilizing predetermined methods, we conducted a systematic review of the literature. Two hundred seventy-two relevant publications were identified...... to methanol: coma, seizures, new vision deficits, metabolic acidosis with blood pH ≤7.15, persistent metabolic acidosis despite adequate supportive measures and antidotes, serum anion gap higher than 24 mmol/L; or, serum methanol concentration 1) greater than 700 mg/L (21.8 mmol/L) in the context...... of fomepizole therapy, 2) greater than 600 mg/L or 18.7 mmol/L in the context of ethanol treatment, 3) greater than 500 mg/L or 15.6 mmol/L in the absence of an alcohol dehydrogenase blocker; in the absence of a methanol concentration, the osmolal/osmolar gap may be informative; or, in the context of impaired...
Use of Poppers (Amyl Nitrite: Unpleasant Side Effects in a Brothel
Directory of Open Access Journals (Sweden)
Thomas Kofler
2014-11-01
Full Text Available Introduction: Various agents can lead to an acquired methaemoglobinaemia (MHB with potentially fatal consequences. There is a lack of literature on the formation of methaemoglobin (MH in the blood after the intake of poppers (amyl nitrite. Poppers are a popular aphrodisiac agent. Case description: A 56-year-old diabetic called an ambulance after using poppers in a brothel with subsequent associated acrocyanosis, confusion and headache. The paramedics reported tachycardia and blood glucose of 3.8 mmol/l. The arterial blood gas analysis in the Emergency Department (ED revealed a MHB of 23.1%. MH levels decreased rapidly without antidotal therapy. The patient was discharged the next day free of symptoms. Discussion: This case illustrates the potential risks of taking poppers. A wide spectrum of symptoms were present in our patient. For the differential diagnosis of acquired MHB, poppers should be considered.
DEFF Research Database (Denmark)
Thorsen, S.; Teisner, A.; Jensen, S.A.
2009-01-01
Objectives: The prothrombin time (PT) assay of factor II+VII+X activity is an important predictor of liver damage in paracetamol poisoned patients. It complicates interpretation of results that the antidote, acetylcysteine (NAC) depresses this activity. The aim was to investigate if NAC influences...... added to plasma in vitro decreased factor II+VII+X activity at 37 degrees C in a time-dependent manner. This effect was quenched at temperatures 24 degrees C. Activity lost at 37 degrees C could partly be recovered by subsequent incubation at 5 or 20 degrees C. Incubation at 37 degrees C prior to assay...... led to a significant additional depression of factor II+VII+X activity in plasma from subjects infused with NAC during the first 3h of infusion indicating that it contained reactive NAC. The risk that this NAC interfered with the accuracy of the PT assay was considered minimal with samples stored...
Umam, F.; Budiarto, H.
2018-01-01
Shrimp farming becomes the main commodity of society in Madura Island East Java Indonesia. Because of Madura island has a very extreme weather, farmers have difficulty in keeping the balance of pond water. As a consequence of this condition, there are some farmers experienced losses. In this study an adaptive control system was developed using ANFIS method to control pH balance (7.5-8.5), Temperature (25-31°C), water level (70-120 cm) and Dissolved Oxygen (4-7,5 ppm). Each parameter (pH, temperature, level and DO) is controlled separately but can work together. The output of the control system is in the form of pump activation which provides the antidote to the imbalance that occurs in pond water. The system is built with two modes at once, which are automatic mode and manual mode. The manual control interface based on android which is easy to use.
Radiation Protection Using Single-Wall Carbon Nanotube Derivatives
Tour, James M.; Lu, Meng; Lucente-Schultz, Rebecca; Leonard, Ashley; Doyle, Condell Dewayne; Kosynkin, Dimitry V.; Price, Brandi Katherine
2011-01-01
This invention is a means of radiation protection, or cellular oxidative stress mitigation, via a sequence of quenching radical species using nano-engineered scaffolds, specifically single-wall carbon nanotubes (SWNTs) and their derivatives. The material can be used as a means of radiation protection by reducing the number of free radicals within, or nearby, organelles, cells, tissue, organs, or living organisms, thereby reducing the risk of damage to DNA and other cellular components (i.e., RNA, mitochondria, membranes, etc.) that can lead to chronic and/or acute pathologies, including but not limited to cancer, cardiovascular disease, immuno-suppression, and disorders of the central nervous system. In addition, this innovation could be used as a prophylactic or antidote for accidental radiation exposure, during high-altitude or space travel where exposure to radiation is anticipated, or to protect from exposure from deliberate terrorist or wartime use of radiation- containing weapons.
A maternal-effect selfish genetic element in Caenorhabditis elegans.
Ben-David, Eyal; Burga, Alejandro; Kruglyak, Leonid
2017-06-09
Selfish genetic elements spread in natural populations and have an important role in genome evolution. We discovered a selfish element causing embryonic lethality in crosses between wild strains of the nematode Caenorhabditis elegans The element is made up of sup-35 , a maternal-effect toxin that kills developing embryos, and pha-1 , its zygotically expressed antidote. pha-1 has long been considered essential for pharynx development on the basis of its mutant phenotype, but this phenotype arises from a loss of suppression of sup-35 toxicity. Inactive copies of the sup-35/pha-1 element show high sequence divergence from active copies, and phylogenetic reconstruction suggests that they represent ancestral stages in the evolution of the element. Our results suggest that other essential genes identified by genetic screens may turn out to be components of selfish elements. Copyright © 2017, American Association for the Advancement of Science.
Rejecting the equilibrium-point hypothesis.
Gottlieb, G L
1998-01-01
The lambda version of the equilibrium-point (EP) hypothesis as developed by Feldman and colleagues has been widely used and cited with insufficient critical understanding. This article offers a small antidote to that lack. First, the hypothesis implicitly, unrealistically assumes identical transformations of lambda into muscle tension for antagonist muscles. Without that assumption, its definitions of command variables R, C, and lambda are incompatible and an EP is not defined exclusively by R nor is it unaffected by C. Second, the model assumes unrealistic and unphysiological parameters for the damping properties of the muscles and reflexes. Finally, the theory lacks rules for two of its three command variables. A theory of movement should offer insight into why we make movements the way we do and why we activate muscles in particular patterns. The EP hypothesis offers no unique ideas that are helpful in addressing either of these questions.
Myat, Aung; Ahmad, Yousif; Haldar, Shouvik; Tantry, Udaya S; Redwood, Simon R; Gurbel, Paul A; Lip, Gregory Yh
2013-08-01
Current European atrial fibrillation (AF) guidelines have assigned a strong recommendation for the initiation of antithrombotic therapy to prevent thromboembolism in all but those AF patients at low risk (or with contraindications). Furthermore, the selection of antithrombotic therapy is based on the absolute risks of thromboembolism and bleeding, and the relative risk and benefit for a given patient. By their very mechanism of action, antithrombotic agents used for stroke prevention in AF will potentially increase the risk of bleeding events. Moreover, the introduction of novel oral anticoagulation agents have introduced new, hitherto ill-defined, deficiencies in the authors' knowledge with respect to anticoagulation monitoring, availability of direct antidotes, drug-drug interactions and the ability to appropriately control and reverse their actions if bleeding events occur. The authors present a comprehensive review on all aspects of bleeding related to currently licensed antithrombotic agents used for stroke prevention in patients with AF.
Non-invasive method for recognition of coronary artery spasm
International Nuclear Information System (INIS)
Mathey, D.; Montz, R.; Hanrath, P.; Kuck, K. H.; Bleifeld, W.; Hamburg Univ.
1980-01-01
For evaluation of coronary artery spasm 201 thallium sequential scintigraphy of the myocardium after ergotamine provocation was performed in 10 patients with recurrent angina pectoris at rest and normal exercise ECG. In 9 out of the 10 patients ergotamine administration in the same dosage was repeated during the coronary angiography. A reversible defect in the 201 thallium scintigram representative of regional myocardial ischaemia developed in 9 patients after ergotamine. Only in 4 out of the 9 patients angina pectoris and ST elevation were present at the same time. In all cases coronary spasm after ergotamine was demonstrable in the coronary angiogram; in the 4 patients with ergotamine-induced Prinzmetal angina pectoris it consisted of complete vascular occlusion, in the asymptomatic patients of incomplete vascular narrowing of a higher degree. In all cases the spasm could be relieved by ergotamine antidotes within a few minutes. (orig.) [de
Sexual dysfunction, depression, and the impact of antidepressants.
Kennedy, Sidney H; Rizvi, Sakina
2009-04-01
Sexual dysfunction is a common symptom of depression. Although decreased libido is most often reported, difficulties with arousal, resulting in vaginal dryness in women and erectile dysfunction in men, and absent or delayed orgasm are also prevalent. Sexual dysfunction is also a frequent adverse effect of treatment with most antidepressants and is one of the predominant reasons for premature drug discontinuation. Selective serotonin reuptake inhibitors are the most widely prescribed antidepressants and have significant effects on arousal and orgasm compared with antidepressants that target norepinephrine, dopamine, and melatonin systems. The availability of an antidepressant that does not cause or exacerbate sexual dysfunction represents an advance in pharmacotherapy for mood disorders and should reduce treatment noncompliance and decrease the need for switching antidepressants or adding antidotes. The purpose of this review was to provide an update on the prevalence, psychobiology, and relative adverse effect burden of sexual dysfunction associated with different antidepressants.
Analysis of prescription database extracted from standard textbooks of traditional Dai medicine.
Zhang, Chuang; Chongsuvivatwong, Virasakdi; Keawpradub, Niwat; Lin, Yanfang
2012-08-29
Traditional Dai Medicine (TDM) is one of the four major ethnomedicine of China. In 2007 a group of experts produced a set of seven Dai medical textbooks on this subject. The first two were selected as the main data source to analyse well recognized prescriptions. To quantify patterns of prescriptions, common ingredients, indications and usages of TDM. A relational database linking the prescriptions, ingredients, herb names, indications, and usages was set up. Frequency of pattern of combination and common ingredients were tabulated. A total of 200 prescriptions and 402 herbs were compiled. Prescriptions based on "wind" disorders, a detoxification theory that most commonly deals with symptoms of digestive system diseases, accounted for over one third of all prescriptions. The major methods of preparations mostly used roots and whole herbs. The information extracted from the relational database may be useful for understanding symptomatic treatments. Antidote and detoxification theory deserves further research.
Prallethrin Poisoning Presenting as Status Epilepticus
Directory of Open Access Journals (Sweden)
D Vijayaraju
2014-02-01
Full Text Available Mosquito repellents contain pyrethroid derivatives, as the active ingredient. Data regarding human toxicity following oral intake is limited. This is a case report of an individual who presented with neurotoxicity following oral ingestion of prallethrin (2.4% w/w of a higher concentration present in formulations commercially available than previously. A 22 year old male presented to the emergency Room (ER in status epilepticus. He was managed in the Intensive Care Unit (ICU. No cause for his status could be determined after all laboratory investigations. A review of history with the patient revealed that he had ingested a bottle of liquid mosquito repellent (45 ml. The patient has had no further symptoms on follow up and has been off anti epileptics. Pyrethroid containing mosquito repellents act on neuronal sodium channels causing hyperexcitiability. With no known specific antidotes, symptomatic treatment is the main stay of management.
Ola-Mudathir, F K; Suru, S M
2015-11-01
Cadmium (Cd) has been implicated in increased prostate gland malignancy risk in both wildlife and humans. This study examines the chemoprotective roles of onion and garlic extracts on Cd-induced biochemical alterations in the prostate glands of rats. Adult male Wistar rats were randomly divided into nine groups: control group received double distilled water; Cd group received Cd alone (1.5 mg/100 g bwt per day); extract-treated groups were pre-treated with varied doses of onion and/or garlic extract (0.5 ml and 1.0 ml/100 g bwt per day) for 1 week and then co-treated with Cd (1.5 mg/100 g bwt per day) for additional 3 weeks. Oxidant/antioxidant status and acid phosphatase (ACPtotal and ACPprostatic ) activity were examined in prostate glands. Cd intoxication caused a marked (P garlic extract significantly minimised these alterations. The onion extract offered a dose-dependent protection. Our findings suggest a chemoprotective capability for onion and garlic extracts against Cd-induced biochemical alteration in the prostate glands. © 2014 Blackwell Verlag GmbH.
Kashdan, Todd B; McKnight, Patrick E
2013-12-01
Recent acceptance- and mindfulness-based cognitive-behavioral interventions explicitly target the clarification and commitment to a purpose in life. Yet, scant empirical evidence exists on the value of purpose as a mechanism relevant to psychopathology or well-being. The present research explored daily (within-person) fluctuations in purposeful pursuits and well-being in a community sample of 84 adults with (n = 41) and without (n = 43) the generalized subtype of social anxiety disorder (SAD). After completing an idiographic measure of purpose in life, participants monitored their effort and progress toward this purpose, along with their well-being each day. Across 2 weeks of daily reports, we found that healthy controls reported increased self-esteem, meaning in life, positive emotions, and decreased negative emotions. People with SAD experienced substantial boosts in well-being indicators on days characterized by significant effort or progress toward their life purpose. We found no evidence for the reverse direction (with well-being boosting the amount of effort or progress that people with SAD devote to their purpose), and effects could not be attributed to comorbid mood or anxiety disorders. Results provide evidence for how commitment to a purpose in life enriches the daily existence of people with SAD. The current study supports principles that underlie what many clinicians are already doing with clients for SAD.