WorldWideScience

Sample records for antidotes

  1. Graphene antidot lattice waveguides

    DEFF Research Database (Denmark)

    Pedersen, Jesper Goor; Gunst, Tue; Markussen, Troels

    2012-01-01

    We introduce graphene antidot lattice waveguides: nanostructured graphene where a region of pristine graphene is sandwiched between regions of graphene antidot lattices. The band gaps in the surrounding antidot lattices enable localized states to emerge in the central waveguide region. We model...... the waveguides via a position-dependent mass term in the Dirac approximation of graphene and arrive at analytical results for the dispersion relation and spinor eigenstates of the localized waveguide modes. To include atomistic details we also use a tight-binding model, which is in excellent agreement...... with the analytical results. The waveguides resemble graphene nanoribbons, but without the particular properties of ribbons that emerge due to the details of the edge. We show that electrons can be guided through kinks without additional resistance and that transport through the waveguides is robust against...

  2. The Antidote to Extremism

    Science.gov (United States)

    Jackson, Anthony

    2016-01-01

    For centuries, education has been seen as an antidote to intolerance and conflict. In a world rocked by violence, much of it across cultural borders, developing students' cultural understanding has become more important than ever. In this article, Asia Society vice president Anthony Jackson discusses how two high schools in the Society's…

  3. Antidotes for acute cyanide poisoning.

    Science.gov (United States)

    Borron, Stephen W; Baud, Frederic J

    2012-08-01

    Cyanide poisoning can present in multiple ways, given its widespread industrial use, presence in combustion products, multiple physical forms, and chemical structures. The primary target of toxicity is mitochondrial cytochrome oxidase. The onset and severity of poisoning depend on the route, dose, physicochemical structure and other variables. Common poisoning features include dyspnea, altered respiratory patterns, abnormal vital signs, altered mental status, seizures, and lactic acidosis. Our present knowledge supports cyanide poisoning treatment based on excellent supportive care with adjunctive antidotal therapy. Multiple antidotes exist and vary in regional availability. All currently marketed antidotes appear to be effective. Antidotal mechanisms include chelation, formation of stable, less toxic complexes, methemoglobin induction, and sulfane sulfur supplementation for detoxification by endogenous rhodanese. Each antidote has advantages and disadvantages. For example, hydroxocobalamin is safer than the methemoglobin inducers in patients with smoke inhalation. Research for new, safer and more effective cyanide antidotes continues.

  4. [Theriac: medicine and antidote].

    Science.gov (United States)

    Parojcic, Dusanka; Stupar, Dragan; Mirica, Milica

    2003-06-01

    Theriac was an ancient multi-ingredient preparation; originating as a cure for the bites of serpents, mad dogs and wild beasts, it later became an antidote to all known poisons. The name theriac (treacle), (Greek theriake, Latin theriaca, French thériaque) was derived from the Greek for wild beast - theriakos. The first formula was created by Mithridates Vl, King of Pontus, a skillful ruler but a monster of cruelty, who, living in such a fear of being poisoned, took a great interest in toxicology. In the 1st century AD, Nero's personal physician Andromachus improved the formula of Antidotum Mithridatium by adding flesh of vipers, which was commonly believed to be the best antidote against snakebite, and by increasing the proportion of opium. It became known as Theriac of Andromachus, and contained 64 ingredients including various minerals, herbals, poisons and animal flesh and blood, all combined with honey in the form of electuarium. Later it became the cure-all medicine which, accumulating all the simples into one form, was supposed to be a universal panacea against all diseases. In the Middle Ages this famous electuarium become a patent medicine and entered official dispensaries and pharmacopoeias. The most famous and expensive Theriac in Europe was that of Venice. It was not until the l8th century that it was excluded from medical use.

  5. Graphene antidot lattice transport measurements

    DEFF Research Database (Denmark)

    Mackenzie, David; Cagliani, Alberto; Gammelgaard, Lene

    2017-01-01

    We investigate graphene devices patterned with a narrow band of holes perpendicular to the current flow, a few-row graphene antidot lattice (FR-GAL). Theoretical reports suggest that a FR-GAL can have a bandgap with a relatively small reduction of the transmission compared to what is typical...... for antidot arrays devices. Graphene devices were fabricated using 100 keV electron beam lithography (EBL) for nanopatterning as well as for defining electrical contacts. Patterns with hole diameter and neck widths of order 30 nm were produced, which is the highest reported pattern density of antidot lattices...... in graphene reported defined by EBL. Electrical measurements showed that devices with one and five rows exhibited field effect mobility of ∼100 cm2/Vs, while a larger number of rows, around 40, led to a significant reduction of field effect mobility (

  6. Graphene on graphene antidot lattices

    DEFF Research Database (Denmark)

    Gregersen, Søren Schou; Pedersen, Jesper Goor; Power, Stephen

    2015-01-01

    Graphene bilayer systems are known to exhibit a band gap when the layer symmetry is broken by applying a perpendicular electric field. The resulting band structure resembles that of a conventional semiconductor with a parabolic dispersion. Here, we introduce a bilayer graphene heterostructure......, where single-layer graphene is placed on top of another layer of graphene with a regular lattice of antidots. We dub this class of graphene systems GOAL: graphene on graphene antidot lattice. By varying the structure geometry, band-structure engineering can be performed to obtain linearly dispersing...

  7. Screening in graphene antidot lattices

    DEFF Research Database (Denmark)

    Schultz, Marco Haller; Jauho, A. P.; Pedersen, T. G.

    2011-01-01

    We compute the dynamical polarization function for a graphene antidot lattice in the random-phase approximation. The computed polarization functions display a much more complicated structure than what is found for pristine graphene (even when evaluated beyond the Dirac-cone approximation...... the plasmon dispersion law and find an approximate square-root dependence with a suppressed plasmon frequency as compared to doped graphene. The plasmon dispersion is nearly isotropic and the developed approximation schemes agree well with the full calculation....

  8. Chemical terrorism attacks: update on antidotes.

    Science.gov (United States)

    Lawrence, David T; Kirk, Mark A

    2007-05-01

    There is well-founded concern that a chemical or radioactive agent will at some point be used as a weapon of terror. There are several antidotes that, if used correctly in a timely fashion, can help lessen the harm caused by these agents. This article is meant to introduce the clinician to several such agents, along with the antidotes useful in the management of exposure to these. It covers the indications, administration, and precautions for using these antidotes.

  9. ACUTE TOXICITY STUDIES AND ANTIDOTAL THERAPY OF ...

    African Journals Online (AJOL)

    ACUTE TOXICITY STUDIES AND ANTIDOTAL THERAPY OF ETHANOL EXTRACT OF JATROPHA CURCAS SEEDS IN EXPERIMENTAL ANIMALS. ... with the aim of investigating the toxicity of the ethanol seed extract of JC in rats, mice, and chicks; and also to use conventional antidotes to treat intoxication in rats due to ...

  10. Spectral Gaps in Graphene Antidot Lattices

    DEFF Research Database (Denmark)

    Barbaroux, Jean-Marie; Cornean, Decebal Horia; Stockmeyer, Edgardo

    2017-01-01

    We consider the gap creation problem in an antidot graphene lattice, i.e. a sheet of graphene with periodically distributed obstacles. We prove several spectral results concerning the size of the gap and its dependence on different natural parameters related to the antidot lattice....

  11. Electronic properties of graphene antidot lattices

    DEFF Research Database (Denmark)

    Fürst, Joachim Alexander; Pedersen, Jesper Goor; Flindt, C.

    2009-01-01

    Graphene antidot lattices constitute a novel class of nano-engineered graphene devices with controllable electronic and optical properties. An antidot lattice consists of a periodic array of holes that causes a band gap to open up around the Fermi level, turning graphene from a semimetal...... into a semiconductor. We calculate the electronic band structure of graphene antidot lattices using three numerical approaches with different levels of computational complexity, efficiency and accuracy. Fast finite-element solutions of the Dirac equation capture qualitative features of the band structure, while full...

  12. Optical properties of graphene antidot lattices

    DEFF Research Database (Denmark)

    Pedersen, Thomas Garm; Flindt, Christian; Pedersen, Jesper Goor

    2008-01-01

    Undoped graphene is semimetallic and thus not suitable for many electronic and optoelectronic applications requiring gapped semiconductor materials. However, a periodic array of holes (antidot lattice) renders graphene semiconducting with a controllable band gap. Using atomistic modeling, we...

  13. ANTIDotE: anti-tick vaccines to prevent tick-borne diseases in Europe

    NARCIS (Netherlands)

    Sprong, Hein; Trentelman, Jos; Seemann, Ingar; Grubhoffer, Libor; Rego, Ryan O. M.; Hajdušek, Ondřej; Kopáček, Petr; Šíma, Radek; Nijhof, Ard M.; Anguita, Juan; Winter, Peter; Rotter, Bjorn; Havlíková, Sabina; Klempa, Boris; Schetters, Theo P.; Hovius, Joppe W. R.

    2014-01-01

    Ixodes ricinus transmits bacterial, protozoal and viral pathogens, causing disease and forming an increasing health concern in Europe. ANTIDotE is an European Commission funded consortium of seven institutes, which aims to identify and characterize tick proteins involved in feeding and pathogen

  14. Antidotes for alcohol and glycol toxicity: translating mechanisms into treatments.

    Science.gov (United States)

    McMartin, K E

    2010-09-01

    Translational toxicology can be defined as the movement of potential antidotes for the treatment of poisonings from basic mechanistic research to the marketplace. Because poisonings are infrequent, the clinical development of antidotes is fraught with trials and tribulations. Academic scientists often conduct basic mechanistic work with antidotes but are infrequently involved in further drug development. This article presents the development of 4-methylpyrazole (4MP) (fomepizole) as an antidote against toxic alcohol poisonings, particularly by methanol and ethylene glycol (EG).

  15. Electronic properties of graphene antidot lattices

    International Nuclear Information System (INIS)

    Fuerst, J A; Brandbyge, M; Jauho, A-P; Pedersen, J G; Mortensen, N A; Flindt, C; Pedersen, T G

    2009-01-01

    Graphene antidot lattices constitute a novel class of nano-engineered graphene devices with controllable electronic and optical properties. An antidot lattice consists of a periodic array of holes that causes a band gap to open up around the Fermi level, turning graphene from a semimetal into a semiconductor. We calculate the electronic band structure of graphene antidot lattices using three numerical approaches with different levels of computational complexity, efficiency and accuracy. Fast finite-element solutions of the Dirac equation capture qualitative features of the band structure, while full tight-binding calculations and density functional theory (DFT) are necessary for more reliable predictions of the band structure. We compare the three computational approaches and investigate the role of hydrogen passivation within our DFT scheme.

  16. Histopathological and Biochemical evaluations of the antidotal ...

    African Journals Online (AJOL)

    Objective: The study was designed to investigate the effects of continuous exposure of dichlorvos (DDVP) on hepatic function and hepatic histomorphology, with the possible antidotal efficacy of Nigella sativa oil (NSO). Methods: Twenty four Wistar rats were randomly divided into four groups, with each group comprising of ...

  17. Thermoelectric properties of finite graphene antidot lattices

    DEFF Research Database (Denmark)

    Gunst, Tue; Markussen, Troels; Jauho, Antti-Pekka

    2011-01-01

    We present calculations of the electronic and thermal transport properties of graphene antidot lattices with a finite length along the transport direction. The calculations are based on the π-tight-binding model and the Brenner potential. We show that both electronic and thermal transport...

  18. Thermoelectric properties of one-dimensional graphene antidot arrays

    International Nuclear Information System (INIS)

    Yan, Yonghong; Liang, Qi-Feng; Zhao, Hui; Wu, Chang-Qin; Li, Baowen

    2012-01-01

    We investigate the thermoelectric properties of one-dimensional (1D) graphene antidot arrays by nonequilibrium Green's function method. We show that by introducing antidots to the pristine graphene nanoribbon the thermal conductance can be reduced greatly while keeping the power factor still high, thus leading to an enhanced thermoelectric figure of merit (ZT). Our numerical results indicate that ZT values of 1D antidot graphene arrays can be up to unity, which means the 1D graphene antidot arrays may be promising for thermoelectric applications. -- Highlights: ► We study thermoelectric properties of one-dimensional (1D) graphene antidot arrays. ► Thermoelectric figure of merit (ZT) of 1D antidot arrays can exceed unity. ► ZT of 1D antidot arrays is larger than that of two-dimensional arrays.

  19. Appropriate Utilization and Stocking of Antidotes in Qatar Public Hospitals

    Directory of Open Access Journals (Sweden)

    Rawan Salameh

    2017-09-01

    Full Text Available Background: There are a few studies that evaluate preparedness and availability of antidotes in the emergency setting and none have been conducted in Qatar. Published studies show that timely availability of antidotes in the emergency department setting is a common issue. To address this, we conducted a study to evaluate antidote stocking and utilization in Qatar hospital pharmacies and emergency departments. Methods: In order to evaluate the appropriate use and timely administration of antidotes, research assistants prospectively collected data on ED patients. All ED patients who received any key antidote over the 6-month study period were identified through both ED and pharmacy records. In order to evaluate the stocking of the 31 most important antidotes in our main public hospitals, a survey assessing the stocking of these key antidotes was sent to the four general hospitals in Qatar, to determine their availability and whether they are stocked in the ED or only in the main pharmacy. Results: Poison exposure was evaluated in 471 cases. Antidotes were given within 30 minutes in 73% of cases, which included atropine, calcium, dextrose, flumazenil, naloxone, pralidoxime, sodium bicarbonate, thiamine, vitamin K and scorpion and snake antivenoms. Administration occurred later than 60 minutes in 2% of cases, exclusively with N-acetylcysteine and activated charcoal. Atropine, calcium, dextrose, naloxone, pralidoxime (2-PAM, sodium bicarbonate, and anti-venoms were clinically indicated 92% of the times they were ordered. N-acetylcysteine was indicated in only 51.5% of administrations. Significant variation in antidote stocking existed between hospitals, and there was no stocked hydroxocobalamin as antidotes for cyanide poisoning or fomepizole for toxic alcohol poisoning. Conclusion: Antidote stocking varied significantly between hospitals, and antidotes necessary for cyanide and toxic alcohol poisoning were deficient in all public hospitals. The

  20. Development of antidotes: problems and strategies.

    Science.gov (United States)

    Szinicz, Ladislaus; Worek, Franz; Thiermann, Horst; Kehe, Kai; Eckert, Saskia; Eyer, Peter

    2007-04-20

    Antidotes against chemical warfare agents are "orphan drugs" given that these poisonings are rare. Therefore, they are of limited interest to the pharmaceutical industry. For this reason, and recognizing the increasing threat of terrorist or asymmetrical use of chemical warfare agents, the responsibility for research into medical countermeasures against these weapons is of primary interest to armies. Accordingly, the research activities of the Bundeswehr Institute of Pharmacology and Toxicology are dedicated to improving diagnosis, prophylaxis and therapy of individuals who are exposed to a chemical agent. Here, antidote development and testing are a high priority in the research program, particularly with respect to organophosphorus (OP) nerve agents and sulphur mustard. The Institute has been coordinating research activities undertaken in house and in collaboration with external researchers. The research program aims to develop primarily in vitro models to minimize the sacrifice of animals, using strategies, which involve human material early in antidote testing. An animal model using isolated mouse diaphragm demonstrated the correlation between AChE activity and neuromuscular function. A similar relationship was found between erythrocyte AChE and neuromuscular function in patients with acute OP pesticide poisoning. In vitro rate constants of the various reactions that are involved in enzyme inhibition and reactivation using human material were used for prediction of what would happen in vivo. This prediction could be confirmed in a patient with acute OP pesticide poisoning. Finally, computer models are being established to estimate the therapeutic effect of an antidote in various human poisoning scenarios. This approach is necessary to compensate for the lack of human clinical pharmacodynamic studies that are usually required for drug regulatory approval, given the obvious ethical issues preventing human volunteer studies with these agents.

  1. Magnetic edge states and magnetotransport in graphene antidot barriers

    DEFF Research Database (Denmark)

    Thomsen, M. R.; Power, Stephen; Jauho, Antti-Pekka

    2016-01-01

    for antidots smaller than the magnetic length and demonstrate the presence of magnetic edge states, which are localized states on the periphery of the antidots due to successive reflections on the antidot edge in the presence of a magnetic field. We show that these states are robust against variations...... in lattice configuration and antidot edge chirality. Moreover, we calculate the transmittance of disordered GABs and find that magnetic edge states survive a moderate degree of disorder. Due to the long phase-coherence length in graphene and the robustness of these states, we expect magnetic edge states...

  2. Electronic properties of disordered graphene antidot lattices

    DEFF Research Database (Denmark)

    Yuan, Shengjun; Roldán, Rafael; Jauho, Antti-Pekka

    2013-01-01

    Regular nanoscale perforations in graphene (graphene antidot lattices, GALs) are known to lead to a gap in the energy spectrum, thereby paving a possible way towards many applications. This theoretical prediction relies on a perfect placement of identical perforations, a situation not likely...... for solving the time-dependent Schro¨dinger equation in a tight-binding representation of the graphene sheet [Yuan et al., Phys. Rev. B 82, 115448 (2010)], which allows us to consider GALs consisting of 6400 × 6400 carbon atoms. The central conclusion for all kinds of disorder is that the gaps found...

  3. Anisotropy engineering using exchange bias on antidot templates

    Directory of Open Access Journals (Sweden)

    F. J. T. Goncalves

    2015-06-01

    Full Text Available We explore an emerging device concept based on exchange bias used in conjunction with an antidot geometry to fine tune ferromagnetic resonances. Planar cavity ferromagnetic resonance is used to study the microwave response of NiO/NiFe bilayers with antidot structuring. A large frequency asymmetry with respect to an applied magnetic field is found across a broad field range whose underlying cause is linked to the distribution of magnetic poles at the antidot surfaces. This distribution is found to be particularly sensitive to the effects of exchange bias, and robust in regards to the quality of the antidot geometry. The template based antidot geometry we study offers advantages for practical device construction, and we show that it is suitable for broadband absorption and filtering applications, allowing tunable anisotropies via interface engineering.

  4. Electronic transport in disordered graphene antidot lattice devices

    DEFF Research Database (Denmark)

    Power, Stephen; Jauho, Antti-Pekka

    2014-01-01

    Nanostructuring of graphene is in part motivated by the requirement to open a gap in the electronic band structure. In particular, a periodically perforated graphene sheet in the form of an antidot lattice may have such a gap. Such systems have been investigated with a view towards application...... in transistor or waveguiding devices. The desired properties have been predicted for atomically precise systems, but fabrication methods will introduce significant levels of disorder in the shape, position and edge configurations of individual antidots. We calculate the electronic transport properties of a wide...... range of finite graphene antidot devices to determine the effect of such disorders on their performance. Modest geometric disorder is seen to have a detrimental effect on devices containing small, tightly packed antidots, which have optimal performance in pristine lattices. Larger antidots display...

  5. Development and Efficacy Testing of Next Generation Cyanide Antidotes

    Science.gov (United States)

    2013-10-01

    LC-MS/MS Analysis of 2-Aminothiazoline-4-Carboxylic Acid as a Forensic Biomarker for Cyanide Poisoning . Journal of World Methodology, 26, 2(5),1-7...Generation Cyanide Antidotes PRINCIPAL INVESTIGATOR: Ilona Petrikovics, Ph.D...Testing of Next Generation Cyanide Antidotes 5a. CONTRACT NUMBER 5b. GRANT NUMBER W81XWH-12-2-0126 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Ilona

  6. Magnetoconductance of a hybrid quantum ring: Effects of antidot potentials

    OpenAIRE

    Nammee Kim; Dae-Han Park; Heesang Kim

    2016-01-01

    The electronic structures and two-terminal magnetoconductance of a hybrid quantum ring are studied. The backscattering due to energy-resonance is considered in the conductance calculation. The hybrid magnetic-electric quantum ring is fabricated by applying an antidot electrostatic potential in the middle of a magnetic quantum dot. Electrons are both magnetically and electrically confined in the plane. The antidot potential repelling electrons from the center of the dot plays a critical role i...

  7. Availability of antidotes in 70 hospitals in Catalonia, Spain.

    Science.gov (United States)

    Broto-Sumalla, Antoni; Rabanal-Tornero, Manel; García-Peláez, Milagros; Aguilar-Salmerón, Raquel; Fernández de Gamarra-Martínez, Edurne; Martínez-Sánchez, Lídia; Gaspar-Caro, María-José; Nogué-Xarau, Santiago

    2018-01-12

    Antidotes may have a relevant role in acute intoxication management and the time until its administration can influence patient survival. Study conducted by a questionnaire sent in early 2015 to 70 hospitals in Catalonia providing emergency services. Qualitative availability on each antidote was considered adequate when present in at least 80% of hospitals. The quantitative availability was considered adequate when at least 80% of hospitals had the number of units of antidote recommended. Lower complexity hospitals (level A) showed a percentage of adequate qualitative and quantitative availability of 66.7 and 42.9% respectively. In higher complexity hospitals (level B) qualitative and quantitative availability was adequate in 64.5 and 38.7% of the antidotes respectively. Data showed no differences between the different health regions as well as a positive correlation (pavailability. The availability of antidotes in Catalonia hospitals is generally low and shows differences across health regions and depending on level of complexity. Copyright © 2017 Elsevier España, S.L.U. All rights reserved.

  8. Rising cost of antidotes in the U.S.: cost comparison from 2010 to 2015.

    Science.gov (United States)

    Heindel, Gregory A; Trella, Jeanette D; Osterhoudt, Kevin C

    2017-06-01

    Our poison control center observed a large increase in the cost of many antidotes over the past several years. The high cost of antidotes has previously been cited as a factor leading to inadequate antidote supply at some hospitals. Continued increases in the cost of antidotes may lead to further reductions in antidote supply and represent serious concerns. This research aims to quantify recent trends in the costs of antidotes in the U.S. Antidotes and minimum stocking recommendations were retrieved from published guidelines. RED BOOK Online ® was used to identify the U.S. average wholesale price (AWP) of each antidote in 2010 and 2015. The AWP in 2010 was adjusted using the U.S. Consumer Price Index to adjust for inflation. The cost of minimum stocking levels for each antidote was calculated and compared between the year 2010 and 2015. The cost of stocking many antidotes demonstrated a large increase in AWP from 2010 to 2015. Of the antidotes evaluated, 15 out of 33 had greater than 50% increase in AWP and 8 out of 33 had greater than $1000 increase in AWP. Only four antidotes demonstrated decreases in AWP greater than 10% and only one antidote had its cost of stocking decrease in AWP by more than $1000. The price increase over the last 5 years may further hinder the willingness of hospitals to stock recommended antidotes at adequate quantities. This may impede timely treatment of patients, and negatively impact poisoning outcomes. The price of many antidotes substantially increased in the United States from 2010 to 2015. Strategies should be investigated to help decrease the cost associated with stocking and use of antidotes, including dose rounding, consignment, and regional sharing.

  9. Graphene antidot lattices: Designed defects and spin qubits

    DEFF Research Database (Denmark)

    Pedersen, Thomas; Flindt, Christian; Pedersen, Jesper Goor

    2008-01-01

    similar phenomenology, but within a much more favorable energy scale, a consequence of the Dirac fermion nature of the states around the Fermi level. Further, by leaving out some of the holes one can create defect states, or pairs of coupled defect states, which can function as hosts for electron spin......Antidot lattices, defined on a two-dimensional electron gas at a semiconductor heterostructure, are a well-studied class of man-made structures with intriguing physical properties. We point out that a closely related system, graphene sheets with regularly spaced holes ("antidots"), should display...... qubits. We present a detailed study of the energetics of periodic graphene antidot lattices, analyze the level structure of a single defect, calculate the exchange coupling between a pair of spin qubits, and identify possible avenues for further developments....

  10. Magnetic properties engineering of nanopatterned cobalt antidot arrays

    International Nuclear Information System (INIS)

    Kaidatzis, Andreas; Niarchos, Dimitrios; Del Real, Rafael P; Vázquez, Manuel; Alvaro, Raquel; Anguita, José; García-Martín, José Miguel; Luis Palma, Juan; Escrig, Juan

    2016-01-01

    We report on the study of arrays of 60 nm wide cobalt antidots, nanopatterned using focused ion beam milling. Square and hexagonal symmetry arrays have been studied, with varying antidot densities and lattice constant from 150 up to 300 nm. We find a strong increase of the arrays’ magnetic coercivity with respect to the unpatterned film, which is monotonic as the antidot density increases. Additionally, there is a strong influence of the array symmetry to the in-plane magnetic anisotropy: square arrays exhibit fourfold symmetry and hexagonal arrays exhibit sixfold symmetry. The above findings are corroborated by magnetic imaging and micromagnetic modeling, which show the magnetic structure of the arrays to depend strongly on the array morphology. (paper)

  11. Magnetoconductance of a hybrid quantum ring: Effects of antidot potentials

    Directory of Open Access Journals (Sweden)

    Nammee Kim

    2016-05-01

    Full Text Available The electronic structures and two-terminal magnetoconductance of a hybrid quantum ring are studied. The backscattering due to energy-resonance is considered in the conductance calculation. The hybrid magnetic-electric quantum ring is fabricated by applying an antidot electrostatic potential in the middle of a magnetic quantum dot. Electrons are both magnetically and electrically confined in the plane. The antidot potential repelling electrons from the center of the dot plays a critical role in the energy spectra and magnetoconductance. The angular momentum transition in the energy dispersion and the magnetoconductance behavior are investigated in consideration of the antidot potential variation. Results are shown using a comparison of the results of the conventional magnetic quantum dot.

  12. Creativity: Performativity's Poison or Its Antidote?

    Science.gov (United States)

    Munday, Ian

    2014-01-01

    A common move in the study of creativity and performativity is to present the former as an antidote to the latter. Might we, therefore, see work on creativity in education as heralding an era of post-performativity? In this paper I argue that the portrayal of performativity in the literature on creativity presents an overly simplistic (vulgar?)…

  13. Antidotes to organophosphate poisoning. 2. Thiadiazole-5-carboxaldoximes

    NARCIS (Netherlands)

    Benschop, H.P.; Berg, G.R. van den; Hooidonk, C. van; Jong, L.P.A. de; Kientz, C.E.; Berends, F.; Kepner, L.A.; Meeter, E.; Visser, R.P.L.S.

    1979-01-01

    Three new nonquaternary oximes have been evaluated with respect to their antidotal activities against organophosphate poisoning. The oximes 1,2,3-thiadiazole-5-carboxaldoxime (1, pKa = 7.6), 2-methyl-1,3,4-thiadiazole-5-carboxaldoxime (2, pKa = 8.4), and 3-methyl-1,2,4-thiadiazole-5-carboxaldoxime

  14. Editorial: Poisons and antidotes | Maitai | East and Central African ...

    African Journals Online (AJOL)

    Editorial: Poisons and antidotes. CK Maitai. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy ...

  15. Magnetic edge states and magnetotransport in graphene antidot barriers

    DEFF Research Database (Denmark)

    Thomsen, M. R.; Power, Stephen; Jauho, Antti-Pekka

    2016-01-01

    in lattice configuration and antidot edge chirality. Moreover, we calculate the transmittance of disordered GABs and find that magnetic edge states survive a moderate degree of disorder. Due to the long phase-coherence length in graphene and the robustness of these states, we expect magnetic edge states...

  16. One patient's search for antidotes to nihilism in psychiatry.

    Science.gov (United States)

    Sealey, Robert

    2004-01-01

    A prosumer who experienced problems after misdiagnosis and mistreatment, the author searched for explanations of the short cuts inflicted on him by a mental health professional. Wanting to learn from the painful experience of willful incompetence, write to achieve closure and create a teaching tale to help other patients, the author studied the literature, read about the tradition of nihilism in psychiatry, found research reports of deviations from practice guidelines and tested three antidotes to nihilism in psychiatry.

  17. [Modern approaches to the formation of antidote stocks at medical institutions in Russia and foreign countries].

    Science.gov (United States)

    Simonenko, V E; Sarmanaev, S Kh; Kovalev, E V; Sarmanaeva, R R; Kukhanov, A V

    2014-11-01

    This article analyses the approaches to the formation of specific treatment of acute poisoning in the various countries. The authors present a systematic review of scientific publications about the formation of reserves of antidote agents at medical institutions of the Russian Federation, the US, Canada, France, Spain, Greece, Norway, Czech Republic, Taiwan and Poland. A search for a variety of databases, as well as by reviewing reference lists of publications on the subject of "stockpiling antidote means". It is concluded that the antidote provision at health care institutions in different countries is insufficient. State of affairs with the formation of antidote stocks is better at hospitals of Czech Republic, France and Spain. To determine the range and volume of the stock of fixed assets necessary antidote coordination and approval of the list and the number of mandatory for every medical institution antidotes.

  18. Energy spectrums of bilayer triangular phosphorene quantum dots and antidots

    Directory of Open Access Journals (Sweden)

    Z. T. Jiang

    2017-04-01

    Full Text Available We theoretically investigate the confined states of the bilayer triangular phosphorene dots and antidots by means of the tight-binding approach. The dependence of the energy levels on the size, the type of the boundary edges, and the orientation of the dots and antidots, and the influences of the electric and magnetic fields on the energy levels, are all completely analyzed. It is found that the energy level numbers of the bilayer dots and antidots are determined by the energy levels in two layers. The external electric field can effectively tune the energy levels of the edge states in both layers to move in opposite directions. With the increase of the magnetic field, the magnetic energy levels can approach the Landau levels of the phosphorene monolayer, the phosphorene bilayer, or both, depending on the specific geometry of the monolayer-bilayer hybrid phosphorene quantum dots. This research should be helpful for the overall understanding of the electronic properties of the multilayer hybrid phosphorene nanostructures and designing the corresponding phosphorene devices.

  19. Selection of an aptamer antidote to the anticoagulant drug bivalirudin.

    Directory of Open Access Journals (Sweden)

    Jennifer A Martin

    Full Text Available Adverse drug reactions, including severe patient bleeding, may occur following the administration of anticoagulant drugs. Bivalirudin is a synthetic anticoagulant drug sometimes employed as a substitute for heparin, a commonly used anticoagulant that can cause a condition called heparin-induced thrombocytopenia (HIT. Although bivalrudin has the advantage of not causing HIT, a major concern is lack of an antidote for this drug. In contrast, medical professionals can quickly reverse the effects of heparin using protamine. This report details the selection of an aptamer to bivalirudin that functions as an antidote in buffer. This was accomplished by immobilizing the drug on a monolithic column to partition binding sequences from nonbinding sequences using a low-pressure chromatography system and salt gradient elution. The elution profile of binding sequences was compared to that of a blank column (no drug, and fractions with a chromatographic difference were analyzed via real-time PCR (polymerase chain reaction and used for further selection. Sequences were identified by 454 sequencing and demonstrated low micromolar dissociation constants through fluorescence anisotropy after only two rounds of selection. One aptamer, JPB5, displayed a dose-dependent reduction of the clotting time in buffer, with a 20 µM aptamer achieving a nearly complete antidote effect. This work is expected to result in a superior safety profile for bivalirudin, resulting in enhanced patient care.

  20. Translational Antidote Research: A Bedside to Bench Tale

    Directory of Open Access Journals (Sweden)

    Jeffrey Brent

    2015-03-01

    Full Text Available Although antidote development should proceed in an orderly fashion from observation, to experimental and safety studies, to clinical trials, this sequence is not always precisely followed. The development of fomepizole as an antidote for toxic alcohol and glycol poisoning is an example of how this may not be the case. Interest in the development of fomepizole was spurred in the 1960s. Shortly thereafter studies characterized by administration to humans commenced. The potential value of fomepizole as an antidote for methanol poisoning was highlighted by primate experiments. Simultaneously, the utility of fomepizole was shown in an experimental model of ethylene glycol poisoning. Further studies on humans showed effectiveness of fomepizole in the treatment of disulfiram-alcohol reactions and ethylene glycol poisoning. In addition, in primate experiments, the safety of fomepizole was established as the subjects tolerated serum fomepizole concentrations over 150 times higher than therapeutic target levels. Subsequent studies have validated the efficacy of fomepizole in the treatment of ethylene glycol and methanol poisonings. Fomepizole has been found to be associated with fewer complications than the alternative alcohol dehydrogenase inhibitor, ethanol. In serious cases of methanol toxicity, fomepizole has been shown to improve survival compared to that obtained with ethanol.

  1. A specific antidote for reversal of anticoagulation by direct and indirect inhibitors of coagulation factor Xa.

    Science.gov (United States)

    Lu, Genmin; DeGuzman, Francis R; Hollenbach, Stanley J; Karbarz, Mark J; Abe, Keith; Lee, Gail; Luan, Peng; Hutchaleelaha, Athiwat; Inagaki, Mayuko; Conley, Pamela B; Phillips, David R; Sinha, Uma

    2013-04-01

    Inhibitors of coagulation factor Xa (fXa) have emerged as a new class of antithrombotics but lack effective antidotes for patients experiencing serious bleeding. We designed and expressed a modified form of fXa as an antidote for fXa inhibitors. This recombinant protein (r-Antidote, PRT064445) is catalytically inactive and lacks the membrane-binding γ-carboxyglutamic acid domain of native fXa but retains the ability of native fXa to bind direct fXa inhibitors as well as low molecular weight heparin-activated antithrombin III (ATIII). r-Antidote dose-dependently reversed the inhibition of fXa by direct fXa inhibitors and corrected the prolongation of ex vivo clotting times by such inhibitors. In rabbits treated with the direct fXa inhibitor rivaroxaban, r-Antidote restored hemostasis in a liver laceration model. The effect of r-Antidote was mediated by reducing plasma anti-fXa activity and the non-protein bound fraction of the fXa inhibitor in plasma. In rats, r-Antidote administration dose-dependently and completely corrected increases in blood loss resulting from ATIII-dependent anticoagulation by enoxaparin or fondaparinux. r-Antidote has the potential to be used as a universal antidote for a broad range of fXa inhibitors.

  2. Cyanide poisoning in Thailand before and after establishment of the National Antidote Project.

    Science.gov (United States)

    Srisuma, Sahaphume; Pradoo, Aimon; Rittilert, Panee; Wongvisavakorn, Sunun; Tongpoo, Achara; Sriapha, Charuwan; Krairojananan, Wannapa; Suchonwanich, Netnapis; Khomvilai, Sumana; Wananukul, Winai

    2018-04-01

    Antidote shortage is a global problem. In Thailand, the National Antidote Project (NAP) has operated since November 2010 to manage the national antidote stockpile, educate the healthcare providers on appropriate antidote use, and evaluate antidote usage. To evaluate the effect of NAP implementation on mortality rate and antidote use in cyanide poisoning cases arising from ingestion of cyanide or cyanogenic glycoside. This is a retrospective cohort of poisoning cases involving cyanide or cyanogenic glycoside ingestion reported to Ramathibodi Poison Center from 1 January 2007 to 31 December 2015. Mortality rate, antidote use, and appropriateness of antidote use (defined as correct indication, proper dosing regimen, and administration within 90 min) before and after NAP implementation were compared. Association between parameters and fatal outcomes was analyzed. A total of 343 cases involving cyanide or cyanogenic glycoside ingestion were reported to Ramathibodi Poison Center. There were 213 cases (62.1%) during NAP (Project group) and 130 cases (37.9%) pre-NAP implementation (Before group). Implementation of NAP led to increased antidote use (39.9% in Project group versus 24.6% in Before group) and a higher rate of appropriate antidote use (74.1% in Project group versus 50.0% in Before group). All 30 deaths were presented with initial severe symptoms. Cyanide chemical source and self-harm intent were associated with death (OR: 12.919, 95% CI: 4.863-39.761 and OR: 10.747, 95% CI: 3.884-28.514, respectively). No difference in overall mortality rate (13 [10.0%] deaths before versus 17 [8.0%] deaths after NAP) was found. In subgroup analysis of 80 cases with initial severe symptoms, NAP and appropriate antidote use reduced mortality (OR: 0.327, 95% CI: 0.106-0.997 and OR: 0.024, 95% CI: 0.004-0.122, respectively). In the multivariate analysis of the cases with initial severe symptoms, presence of the NAP and appropriate antidote use independently reduced the risk of

  3. New Direction Treatment in Antidote Treatment of OPC Intoxications

    International Nuclear Information System (INIS)

    Dishovsky, C.

    2007-01-01

    The toxic effect of organophosphorus compounds (OPC) is based on inhibition of acetylcholinesterase (AChE), enzyme which plays an important physiological role in the cholinergic nervous system. The drug therapy on intoxication with OPC included mainly combination of cholinesterase reactivators and cholinolytics. There is no single AChE reactivator having the ability to sufficiently reactivate inhibited enzyme due to the high variability of chemical structure of the inhibitors. The classic oximes have antidote effect against intoxication with sarin, Vx and tabun, but are not effective against soman. HI-6 (Bulgarian ampoule form T oxidin ) has an effect against sarin, soman and Vx, and to a lesser degree against tabun. In order to improve the treatment of poisoning with highly toxic OPC, in ours laboratory we synthesized a variety of mono- and dioximes. We use different numbers of pyridinium or heterocyclic rings, different length and shape of the connecting chain between pyridinium or pyridinium-heterocyclic rings; different number and position of the oxime groups at the pyridinium rings and others. The investigations of some authors and our research showed that the compounds which present a combination between HI-6 and TMB-4 have a better antidote activity against tabun intoxications. The important finding of this study is that we synthesized complex compounds, reactivators of cholinesterase activity (including HI-6) with AMP / ATP and polycarboxilats, which have prolonged action in organism compared with original oximes. Pharmacokinetic studies showed that they are eliminated more slowly. The antidotal efficacy of these compounds after soman poisoning in rats was similar like that of the original oximes. The same tendency showed and the other pharmacological (blood pressure, EKG, breathing, neuromuscular transmission), and biochemical (ChE) investigations. (author)

  4. Periodic Arrays of Phosphorene Nanopores as Antidot Lattices with Tunable Properties.

    Science.gov (United States)

    Cupo, Andrew; Masih Das, Paul; Chien, Chen-Chi; Danda, Gopinath; Kharche, Neerav; Tristant, Damien; Drndić, Marija; Meunier, Vincent

    2017-07-25

    A tunable band gap in phosphorene extends its applicability in nanoelectronic and optoelectronic applications. Here, we propose to tune the band gap in phosphorene by patterning antidot lattices, which are periodic arrays of holes or nanopores etched in the material, and by exploiting quantum confinement in the corresponding nanoconstrictions. We fabricated antidot lattices with radii down to 13 nm in few-layer black phosphorus flakes protected by an oxide layer and observed suppression of the in-plane phonon modes relative to the unmodified material via Raman spectroscopy. In contrast to graphene antidots, the Raman peak positions in few-layer BP antidots are unchanged, in agreement with predicted power spectra. We also use DFT calculations to predict the electronic properties of phosphorene antidot lattices and observe a band gap scaling consistent with quantum confinement effects. Deviations are attributed primarily to self-passivating edge morphologies, where each phosphorus atom has the same number of bonds per atom as the pristine material so that no dopants can saturate dangling bonds. Quantum confinement is stronger for the zigzag edge nanoconstrictions between the holes as compared to those with armchair edges, resulting in a roughly bimodal band gap distribution. Interestingly, in two of the antidot structures an unreported self-passivating reconstruction of the zigzag edge endows the systems with a metallic component. The experimental demonstration of antidots and the theoretical results provide motivation to further scale down nanofabrication of antidots in the few-nanometer size regime, where quantum confinement is particularly important.

  5. FAR-INFRARED EXCITATIONS IN ANTIDOT SYSTEMS ON SILICON MOS STRUCTURES

    NARCIS (Netherlands)

    HUBER, A; JEJINA, [No Value; LORENZ, H; KOTTHAUS, JP; BAKKER, S; KLAPWIJK, TM

    We report on far-infrared transmission measurements of an antidot superlattice in a stacked-gate silicon MOS device. The electrons in this antidot system are electrostatically confined below the metallic mesh of the bottom gate. Sweeping the top gate voltage allows to tune the electron system from a

  6. Cyanide Antidotes for Mass Casualties: Comparison of Intramuscular Injector by Autoinjector, Intraosseous Injection, and Inhalational Delivery

    Science.gov (United States)

    2015-12-01

    Public Release; Distribution Unlimited 13. SUPPLEMENTARY NOTES 14. ABSTRACT Current antidotes for cyanide poisoning must be administered by intravenous... Cyanide Poisoning ; Intramuscular Injection; Intraosseous Injection; Inhalational Delivery 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT...required in cyanide - poisoned victims, since they may be hypotensive with collapsed peripheral veins. Thus, intravenous antidote administration would not

  7. All optical detection of picosecond spin-wave dynamics in 2D annular antidot lattice

    Science.gov (United States)

    Porwal, Nikita; Mondal, Sucheta; Choudhury, Samiran; De, Anulekha; Sinha, Jaivardhan; Barman, Anjan; Datta, Prasanta Kumar

    2018-02-01

    Novel magnetic structures with precisely controlled dimensions and shapes at the nanoscale have potential applications in spin logic, spintronics and other spin-based communication devices. We report the fabrication of 2D bi-structure magnonic crystal in the form of embedded nanodots in a periodic Ni80Fe20 antidot lattice structure (annular antidot) by focused ion-beam lithography. The spin-wave spectra of the annular antidot sample, studied for the first time by a time-resolved magneto-optic Kerr effect microscopy show a remarkable variation with bias field, which is important for the above device applications. The optically induced spin-wave spectra show multiple modes in the frequency range 14.7 GHz-3.5 GHz due to collective interactions between the dots and antidots as well as the annular elements within the whole array. Numerical simulations qualitatively reproduce the experimental results, and simulated mode profiles reveal the spatial distribution of the spin-wave modes and internal magnetic fields responsible for these observations. It is observed that the internal field strength increases by about 200 Oe inside each dot embedded within the hole of annular antidot lattice as compared to pure antidot lattice and pure dot lattice. The stray field for the annular antidot lattice is found to be significant (0.8 kOe) as opposed to the negligible values of the same for the pure dot lattice and pure antidot lattice. Our findings open up new possibilities for development of novel artificial crystals.

  8. Antidote availability in the municipality of Campinas, São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Luciane Cristina Rodrigues Fernandes

    2017-03-01

    Full Text Available ABSTRACT CONTEXT AND OBJECTIVE: The lack of availability of antidotes in emergency services is a worldwide concern. The aim of the present study was to evaluate the availability of antidotes used for treating poisoning in Campinas (SP. DESIGN AND SETTING: This was a cross-sectional study of emergency services in Campinas, conducted in 2010-2012. METHODS: The availability, amount in stock, place of storage and access time for 26 antidotal treatments was investigated. In the hospitals, the availability of at least one complete treatment for a 70 kg adult over the first 24 hours of admission was evaluated based on stock and access recommendations contained in two international guidelines. RESULTS: 14 out of 17 functioning emergency services participated in the study, comprising pre-hospital services such as the public emergency ambulance service (SAMU; n = 1 and public emergency rooms for admissions lasting ≤ 24 hours (UPAs; n = 3, and 10 hospitals with emergency services. Six antidotes (atropine, sodium bicarbonate, diazepam, Phytomenadione, flumazenil and calcium gluconate were stocked in all the services, followed by 13 units that also stocked activated charcoal, naloxone and diphenhydramine or biperiden. No service stocked all of the recommended antidotes; only the regional Poison Control Center had stocks close to recommended (22/26 antidotal treatments. The 10 hospitals had almost half of the antidotes for starting treatments, but only one quarter of the antidotes was present with stocks sufficient for providing treatment for 24 hours. CONCLUSION: The stock of antidotes for attending poisoning emergencies in the municipality of Campinas is incomplete and needs to be improved.

  9. Evaluation of processed borax as antidote for aconite poisoning.

    Science.gov (United States)

    Sarkar, Prasanta Kumar; Prajapati, Pradeep K; Shukla, Vinay J; Ravishankar, Basavaiah

    2017-06-09

    Aconite root is very poisonous; causes cardiac arrhythmias, ventricular fibrillation and ventricular tachycardia. There is no specific antidote for aconite poisoning. In Ayurveda, dehydrated borax is mentioned for management of aconite poisoning. The investigation evaluated antidotal effect of processed borax against acute and sub-acute toxicity, cardiac toxicity and neuro-muscular toxicity caused by raw aconite. For acute protection Study, single dose of toxicant (35mg/kg) and test drug (22.5mg/kg and 112.5mg/kg) was administered orally, and then 24h survival of animals was observed. The schedule was continued for 30 days in sub-acute protection Study with daily doses of toxicant (6.25mg/kg), test drug (22.5mg/kg and 112.5mg/kg) and vehicle. Hematological and biochemical tests of blood and serum, histopathology of vital organs were carried out. The cardiac activity Study was continued for 30 days with daily doses of toxicant (6.25mg/kg), test drug (22.5mg/kg), processed borax solution (22.5mg/kg) and vehicle; ECG was taken after 1h of drug administration on 1 TB , 15th and on 30th day. For neuro-muscular activity Study, the leech dorsal muscle response to 2.5µg of acetylcholine followed by response of toxicant at 25µg and 50µg doses and then response of test drug at 25µg dose were recorded. Protection index indicates that treated borax gave protection to 50% rats exposed to the lethal dose of toxicant in acute protection Study. Most of the changes in hematological, biochemical parameters and histopathological Study induced by the toxicant in sub-acute protection Study were reversed significantly by the test drug treatment. The ventricular premature beat and ventricular tachyarrhythmia caused by the toxicant were reversed by the test drug indicate reversal of toxicant induced cardio-toxicity. The acetylcholine induced contractions in leech muscle were inhibited by toxicant and it was reversed by test drug treatment. The processed borax solution is found as an

  10. Density functional study of graphene antidot lattices: Roles of geometrical relaxation and spin

    DEFF Research Database (Denmark)

    Fürst, Joachim Alexander; Pedersen, Thomas Garm; Brandbyge, Mads

    2009-01-01

    Graphene sheets with regular perforations, dubbed as antidot lattices, have theoretically been predicted to have a number of interesting properties. Their recent experimental realization with lattice constants below 100 nanometers stresses the urgency of a thorough understanding of their electronic...

  11. Antidot density dependence of magnetization reversal dynamics in ultrathin epitaxial Fe/GaAs(001)

    International Nuclear Information System (INIS)

    Moore, T A; Wastlbauer, G; Bland, J A C; Cambril, E; Natali, M; Decanini, D; Chen, Y

    2004-01-01

    Easy axis dynamic magneto-optic Kerr effect loops have been measured from ultrathin (2 nm) epitaxial Fe/GaAs(001) films patterned with arrays of 1 μm square antidots of different densities (antidot spacings 10-50 μm). The applied field was sinusoidal with frequency f = 0.01 Hz-2.3 kHz. A study of dynamic coercivity H c * as a function of f reveals an intermediate dynamic regime (20 Hz c * that is suppressed at high antidot density. The dip is attributed to timescale matching of the sweeping applied field with the domain wall propagation in the film. Suppression of the dip is explained by an increase of domain nucleation in the higher antidot density films in the intermediate dynamic regime. (letter to the editor)

  12. A micromagnetic study of the hysteretic behavior of antidot Fe films

    International Nuclear Information System (INIS)

    Torres Bruna, J.M.; Bartolome, J.; Garcia Vinuesa, L.M.; Garcia Sanchez, F.; Gonzalez, J.M.; Chubykalo-Fesenko, O.A.

    2005-01-01

    We report on the results of a micromagnetic study of the magnetization reversal process taking place in square arrays of antidots lithographed in Fe thin films. Our study focuses on the influence on the reversal process of the antidot diameter and the distance between adjacent antidots. It is shown that the minimization of the dipolar energy term of the total system energy originates inhomogeneous moment distributions at the antidot surfaces, and that these structures and their coupling rule the reversal process. We also show that the variation of the interantidot distance in the range of a few units of the exchange length allows varying the coercive force value by a factor of four approximately

  13. Vortices trapped in the damaged surroundings of antidots in Nb films - Depinning transition

    International Nuclear Information System (INIS)

    Nunes-Kapp, J.S.; Zadorosny, R.; Oliveira, A.A.M.; Vaz, A.R.; Moshkalev, S.A.; Lepienski, M.; Ortiz, W.A.

    2010-01-01

    The depinning transition of Vortex Matter in the presence of antidots in superconducting Nb films has been investigated. The antidots were fabricated using two different techniques, resulting in samples with arrays of diverse pinning efficiency. At low temperatures and fields, the spatial arrangement of Vortex Matter is governed by the presence of the antidots. Keeping the temperature fixed, an increase of the field induces a depinning transition. As the temperature approaches T c , the depinning frontier exhibits a characteristic kink at the temperature T k , above which the phase boundary exhibits a different regime. The lower-temperature regime is adequately described by a power-law expression, whose exponent n was observed to be inversely proportional to the pinning capability of the antidot, a feature that qualifies this parameter as a figure of merit to quantify the pinning strength of the defect.

  14. Vortices trapped in the damaged surroundings of antidots in Nb films - Depinning transition

    Energy Technology Data Exchange (ETDEWEB)

    Nunes-Kapp, J.S. [Grupo de Supercondutividade e Magnetismo, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil); Faculdade de Tecnologia SENAI ' Antonio Adolpho Lobbe' , Sao Carlos, SP (Brazil); Zadorosny, R.; Oliveira, A.A.M. [Grupo de Supercondutividade e Magnetismo, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil); Vaz, A.R.; Moshkalev, S.A. [Centro de Componentes Semicondutores, UNICAMP, Campinas, SP (Brazil); Lepienski, M. [Departamento de Fisica, Universidade Federal do Parana, Curitiba, PR (Brazil); Ortiz, W.A., E-mail: wortiz@df.ufscar.b [Grupo de Supercondutividade e Magnetismo, Departamento de Fisica, Universidade Federal de Sao Carlos, Sao Carlos, SP (Brazil)

    2010-10-01

    The depinning transition of Vortex Matter in the presence of antidots in superconducting Nb films has been investigated. The antidots were fabricated using two different techniques, resulting in samples with arrays of diverse pinning efficiency. At low temperatures and fields, the spatial arrangement of Vortex Matter is governed by the presence of the antidots. Keeping the temperature fixed, an increase of the field induces a depinning transition. As the temperature approaches T{sub c}, the depinning frontier exhibits a characteristic kink at the temperature T{sub k}, above which the phase boundary exhibits a different regime. The lower-temperature regime is adequately described by a power-law expression, whose exponent n was observed to be inversely proportional to the pinning capability of the antidot, a feature that qualifies this parameter as a figure of merit to quantify the pinning strength of the defect.

  15. Effective tunneling processes in an interferometer of helical edge states with an antidot

    Science.gov (United States)

    Rizzo, Bruno; Camjayi, Alberto; Arrachea, Liliana

    2014-12-01

    We consider an interferometer of edge states of a two-dimensional topological insulator with an antidot. We analyze the mechanisms leading to an effective tunneling with spin flip between different helical states.

  16. Gastroprotective effects of novel antidotal combination in rats acutely poisoned by T-2 toxin

    OpenAIRE

    Jaćević Vesna; Resanović Radmila; Bočarov-Stančić Aleksandra; Đorđević Snežana; Dragojević-Simić Viktorija; Vukajlović Ana; Bokonjić D.

    2010-01-01

    The purpose of this experiment was to evaluate the antidotal potencies of methylprednisolone (soluble form, Lemod-solu®), nimesulide, N-acetylcysteine (Fluimucil®) and their combinations in rats treated with 1.0 LD50 (0.23 mg/kg) of trichothecene mycotoxin, T-2 toxin. Their antidotal efficacy was investigated by monitoring their effects on general condition, 24-hour-survival, body weight gain, food and water consumption and pathohistological changes in the ...

  17. Designed defects in 2D antidot lattices for quantum information processing

    DEFF Research Database (Denmark)

    Pedersen, Jesper Goor; Flindt, Christian; Mortensen, Niels Asger

    2008-01-01

    We propose a new physical implementation of spin qubits for quantum information processing, namely defect states in antidot lattices defined in the two-dimensional electron gas (2DEG) at a semiconductor heterostructure. Calculations of the band structure of a periodic antidot lattice are presente....... We find results reminiscent of double quantum dot structures, indicating that the suggested structure is a feasible physical implementation of spin qubits....

  18. Antidotes for poisoning by alcohols that form toxic metabolites.

    Science.gov (United States)

    McMartin, Kenneth; Jacobsen, Dag; Hovda, Knut Erik

    2016-03-01

    The alcohols, methanol, ethylene glycol and diethylene glycol, have many features in common, the most important of which is the fact that the compounds themselves are relatively non-toxic but are metabolized, initially by alcohol dehydrogenase, to various toxic intermediates. These compounds are readily available worldwide in commercial products as well as in homemade alcoholic beverages, both of which lead to most of the poisoning cases, from either unintentional or intentional ingestion. Although relatively infrequent in overall occurrence, poisonings by metabolically-toxic alcohols do unfortunately occur in outbreaks and can result in severe morbidity and mortality. These poisonings have traditionally been treated with ethanol since it competes for the active site of alcohol dehydrogenase and decreases the formation of toxic metabolites. Although ethanol can be effective in these poisonings, there are substantial practical problems with its use and so fomepizole, a potent competitive inhibitor of alcohol dehydrogenase, was developed for a hopefully better treatment for metabolically-toxic alcohol poisonings. Fomepizole has few side effects and is easy to use in practice and it may obviate the need for haemodialysis in some, but not all, patients. Hence, fomepizole has largely replaced ethanol as the toxic alcohol antidote in many countries. Nevertheless, ethanol remains an important alternative because access to fomepizole can be limited, the cost may appear excessive, or the physician may prefer ethanol due to experience. © 2015 The British Pharmacological Society.

  19. Activated charcoal for pediatric poisonings: the universal antidote?

    Science.gov (United States)

    Lapus, Robert Michael

    2007-04-01

    For decades, activated charcoal has been used as a 'universal antidote' for the majority of poisons because of its ability to prevent the absorption of most toxic agents from the gastrointestinal tract and enhance the elimination of some agents already absorbed. This manuscript will review the history of activated charcoal, its indications, contraindications, and the complications associated with its use as reported in the literature. Recent randomized prospective studies, although with small numbers, have shown no difference in length of hospital stay, morbidity, and mortality between groups who received and did not receive activated charcoal. No study has had sufficient numbers to satisfactorily address clinical outcome in patients who received activated charcoal less than 1 h following ingestion. If used appropriately, activated charcoal has relatively low morbidity. Due to the lack of definitive studies showing a benefit in clinical outcome, it should not be used routinely in ingestions. AC could be considered for patients with an intact airway who present soon after ingestion of a toxic or life-threatening dose of an adsorbable toxin. The appropriate use of activated charcoal should be determined by the analysis of the relative risks and benefits of its use in each specific clinical scenario.

  20. Do gastric contents modify antidotal efficacy of oral activated charcoal?

    Science.gov (United States)

    Olkkola, K T; Neuvonen, P J

    1984-01-01

    The effect of food on the antidotal efficacy of activated charcoal was studied in six healthy volunteers, who ingested aspirin 1000 mg, mexiletine 200 mg and tolfenamic acid 400 mg in a randomized cross-over study. Activated charcoal 25 g, suspended in water, was administered 5 min or 60 min after the drugs were taken on an empty stomach or after a standard meal. The serum concentrations and the cumulative excretion into urine of the drugs were followed for 48 h. When the drugs were taken on an empty stomach, activated charcoal given 5 min or 60 min afterwards reduced the bioavailability of the drugs by 75-98% or 10-60%, respectively. Food moderately weakened the effect of activated charcoal administered 5 min after the drugs, but when the charcoal was given 1 h later the effect was still practically the same, the reduction of absorption varying in both cases in the range of 45-85%. Thus the efficacy of charcoal given 60 min after the drugs was better after a standard meal than on an empty stomach. Presence of food in the stomach of patients with drug overdosage modifies the efficacy of activated charcoal and gives it more time to adsorb drugs in the gastrointestinal canal, possibly by slowing gastric emptying rate. PMID:6508975

  1. Intraosseous Administration of Antidotes in the Chemical Weapons Victim - An Alternative to the Intravenous Route

    International Nuclear Information System (INIS)

    Borron, S. W.; Arias, J. C.

    2007-01-01

    Hazardous materials paradigms call for definitive treatment of chemical victims to begin in the 'warm zone' during decontamination. This delay may result in lethal outcomes, particularly in the case of multiple victims, where rescue may be delayed due to insufficient numbers of rescue teams. It is virtually impossible for rescuers in full protective gear to establish intravenous lines. In recent years, significant advances have been made in intraosseous (IO) infusion devices. An IO device developed in our institution, the EZ-IO, is very easily placed by rescuers in typical work uniforms. IO placement takes longer while in protective gear, but is feasible. The IO is equivalent to an intravenous line, allowing more rapid administration of antidotes in the event of chemical mass casualties. Antidotes not amenable to intramuscular administration and even those often given IM may be more effective given IO. IO administration has the following possible advantages over intravenous or intramuscular antidote administration: 1. Drugs administered IO reach the vascular system virtually instantaneously. 2. IO administration may be performed in protective clothing and could theoretically be employed while awaiting rescue. 3. IO administration may be preferred over intravenous administration in the warm zone. In summary, IO administration of antidotes should be further evaluated for use in chemical disasters. The ease and speed of placement, ready access to the vascular tree, and potential for earlier intervention make it a potentially ideal means of vascular access and antidotal administration in the mass casualty situation. (author)

  2. [Recommendations for stocking and using antidotes in hospitals of varying levels of complexity].

    Science.gov (United States)

    Aguilar-Salmerón, Raquel; Martínez-Sánchez, Lídia; Broto-Sumalla, Antoni; Fernández de Gamarra-Martínez, Edurne; García-Pelaéz, Milagros; Nogué-Xarau, Santiago

    2016-02-01

    The stocking of antidotes in various care settings is a subject of debate. A group of experts in hospital pharmacy and both adult and pediatric clinical toxicology was formed to review the Spanish and international literature on the subject with the aim of updating recommendations about which antidotes to stock and in what amounts in hospitals of different levels of complexity. The experts also considered the usual indications for the use of antidotes and dosing. The amount to have on hand was defined as enough to treat an adult weighing 70 kg for 24 hours (or 3 such adults in an A-level hospital; ie, a highly complex center or the reference hospital for an area). The group also listed 34 antidotes that B-level hospitals should stock and 22 that other types of hospital should stock. The recommendations also provide a guide for using the antidotes in the forms of presentation available in Spain in 2015, a list of their main indications and recommended doses, and specific notes on each.

  3. Ethylene glycol or methanol intoxication: which antidote should be used, fomepizole or ethanol?

    Science.gov (United States)

    Rietjens, S J; de Lange, D W; Meulenbelt, J

    2014-02-01

    Ethylene glycol (EG) and methanol poisoning can cause life-threatening complications. Toxicity of EG and methanol is related to the production of toxic metabolites by the enzyme alcohol dehydrogenase (ADH), which can lead to metabolic acidosis, renal failure (in EG poisoning), blindness (in methanol poisoning) and death. Therapy consists of general supportive care (e.g. intravenous fluids, correction of electrolytes and acidaemia), the use of antidotes and haemodialysis. Haemodialysis is considered a key element in the treatment of severe EG and methanol intoxication and is aimed at removing both the parent compound and its toxic metabolites, reducing the duration of antidotal treatment and shortening the hospital observation period. Currently, there are two antidotes used to block ADH-mediated metabolism of EG and methanol: ethanol and fomepizole. In this review, the advantages and disadvantages of both antidotes in terms of efficacy, safety and costs are discussed in order to help the physician to decide which antidote is appropriate in a specific clinical setting.

  4. Hydroxocobalamin as a Cyanide Antidote: Empirical use , Safety, Efficacy, and Considerations for Stockpiling

    International Nuclear Information System (INIS)

    Hall, A. H.

    2007-01-01

    Cyanide is a well-known toxic terrorism agent and is a major cause of mortality and morbidity in smoke inhalation victims. Terrorist attacks could start enclosed-space fires with cyanide-poisoned victims, even if cyanide itself was not utilized. Cyanide poisoning cannot be emergent confirmed by laboratory analysis and treatment with safe and efficacious antidotes must be administered empirically. Hydroxocobalamin has been recently approved by the US FDA and is a safe and efficacious antidote. Its efficacy is comparable to that of other, more toxic, cyanide antidotes. Its mechanism of action involves both direct cyanide chelation (forming non-toxic cyanocobalamin which is excreted in the urine) and nitric oxide scavenging. Adverse effects are usually limited to transient dark red-brown discoloration of urine, skin, sclera, and mucous membranes. Antidotal doses have not caused allergic reactions in cyanide-poisoned patients and only minor and easily-treated allergic reactions occurred in 2 of 136 normal volunteers. Transient, asymptomatic hypertension and reflex bradycardia have occurred in some normal volunteers, but not in seriously ill smoke inhalation victims not having significant cyanide poisoning. Hydroxocobalamin is a safe and efficacious antidote and can be empirically administered in pre-hospital or emergency department settings. It is therefore suitable for inclusion in national or multinational medication stockpiles and is already included in some national programs in the European Union.(author)

  5. The Copernican Revolution as Story: an Antidote for Scientific Illiteracy

    Science.gov (United States)

    Wallace, P. M.

    2005-08-01

    ``When a white-robed scientist, momentarily looking away from his microscope or cyclotron [or telescope], makes some pronouncement for the general public, he may not be understood but at least he is certain to be believed.'' The truth of this opening sentence of Anthony Standen's 1950 book Science is a Sacred Cow, as clear today as it was then, is the motivation for a new astronomy course at Berry College near Atlanta, GA, USA. To non-scientists, science is known by its products, not by what it is: a human progress. For this illiteracy an antidote is offered: the history of astronomy. In this course the story of the Copernican Revolution is told, for within this story the true nature of science can be found in its fullness. For example, Aristotle's uniform circular motion is used to emphasize the role of assumptions, and the occasional value of wrong ideas is evident in Tycho's theory and in Kepler's universe of perfect solids. Tycho's observations of Mars and Kepler's analysis illustrate the interplay of observation, theory, and technology. As a final example, the indirectness and often-unintentional nature of scientific advance can be seen in the work of Copernicus. The roles of personality and the intersections of science and society are themes throughout the course, as are the merging of disparate fields and the power of strong theories. There are other themes (e.g., coherence, the role of mathematics), but the emphasis is on the science and much of the work is quantitative. There is a laboratory component that features observations and experiments, and in order to bring the narrative to life the class spends two weeks in Poland, the Czech Republic, and Italy, touring sites that are relevant to the story of the Copernican Revolution.

  6. Rapid Complexation of Aptamers by Their Specific Antidotes

    Directory of Open Access Journals (Sweden)

    Heidi Stoll

    2017-06-01

    Full Text Available Nucleic acid ligands, aptamers, harbor the unique characteristics of small molecules and antibodies. The specificity and high affinity of aptamers enable their binding to different targets, such as small molecules, proteins, or cells. Chemical modifications of aptamers allow increased bioavailability. A further great benefit of aptamers is the antidote (AD-mediated controllability of their effect. In this study, the AD-mediated complexation and neutralization of the thrombin binding aptamer NU172 and Toll-like receptor 9 (TLR9 binding R10-60 aptamer were determined. Thereby, the required time for the generation of aptamer/AD-complexes was analyzed at 37 °C in human serum using gel electrophoresis. Afterwards, the blocking of aptamers’ effects was analyzed by determining the activated clotting time (ACT in the case of the NU172 aptamer, or the expression of immune activation related genes IFN-1β, IL-6, CXCL-10, and IL-1β in the case of the R10-60 aptamer. Gel electrophoresis analyses demonstrated the rapid complexation of the NU172 and R10-60 aptamers by complementary AD binding after just 2 min of incubation in human serum. A rapid neutralization of anticoagulant activity of NU172 was also demonstrated in fresh human whole blood 5 min after addition of AD. Furthermore, the TLR9-mediated activation of PMDC05 cells was interrupted after the addition of the R10-60 AD. Using these two different aptamers, the rapid antagonizability of the aptamers was demonstrated in different environments; whole blood containing numerous proteins, cells, and different small molecules, serum, or cell culture media. Thus, nucleic acid ADs are promising molecules, which offer several possibilities for different in vivo applications, such as antagonizing aptamer-based drugs, immobilization, or delivery of oligonucleotides to defined locations.

  7. Monitoring the Effects and Antidotes of the Non-vitamin K Oral Anticoagulants

    DEFF Research Database (Denmark)

    Rahmat, Nur A; Lip, Gregory Y H

    2015-01-01

    In the last decade, we have witnessed the emergence of the oral non-vitamin K oral anticoagulants (NOACs), which have numerous advantages compared with the vitamin K antagonists, particularly their lack of need for monitoring; as a result their use is increasing. Nonetheless, the NOACs face two...... major challenges: the need for reliable laboratory assays to assess their anticoagulation effect, and the lack of approved antidotes to reverse their action. This article provides an overview of monitoring the anticoagulant effect of NOACs and their potential specific antidotes in development....

  8. Anomalous giant piezoresistance in AlAs 2D electron systems with antidot lattices.

    Science.gov (United States)

    Gunawan, O; Gokmen, T; Shkolnikov, Y P; De Poortere, E P; Shayegan, M

    2008-01-25

    An AlAs two-dimensional electron system patterned with an antidot lattice exhibits a giant piezoresistance effect at low temperatures, with a sign opposite to the piezoresistance observed in the unpatterned region. We suggest that the origin of this anomalous giant piezoresistance is the nonuniform strain in the antidot lattice and the exclusion of electrons occupying the two conduction-band valleys from different regions of the sample. This is analogous to the well-known giant magnetoresistance effect, with valley playing the role of spin and strain the role of magnetic field.

  9. Ferromagnetic resonance investigation in permalloy magnetic antidot arrays on alumina nanoporous membranes

    Energy Technology Data Exchange (ETDEWEB)

    Rodríguez-Suárez, R.L., E-mail: rrodriguez@fis.puc.cl [Facultad de Física, Pontificia Universidad Católica de Chile, Av. Vicuña Mackenna 4860 Casilla 306, Santiago (Chile); Palma, J.L.; Burgos, E.O. [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Michea, S. [Facultad de Física, Pontificia Universidad Católica de Chile, Av. Vicuña Mackenna 4860 Casilla 306, Santiago (Chile); Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Escrig, J.; Denardin, J.C. [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Center for the Development of Nanoscience and Nanotechnology (CEDENNA), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Aliaga, C. [Center for the Development of Nanoscience and Nanotechnology (CEDENNA), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Facultad de Química y Biología, Universidad de Santiago de Chile, Casilla 40, Correo 33, Santiago (Chile)

    2014-01-15

    The magnetic properties of Ni{sub 80}Fe{sub 20} antidot arrays with hole diameters of 18 and 70 nm fabricated by a template-assisted method were investigated using the ferromagnetic resonance technique. Tuning the antidot arrays by changing the hole diameter enables control on the angular dependence of the ferromagnetic resonance field. The scanning electron microscope images reveal a quite regular hexagonal arrangement of the pores, however the angular dependence of the resonance field do not exhibit the six-fold symmetry expected for this symmetry. Micromagnetic simulations performed on a perfect hexagonal lattice, when compared with those made on our real system taken from the scanning microscope images, reveal that the presence of defects in the antidot lattice affects the ferromagnetic resonance field symmetry. - Highlights: • We use the FMR technique to investigate the magnetic properties of Py antidots. • We studied the effect of pore diameter on FMR angular measurement. • FMR field does not exhibit the six-fold symmetry. • For all angular positions there are two resonance modes always present. • Micromagnetic simulations agree with the experimental results with defects.

  10. Quaternary and tertiary aldoxime antidotes for organophosphate exposure in a zebrafish model system

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, Hayden R. [Department of Biology, Whittier College, Whittier, CA 90608 (United States); Radić, Zoran; Taylor, Palmer [Department of Pharmacology, Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California at San Diego, La Jolla, CA 92093-0650 (United States); Fradinger, Erica A., E-mail: efrading@whittier.edu [Department of Biology, Whittier College, Whittier, CA 90608 (United States)

    2015-04-15

    The zebrafish is rapidly becoming an important model system for screening of new therapeutics. Here we evaluated the zebrafish as a potential pharmacological model for screening novel oxime antidotes to organophosphate (OP)-inhibited acetylcholinesterase (AChE). The k{sub i} values determined for chlorpyrifos oxon (CPO) and dichlorvos (DDVP) showed that CPO was a more potent inhibitor of both human and zebrafish AChE, but overall zebrafish AChE was less sensitive to OP inhibition. In contrast, aldoxime antidotes, the quaternary ammonium 2-PAM and tertiary amine RS-194B, showed generally similar overall reactivation kinetics, k{sub r}, in both zebrafish and human AChE. However, differences between the K{sub ox} and k{sub 2} constants suggest that zebrafish AChE associates more tightly with oximes, but has a slower maximal reactivation rate than human AChE. Homology modeling suggests that these kinetic differences result from divergences in the amino acids lining the entrance to the active site gorge. Although 2-PAM had the more favorable in vitro reactivation kinetics, RS-194B was more effective antidote in vivo. In intact zebrafish embryos, antidotal treatment with RS-194B rescued embryos from OP toxicity, whereas 2-PAM had no effect. Dechorionation of the embryos prior to antidotal treatment allowed both 2-PAM and RS-194B to rescue zebrafish embryos from OP toxicity. Interestingly, RS-194B and 2-PAM alone increased cholinergic motor activity in dechorionated embryos possibly due to the reversible inhibition kinetics, K{sub i} and αK{sub i}, of the oximes. Together these results demonstrate that the zebrafish at various developmental stages provides an excellent model for investigating membrane penetrant antidotes to OP exposure. - Highlights: • Zebrafish AChE shares significant structural similarities with human AChE. • OP-inhibited zebrafish and human AChE exhibit similar reactivation kinetics. • The zebrafish chorion is permeable to BBB penetrant and not

  11. An All-Hazards Approach to Antidotal Therapy in Cyanide Poisoning

    International Nuclear Information System (INIS)

    Borron, S. W.; Arias, J. C.

    2007-01-01

    In recent years in the USA, increased emphasis has been placed on utilizing an 'all-hazards approach' in the development and testing of disaster plans. Disaster plans developed in this way should prepare the community to deal with a wide variety of natural and man-made emergencies, both anticipated and unanticipated in etiology. The basic approach in each disaster remains the same, with adaptation as necessary to deal with specific threats. Such an approach 'enables communities to be prepared to manage any number or type of emergencies. It facilitates prevention, preparation, response, and recovery, based on the broad scope of what could happen within and beyond the community.' (JCAHO) An all-hazards approach appears to have merit as well in the selection of antidotes for mass casualty use. Using cyanide as an example, we examine several criteria which permit a disaster preparedness entity to choose among available cyanide antidotes to permit the broadest application possible in the context of a cyanide-related chemical emergency. These criteria include: source of exposure, efficacy, safety (in the presence and absence of poisoning), safety in adults and children, ease of administration, conditions for storage and maintenance, stock rotation, and cost. The greatest limitation to the all-hazards approach in antidote selection is geographic availability. Because of the high cost of regulatory approval and historical protectionism / preferences by governments, certain regions may have little or no choice in the selection of antidotes. Hydroxocobalamin appears to best meet the requirements of an 'all-hazards' antidote for cyanide.(author)

  12. Patterns of cyanide antidote use since regulatory approval of hydroxocobalamin in the United States.

    Science.gov (United States)

    Streitz, Matthew J; Bebarta, Vikhyat S; Borys, Douglas J; Morgan, David L

    2014-01-01

    Sodium nitrite and sodium thiosulfate are common cyanide antidotes. Hydroxocobalamin was approved for use in the United States in 2006. Our objective was to determine the frequency of antidote use as reported to the US poison centers from 2005 to 2009 and describe which antidotes were used in critically ill cyanide toxic patients. We performed a retrospective review over 5 years (2005-2009) from 61 US poison centers. We identified all cyanide-exposed cases that received a cyanide antidote. Variables collected included demographics, gastric decontamination, antidote used, predefined serious clinical effects (hypotension, cardiac arrest, respiratory arrest, and coma), and predefined serious therapies (cardiopulmonary resuscitation, vasopressors, atropine, anticonvulsant, antidysrhythmic, and intubation/ventilation). One trained abstractor abstracted each chart to a standardized electronic form. Another investigator audited 20% of the charts. Kappa values were calculated. One hundred sixty-five exposures were identified. Mean age was 42 years (range, 3-93 years). Seventy-one percent were male. Exposures were 27% ingestion and 53% inhalation. Thirty-two percent of the ingestions were suicide attempts. Twenty percent (32 of 157) of all cases died. Over all years reported, hydroxocobalamin was administered to 29% (45 of 157) of patients, sodium nitrite to 25%, and sodium thiosulfate to 46%. Hydroxocobalamin use increased from 24% to 54% from 2007 to 2009, respectively (P = 0.024). Sodium thiosulfate use decreased from 73% to 31% (P = 0.002) and sodium nitrite use decreased from 26% to 14% (P = 0.39). The proportion of cases with serious clinical effects that received hydroxocobalamin increased each year, and the proportion that received other antidotes decreased. Hydroxocobalamin was also administered more often in cases that required serious therapies and increased each year. Hydroxocobalamin use for cyanide toxicity increased each year as reported to the US poison

  13. Seven years of cyanide ingestions in the USA: critically ill patients are common, but antidote use is not.

    Science.gov (United States)

    Bebarta, Vikhyat S; Pitotti, Rebecca L; Borys, Doug J; Morgan, David L

    2011-02-01

    Cyanide is a common toxin in structural fires and a salt that is ingested for suicide. However, most studies have focused on the effects of inhaled cyanide. The objective of this study was to describe the incidence of cyanide ingestions, symptoms, cardiac arrest and antidotal therapy used as reported to all US poison centres over 7 years. A retrospective review of cases over 7 years as reported to 61 poison centres in the USA was performed. Sole ingestions of cyanide were identified. A trained reviewer used a standard data collection sheet within a secured electronic database. Age, intent, clinical effects, treatments, antidotes and outcomes were recorded. One investigator audited a random sample of charts. Out of 1741 exposures, 435 ingestions were identified. Most were male (68%) and the mean age was 34 years (range 1 month-83 years). 45% of cases were intentional, most commonly as a suicide attempt. 8.3% of cases died and 9% (38/435) of patients had cardiac arrest or hypotension. 13% of all cases and 26% of cases arriving at a healthcare facility received an antidote. In 35% of cases of cardiac arrest or hypotension, and in 74% of intentional ingestions, antidotes were not given. Suicide attempt was the most common reason for cyanide ingestion. Most of these patients died. Cardiac arrest or hypotension was common, but antidote use was not, particularly in critically ill patients. Research is needed to improve outcomes of cyanide-induced hypotension and cardiac arrest and to reduce barriers to antidote use.

  14. Magnetic properties of Fe{sub 20} Ni{sub 80} antidots: Pore size and array disorder

    Energy Technology Data Exchange (ETDEWEB)

    Palma, J.L., E-mail: juan.palma.s@usach.cl [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Gallardo, C. [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Spinu, L.; Vargas, J.M. [Advanced Material Research Institute (AMRI) and Department of Physics, University of New Orleans, New Orleans, LA 70148 (United States); Dorneles, L.S. [Departamento de Fisica, Universidade Federal de Santa Maria UFSM, Av. Roraima 1000, Camobi, Santa Maria, RS 97105-900 (Brazil); Denardin, J.C.; Escrig, J. [Departamento de Física, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Center for the Development of Nanoscience and Nanotechnology (CEDENNA), Avda. Ecuador 3493, 917-0124 Santiago (Chile)

    2013-10-15

    Magnetic properties of nanoscale Fe{sub 20}Ni{sub 80} antidot arrays with different hole sizes prepared on top of nanoporous alumina membranes have been studied by means of magnetometry and micromagnetic simulations. The results show a significant increase of the coercivity as well as a reduction of the remanence of the antidot arrays, as compared with their parent continuous film, which depends on the hole size introduced in the Fe{sub 20}Ni{sub 80} thin film. When the external field is applied parallel to the antidots, the reversal of magnetization is achieved by free-core vortex propagation, whereas when the external field is applied perpendicular to the antidots, the reversal occurs through a process other than the coherent rotation (a maze-like pattern). Besides, in-plane hysteresis loops varying the angle show that the degree of disorder in the sample breaks the expected hexagonal symmetry. - Highlights: • Magnetic properties are strongly influenced by the pore diameter of the samples. • Coercive fields for antidots are higher than the values for the continuous film. • Disorder breaks the hexagonal symmetry of the sample. • Each hole acts as a vortex nucleation point. • Antidots have unique properties that allow them to be used in applications.

  15. Edge structures and properties of triangular antidots in single-layer MoS2

    KAUST Repository

    Gan, Li Yong

    2016-08-30

    Density functional theory and experiments are employed to shed light on the edge structures of antidots in O etched single-layer MoS2. The equilibrium morphology is found to be the zigzag Mo edge with each Mo atom bonded to two O atoms, in a wide range of O chemical potentials. Scanning electron microscopy shows that the orientation of the created triangular antidots is opposite to the triangular shape of the single-layer MoS2 samples, in agreement with the theoretical predictions. Furthermore, edges induced by O etching turn out to be p-doped, suggesting an effective strategy to realize p-type MoS2 devices. Published by AIP Publishing.

  16. Angle-resolved spin wave band diagrams of square antidot lattices studied by Brillouin light scattering

    Energy Technology Data Exchange (ETDEWEB)

    Gubbiotti, G.; Tacchi, S. [Istituto Officina dei Materiali del Consiglio Nazionale delle Ricerche (IOM-CNR), Sede di Perugia, c/o Dipartimento di Fisica e Geologia, Via A. Pascoli, I-06123 Perugia (Italy); Montoncello, F.; Giovannini, L. [Dipartimento di Fisica e Scienze della Terra, Università di Ferrara, Via G. Saragat 1, I-44122 Ferrara (Italy); Madami, M.; Carlotti, G. [Dipartimento di Fisica e Geologia, Università di Perugia, Via A. Pascoli, I-06123 Perugia (Italy); Ding, J.; Adeyeye, A. O. [Information Storage Materials Laboratory, Department of Electrical and Computer Engineering, National University of Singapore, Singapore 117576 (Singapore)

    2015-06-29

    The Brillouin light scattering technique has been exploited to study the angle-resolved spin wave band diagrams of squared Permalloy antidot lattice. Frequency dispersion of spin waves has been measured for a set of fixed wave vector magnitudes, while varying the wave vector in-plane orientation with respect to the applied magnetic field. The magnonic band gap between the two most dispersive modes exhibits a minimum value at an angular position, which exclusively depends on the product between the selected wave vector magnitude and the lattice constant of the array. The experimental data are in very good agreement with predictions obtained by dynamical matrix method calculations. The presented results are relevant for magnonic devices where the antidot lattice, acting as a diffraction grating, is exploited to achieve multidirectional spin wave emission.

  17. Antidotes to coumarins, isoniazid, methotrexate and thyroxine, toxins that work via metabolic processes.

    Science.gov (United States)

    Bateman, D Nicholas; Page, Colin B

    2016-03-01

    Some toxins cause their effects by affecting physiological processes that are fundamental to cell function or cause systemic effects as a result of cellular interaction. This review focuses on four examples, coumarin anticoagulants, isoniazid, methotrexate and thyroxine from the context of management of overdose as seen in acute general hospitals. The current basic clinical pharmacology of the toxin, the clinical features in overdose and evidence base for specific antidotes are discussed. The treatment for this group is based on an understanding of the toxic mechanism, but studies to determine the optimum dose of antidote are still required in all these toxins except thyroxine, where treatment dose is based on symptoms resulting from the overdose. © 2015 The British Pharmacological Society.

  18. Edge structures and properties of triangular antidots in single-layer MoS{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Gan, Li-Yong, E-mail: ganly@swjtu.edu.cn, E-mail: iamyccheng@njtech.edu.cn, E-mail: udo.schwingenschlogl@kaust.edu.sa [Key Laboratory of Advanced Technology of Materials (Ministry of Education), Superconductivity and New Energy R& D Center, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); Cheng, Yingchun, E-mail: ganly@swjtu.edu.cn, E-mail: iamyccheng@njtech.edu.cn, E-mail: udo.schwingenschlogl@kaust.edu.sa; Huang, Wei [Key Laboratory of Flexible Electronics (KLOFE) and Institute of Advanced Materials (IAM), Jiangsu National Synergetic Innovation Center for Advanced Materials - SICAM, Nanjing Tech University - NanjingTech, 30 South Puzhu Road, Nanjing 211816 (China); Schwingenschlögl, Udo, E-mail: ganly@swjtu.edu.cn, E-mail: iamyccheng@njtech.edu.cn, E-mail: udo.schwingenschlogl@kaust.edu.sa [Physical Science and Engineering Division (PSE), King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia); Yao, Yingbang [Advanced Nanofabrication and Imaging Core Lab, King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia); School of Materials and Energy, Guangdong University of Technology, Guangdong 510006 (China); Zhao, Yong [Key Laboratory of Advanced Technology of Materials (Ministry of Education), Superconductivity and New Energy R& D Center, Southwest Jiaotong University, Chengdu, Sichuan 610031 (China); School of Physical Science and Technology, Southwest Jiaotong University, Chengdu, 610031 Sichuan (China); Zhang, Xi-xiang [Physical Science and Engineering Division (PSE), King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia); Advanced Nanofabrication and Imaging Core Lab, King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia)

    2016-08-29

    Density functional theory and experiments are employed to shed light on the edge structures of antidots in O etched single-layer MoS{sub 2}. The equilibrium morphology is found to be the zigzag Mo edge with each Mo atom bonded to two O atoms, in a wide range of O chemical potentials. Scanning electron microscopy shows that the orientation of the created triangular antidots is opposite to the triangular shape of the single-layer MoS{sub 2} samples, in agreement with the theoretical predictions. Furthermore, edges induced by O etching turn out to be p-doped, suggesting an effective strategy to realize p-type MoS{sub 2} devices.

  19. Aluminum phosphide poisoning: Possible role of supportive measures in the absence of specific antidote.

    Science.gov (United States)

    Agrawal, Vijay Kumar; Bansal, Abhishek; Singh, Ranjeet Kumar; Kumawat, Bhanwar Lal; Mahajan, Parul

    2015-02-01

    Aluminum phosphide (ALP) poisoning is one of the major causes of suicidal deaths. Toxicity by ALP is caused by the liberation of phosphine gas, which rapidly causes cell hypoxia due to inhibition of oxidative phosphorylation, leading to circulatory failure. Treatment of ALP toxicity is mainly supportive as there is no specific antidote. We recently managed 7 cases of ALP poisoning with severe hemodynamic effects. Patients were treated with supportive measures including gastric lavage with diluted potassium permanganate, coconut oil and sodium-bicarbonate first person account should be avoided in a scientific paper. Intravenous magnesium sulfate, proper hemodynamic monitoring and vasopressors. Four out of 7 survived thus suggesting a role of such supportive measures in the absence of specific antidote for ALP poisoning.

  20. Nitrocobinamide, a new cyanide antidote that can be administered by intramuscular injection.

    Science.gov (United States)

    Chan, Adriano; Jiang, Jingjing; Fridman, Alla; Guo, Ling T; Shelton, G Diane; Liu, Ming-Tao; Green, Carol; Haushalter, Kristofer J; Patel, Hemal H; Lee, Jangwoen; Yoon, David; Burney, Tanya; Mukai, David; Mahon, Sari B; Brenner, Matthew; Pilz, Renate B; Boss, Gerry R

    2015-02-26

    Currently available cyanide antidotes must be given by intravenous injection over 5-10 min, making them ill-suited for treating many people in the field, as could occur in a major fire, an industrial accident, or a terrorist attack. These scenarios call for a drug that can be given quickly, e.g., by intramuscular injection. We have shown that aquohydroxocobinamide is a potent cyanide antidote in animal models of cyanide poisoning, but it is unstable in solution and poorly absorbed after intramuscular injection. Here we show that adding sodium nitrite to cobinamide yields a stable derivative (referred to as nitrocobinamide) that rescues cyanide-poisoned mice and rabbits when given by intramuscular injection. We also show that the efficacy of nitrocobinamide is markedly enhanced by coadministering sodium thiosulfate (reducing the total injected volume), and we calculate that ∼1.4 mL each of nitrocobinamide and sodium thiosulfate should rescue a human from a lethal cyanide exposure.

  1. Antidote treatment for cyanide poisoning with hydroxocobalamin causes bright pink discolouration and chemical-analytical interferences.

    Science.gov (United States)

    Brunel, C; Widmer, C; Augsburger, M; Dussy, F; Fracasso, T

    2012-11-30

    Here we report the case of a 70-year-old woman who committed suicide by cyanide poisoning. During resuscitation cares, she underwent an antidote treatment by hydroxocobalamin. Postmortem investigations showed marked bright pink discolouration of organs and fluids, and a lethal cyanide blood concentration of 43 mg/L was detected by toxicological investigation. Discolouration of hypostasis and organs has widely been studied in forensic literature. In our case, we interpreted the unusual pink coloration as the result of the presence of hydroxocobalamin. This substance is a known antidote against cyanide poisoning, indicated because of its efficiency and poor adverse effects. However, its main drawback is to interfere with measurements of many routine biochemical parameters. We have tested the potential influence of this molecule in some routine postmortem investigations. The results are discussed. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  2. Stability and Hopf Bifurcation for a Delayed Computer Virus Model with Antidote in Vulnerable System

    Directory of Open Access Journals (Sweden)

    Zizhen Zhang

    2017-01-01

    Full Text Available A delayed computer virus model with antidote in vulnerable system is investigated. Local stability of the endemic equilibrium and existence of Hopf bifurcation are discussed by analyzing the associated characteristic equation. Further, direction of the Hopf bifurcation and stability of the bifurcating periodic solutions are investigated by using the normal form theory and the center manifold theorem. Finally, numerical simulations are presented to show consistency with the obtained results.

  3. Supramolecular ferric porphyrins and a cyclodextrin dimer as antidotes for cyanide poisoning.

    Science.gov (United States)

    Yamagiwa, T; Kawaguchi, A T; Saito, T; Inoue, S; Morita, S; Watanabe, K; Kitagishi, H; Koji, K; Inokuchi, S

    2014-04-01

    This study aimed to evaluate the antidotal effect of a newly developed supramolecular complex, ferric porphyrins and a cyclodextrin dimer (Fe(III)PIm3CD), that possess a higher binding constant and quicker binding rate to cyanide ions than those of hydroxocobalamin (OHCbl) in the presence of serum protein. First, in vitro cytochrome activity and cell viability were evaluated in murine fibroblast cells cultured with various doses of Fe(III)PIm3CD and potassium cyanide (KCN). Next, BALB/c mice were pretreated with intravenous OHCbl (0.23 mmol/kg), Fe(III)PIm3CD (0.23 mmol/kg), or saline and then received KCN (lethal dose 100% (LD100): 0.23 mmol/kg) through a stomach tube. Finally, as a resuscitation model, KCN-induced apnea was treated with a bolus injection of an equimolar dose of antidotes followed by a slow infusion of the same reagent. Fe(III)PIm3CD showed dose-dependent antidotal effects in vitro. Pretreatment with Fe(III) PIm3CD prevented KCN-induced apnea significantly better than OHCbl. Resuscitation with Fe(III)PIm3CD resulted in an earlier resumption of respiration than that seen with OHCbl. However, 24-h survival was similar among the treatments (Fe(III)PIm3CD, nine of nine mice; OHCbl, eight of nine mice). Fe(III)PIm3CD exerted significant antidotal effects on cyanide toxicity in vitro and in vivo, with a potency equal in the mortality of cyanide-poisoned mice or superior in the respiratory status during an acute phase to those of OHCbl.

  4. Identification, solubility enhancement and in vivo testing of a cyanide antidote candidate.

    Science.gov (United States)

    Kovacs, Kristof; Ancha, Madhuri; Jane, Mario; Lee, Stephen; Angalakurthi, Siva; Negrito, Maelani; Rasheed, Senan; Nwaneri, Assumpta; Petrikovics, Ilona

    2013-06-14

    Present studies focused on the in vitro testing, the solubility enhancement and the in vivo testing of methyl propyl trisulfide (MPTS), a newly identified sulfur donor to treat cyanide (CN) intoxication. To enhance the solubility of the lipophilic MPTS, various FDA approved co-solvents, surfactants and their combinations were applied. The order of MPTS solubility in the given co-solvents was found to be the following: ethanol > PEG 200 ≈ PEG400 ≈ PEG300 > PG. The maximum solubility of MPTS was found at 90% ethanol of 177.11 ± 12.17 mg/ml. The order of MPTS solubility in different surfactants is Cremophor EL>Cremophor RH40>polysorbate 80>sodium deoxycholate>sodium cholate. The maximum solubility of 40.99 mg/ml was achieved with 20% Cremophor EL. A synergistic solubilizing effect encountered with the combination of 20% Cremophor EL+75% ethanol lead to a 2900-fold increase (compared to water solubility) in solubility. The in vivo efficacy using intramuscular administration was determined on a therapeutic mice model and expressed as a ratio of CN LD50 with and without the test antidote(s) (APR). Intramuscular administration was shown to be effective and the therapeutic antidotal protection by MPTS alone and MPTS+thiosulfate (TS) was significantly higher than the present therapy of TS. Copyright © 2013 Elsevier B.V. All rights reserved.

  5. Nonclinical evaluation of novel cationically modified polysaccharide antidotes for unfractionated heparin.

    Directory of Open Access Journals (Sweden)

    Bartlomiej Kalaska

    Full Text Available Protamine, the only registered antidote of unfractionated heparin (UFH, may produce a number of adverse effects, such as anaphylactic shock or serious hypotension. We aimed to develop an alternative UFH antidote as efficient as protamine, but safer and easier to produce. As a starting material, we have chosen generally non-toxic, biocompatible, widely available, inexpensive, and easy to functionalize polysaccharides. Our approach was to synthesize, purify and characterize cationic derivatives of dextran, hydroxypropylcellulose, pullulan and γ-cyclodextrin, then to screen them for potential heparin-reversal activity using an in vitro assay and finally examine efficacy and safety of the most active polymers in Wistar rat and BALB/c mouse models of experimentally induced arterial and venous thrombosis. Efficacy studies included the measurement of thrombus formation, activated partial thromboplastin time, bleeding time, and anti-factor Xa activity; safety studies included the measurement of hemodynamic, hematologic and immunologic parameters. Linear, high molecular weight dextran substituted with glycidyltrimethylammonium chloride groups at a ratio of 0.65 per glucose unit (Dex40-GTMAC3 is the most potent and the safest UFH inhibitor showing activity comparable to that of protamine while possessing lower immunogenicity. Cationic polysaccharides of various structures neutralize UFH. Dex40-GTMAC3 is a promising and potentially better UFH antidote than protamine.

  6. MFM observations of domain wall creep and pinning effects in amorphous Co{sub x}Si{sub 1-x} films with diluted arrays of antidots

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez-Rodriguez, G [Departamento Fisica, Facultad Ciencias, Universidad de Oviedo, Av. Calvo Sotelo s/n, 33007 Oviedo (Spain); Perez-Junquera, A [Departamento Fisica, Facultad Ciencias, Universidad de Oviedo, Av. Calvo Sotelo s/n, 33007 Oviedo (Spain); Velez, M [Departamento Fisica, Facultad Ciencias, Universidad de Oviedo, Av. Calvo Sotelo s/n, 33007 Oviedo (Spain); Anguita, J V [Instituto de Microelectronica de Madrid, CNM-CSIC, Isaac Newton 8, PTM, Tres Cantos, 28760 Madrid (Spain); Martin, J I [Departamento Fisica, Facultad Ciencias, Universidad de Oviedo, Av. Calvo Sotelo s/n, 33007 Oviedo (Spain); Rubio, H [Departamento Fisica, Facultad Ciencias, Universidad de Oviedo, Av. Calvo Sotelo s/n, 33007 Oviedo (Spain); Alameda, J M [Departamento Fisica, Facultad Ciencias, Universidad de Oviedo, Av. Calvo Sotelo s/n, 33007 Oviedo (Spain)

    2007-05-21

    Magnetic force microscopy (MFM) has been used to analyse the behaviour of domain walls in uniaxial amorphous Co{sub x}Si{sub 1-x} films patterned with diluted arrays of antidots by electron beam lithography. The walls are found to be pinned by the antidot array when the antidot density is high enough along the easy axis. The expansion of reversed nuclei under the influence of the tip stray field has been observed in several consecutive MFM images of the same area, showing how the competition between line tension effects and pinning by the patterned holes governs the creep motion of the 180{sup 0} walls across the array of antidots.

  7. Magnetic characteristics of CoPd and FePd antidot arrays on nanoperforated Al{sub 2}O{sub 3} templates

    Energy Technology Data Exchange (ETDEWEB)

    Maximenko, A., E-mail: Alexey.Maximenko@ifj.edu.pl [The Henryk Niewodniczanski Institute of Nuclear Physics Polish Academy of Sciences, Radzikowskiego Str. 152, 31-342 Krakow (Poland); Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya Str. 11, 220030 Minsk (Belarus); Fedotova, J. [Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya Str. 11, 220030 Minsk (Belarus); Marszałek, M.; Zarzycki, A.; Zabila, Y. [The Henryk Niewodniczanski Institute of Nuclear Physics Polish Academy of Sciences, Radzikowskiego Str. 152, 31-342 Krakow (Poland)

    2016-02-15

    Hard magnetic antidot arrays show promising results in context of designing of percolated perpendicular media. In this work the technology of magnetic FePd and CoPd antidot arrays fabrication is presented and correlation between surface morphology, structure and magnetic properties is discussed. CoPd and FePd antidot arrays were fabricated by deposition of Co/Pd and Fe/Pd multilayers (MLs) on porous anodic aluminum oxide templates with bowl-shape cell structure with inclined intercellular regions. FePd ordered L1{sub 0} structure was obtained by successive vacuum annealing at elevated temperatures (530 °C) and confirmed by XRD analysis. Systematic analysis of magnetization curves evidenced perpendicular magnetic anisotropy of CoPd antidot arrays, while FePd antidot arrays revealed isotropic magnetic anisotropy with increased out-of-plane magnetic contribution. MFM images of antidots showed more complicated contrast, with alternating magnetic dots oriented parallel and antiparallel to tip magnetization moment. - Highlights: • CoPd and FePd antidots were fabricated on porous anodic aluminum oxide templates. • CoPd antidot arrays have perpendicular magnetic anisotropy. • FePd antidot arrays revealed isotropic magnetic behavior. • The complex morphology of nanoporous template resulted in a complex magnetic domains image.

  8. MFM observations of domain wall creep and pinning effects in amorphous CoxSi1-x films with diluted arrays of antidots

    International Nuclear Information System (INIS)

    Rodriguez-Rodriguez, G; Perez-Junquera, A; Velez, M; Anguita, J V; Martin, J I; Rubio, H; Alameda, J M

    2007-01-01

    Magnetic force microscopy (MFM) has been used to analyse the behaviour of domain walls in uniaxial amorphous Co x Si 1-x films patterned with diluted arrays of antidots by electron beam lithography. The walls are found to be pinned by the antidot array when the antidot density is high enough along the easy axis. The expansion of reversed nuclei under the influence of the tip stray field has been observed in several consecutive MFM images of the same area, showing how the competition between line tension effects and pinning by the patterned holes governs the creep motion of the 180 0 walls across the array of antidots

  9. Use of cyanide antidotes in burn patients with suspected inhalation injuries in North America: a cross-sectional survey.

    Science.gov (United States)

    Dumestre, Danielle; Nickerson, Duncan

    2014-01-01

    This study aimed to assess the use of cyanide antidotes and the determine the opinion on empiric administration of hydroxocobalamin in North American burn patients with suspected smoke inhalation injuries. An online cross-sectional survey was sent to directors of 90 major burn centers in North America, which were listed on the American Burn Association Web site. A multiple-choice format was used to determine the percentage of patients tested for cyanide poisoning on admission, the current administration of a cyanide antidote based solely on clinical suspicion of poisoning, and the antidote used. To ascertain views on immediate administration of hydroxocobalamin before confirmation of cyanide poisoning an option was included to expand the response in written format. Twenty-nine of 90 burn directors (32%) completed the survey. For the population of interest, the majority of burn centers (59%) do not test for cyanide poisoning on admission and do not administer an antidote based solely on clinical suspicion of cyanide poisoning (58%). The most commonly available antidote is hydroxocobalamin (50%), followed by the cyanide antidote kit (29%). The opinion regarding instant administration of hydroxocobalamin when inhalation injury is suspected is mixed: 31% support its empiric use, 17% do not, and the remaining 52% have varying degrees of confidence in its utility. In North America, most patients burnt in closed-space fires with inhalation injuries are neither tested for cyanide poisoning in a timely manner nor empirically treated with a cyanide antidote. Although studies have shown the safety and efficacy of empiric and immediate administration of hydroxocobalamin, most centers are not willing to do so.

  10. Rapid and complete bioavailability of antidotes for organophosphorus nerve agent and cyanide poisoning in minipigs after intraosseous administration.

    Science.gov (United States)

    Murray, Douglas B; Eddleston, Michael; Thomas, Simon; Jefferson, Robert D; Thompson, Adrian; Dunn, Mick; Vidler, Daniel S; Clutton, R Eddie; Blain, Peter G

    2012-10-01

    Management of chemical weapon casualties includes the timely administration of antidotes without contamination of rescuers. Personal protective equipment makes intravenous access difficult but does not prevent intraosseous drug administration. We therefore measured the systemic bioavailability of antidotes for organophosphorus nerve agent and cyanide poisoning when administered by the intraosseous, intravenous, and intramuscular routes in a small study of Göttingen minipigs. Animals were randomly allocated to sequentially receive atropine (0.12 mg/kg by rapid injection), pralidoxime (25 mg/kg by injection during 2 minutes), and hydroxocobalamin (75 mg/kg during 10 minutes) by the intravenous or intraosseous route, or atropine and pralidoxime by the intramuscular route. Plasma concentrations were measured for 6 hours to characterize the antidote concentration-time profiles for each route. Maximum plasma concentrations of atropine and pralidoxime occurred within 2 minutes when administered by the intraosseous route compared with 8 minutes by the intramuscular route. Maximum plasma hydroxocobalamin concentration occurred at the end of the infusion when administered by the intraosseous route. The mean area under the concentration-time curve by the intraosseous route was similar to the intravenous route for all 3 drugs and similar to the intramuscular route for atropine and pralidoxime. This study showed rapid and substantial antidote bioavailability after intraosseous administration that appeared similar to that of the intravenous route. The intraosseous route of antidote administration should be considered when intravenous access is difficult. Copyright © 2012. Published by Mosby, Inc.

  11. Antidotal Efficacy of a New Combination in Treatment of Subacute T-2 Toxin Poisoning in Rats

    International Nuclear Information System (INIS)

    Jacevic, V. M.; Bocarov-Stancic, A. S.; Resanovic, R. D.; Djordjevic, S. B.; Bokonjic, D. R.

    2007-01-01

    Trichothecene mycotoxin, T-2 toxin is a natural metabolite of Fusarium fungi. T-2 toxin possesses several properties (significant persistence in the environment, cheap manufacture, difficult detection and absence of a specific antidote) that make it a very dangerous potential chemical warfare agent. In our previous experiments, nonsteroidal anti-inflammatory drug (NSAID) nimesulide (NIM), as a selective COX-2 inhibitor, and zeolite absorbent (Min-a-zel Plus, MINplus) administered separately showed a good protective effects against general toxicity induced by T-2 toxin (T2). The aim of this study was to evaluate the antidotal potential of the combination of these two antidotes. T2 was given in a dose of 0.15 mg/kg sc (0.1 LD50), 5 times per week, 4 weeks to adult Wistar rats. Protected animals were given NIM (20 mg/kg im) or/and MINplus (40 mg/kg po) each time immediately after T2. Mortality, general condition, body weight gain, food and water consumption and gut alterations of the animals were registered on a daily basis during 4 weeks. Treatment with NIM or/and MINplus significantly reduced mortality of the rats treated only with T2. Body weight gain, food and water consumption were significantly decreased in T2-treated animals compared to control ones (p < 0.001), what was not the case in the protected rats. In the groups treated with NIM and MINplus gut alterations were significantly less severe than those observed in animals receiving T2 alone (p less than 0.001). These results imply that combined treatment with nimesulide and zeolite absorbent affords a significant protection against subacute T-2 toxin poisoning in rats.(author)

  12. Specific antidotes against direct oral anticoagulants: A comprehensive review of clinical trials data.

    Science.gov (United States)

    Tummala, Ramyashree; Kavtaradze, Ana; Gupta, Anjan; Ghosh, Raktim Kumar

    2016-07-01

    The Vitamin K antagonist warfarin was the only oral anticoagulant available for decades for the treatment of thrombosis and prevention of thromboembolism until Direct Oral Anticoagulants (DOACs); a group of new oral anticoagulants got approved in the last few years. Direct thrombin inhibitor: dabigatran and factor Xa inhibitors: apixaban, rivaroxaban, and edoxaban directly inhibit the coagulation cascade. DOACs have many advantages over warfarin. However, the biggest drawback of DOACs has been the lack of specific antidotes to reverse the anticoagulant effect in emergency situations. Activated charcoal, hemodialysis, and activated Prothrombin Complex Concentrate (PCC) were amongst the nonspecific agents used in a DOAC associated bleeding but with limited success. Idarucizumab, the first novel antidote against direct thrombin inhibitor dabigatran was approved by US FDA in October 2015. It comprehensively reversed dabigatran-induced anticoagulation in a phase I study. A phase III trial on Idarucizumab also complete reversal of anticoagulant effect of dabigatran. Andexanet alfa (PRT064445), a specific reversal agent against factor Xa inhibitors, showed a complete reversal of anticoagulant activity of apixaban and rivaroxaban within minutes after administration without adverse effects in two recently completed parallel phase III trials ANNEXA-A and ANNEXA-R respectively. It is currently being studied in ANNEXA-4, a phase IV study. Aripazine (PER-977), the third reversal agent, has shown promising activity against dabigatran, apixaban, rivaroxaban, as well as subcutaneous fondaparinux and LMWH. This review article summarizes pharmacological characteristics of these novel antidotes, coagulation's tests affected, available clinical and preclinical data, and the need for phase III and IV studies. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  13. Effects of Cheap Antidotes; Sodium Bicarbonate and Magnesium Sulfate in Organophosphorous Poisoning

    International Nuclear Information System (INIS)

    Balali-Mood, M.; Afshari, R.

    2007-01-01

    Organophosphorous (OP) compounds have been used as pesticides and chemical warfare nerve agents. Despite administration of well known antidotes (atropine and oximes), morbidity and mortality of OP poisoning were still high. Besides, oximes are very expensive and not available in most developing countries. It was thus aimed to study the effects of cheap available antidotes; sodium bicarbonate and magnesium sulfate in OP poisoning. In addition to the standard antidotal treatment, out of 117 patients (63M, 47F) aged 25.2 ± 9.5 years with moderate to severe acute OP pesticide poisoning 59 were given sodium bicarbonate 5 mEq/kg in 60 min. followed by 5-6 mEq/kg/day to obtain arterial blood pH of 7.45 to 7.55. Arterial blood pH increased significantly (p less than 0.01) to 7.48 ± 0.05 compared to the controls (7.32 ± 0.06). Morbidity based on hospitalization days reduced significantly (p less than 0.05) from 5.62 ± 3.4 in the controls to 3.1 ± 2.6 days in the sodium bicarbonate group. Total atropine dose was also significantly (p less than 0.05) lower in the test group. Mortality was lower, but not significantly due to the low numbers (5 and 2 of the controls and test group, respectively). Sodium bicarbonate appeared to be effective and could be added to the treatment regime of OP poisoning. Magnesium sulfate was administered four gram intravenously only for the first 24 hr of hospitalization day for the patients with moderate to severe OP poisoning in a pilot study. The results were promising and thus further investigations are continued.(author)

  14. Medication errors associated with the use of ethanol and fomepizole as antidotes for methanol and ethylene glycol poisoning.

    Science.gov (United States)

    Lepik, Katherine J; Sobolev, Boris G; Levy, Adrian R; Purssell, Roy A; Dewitt, Christopher R; Erhardt, Gunnar D; Baker, Jane L; Kennedy, James R; Daws, Derek E

    2011-06-01

    Little is known about medication errors which occur with the antidotes ethanol and fomepizole, used for treatment of methanol and ethylene glycol poisoning. Study objectives were to describe and compare the frequency, type, outcome and underlying causes of medication errors associated with ethanol and fomepizole. Patients aged ≥13 years were included if they were hospitalized in 1996-2005 for methanol or ethylene glycol poisoning and treated with ethanol or fomepizole. Charts from 10 hospitals were separately reviewed by two abstracters who recorded case details. A consensus panel of clinicians used the abstracted data to identify medication errors and classify error outcome. Fisher's exact test determined significant differences in the proportion of ethanol and fomepizole-treated cases with medication error and univariate logistic regression identified risk factors associated with harmful dosage errors. There were 145 ethanol- and 44 fomepizole-treated cases. There was ≥1 medication error in 113/145 (78%) ethanol- and 20/44 (45%) fomepizole-treated cases (p = 0.0001) with more ethanol-related errors involving excessive dose, inadequate monitoring and inappropriate antidote duration. Harmful errors occurred in 19% of ethanol- and 7% of fomepizole-treated cases (p = 0.06) and were largely due to excessive antidote dose or delayed antidote initiation. Occurrence of harmful dosage error was reduced in cases with Poison Control Centre consultation, odds ratio (95% confidence interval) 0.39 (0.17, 0.91), hemodialysis 0.37 (0.16, 0.88), or fomepizole versus ethanol 0.24 (0.06, 1.04). Fomepizole was less prone to medication error than ethanol. Error-related harm was most commonly due to excessive antidote dose or delayed antidote initiation.

  15. Limitations in current acetylcholinesterase structure–based design of oxime antidotes for organophosphate poisoning

    Science.gov (United States)

    Kovalevsky, Andrey; Blumenthal, Donald K.; Cheng, Xiaolin; Taylor, Palmer; Radić, Zoran

    2016-01-01

    Acetylcholinesterase (AChE; EC 3.1.1.7), an essential enzyme of cholinergic neurotransmission in vertebrates, is a primary target in acute nerve agent and organophosphate (OP) pesticide intoxication. Catalytically inactive OP–AChE conjugates formed between the active-center serine and phosphorus of OPs can, in principle, be reactivated by nucleophilic oxime antidotes. Antidote efficacy is limited by the structural diversity of OP–AChE conjugates resulting from differences in the structure of the conjugated OP, the different active-center volumes they occupy when conjugated to the active-center serine of AChE, and the distinct chemical characteristics of both OPs and oximes, documented in numerous X-ray structures of OP-conjugated AChEs. Efforts to improve oxime reactivation efficacy by AChE structure–based enhancement of oxime structure have yielded only limited success. We outline here potential limitations of available AChE X-ray structures that preclude an accurate prediction of oxime structures, which are necessary for association in the OP–AChE gorge and nucleophilic attack of the OP-conjugated phosphorus. PMID:27371941

  16. In vitro Evaluation of New Acetylcholinesterase Reactivators as Casual Antidotes against Tabun and Cyclosarin

    International Nuclear Information System (INIS)

    Kuca, Kamil; Jun, Daniel; Jung, Young Sik; Kim, Tae Hyuk; Cabal, Jiri

    2006-01-01

    Nerve agents (sarin, tabun, soman and VX) are class of military important substances able to cause many severe intoxications during few minutes. Currently, the threat of misuse of these agents is daily discussed. Unfortunately, there is no single antidote able to treat intoxication caused by all of these agents. Owing to this fact, new generation of antidotes, especially acetylcholinesterase (AChE: EC 3.1.1.7) reactivators, is still developed. In this study, we have tested four newly developed AChE reactivators: 1-(4-hydroxyiminomethylpyridinium)- 5-(4-carbamoylpyridinium)-3-oxa-pentane dibromide (1), 1-(3-hydroxyiminomethylpyridinium)- 5-(4-carbamoylpyridinium)-3-oxa-pentane dibromide (2), 1,5-bis(2-hydroxyiminomethylpyridinium)- 3-oxa-pentane dichloride (3) and 1,5-bis(4-hydroxyiminomethylpyridinium)-3-oxa-pentane dibromide (4) for their potency to reactivate in vitro tabun and cyclosarin-inhibited AChE. Their reactivation efficacy was compared with currently the most promising oxime HI-6 (1-(2-hydroxyiminomethylpyridinium)-3-(4- carbamoylpyridinium)-2-oxa-propane dichloride). According to obtained results, two AChE reactivators 1 and 4 were able to reactivate tabun-inhibited AChE. On the contrary, there was no better AChE reactivator than HI- 6 able to reactivate cyclosarin-inhibited AChE

  17. The role of the hospital pharmacy in the storage and supply of antidotes

    Directory of Open Access Journals (Sweden)

    Luisa Lombardo

    2013-12-01

    Full Text Available Cases of poisoning have been analyzed with the aim of estimating both the incidence and the seriousness of such xenobiotic effects, the major determinant agents, and the related antidotes used in hospital departments. From 2009 to November 2012, a survey of the availability of antidotes in the emergency room services was carried out in all hospital pharmacies under the Palermo Health Authority: Policlinico Paolo Giaccone, ARNAS Civico di Cristina Benefratelli, Azienda Ospedaliera Ospedali Riuniti Villa Sofia-Cervello. Figures show that the majority of poisoning events were caused by the use/abuse of drugs, especially psychopharmaceuticals, alcohol and narcotic substances. This overdose of medical drugs and its various causes is a cause for concern and highlights the fact that this tendency has not regressed over the years. Doctors and pharmacists should raise patients’ awareness about how to use drugs correctly, and make adequate information available to all patients in order to, first, reduce the risks, and second, reduce the cost of treatment for intoxication.

  18. The Organophosphate Paraoxon and Its Antidote Obidoxime Inhibit Thrombin Activity and Affect Coagulation In Vitro

    Science.gov (United States)

    Golderman, Valery; Shavit-Stein, Efrat; Tamarin, Ilia; Rosman, Yossi; Shrot, Shai; Rosenberg, Nurit

    2016-01-01

    Organophosphates (OPs) are potentially able to affect serine proteases by reacting with their active site. The potential effects of OPs on coagulation factors such as thrombin and on coagulation tests have been only partially characterized and potential interactions with OPs antidotes such as oximes and muscarinic blockers have not been addressed. In the current study, we investigated the in vitro interactions between coagulation, thrombin, the OP paraoxon, and its antidotes obidoxime and atropine. The effects of these substances on thrombin activity were measured in a fluorescent substrate and on coagulation by standard tests. Both paraoxon and obidoxime but not atropine significantly inhibited thrombin activity, and prolonged prothrombin time, thrombin time, and partial thromboplastin time. When paraoxon and obidoxime were combined, a significant synergistic effect was found on both thrombin activity and coagulation tests. In conclusion, paraoxon and obidoxime affect thrombin activity and consequently alter the function of the coagulation system. Similar interactions may be clinically relevant for coagulation pathways in the blood and possibly in the brain. PMID:27689805

  19. Effect of charcoal-drug ratio on antidotal efficacy of oral activated charcoal in man.

    Science.gov (United States)

    Olkkola, K T

    1985-01-01

    The effect of charcoal-drug ratio on the antidotal efficacy of oral activated charcoal was studied in six healthy volunteers in a randomized cross-over study and compared with the adsorption capacity of activated charcoal in vitro. Aminosalicylic acid (PAS) 1 g and 5 g were ingested on an empty stomach in 30 ml of water. Immediately afterwards the subjects ingested 50 g of activated charcoal in 300 ml of water or 300 ml of water only. PAS 10 g 20 g were only given with 50 g of activated charcoal administered immediately afterwards. The plasma concentrations and the cumulative excretion of PAS into urine were measured for 48 h. Increasing the dose of PAS from 1 g to 20 g reduced the antidotal efficacy of activated charcoal: at a charcoal-drug ratio of 50:1 under 5% of the dose was absorbed but at a ratio of 2.5:1 about 37%. These data correlated well to the saturation of adsorption capacity of charcoal in vitro. To minimize the possibility of saturation of the adsorption capacity of charcoal in acute intoxications where the amount and type of drug taken is usually unknown, large doses (50-100 g) of activated charcoal should be used. PMID:4027120

  20. Saffron as an antidote or a protective agent against natural or chemical toxicities.

    Science.gov (United States)

    Razavi, Bibi Marjan; Hosseinzadeh, Hossein

    2015-05-01

    Saffron (Crocus sativus) is an extensively used food additive for its color and taste. Since ancient times this plant has been introduced as a marvelous medicine throughout the world. The wide spectrum of saffron pharmacological activities is related to its major constituents including crocin, crocetin and safranal. Based on several studies, saffron and its active ingredients have been used as an antioxidant, antiinflammatory and antinociceptive, antidepressant, antitussive, anticonvulsant, memory enhancer, hypotensive and anticancer. According to the literatures, saffron has remarkable therapeutic effects. The protective effects of saffron and its main constituents in different tissues including brain, heart, liver, kidney and lung have been reported against some toxic materials either natural or chemical toxins in animal studies.In this review article, we have summarized different in vitro and animal studies in scientific databases which investigate the antidotal and protective effects of saffron and its major components against natural toxins and chemical-induced toxicities. Due to the lake of human studies, further investigations are required to ascertain the efficacy of saffron as an antidote or a protective agent in human intoxication.

  1. [Poisons and antidotes according to Gunyetü'l Muhassilin and an 18th century Ottoman pamphlet].

    Science.gov (United States)

    Tuğ, R

    2000-01-01

    This study deals with the chapter on poisons (Sümum) of Gunyetü'l-Muhassilin, a translation, and a pamphlet on antidotes called Panzehir, by Ahmed Sani, one of the most prominent figures of the Ottoman physicians. As a foreword, the terminology related with the subject; and an introduction to the Islamic medical theory, the basis of the subject, is discussed. The main topics on poisons are; protection against and treatment of poisons; being poisoned by the sting of insects, snakes etc. and diseases such as rabies, as a result of bites of animals and their treatment; treatment of poisoned suppuration; insecticide drugs and measures; and common drugs against all kinds of poisons. Immunization and nutrition with respect to being poisoned; and preventive measures against insects; and mineral and organic antidotes are also discussed. The classification of diseases and treatment ase evaluated on the humoral theory basis. The treatment of insect poisoning is viewed from the perspective of its symptoms. The pamphlet named Panzehir is about a special antidote, the bezoar stone. This antidote is divided into two, of the mineral and the animal origin and the uses of the bezoar are discussed. A vocabulary is added to help readers to understand the terminology.

  2. Ethnopharmacological approach to the herbal medicines of the "Antidotes" in Nikolaos Myrepsos׳ Dynameron.

    Science.gov (United States)

    Valiakos, E; Marselos, M; Sakellaridis, N; Constantinidis, Th; Skaltsa, H

    2015-04-02

    This paper focuses on the plants quoted in the recipes of the first chapter entitled "About the Antidotes" belonging to the first and largest section "Element Alpha" of Nikolaos Myrepsos׳ Dynameron, a medieval medical manuscript. Nikolaos Myrepsos was a Byzantine physician at the court of John III Doukas Vatatzes at Nicaea (13th century). He wrote in Greek a rich collection of 2667 recipes, the richest number known in late Byzantine era, conventionally known as Dynameron and divided into 24 sections, the "Elements". The only existing translation of this work is in Latin, released in 1549 in Basel by Leonhart Fuchs. Since no other translation has ever been made in any language, this work still remains poorly known. Our primary source material was the codex written in 1339 and kept in the National Library of France (in Paris) under the number grec. 2243. For comparison, all the other codices, which contain the entire manuscript, have also been studied, namely the codices EBE 1478 (National Library of Greece, Athens), grec. 2237 and grec. 2238 (both in Paris), Lavra Ε 192 (Mont Athos, Monastery of Megisti Lavra), Barocci 171 (Oxford) and Revilla 83 (Escorial). The exhaustive study of the "About the Antidotes" led us to the interpretation of 293 plant names among which we recognized 39 medicinal plants listed by the European Medicines Agency, (Herbal Medicines, www.ema.eu); the therapeutic indications of some of them provided by Myrepsos were similar or related to their current ones, as given in their monographs. The plants belong to various families of which the most frequent are: Apiaceae 10.6%; Lamiaceae 9.2%; Asteraceae 8.9%; Fabaceae 6.8% and Rosaceae 5.1%. The most frequently mentioned plants even under several different names are the following: Apium graveolens L., Crocus sativus L., Nardostachys jatamansi (D. Don) DC., Zingiber officinale Roscoe, Rosa centifolia L., Syzygium aromaticum (L.) Merr. & L.M. Perry, Papaver somniferum L., Costus sp., Petroselinum

  3. Hofstadter butterflies and magnetically induced band-gap quenching in graphene antidot lattices

    DEFF Research Database (Denmark)

    Pedersen, Jesper Goor; Pedersen, Thomas Garm

    2013-01-01

    We study graphene antidot lattices (GALs) in magnetic fields. Using a tight-binding model and a recursive Green's function technique that we extend to deal with periodic structures, we calculate Hofstadter butterflies of GALs. We compare the results to those obtained in a simpler gapped graphene...... model. A crucial difference emerges in the behavior of the lowest Landau level, which in a gapped graphene model is independent of magnetic field. In stark contrast to this picture, we find that in GALs the band gap can be completely closed by applying a magnetic field. While our numerical simulations...... can only be performed on structures much smaller than can be experimentally realized, we find that the critical magnetic field for which the gap closes can be directly related to the ratio between the cyclotron radius and the neck width of the GAL. In this way, we obtain a simple scaling law...

  4. Ballistic magnetotransport in a suspended two-dimensional electron gas with periodic antidot lattices

    Energy Technology Data Exchange (ETDEWEB)

    Zhdanov, E. Yu., E-mail: zhdanov@isp.nsc.ru; Pogosov, A. G.; Budantsev, M. V.; Pokhabov, D. A.; Bakarov, A. K. [Siberian Branch of the Russian Academy of Sciences, Rzhanov Institute of Semiconductor Physics (Russian Federation)

    2017-01-15

    The magnetoresistance of suspended semiconductor nanostructures with a two-dimensional electron gas structured by periodic square antidot lattices is studied. It is shown that the ballistic regime of electron transport is retained after detaching the sample from the substrate. Direct comparative analysis of commensurability oscillations of magnetoresistance and their temperature dependences in samples before and after suspension is performed. It is found that the temperature dependences are almost identical for non-suspended and suspended samples, whereas significant differences are observed in the nonlinear regime, caused by direct current passage. Commensurability oscillations in the suspended samples are more stable with respect to exposure to direct current, which can be presumably explained by electron–electron interaction enhancement after detaching nanostructures from the high-permittivity substrate.

  5. Mapping degenerate vortex states in a kagome lattice of elongated antidots via scanning Hall probe microscopy

    Science.gov (United States)

    Xue, C.; Ge, J.-Y.; He, A.; Zharinov, V. S.; Moshchalkov, V. V.; Zhou, Y. H.; Silhanek, A. V.; Van de Vondel, J.

    2017-07-01

    We investigate the degeneracy of the superconducting vortex matter ground state by directly visualizing the vortex configurations in a kagome lattice of elongated antidots via scanning Hall probe microscopy. The observed vortex patterns, at specific applied magnetic fields, are in good agreement with the configurations obtained using time-dependent Ginzburg-Landau simulations. Both results indicate that the long-range interaction in this nanostructured superconductor is unable to lift the degeneracy between different vortex states and the pattern formation is mainly ruled by the nearest-neighbor interaction. This simplification makes it possible to identify a set of simple rules characterizing the vortex configurations. We demonstrate that these rules can explain both the observed vortex distributions and the magnetic-field-dependent degree of degeneracy.

  6. Parity effect of bipolar quantum Hall edge transport around graphene antidots.

    Science.gov (United States)

    Matsuo, Sadashige; Nakaharai, Shu; Komatsu, Katsuyoshi; Tsukagoshi, Kazuhito; Moriyama, Takahiro; Ono, Teruo; Kobayashi, Kensuke

    2015-06-30

    Parity effect, which means that even-odd property of an integer physical parameter results in an essential difference, ubiquitously appears and enables us to grasp its physical essence as the microscopic mechanism is less significant in coarse graining. Here we report a new parity effect of quantum Hall edge transport in graphene antidot devices with pn junctions (PNJs). We found and experimentally verified that the bipolar quantum Hall edge transport is drastically affected by the parity of the number of PNJs. This parity effect is universal in bipolar quantum Hall edge transport of not only graphene but also massless Dirac electron systems. These results offer a promising way to design electron interferometers in graphene.

  7. Humanistic Antidotes to Social Media/Cell Phone Addiction in the College Classroom

    Directory of Open Access Journals (Sweden)

    Elliot Benjamin

    2016-08-01

    Full Text Available This article describes “humanistic antidotes” to offset the widespread social media/cell phone addiction prevalent in current US college classrooms. The inappropriate use of cell phones to engage in social media in college classrooms is a pervasive problem that many college instructors have complained about.  The dominant focus of this article is in humanistic education, in which the author's efforts at getting psychology college students to put away their cell phones, “talk with each other,” and gain awareness of the detrimental effects of social media addiction and narcissism is illustrated.  The methodology utilized in this article is based upon autoethnographic research, where relevant experiences of the researcher are considered to be an informative and fundamental part of the research. The author describes in narrative form his relevant experiences in formulating humanistic antidotes to the excessive and inappropriate use of cell phones to engage in social media, that he encountered in his college psychology teaching. These humanistic antidotes are described as a three-step process: 1 take necessary actions to eliminate as much as possible the inappropriate use of cell phones in the classroom; 2 engage students in required personal/academic small group discussions every class period; 3 include small discussions about the excessive and inappropriate use of cell phones and social media, and require them to write and present project papers of their own choosing, which will likely include some papers on the topic of cell phone/social media addiction, demonstrating their awareness of the detrimental aspects of this pervasive problem.

  8. Optically induced spin wave dynamics in [Co/Pd]{sub 8} antidot lattices with perpendicular magnetic anisotropy

    Energy Technology Data Exchange (ETDEWEB)

    Pal, S.; Das, K.; Barman, A., E-mail: abarman@ybose.res.in [Thematic Unit of Excellence on Nanodevice Technology and Department of Condensed Matter Physics and Material Sciences, S. N. Bose National Centre for Basic Sciences, Block JD, Sector III, Salt Lake, Kolkata 700 098 (India); Klos, J. W.; Gruszecki, P.; Krawczyk, M., E-mail: krawczyk@amu.edu.pl [Faculty of Physics, A. Mickiewicz University in Poznan, Umultowska 85, 61-614 Poznań (Poland); Hellwig, O. [San Jose Research Center, HGST, a Western Digital Company, 3403 Yerba Buena Rd., San Jose, California 95135 (United States)

    2014-10-20

    We present an all-optical time-resolved measurement of spin wave (SW) dynamics in a series of antidot lattices based on [Co(0.75 nm)/Pd(0.9 nm)]{sub 8} multilayer (ML) systems with perpendicular magnetic anisotropy. The spectra depend significantly on the areal density of the antidots. The observed SW modes are qualitatively reproduced by the plane wave method. The interesting results found in our measurements and calculations at small lattice constants can be attributed to the increase of areal density of the shells with modified magnetic properties probably due to distortion of the regular ML structure by the Ga ion bombardment and to increased coupling between localized modes. We propose and discuss the possible mechanisms for this coupling including exchange interaction, tunnelling, and dipolar interactions.

  9. Structure of a prereaction complex between the nerve agent sarin, its biological target acetylcholinesterase, and the antidote HI-6.

    Science.gov (United States)

    Allgardsson, Anders; Berg, Lotta; Akfur, Christine; Hörnberg, Andreas; Worek, Franz; Linusson, Anna; Ekström, Fredrik J

    2016-05-17

    Organophosphorus nerve agents interfere with cholinergic signaling by covalently binding to the active site of the enzyme acetylcholinesterase (AChE). This inhibition causes an accumulation of the neurotransmitter acetylcholine, potentially leading to overstimulation of the nervous system and death. Current treatments include the use of antidotes that promote the release of functional AChE by an unknown reactivation mechanism. We have used diffusion trap cryocrystallography and density functional theory (DFT) calculations to determine and analyze prereaction conformers of the nerve agent antidote HI-6 in complex with Mus musculus AChE covalently inhibited by the nerve agent sarin. These analyses reveal previously unknown conformations of the system and suggest that the cleavage of the covalent enzyme-sarin bond is preceded by a conformational change in the sarin adduct itself. Together with data from the reactivation kinetics, this alternate conformation suggests a key interaction between Glu202 and the O-isopropyl moiety of sarin. Moreover, solvent kinetic isotope effect experiments using deuterium oxide reveal that the reactivation mechanism features an isotope-sensitive step. These findings provide insights into the reactivation mechanism and provide a starting point for the development of improved antidotes. The work also illustrates how DFT calculations can guide the interpretation, analysis, and validation of crystallographic data for challenging reactive systems with complex conformational dynamics.

  10. Evaluation of the benefit of the bispyridinium compound MB327 for the antidotal treatment of nerve agent-poisoned mice.

    Science.gov (United States)

    Kassa, Jiri; Pohanka, Miroslav; Timperley, Christopher M; Bird, Mike; Green, A Christopher; Tattersall, John E H

    2016-06-01

    The potency of the bispyridinium non-oxime compound MB327 [1,1'-(propane-1,3-diyl)bis(4-tert-butylpyridinium) diiodide] to increase the therapeutic efficacy of the standard antidotal treatment (atropine in combination with an oxime) of acute poisoning with organophosphorus nerve agents was studied in vivo. The therapeutic efficacy of atropine alone - or atropine in combination with an oxime, MB327, or both an oxime and MB237 - was evaluated by the determination of LD50 values of several nerve agents (tabun, sarin and soman) in mice with and without treatment. The addition of MB327 increased the therapeutic efficacy of atropine alone, and atropine in combination with an oxime, against all three nerve agents, although differences in the LD50 values only reached statistical significance for sarin. In conclusion, the addition of the compound MB327 to the standard antidotal treatment of acute poisonings with nerve agents was beneficial regardless of the chemical structure of the nerve agent, although at the dose employed, MB327 in combination with atropine, or atropine and an oxime, provided only a modest increase in protection ratio. These results from mice, and previous ones from guinea-pigs, provide consistent evidence for additional, albeit modest, efficacy resulting from the inclusion of the antinicotinic compound MB327 in standard antidotal therapy. Given the typically steep probit slope for the dose-lethality relationship for nerve agents, such modest increases in protection ratio could provide significant survival benefit.

  11. Adverse drug events associated with the antidotes for methanol and ethylene glycol poisoning: a comparison of ethanol and fomepizole.

    Science.gov (United States)

    Lepik, Katherine J; Levy, Adrian R; Sobolev, Boris G; Purssell, Roy A; DeWitt, Christopher R; Erhardt, Gunnar D; Kennedy, James R; Daws, Derek E; Brignall, Jane L

    2009-04-01

    We investigate adverse drug events associated with antidotes ethanol and fomepizole in methanol or ethylene glycol poisonings. An "adverse drug event" is harm associated with normal or incorrect drug use. We describe type, frequency, severity, seriousness, and onset time of adverse drug events and test the hypothesis that fomepizole results in fewer adverse drug events than ethanol. This cohort study included patients aged 13 years or older, hospitalized between 1996 and 2005 for methanol or ethylene glycol poisoning (identified by International Classification of Diseases, Ninth Revision or 10th Revision codes) and treated with at least 1 dose of ethanol or fomepizole. Two abstractors separately reviewed each chart, identifying new clinical events during antidote treatment. Three toxicologists determined, by consensus, which events were adverse drug events. The primary outcome was at least 1 adverse drug event, expressed as adverse drug event rate per person-day of antidote treatment. Association between time to first adverse drug event and antidote type was modeled by Cox regression, adjusted for confounders. Two hundred twenty-three charts were reviewed and 172 analyzed. Toxicologists identified at least 1 adverse drug event in 74 of 130 (57%) ethanol-treated and 5 of 42 (12%) fomepizole-treated cases. Central nervous system symptoms accounted for most adverse drug events (48% ethanol-treated, 2% fomepizole-treated). Severe adverse drug events occurred in 26 of 130 (20%) ethanol-treated (coma, extreme agitation, cardiovascular) and 2 of 42 (5%) fomepizole-treated (coma, cardiovascular). Serious (life-threatening) adverse drug events occurred in 11 of 130 (8%) ethanol-treated (respiratory depression, hypotension) and 1 of 42 (2%) fomepizole-treated (hypotension, bradycardia) cases. Median adverse drug event onset was within 3 hours after the start of either antidote. Ethanol and fomepizole adverse drug event rates were 0.93 and 0.13 adverse drug events per

  12. Nanometric MIL-125-NH2 Metal–Organic Framework as a Potential Nerve Agent Antidote Carrier

    Science.gov (United States)

    Vilela, Sérgio M. F.; Salcedo-Abraira, Pablo; Colinet, Isabelle; Salles, Fabrice; Serre, Christian; Horcajada, Patricia

    2017-01-01

    The three-dimensional (3D) microporous titanium aminoterephthalate MIL-125-NH2 (MIL: Material of Institut Lavoisier) was successfully isolated as monodispersed nanoparticles, which are compatible with intravenous administration, by using a simple, safe and low-cost synthetic approach (100 °C/32 h under atmospheric pressure) so that for the first time it could be considered for encapsulation and the release of drugs. The nerve agent antidote 2-[(hydroxyimino)methyl]-1-methyl-pyridinium chloride (2-PAM or pralidoxime) was effectively encapsulated into the pores of MIL-125-NH2 as a result of the interactions between 2-PAM and the pore walls being mediated by π-stacking and hydrogen bonds, as deduced from infrared spectroscopy and Monte Carlo simulation studies. Finally, colloidal solutions of MIL-125-NH2 nanoparticles exhibited remarkable stability in different organic media, aqueous solutions at different pH and under relevant physiological conditions over time (24 h). 2-PAM was rapidly released from the pores of MIL-125-NH2 in vitro. PMID:29023426

  13. Nanometric MIL-125-NH₂ Metal-Organic Framework as a Potential Nerve Agent Antidote Carrier.

    Science.gov (United States)

    Vilela, Sérgio M F; Salcedo-Abraira, Pablo; Colinet, Isabelle; Salles, Fabrice; de Koning, Martijn C; Joosen, Marloes J A; Serre, Christian; Horcajada, Patricia

    2017-10-12

    The three-dimensional (3D) microporous titanium aminoterephthalate MIL-125-NH₂ (MIL: Material of Institut Lavoisier) was successfully isolated as monodispersed nanoparticles, which are compatible with intravenous administration, by using a simple, safe and low-cost synthetic approach (100 °C/32 h under atmospheric pressure) so that for the first time it could be considered for encapsulation and the release of drugs. The nerve agent antidote 2-[(hydroxyimino)methyl]-1-methyl-pyridinium chloride (2-PAM or pralidoxime) was effectively encapsulated into the pores of MIL-125-NH₂ as a result of the interactions between 2-PAM and the pore walls being mediated by π-stacking and hydrogen bonds, as deduced from infrared spectroscopy and Monte Carlo simulation studies. Finally, colloidal solutions of MIL-125-NH₂ nanoparticles exhibited remarkable stability in different organic media, aqueous solutions at different pH and under relevant physiological conditions over time (24 h). 2-PAM was rapidly released from the pores of MIL-125-NH₂ in vitro.

  14. Human butyrylcholinesterase as a general scavenging antidote for nerve agents toxicity

    Energy Technology Data Exchange (ETDEWEB)

    Ashani, Y.; Grunwald, J.; Grauer, E.; Brandeis, R.; Cohen, E.

    1993-05-13

    Butyrylcholinesterase purified from human plasma (HuBChE) was evaluated both in vitro and in vivo as a single prophylactic antidote against multiples of i.v. LD(50) doses of nerve agents (NA) (GA, GB, GD, and VX). Significant therapeutic concentrations of HuBChE were observed in blood even 48 hrs following either i.v. or i.m. injection in mice, rats, guinea pigs, and monkeys. High levels of protection were also demonstrated in a small number of animals exposed to GD vapors. The stoichiometry of the in vivo sequestration of the anti-ChE toxicants was consistent with HuBChE/NA ratio of the molar concentration required to inhibit 100% enzyme activity in vitro. Further, linear correlation was demonstrated between blood level of HuBChE and the extent of protection obtained against the toxicity of NA. It was estimated that in order to obtain reasonable protection, exogenously administered HuBChE should be able to reduce the concentration of the NA to a level below its LD(50) value within less than one blood circulation time. HuBChE significantly prevented GD-induced behavioral deficits. The enzyme itself did not alter performance of cognitive tasks. Thus, HuBChE not only increased survival after NA exposure, but also alleviated post exposure symptoms. without the need for any additional therapeutic drugs (e. g., atropine, pralidoxime chloride, diazepam).

  15. Hydroxypyri(mi)dine-based chelators as antidotes of toxicity due to aluminum and actinides.

    Science.gov (United States)

    Santos, M A; Esteves, M A; Chaves, S

    2012-01-01

    This review is focused on recent developments on hydroxypyri(mi)dines, as aluminum and actinide chelating agents to combat the toxicity due to accumulations of these metal ions in human body resulting from excessive metal exposure. After a brief update revision of the most common processes of aluminum (Al) exposure, as well as the associated toxicities and pathologies, we will focus on the current available Al chelators and future perspective as potential antidotes of Al toxicity. Due to the similarity between Al and Fe, a major emphasis is given to the hydroxypyridinone and hydroxypyrimidinone chelators, since they are analogues of the current iron chelators in clinical use (DFP and DFO). This review includes issues such as molecular design strategies and corresponding effects on the associated physico-chemical properties, lipo-hydrophilic balance, toxicity, in vivo bioassays and current clinical applications. The hydroxypyri(mi)dine chelators are also suitable for other hard metal ions, such as the radiotoxic actinides, and so a brief review is included on the applications of these chelators in actinides scavenging.

  16. Observation of Novel Low-Field FMR modes in Permalloy Antidot Arrays

    Science.gov (United States)

    de Long, Lance; Bhat, Vinayak; Farmer, Barry; Woods, Justin; Hastings, Todd; Sklenar, Joseph; Ketterson, John

    2013-03-01

    Permalloy films of thickness 23 nm were patterned with square arrays of square antidots (AD) with feature size D = 120 nm, and lattice constants d = 200, 300, 500 and 700 nm (total sample area = 2 mm x 2mm), using electron beam lithography. Our broad-band (frequencies f = 10 MHz-15 GHz) and narrow-band (9.7 GHz) FMR measurements of even dilute (D/d <<1) AD lattices (ADL) reveal remarkably reproducible absorption spectra in the low-frequency, hysteretic regime in which disordered domain wall (DW) patterns and unsaturated magnetization textures are expected for unpatterned films, but in the present case are strongly affected by the periodic ADL. Other modes in the saturated regime exhibit strong dependence on the angle between the applied DC field H and the ADL axes, as confirmed by our micromagnetic simulations. Novel modes are observed at DC fields above that of the uniform mode, which simulations indicate are localized at AD edges. Other novel modes are observed for DC fields below that of the uniform mode, which simulated power and phase maps indicate are confined to ADL interstices oriented parallel to H. These results show even dilute AD concentrations can effect strong control of DW evolution. Research at Kentucky is supported by U.S. DoE Grant DE-FG02-97ER45653 and NSF Grant EPS-0814194.

  17. Nanometric MIL-125-NH2 Metal–Organic Framework as a Potential Nerve Agent Antidote Carrier

    Directory of Open Access Journals (Sweden)

    Sérgio M. F. Vilela

    2017-10-01

    Full Text Available The three-dimensional (3D microporous titanium aminoterephthalate MIL-125-NH2 (MIL: Material of Institut Lavoisier was successfully isolated as monodispersed nanoparticles, which are compatible with intravenous administration, by using a simple, safe and low-cost synthetic approach (100 °C/32 h under atmospheric pressure so that for the first time it could be considered for encapsulation and the release of drugs. The nerve agent antidote 2-[(hydroxyiminomethyl]-1-methyl-pyridinium chloride (2-PAM or pralidoxime was effectively encapsulated into the pores of MIL-125-NH2 as a result of the interactions between 2-PAM and the pore walls being mediated by π-stacking and hydrogen bonds, as deduced from infrared spectroscopy and Monte Carlo simulation studies. Finally, colloidal solutions of MIL-125-NH2 nanoparticles exhibited remarkable stability in different organic media, aqueous solutions at different pH and under relevant physiological conditions over time (24 h. 2-PAM was rapidly released from the pores of MIL-125-NH2 in vitro.

  18. Memory load as a cognitive antidote to performance decrements in data entry.

    Science.gov (United States)

    Chapman, Mary J; Healy, Alice F; Kole, James A

    2016-10-01

    In two experiments, subjects trained in data entry, typing one 4-digit number at a time. At training, subjects either typed the numbers immediately after they appeared (immediate) or typed the previous number from memory while viewing the next number (delayed). In Experiment 2 stimulus presentation time was limited and either nothing or a space (gap) was inserted between the second and third digits. In both experiments after training, all subjects completed a test with no gap and typed numbers immediately. Training with a memory load improved speed across training blocks (Experiment 1) and eliminated the decline in accuracy across training blocks (Experiment 2), thus serving as a cognitive antidote to performance decrements. An analysis of each keystroke revealed different underlying processes and strategies for the two training conditions, including when encoding took place. Chunking (in which the first and last two digits are treated separately) was more evident in the immediate than in the delayed condition and was exaggerated with a gap, even at test when there was no gap. These results suggest that such two-digit chunking is due to stimulus encoding and motor planning processes as well as memory, and those processes transferred from training to testing.

  19. Review of UV spectroscopic, chromatographic, and electrophoretic methods for the cholinesterase reactivating antidote pralidoxime (2-PAM).

    Science.gov (United States)

    John, Harald; Blum, Marc-Michael

    2012-01-01

    Pralidoxime (2-PAM) belongs to the class of monopyridinium oximes with reactivating potency on cholinesterases inhibited by phosphylating organophosphorus compounds (OPC), for example, pesticides and nerve agents. 2-PAM represents an established antidote for the therapy of anticholinesterase poisoning since the late 1950s. Quite high therapeutic concentrations in human plasma (about 13 µg/ml) lead to concentrations in urine being about 100 times higher allowing the use of less sensitive analytical techniques that were used especially in the early years after 2-PAM was introduced. In this time (mid-1950s until the end of the 1970s) 2-PAM was most often analyzed by either paper chromatography or simple UV spectroscopic techniques omitting any sample separation step. These methods were displaced completely after the establishment of column liquid chromatography in the early 1980s. Since then, diverse techniques including cation exchange, size-exclusion, reversed-phase, and ligand-exchange chromatography have been introduced. Today, the most popular method for 2-PAM quantification is ion pair chromatography often combined with UV detection representing more than 50% of all column chromatographic procedures published. Furthermore, electrophoretic approaches by paper and capillary zone electrophoresis have been successfully used but are seldom applied. This review provides a commentary and exhaustive summary of analytical techniques applied to detect 2-PAM in pharmaceutical formulations and biological samples to characterize stability and pharmacokinetics as well as decomposition and biotransformation products. Separation techniques as well as diverse detectors are discussed in appropriate detail allowing comparison of individual preferences and limitations. In addition, novel data on mass spectrometric fragmentation of 2-PAM are provided. Copyright © 2011 John Wiley & Sons, Ltd.

  20. The Vitamin B12 Analog Cobinamide Is an Effective Antidote for Oral Cyanide Poisoning.

    Science.gov (United States)

    Lee, Jangwoen; Mahon, Sari B; Mukai, David; Burney, Tanya; Katebian, Behdod S; Chan, Adriano; Bebarta, Vikhyat S; Yoon, David; Boss, Gerry R; Brenner, Matthew

    2016-12-01

    Cyanide is a major chemical threat, and cyanide ingestion carries a higher risk for a supra-lethal dose exposure compared to inhalation but provides an opportunity for effective treatment due to a longer treatment window and a gastrointestinal cyanide reservoir that could be neutralized prior to systemic absorption. We hypothesized that orally administered cobinamide may function as a high-binding affinity scavenger and that gastric alkalinization would reduce cyanide absorption and concurrently increase cobinamide binding, further enhancing antidote effectiveness. Thirty New Zealand white rabbits were divided into five groups and were given a lethal dose of oral cyanide poisoning (50 mg). The survival time of animals was monitored with oral cyanide alone, oral cyanide with gastric alkalinization with oral sodium bicarbonate buffer (500 mg), and in combination with either aquohydroxocobinamide or dinitrocobinamide (250 mM). Red blood cell cyanide concentration, plasma cobinamide, and thiocyanate concentrations were measured from blood samples. In cyanide ingested animals, oral sodium bicarbonate alone significantly prolonged survival time to 20.3 ± 8.6 min compared to 10.5 ± 4.3 min in saline-treated controls, but did not lead to overall survival. Aquohydroxocobinamide and dinitrocobinamide increased survival time to 64 ± 41 (p cyanide concentration. Under all conditions, the plasma thiocyanate concentration gradually increased with time. This study demonstrates a promising new approach to treat high-dose cyanide ingestion, with gastric alkalinization alone and in combination with oral cobinamide for treating a supra-lethal dose of orally administered cyanide in rabbits.

  1. Plasmon–Phonon Coupling in Large-Area Graphene Dot and Antidot Arrays Fabricated by Nanosphere Lithography

    DEFF Research Database (Denmark)

    Zhu, Xiaolong; Wang, Weihua; Yan, Wei

    2014-01-01

    Nanostructured graphene on SiO2 substrates paves the way for enhanced light–matter interactions and explorations of strong plasmon–phonon hybridization in the mid-infrared regime. Unprecedented large-area graphene nanodot and antidot optical arrays are fabricated by nanosphere lithography......, with structural control down to the sub-100 nm regime. The interaction between graphene plasmon modes and the substrate phonons is experimentally demonstrated, and structural control is used to map out the hybridization of plasmons and phonons, showing coupling energies of the order 20 meV. Our findings...

  2. Intravenous Lipid Emulsion as an Antidote for the Treatment of Acute Poisoning: A Bibliometric Analysis of Human and Animal Studies.

    Science.gov (United States)

    Zyoud, Sa'ed H; Waring, W Stephen; Al-Jabi, Samah W; Sweileh, Waleed M; Rahhal, Belal; Awang, Rahmat

    2016-11-01

    In recent years, there has been increasing interest in the role of intravenous lipid formulations as potential antidotes in patients with severe cardiotoxicity caused by drug toxicity. The aim of this study was to conduct a comprehensive bibliometric analysis of all human and animal studies featuring lipid emulsion as an antidote for the treatment of acute poisoning. The Scopus database search was performed on 5 February 2016 to analyse the research output related to intravenous lipid emulsion as an antidote for the treatment of acute poisoning. Research indicators used for analysis included total number of articles, date (year) of publication, total citations, value of the h-index, document types, countries of publication, journal names, collaboration patterns and institutions. A total of 594 articles were retrieved from Scopus database for the period of 1955-2015. The percentage share of global intravenous lipid emulsion research output showed that research output was 85.86% in 2006-2015 with yearly average growth in this field of 51 articles per year. The USA, United Kingdom (UK), France, Canada, New Zealand, Germany, Australia, China, Turkey and Japan accounted for 449 (75.6%) of all the publications. The total number of citations for all documents was 9,333, with an average of 15.7 citations per document. The h-index of the retrieved documents for lipid emulsion research as antidote for the treatment of acute poisoning was 49. The USA and the UK achieved the highest h-indices, 34 and 14, respectively. New Zealand produced the greatest number of documents with international collaboration (51.9%) followed by Australia (50%) and Canada (41.4%) out of the total number of publications for each country. In summary, we found an increase in the number of publications in the field of lipid emulsion after 2006. The results of this study demonstrate that the majority of publications in the field of lipid emulsion were published by high-income countries. Researchers from

  3. Depth dependence of Neel wall pinning on amorphous Co {sub x} Si{sub 1-} {sub x} films with diluted arrays of elliptical antidots

    Energy Technology Data Exchange (ETDEWEB)

    Perez-Junquera, A. [Dpto. Fisica, Universidad de Oviedo, c/ Calvo Sotelo s/n, 33007 Oviedo (Spain); Martin, J.I. [Dpto. Fisica, Universidad de Oviedo, c/ Calvo Sotelo s/n, 33007 Oviedo (Spain)]. E-mail: jmartin@condmat.uniovi.es; Anguita, J.V. [Instituto de Microelectronica de Madrid, CNM-CSIC, Isaac Newton 8, PTM, Tres Cantos, 28760 Madrid (Spain); Rodriguez-Rodriguez, G. [Dpto. Fisica, Universidad de Oviedo, c/ Calvo Sotelo s/n, 33007 Oviedo (Spain) and Instituto Nacional del Carbon (INCAR), CSIC, c/Francisco Pintado Fe 26, 33011 Oviedo (Spain); Velez, M. [Dpto. Fisica, Universidad de Oviedo, c/ Calvo Sotelo s/n, 33007 Oviedo (Spain); Rubio, H. [Dpto. Fisica, Universidad de Oviedo, c/ Calvo Sotelo s/n, 33007 Oviedo (Spain); Alvarez-Prado, L.M. [Dpto. Fisica, Universidad de Oviedo, c/ Calvo Sotelo s/n, 33007 Oviedo (Spain); Alameda, J.M. [Dpto. Fisica, Universidad de Oviedo, c/ Calvo Sotelo s/n, 33007 Oviedo (Spain)

    2007-09-15

    Diluted arrays of elliptical antidots have been fabricated by optical lithography, electron beam lithography and plasma etching on amorphous Co{sub 74}Si{sub 26} magnetic films with a well-defined uniaxial anisotropy. The magnetic behavior of two identical antidot arrays but with different hole depth in comparison with film thickness has been studied by transverse magneto-optical Kerr effect. Significant differences appear in the coercivity depending on whether the magnetic film is completely perforated or not, indicating a much more effective domain wall pinning process when the depth of the holes is smaller than the magnetic film thickness.

  4. Effect of special modified clinoptylolite as an antidote used for treatment of radiocaesium contamination of broiler chicken

    International Nuclear Information System (INIS)

    Poschl, M.; Borkovec, V.; Zelenka, J.; Prochazka, J.

    1994-01-01

    The post-Chernobyl 137 Cs contamination caused gut uptake of this nuclide by ruminants, pigs and laying hens. The application of several clay minerals, stable caesium as well as hexacyanoferrate and related compounds has shown to be effective in reducing the gut uptake. The aim of this study was focused on a possibility of the suppression of gut uptake of 13 '7Cs from the contaminated feed mixture to broiler chicken and/or increasing the rate of excretion of 137 Cs from tissues of broiler chicken by a special food additive (RADECONT, i.e. 98% of clinoptilolite + 2% of FeHCF, made by BIOPOR, CZ). The antidote material RADECONT was added to the feed mixture 2 hours after application of artificially contaminated feed (5kBq of 137 Cs per chicken). The dose of the material was 0.5g per kg body weight and it was repeated daily. The control chickens were given 137 Cs but not antidote in the feed. Lower radiocaesium activities in breast and leg muscles (statistically significant, P 137 Cs administration. The biological half-lives of 137 Cs in the controls treated animals were similar. Application of RADECONT decreased the uptake of radiocaesium in tissues (by up to 20% in muscles) but did not enhance the excretion rate of 137 Cs. (author)

  5. Tailoring of Perpendicular Magnetic Anisotropy in Dy13Fe87 Thin Films with Hexagonal Antidot Lattice Nanostructure

    Directory of Open Access Journals (Sweden)

    Mohamed Salaheldeen

    2018-04-01

    Full Text Available In this article, the magnetic properties of hexagonally ordered antidot arrays made of Dy13Fe87 alloy are studied and compared with corresponding ones of continuous thin films with the same compositions and thicknesses, varying between 20 nm and 50 nm. Both samples, the continuous thin films and antidot arrays, were prepared by high vacuum e-beam evaporation of the alloy on the top-surface of glass and hexagonally self-ordered nanoporous alumina templates, which serve as substrates, respectively. By using a highly sensitive magneto-optical Kerr effect (MOKE and vibrating sample magnetometer (VSM measurements an interesting phenomenon has been observed, consisting in the easy magnetization axis transfer from a purely in-plane (INP magnetic anisotropy to out-of-plane (OOP magnetization. For the 30 nm film thickness we have measured the volume hysteresis loops by VSM with the easy magnetization axis lying along the OOP direction. Using magnetic force microscopy measurements (MFM, there is strong evidence to suggest that the formation of magnetic domains with OOP magnetization occurs in this sample. This phenomenon can be of high interest for the development of novel magnetic and magneto-optic perpendicular recording patterned media based on template-assisted deposition techniques.

  6. Purity of antidotal oxime HI-6 DMS as an active pharmaceutical ingredient for auto-injectors and infusions.

    Science.gov (United States)

    Bogan, Reinhard; Koller, Marianne; Klaubert, Bernd

    2012-01-01

    As reactivators of inhibited acetylcholinesterase, oximes are essential antidotes in poisoning by organophosphorus compounds. Due to its superior efficacy in cases of soman, cyclosarin, and sarin poisoning, the oxime HI-6 represents a promising option for an active pharmaceutical ingredient (API) in the further development of antidote therapy for nerve agent poisoning. Developmental lots of HI-6 DMS (dimethanesulfonate) provided by different manufacturers were examined with respect to their content and purity with a view to their future use as an API. There are distinct differences in the HI-6 content from three manufacturers. With respect to purity, gradual differences arise with the known synthetic by-products as well as with unknown accompanying compounds. It became apparent that in the case of a modified synthesis using protective groups, the proportion of some synthesis by-products decreases considerably. With one exception, they are thus below the reporting threshold for API in accordance with pertinent regulatory guidelines. In HI-6, an unknown impurity always occurs, whose percentage necessitates identification due to regulations. This unknown impurity, which has not been described so far, could be identified as an isomer. These findings supply data required for the description of pharmaceutical quality in accordance with module 3 of a Common Technical Document (CTD). They thus contribute to the marketing authorization of this substance as an API for auto-injectors and infusions. Copyright © 2012 John Wiley & Sons, Ltd.

  7. Chemical Reaction between Boric Acid and Phosphine Indicates Boric Acid as an Antidote for Aluminium Phosphide Poisoning

    Directory of Open Access Journals (Sweden)

    Motahareh Soltani

    2016-08-01

    Full Text Available Objectives: Aluminium phosphide (AlP is a fumigant pesticide which protects stored grains from insects and rodents. When it comes into contact with moisture, AlP releases phosphine (PH3, a highly toxic gas. No efficient antidote has been found for AlP poisoning so far and most people who are poisoned do not survive. Boric acid is a Lewis acid with an empty p orbital which accepts electrons. This study aimed to investigate the neutralisation of PH3 gas with boric acid. Methods: This study was carried out at the Baharlou Hospital, Tehran University of Medical Sciences, Tehran, Iran, between December 2013 and February 2014. The volume of released gas, rate of gas evolution and changes in pH were measured during reactions of AlP tablets with water, acidified water, saturated boric acid solution, acidified saturated boric acid solution, activated charcoal and acidified activated charcoal. Infrared spectroscopy was used to study the resulting probable adduct between PH3 and boric acid. Results: Activated charcoal significantly reduced the volume of released gas (P <0.01. Although boric acid did not significantly reduce the volume of released gas, it significantly reduced the rate of gas evolution (P <0.01. A gaseous adduct was formed in the reaction between pure AlP and boric acid. Conclusion: These findings indicate that boric acid may be an efficient and non-toxic antidote for PH3 poisoning.

  8. Industrialization and the increasing risk of genome instability in developing countries: nutrigenomics as a promising antidote.

    Science.gov (United States)

    Anetor, J I

    2010-12-01

    as much genome damage as that induced by exposure to a high dose of ionizing radiation. Even moderate folate deficiency causes very severe damage to the genome in the general population. All these accentuate the susceptibility of populations in these nations to environmental toxic assault requiring preventive measures employing the science of Nutrigenomics, probably augmented with adaptive response pathways such as the Nrf2 signaling pathway. Human populations in developing countries are increasingly exposed to a diverse array of industrial chemicals, which adversely modify the genome, the precursor of many diseases especially cancer. Nutrigenomics encompasses nutritional factors that protect the genome from damage and is a promising new field that can be exploited, perhaps augmented with the Nrf2 signaling pathway with international collaboration in these nations as an antidote to chemical-induced genome instability.

  9. Intramuscular versus Intraosseous Delivery of Nerve Agent Antidote Pralidoxime Chloride in Swine.

    Science.gov (United States)

    Uwaydah, Nabeel I; Hoskins, Stephen L; Bruttig, Stephen P; Farrar, Henry; Copper, Nick C; Deyo, Donald J; Dubick, Michael A; Kramer, George C

    2016-01-01

    Exposure to nerve agents requires prompt treatment. We hypothesized that intraosseous (IO) injections of drug antidotes into the vascularized bone marrow will provide a more rapid and effective means to treat exposure to nerve agents than standard intramuscular (IM) injections. We compared the pharmacokinetics of IM and IO administration of pralidoxime chloride (2-PAM Cl) during normovolemia and hypovolemia, as well as their combined administration during normovolemia in swine. Ten normovolemic swine were randomly administered 2 mL, 660 mg 2-PAM Cl via the IM or IO route and monitored for 180 minutes. IM versus IO also was compared in 8 hypovolemic swine bled to a mean arterial pressure of 50 mmHg. In a combined group, an IO injection was administered followed by an IM injection 60 minutes later. Blood samples were collected at times over a 180-minute period to calculate standard pharmacokinetic variables to compare the 2 routes of administration. In the normovolemic swine, IM injection achieved therapeutic levels (4 μg/mL) in 2 minutes, whereas IO infusion achieved these levels in less than 15 seconds. 2-PAM-Cl concentrations fell below these levels at 60 minutes post-injection in both groups. In the hypovolemic swine, IM injection achieved therapeutic levels in 4 minutes compared to less than 15 seconds in the IO group. 2-PAM-Cl concentrations fell below therapeutic levels at 12 and 90 minutes post-injection in the IM and IO groups, respectively. In the combined IO-IM treatment, plasma levels remained above therapeutic levels for the entire experiment and had two concentration peaks that corresponded to IO and IM injections. The IO route for the delivery of 2-PAM Cl provides a significant time and high initial blood concentrations advantage compared to the IM route for the prehospital treatment of nerve agent exposure even under hypovolemic conditions. The initial concentration peak associated with IO, but not IM, may provide greater initial therapy at the

  10. Structure Elucidation of A New Coumarin Type Compound, Alternamin, Isolated from the Plant (Murraya Alternans (Kurz) Swingle) Having The Antidote Activity on Snake Venoms

    International Nuclear Information System (INIS)

    Hla Myo Min; Mya Aye

    2004-06-01

    The structure of a new coumarin type compound isolated from the entitled species was elucidated by the full spectral analysis consisting of FTIR, 1H NMR, DQF COSY, 13C NMR, DEPT, EIMS (HR-EIMS), HMQC and HMBC. The antidote activities of the fresh juice and the ethanolic extract of the plant, and the isolated compound alternamin were also determined

  11. Comparison of the relative propensities of isoamyl nitrite and sodium nitrite to ameliorate acute cyanide poisoning in mice and a novel antidotal effect arising from anesthetics.

    Science.gov (United States)

    Cambal, Leah K; Weitz, Andrew C; Li, Hui-Hua; Zhang, Yang; Zheng, Xi; Pearce, Linda L; Peterson, Jim

    2013-05-20

    Isoamyl nitrite has previously been considered acceptable as an inhaled cyanide antidote; therefore, the antidotal utility of this organic nitrite compared with sodium nitrite was investigated. To facilitate a quantitative comparison, doses of both sodium nitrite and isoamyl nitrite were given intraperitoneally in equimolar amounts to sublethally cyanide-challenged mice. Righting recovery from the knockdown state was clearly compromised in the isoamyl nitrite-treated animals, the effect being attributable to the toxicity of the isoamyl alchol produced during hydrolysis of the isoamyl nitrite to release nitrite anion. Subsequently, inhaled aqueous sodium nitrite aerosol was demonstrated to ameliorate sublethal cyanide toxicity, when provided to mice after the toxic dose, by the more rapid recovery of righting ability compared to that of the control animals given only the toxicant. Aerosolized sodium nitrite has thus been shown by these experiments to have promise as a better alternative to organic nitrites for development as an inhaled cyanide antidote. The inhaled sodium nitrite led to the production of NO in the bloodstream as determined by the appearance of EPR signals attributable to nitrosylhemoglobin and methemoglobin. The aerosol delivery was performed in an unmetered inhalation chamber, and in this study, no attempt was made to optimize the procedure. It is argued that administration of an effective inhaled aqueous sodium nitrite dose in humans is possible, though just beyond the capability of current individual metered-dose inhaler designs, such as those used for asthma. Finally, working at slightly greater than LD50 NaCN doses, it was fortuitously discovered that (i) anesthesia leads to significantly prolonged survival compared to that of unanesthetized animals and that (ii) the antidotal activity of nitrite anion was completely abolished under anesthesia. Plausible explanations for these effects in mice and their practical consequences in relation to

  12. Observation of a hole-size-dependent energy shift of the surface-plasmon resonance in Ni antidot thin films

    Energy Technology Data Exchange (ETDEWEB)

    Fang, H.; Akinoglu, E. M.; Fumagalli, P., E-mail: paul.fumagalli@fu-berlin.de [Institut für Experimentalphysik, Freie Universität Berlin, 14195 Berlin (Germany); Caballero, B.; García-Martín, A. [IMM-Instituto de Microelectrónica de Madrid (CNM-CSIC), Isaac Newton 8, PTM, Tres Cantos, E-28760 Madrid (Spain); Papaioannou, E. Th. [Fachbereich Physik and Landesforschungszentrum OPTIMAS, Technische Universität Kaiserslautern, 67663 Kaiserslautern (Germany); Cuevas, J. C. [Departamento de Física Teórica de la Materia Condensada and Condensed Matter Physics Center (IFIMAC), Universidad Autónoma de Madrid, E-28049 Madrid (Spain); Giersig, M. [Institut für Experimentalphysik, Freie Universität Berlin, 14195 Berlin (Germany); Helmholtz Zentrum Berlin, Institute of Nanoarchitectures for Energy Conversion, 14195 Berlin (Germany)

    2015-04-13

    A combined experimental and theoretical study of the magneto-optic properties of a series of nickel antidot thin films is presented. The hole diameter varies from 869 down to 636 nm, while the lattice periodicity is fixed at 920 nm. This results in an overall increase of the polar Kerr rotation with decreasing hole diameter due to the increasing surface coverage with nickel. In addition, at photon energies of 2.7 and 3.3 eV, where surface-plasmon excitations are expected, we observe distinct features in the polar Kerr rotation not present in continuous nickel films. The spectral position of the peaks exhibits a red shift with decreasing hole size. This is explained within the context of an effective medium theory by a change in the effective dielectric function of the Ni thin films.

  13. When the GERM Hosts the Antidote: The Surprising New Birth of Israel's Anti-GERM Pre-K Policy

    Directory of Open Access Journals (Sweden)

    Gadi Bialik

    2017-09-01

    Full Text Available Since the 1970s, Israel's educational policy has been undergoing a change generated by the neo-liberal agenda. In this light, it is not surprising that since the 1990s, Israel’s education system has adopted the main characteristics of the Global Education Reform Movement (GERM. In light of this, the current research will focus on a newly born pre-K policy formation process that set out as GERM-like in nature, but nevertheless ended up with anti-GERM characteristics. Using historical-narrative qualitative tools, this paper will portray and analyze the main factors that generated the new anti-GERMian reform. We will outline conclusions from the Israeli case study to create a potential conceptual framework that highlights a more complex, hybrid, or dual outlook at the GERM containing its antidote within itself.

  14. Intravenous Cobinamide, a Novel Cyanide Antidote, versus Hydroxocobalamin in the Treatment of Acute Cyanide Toxicity and Apnea in a Swine (Sus scrofa) Model

    Science.gov (United States)

    2013-02-12

    and severe toxicity. Cobinamide was 5 times as potent as hydroxocobalamin. hydroxocobalamin, cobinamide, cyanide , poisoning , Vitamin B12a, Vit B12...treatment of acute, severe cyanide induced cardiotoxicity of severe hypotension and of cardiac arrest in a swine (Sus Scrofa) model Intravenous...cobinamide, a novel cyanide antidote, versus hydroxocobalamin in the treatment of acute cyanide toxicity and apnea in a swine (Sus Scrofa) model

  15. The I{sub c}(H)-T{sub c}(H) phase boundary of superconducting Nb thin films with periodic and quasiperiodic antidot arrays

    Energy Technology Data Exchange (ETDEWEB)

    Bothner, D.; Kemmler, M.; Cozma, R.; Kleiner, R.; Koelle, D. [Physikalisches Institut and Center for Collective Quantum Phenomena, Universitaet Tuebingen (Germany); Misko, V.; Peeters, F. [Departement Fysica, Universiteit Antwerpen (Belgium); Nori, F. [Advanced Science Institute, RIKEN (Japan)

    2011-07-01

    The magnetic field dependent critical current I{sub c}(H) of superconducting thin films with artificial defects strongly depends on the symmetry of the defect arrangement. Likewise the critical temperature T{sub c}(H) of superconducting wire networks is heavily influenced by the symmetry of the system. Here we present experimental data on the I{sub c}(H)-T{sub c}(H) phase boundary of Nb thin films with artificial defect lattices of different symmetries. For this purpose we fabricated 60 nm thick Nb films with antidots in periodic (triangular) and five different quasiperiodic arrangements. The parameters of the antidot arrays were varied to investigate the influence of antidot diameter and array density. Experiments were performed with high temperature stability ({delta}T<1 mK) at 0.5{<=}T/T{sub c}{<=}1. From the I-V-characteristics at variable H and T we extract I{sub c}(H) and T{sub c}(H) for different voltage and resistance criteria. The experimental data for the critical current density are compared with results from numerical molecular dynamics simulations.

  16. Cinnamon (Cinnamomum zeylanicum) as an antidote or a protective agent against natural or chemical toxicities: a review.

    Science.gov (United States)

    Dorri, Mahyar; Hashemitabar, Shirin; Hosseinzadeh, Hossein

    2018-01-10

    Cinnamon (Cinnamomum zeylanicum, Lauraceae) is a food additive greatly used for its taste. However, recently this medicinal plant has been brought to attention due to its medical effects. Cinnamon has constituents such as cinnamaldehyde and cinnamic acid that offers some health benefits including antioxidant and free-radical scavenging properties, lowering of blood glucose, anti-cholesterolemic, analgesic, antimicrobial, anti-inflammatory, anti-yeast, anti-secretagogue, and anti-gastric ulcer effects. This review summarizes various in vitro and animal studies on the protective effects of cinnamon against natural and chemical toxins. These studies consider the antidotal and/or protective effects of cinnamon and its major constituents against natural toxins and chemical-induced toxicities. It has been mentioned that cinnamon and its main constituents can ameliorate the toxicity of chemical toxins in liver, kidney, blood, brain, embryo, reproductive system, heart, spleen in part through antioxidant effect, radical scavenging, reducing lipid peroxidation, anti-inflammatory, fungistatic and fungicidal activities, modulation of CK-MB, LDH, TNF-α, IL-6, mitogen-activated protein kinase (MAPK), and nuclear factor-ĸB (NF-ĸB) signaling pathways.

  17. Glutathione as an antidote for sulfur mustard poisoning: Mass spectrometric investigations of its potency as a chemical scavenger.

    Science.gov (United States)

    Siegert, Markus; Kranawetvogl, Andreas; Thiermann, Horst; John, Harald

    2017-12-23

    The banned chemical warfare agent sulfur mustard (SM) still represents a serious threat to civilians and military personnel. Therefore, identification of antidotes and scavengers is of high concern. One promising substance is glutathione (GSH). GSH is known to mitigate symptoms of SM poisoning in vitro and in vivo. However, the mechanism of action remains unclear with respect to physiological impact as well as chemical scavenging by reaction between GSH and SM. Therefore, a novel in vitro method was used to characterize the scavenging potential of GSH. Accordingly, alkylation of human serum albumin (HSA), which represents an established biomarker for SM intoxication, was used as a measure for remaining SM. Coincubation of GSH and SM in human serum was performed, and time-dependent degradation of SM was monitored in the presence and absence of GSH. Protein-derived and small molecular reaction products between GSH, HSA, and SM were analyzed using microbore liquid chromatography-electrospray ionization high-resolution tandem-mass spectrometry. Although covalent modification of GSH by SM was observed, measurements clearly documented no significant reduction of SM concentration in the presence of GSH. Accordingly, beneficial therapeutic mechanisms of GSH in the case of SM poisoning would appear to be based on physiological effects than on chemical scavenging. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Relationship-centred care: antidote, guidepost or blind alley? The epistemology of 21st century health care.

    Science.gov (United States)

    Wyer, Peter C; Alves Silva, Suzana; Post, Stephen G; Quinlan, Patricia

    2014-12-01

    Contemporary health care is increasing in complexity and lacks a unifying understanding of epistemology, methodology and goals. Lack of conceptual consistency in concepts such as 'patient-centred care' (PCC) typifies system-wide discordance. We contrast the fragmented descriptions of PCC and related tools to its own origins in the writings of Balint and to a subsequent construct, relationship-centred care (RCC). We identify the explicit and elaborated connection between RCC and a defined epistemological foundation as a distinguishing feature of the construct and we demonstrate that this makes possible the recognition of alignments between RCC and independently developed constructs. Among these, we emphasize Schon's reflective practice, Nonaka's theory of organizational knowledge creation and the research methodology of realist synthesis. We highlight the relational principles common to these domains and to their common epistemologies and illustrate unsatisfying consequences of adherence to less adequate epistemological frameworks such as positivism. We offer RCC not as an 'antidote' to the dilemmas identified at the outset but as an example that illuminates the value and importance of explicit identification of the premises and assumptions underlying approaches to improvement of the health care system. We stress the potential value of identifying epistemological affinities across otherwise disparate fields and disciplines. © 2014 John Wiley & Sons, Ltd.

  19. Chemical Reaction between Boric Acid and Phosphine Indicates Boric Acid as an Antidote for Aluminium Phosphide Poisoning.

    Science.gov (United States)

    Soltani, Motahareh; Shetab-Boushehri, Seyed F; Shetab-Boushehri, Seyed V

    2016-08-01

    Aluminium phosphide (AlP) is a fumigant pesticide which protects stored grains from insects and rodents. When it comes into contact with moisture, AlP releases phosphine (PH3), a highly toxic gas. No efficient antidote has been found for AlP poisoning so far and most people who are poisoned do not survive. Boric acid is a Lewis acid with an empty p orbital which accepts electrons. This study aimed to investigate the neutralisation of PH3 gas with boric acid. This study was carried out at the Baharlou Hospital, Tehran University of Medical Sciences, Tehran, Iran, between December 2013 and February 2014. The volume of released gas, rate of gas evolution and changes in pH were measured during reactions of AlP tablets with water, acidified water, saturated boric acid solution, acidified saturated boric acid solution, activated charcoal and acidified activated charcoal. Infrared spectroscopy was used to study the resulting probable adduct between PH3 and boric acid. Activated charcoal significantly reduced the volume of released gas (P poisoning.

  20. Hemostatic effects of the ticagrelor antidote MEDI2452 in pigs treated with ticagrelor on a background of aspirin.

    Science.gov (United States)

    Pehrsson, S; Johansson, K J; Janefeldt, A; Sandinge, A-S; Maqbool, S; Goodman, J; Sanchez, J; Almquist, J; Gennemark, P; Nylander, S

    2017-06-01

    Essentials MEDI2452 is a specific antidote of the platelet P2Y 12 receptor antagonist ticagrelor. Hemostatic effects of MEDI2452 were evaluated in pigs treated with ticagrelor and aspirin. MEDI2452 eliminated free ticagrelor within 5 min and gradually normalized platelet aggregation. Improvements in blood pressure (significant) and in blood-loss and survival (non-significant) were observed. Background Ticagrelor, a P2Y 12 antagonist, is approved for the prevention of thromboembolic events. However, antiplatelet therapies carry a risk of bleeding. Objective To explore the hemostatic effects of MEDI2452, an antidote for ticagrelor. Methods Pigs, pre-treated with aspirin, were given an intravenous infusion of ticagrelor or vehicle. At the end of the infusion, a piece of a liver lobe was cut off and a bolus of MEDI2452 or vehicle was administered intravenously. Blood was collected to monitor blood loss, mean arterial blood pressure (MAP) was recorded and survival time was observed over 4 h. Blood samples for drug plasma exposures and platelet aggregation were collected. Results MEDI2452 eliminated the free concentrations of ticagrelor and its active metabolite AR-C124910XX within 5 min. ADP-induced platelet aggregation was close to normal at 60 min, which was not significantly different from aspirin alone. MEDI2452 numerically reduced ticagrelor-mediated effects: body-weight-adjusted blood loss in the 15- to 90-min interval, 12 (confidence interval [CI] 95% 7-28] vs. 17 (CI 95% 5-31) (ticagrelor and aspirin) vs. 5 (CI 95% 3-9) mL kg -1 (aspirin alone), survival 70% (CI 95% 47-100) vs. 45% (CI 95% 21-92) (ticagrelor and aspirin) vs. 100% (CI 95% 100-100) (aspirin alone), and median survival time, 240 (CI 95% 180-240) vs. 169 (CI 95% 64-240) (ticagrelor and aspirin) vs. 240 (CI 95% 240-240) min (aspirin alone). Finally, MEDI2452 significantly attenuated the decline in MAP, 0.08 (CI 95% 0.07-0.09) vs. 0.141 (CI 95% 0.135-0.148) (ticagrelor and aspirin) vs. 0.04 (CI 95% 0

  1. Lipid profile and atherogenic predictor indices of albino rabbits administered coconut water as antidote to paracetamol overdose

    Directory of Open Access Journals (Sweden)

    Chidi Uzoma Igwe

    2016-11-01

    Full Text Available Objective: To investigate the effects of coconut water intake on lipid profile and atherogenic predictor indices of albino rabbits overdosed with paracetamol using standard methods. Methods: Thirty-five albino rabbits weighing between 800–1200 g and aged between 2 and 3 months, were divided into 7 groups (I–VII of 5 animals each. Groups I, II and III were orally administered distilled water (20 mL/kg body weight, coconut water (20 mL/kg body weight and paracetamol (1000 mg/kg body weight respectively, for 7 days. Groups IV and V were administered coconut water (20 mL/kg body weight and silymarin (35 mg/kg body weight, respectively, for 6 days, then paracetamol (1000 mg/kg body weight on the 7th day. Groups VI and VII were administered distilled water for 6 days, paracetamol on the 7th day, then coconut water and silymarin, respectively, after 3 h. Results: The results showed that paracetamol overdose significantly reduced (P < 0.05 the mean body weight of the animals, increased the concentrations of serum total cholesterol, triacylglycerol, very low density lipoprotein cholesterol, low density lipoprotein cholesterol and the atherogenic predictor indices but reduced the serum high density lipoprotein cholesterol concentration of the animals relative to the control. The observed changes in the lipid profile and atherogenic predictor indices were countered more by post- than pre-treatment with coconut water and silymarin. Conclusions: The results indicated that coconut water acted as an effective antidote to paracetamol overdose-induced lipid abnormality in animals.

  2. Utilisation de l'assistant grammatical Antidote dans le cadre d'activités de révision - Analyse exploratoire de protocoles d'observation Using Antidote in Revision Tasks: An Exploratory Study of Grammar Checker Usage Through Verbal Protocol Analysis

    Directory of Open Access Journals (Sweden)

    Patrick Durel

    2006-06-01

    Full Text Available Cette étude examine les opérations mentales d'apprenants utilisant l'assistant grammatical Antidote en phase de révision de leurs productions écrites. Analysant des données obtenues à partir de la méthode des protocoles verbaux, ce travail montre comment ce type d'activité de révision assistée par ordinateur conduit l'apprenant à manipuler, construire, renforcer ou élargir le champ d'application de ses connaissances, qu'elles soient déclaratives ou procédurales. Les éléments dégagés indiquent que l'utilisation d'Antidote peut être vecteur d'apprentissage et offrent quelques pistes permettant de concevoir des activités de révision assistée par ordinateur qui s'inscrivent dans le cadre d'une didactique de la production scripturale.This study explores learners' cognitive processes when using the grammar assistant software Antidote during the revision phase of their composition. Analysing data obtained using a hybrid form of verbal protocols, it shows how computer-assisted revision activity can lead learners to manipulate, build or reinforce declarative and procedural knowledge. We argue that using grammar assistant software can be conducive to learning. The results of the analysis provide an insight into how such a tool can be integrated into classroom activities, contributing to writing quality and the acquisition of revision strategies.

  3. Fructose-1, 6-diphosphate (FDP as a novel antidote for yellow oleander-induced cardiac toxicity: A randomized controlled double blind study

    Directory of Open Access Journals (Sweden)

    Dawson Andrew H

    2010-06-01

    Full Text Available Abstract Background Cardiac toxicity due to ingestion of oleander plant seeds in Sri Lanka and some other South Asian countries is very common. At present symptomatic oleander seed poisoning carries a mortality of 10% in Sri Lanka and treatment of yellow oleander poisoning is limited to gastric decontamination and atropine administration. The only proven effective antidote is digoxin antibodies but these are not available for routine use because of the high cost. The main objective of this study is to investigate the effectiveness of a new and inexpensive antidote for patients with life threatening arrhythmias due oleander poisoning. Method/design We set up a randomised double blind clinical trial to assess the effectiveness of Fructose 1, 6 diphosphate (FDP in acute yellow oleander poisoning patients admitted to the adult medical wards of a tertiary hospital in Sri Lanka. Patients will be initially resuscitated following the national guidelines and eligible patients will be randomised to receive either FDP or an equal amount of normal saline. The primary outcome measure for this study is the sustained reversion to sinus rhythm with a heart rate greater than 50/min within 2 hours of completion of FDP/placebo bolus. Secondary outcomes include death, reversal of hyperkalaemia on the 6, 12, 18 and 24 hour samples and maintenance of sinus rhythm on the holter monitor. Analysis will be on intention-to-treat. Discussion This trial will provide information on the effectiveness of FDP in yellow oleander poisoning. If FDP is effective in cardiac glycoside toxicity, it would provide substantial benefit to the patients in rural Asia. The drug is inexpensive and thus could be made available at primary care hospitals if proven to be effective. Trial Registration Current Controlled trial ISRCTN71018309

  4. Trends in toxic alcohol exposures in the United States from 2000 to 2013: a focus on the use of antidotes and extracorporeal treatments.

    Science.gov (United States)

    Ghannoum, Marc; Hoffman, Robert S; Mowry, James B; Lavergne, Valery

    2014-01-01

    Morbidity and mortality from toxic alcohols like ethylene glycol and methanol remain prevalent worldwide. The introduction of fomepizole, a potent blocker of alcohol dehydrogenase, has modified current practice over the last 15 years. The aim of the study was to describe the characteristics of toxic alcohol poisoning reported to US poison centers, the trends in the incidence of antidote use and hemodialysis treatment, as well as the related mortality. A retrospective study of all electronic entries from the AAPCC National Poison Data System database, from the years 2000 to 2013 was reviewed. When considering all exposures, the great majority of patients had a benign outcome. Major effects (e.g., life threatening) occurred in 2.1% and 4.9% of methanol and ethylene glycol cases, respectively. Mortality rates were similar for both toxic alcohols, approximately 0.6%. When only considering ingestions reported to healthcare facilities, a major effect was reported in 9.5% and 20.5%, and the mortality rate was 2.9% and 2.4% for methanol and ethylene glycol exposures, respectively, and remained constant over time. The use of fomepizole increased statistically over the study period while that of ethanol decreased, until it became proportionally negligible by 2012-2013. The use of hemodialysis significantly decreased in "Early" ethylene glycol exposures during the study period. Similar to other reports, it appears that the use of fomepizole has largely supplanted ethanol as the antidote of choice in toxic alcohol exposures and may decrease the requirements for hemodialysis in patients poisoned with ethylene glycol who have no acidosis and normal kidney function. © 2014 Wiley Periodicals, Inc.

  5. SYNTHESIS OF TETRAKIS-N,N,N-TRIMETHYLAMMONIUMMETHYL-C-3,4-DIMETHOXYPHENYLCALIX[4]RESORCINARENE IODIDE BASED VANILLIN AND ITS ANTIDOTE ACTIVITY FOR CHROMIUM(VI INTOXICATION

    Directory of Open Access Journals (Sweden)

    Suryadi Budi Utomo

    2013-08-01

    Full Text Available A research has been conducted to synthesize tetrakis-N,N,N-trimethylammoniummethyl-C-3,4-dimethoxyphenylcalix[4]resorcinarene iodide from vanillin and investigate its antidote capability for Cr(VI intoxication. The synthesis was carried out in four steps i.e. (1 O-alkylation of 4-hydroxy-3-methoxybenzaldehyde, (2 HCl-catalyzed condensation of 3,4-dimethoxybenzaldehyde with resorcinol, (3 Mannich reaction of C-3,4-dimethoxyphenylcalix[4]resorcinarene with formaldehyde and dimethylamine in the presence of HCl to yield tetrakis-N,N-dimethylaminomethyl-C-3,4-dimethoxyphenylcalix[4]resorcinarene, and (4 treatment the Mannich base with methyl iodide to produce the quaternary ammonium salt of tetrakis-N,N,N-trimethylammoniummethyl-C-3,4-dimethoxyphenylcalix[4]resorcinarene iodide. According to the analysis of 1H-NMR spectrometer, the targeted compounds tend to exist in the chair (C2h conformation. The capability of resorcinarene for Cr(VI antidote was examined by orally injection method on mice groups. Based on LD50 determination, the resorcinarene was classified as non toxic compound according to Loomis criteria. Therapeutic using quaternary ammonium-modified resorcinarene was able to reduce metal concentrations of Cr(VI in liver, kidney, and serum in the magnitude of 78.30; 85.72, and 88.79%, respectively. The higher dose of drug administered the greater decrease in the level of heavy metal. Judging from the amount of milligrams of reduced chromium per gram of organ, kidney is the organ having highest decreasing metal concentrations.

  6. Acute, Sub-lethal Cyanide Poisoning in Mice is Ameliorated by Nitrite Alone: Complications Arising from Concomitant Administration of Nitrite and Thiosulfate as an Antidotal Combination

    Science.gov (United States)

    Cambal, Leah K.; Swanson, Megan R.; Yuan, Quan; Weitz, Andrew C.; Li, Hui-Hua; Pitt, Bruce R.; Pearce, Linda L.; Peterson, Jim

    2011-01-01

    Sodium nitrite alone is shown to ameliorate sub-lethal cyanide toxicity in mice when given from ~1 hour before until 20 minutes after the toxic dose as demonstrated by the recovery of righting ability. An optimum dose (12 mg/kg) was determined to significantly relieve cyanide toxicity (5.0 mg/kg) when administered to mice intraperitoneally. Nitrite so administered was shown to rapidly produce NO in the bloodsteam as judged by the dose dependent appearance of EPR signals attributable to nitrosylhemoglobin and methemoglobin. It is argued that antagonism of cyanide inhibition of cytochrome c oxidase by NO is the crucial antidotal activity rather than the methemoglobin-forming action of nitrite. Concomitant addition of sodium thiosulfate to nitrite-treated blood resulted in the detection of sulfidomethemoblobin by EPR spectroscopy. Sulfide is a product of thiosulfate hydrolysis and, like cyanide, is known to be a potent inhibitor of cytochrome c oxidase; the effects of the two inhibitors being essentially additive under standard assay conditions, rather than dominated by either one. The findings afford a plausible explanation for an observed detrimental effect in mice associated with the use of the standard nitrite-thiosulfate combination therapy at sub-lethal levels of cyanide intoxication. PMID:21534623

  7. Acute, sublethal cyanide poisoning in mice is ameliorated by nitrite alone: complications arising from concomitant administration of nitrite and thiosulfate as an antidotal combination.

    Science.gov (United States)

    Cambal, Leah K; Swanson, Megan R; Yuan, Quan; Weitz, Andrew C; Li, Hui-Hua; Pitt, Bruce R; Pearce, Linda L; Peterson, Jim

    2011-07-18

    Sodium nitrite alone is shown to ameliorate sublethal cyanide toxicity in mice when given from ∼1 h before until 20 min after the toxic dose as demonstrated by the recovery of righting ability. An optimum dose (12 mg/kg) was determined to significantly relieve cyanide toxicity (5.0 mg/kg) when administered to mice intraperitoneally. Nitrite so administered was shown to rapidly produce NO in the bloodsteam as judged by the dose-dependent appearance of EPR signals attributable to nitrosylhemoglobin and methemoglobin. It is argued that antagonism of cyanide inhibition of cytochrome c oxidase by NO is the crucial antidotal activity rather than the methemoglobin-forming action of nitrite. Concomitant addition of sodium thiosulfate to nitrite-treated blood resulted in the detection of sulfidomethemoblobin by EPR spectroscopy. Sulfide is a product of thiosulfate hydrolysis and, like cyanide, is known to be a potent inhibitor of cytochrome c oxidase, the effects of the two inhibitors being essentially additive under standard assay conditions rather than dominated by either one. The findings afford a plausible explanation for an observed detrimental effect in mice associated with the use of the standard nitrite-thiosulfate combination therapy at sublethal levels of cyanide intoxication. © 2011 American Chemical Society

  8. Investigation of oxidative stress in blood, brain, kidney, and liver after oxime antidote HI-6 application in a mouse experimental model.

    Science.gov (United States)

    Pohanka, Miroslav; Sobotka, Jakub; Svobodova, Hana; Stetina, Rudolf

    2011-07-01

    Oxime reactivator HI-6 (asoxime, in some sources) is a potent antidote suitable for treatment of intoxication by nerve agents. Despite the fact that HI-6 is considered for practical application in emergency situations, the impact of HI-6 on patients' bodies has not been established yet. The present experiment was carried out in order to estimate whether HI-6 would be able to trigger or protect from oxidative stress in a BALB/c mice model. HI-6 was applied in doses ranging from 0.2 to 20% of LD₅₀. Ferric-reducing antioxidant power (FRAP), thiobarbituric acid reactive substances (TBARS), reduced glutathione (GSH), and glutathione reductase (GR) were assayed in the blood, liver, kidney, and brain of treated animals. It was found that HI-6 does not increase GR or TBARS. On the contrary, TBARS levels in the brain and liver were found to be significantly decreased in HI-6-treated animals. Pertinent antioxidant properties of HI-6 were excluded by the FRAP method. Endogenous antioxidants were unchanged, with the exception of the kidney. Low-molecular-weight antioxidants assayed by the FRAP method were significantly decreased in kidneys of animals treated with HI-6. However, GSH partially recovered the loss of the other low-molecular-weight antioxidants and was significantly increased in the kidney of HI-6-exposed mice. HI-6 potential to produce nephropathy is hypothesized. The achieved conclusions were quite surprising and showed a complex impact of HI-6 on the body.

  9. [Antidotal effects of sulfhydryl compounds on acute poisonings by sodium ammonium dimethyl-2-(propane-1,3-dithiosulfate) monohydrate, nereistoxin and cartap].

    Science.gov (United States)

    Cao, B J; Chen, Z K; Chi, Z Q

    1990-03-01

    Sodium dimercaptopropanesulphonate (DMPS) and sodium dimercaptosuccinate (DMS) were discovered to be effective antidotes for acute poisoning of insecticides SCD [sodium ammonium dimethyl-2-(propane-1,3-dithiosulfate) monohydrate], nereistoxin (4-N,N-dimethylamino-1,2-dithiolane) and cartap (dihydronereistoxin dicarbamate). In mice, DMPS (250 mg/kg) or DMS (1000 mg/kg) ip 20 min before SCD increased LD50 of ig SCD from 97 to 374 or 251 mg/kg, respectively. The prophylactic effect of DMPS was better than that of DMS. Administration of DMPS prior to cartap increased LD50 of ig cartap from 130 to 375 mg/kg. The therapeutic effect of DMPS was also demonstrated in SCD-poisoned conscious rabbits. DMPS 62.5 mg/kg or DMS 500 mg/kg iv completely antagonized the neuromuscular blockade and respiratory depression caused by SCD, nereistoxin and cartap in anesthetized rabbits. The antagonism of SCD-induced neuromuscular blockade by cysteine (400 mg/kg, iv) was less effective and of shorter duration than that by DMPS and DMS. Dimercaprol 50 mg/kg im showed little effect on SCD-induced paralysis. The antagonistic actions of sulfhydryl compounds on neuromuscular blockade induced by these insecticides probably belong to chemical antagonism.

  10. Crystallization of the C-terminal domain of the addiction antidote CcdA in complex with its toxin CcdB

    International Nuclear Information System (INIS)

    Buts, Lieven; De Jonge, Natalie; Loris, Remy; Wyns, Lode; Dao-Thi, Minh-Hoa

    2005-01-01

    The CcdA C-terminal domain was crystallized in complex with CcdB in two crystal forms that diffract to beyond 2.0 Å resolution. CcdA and CcdB are the antidote and toxin of the ccd addiction module of Escherichia coli plasmid F. The CcdA C-terminal domain (CcdA C36 ; 36 amino acids) was crystallized in complex with CcdB (dimer of 2 × 101 amino acids) in three different crystal forms, two of which diffract to high resolution. Form II belongs to space group P2 1 2 1 2 1 , with unit-cell parameters a = 37.6, b = 60.5, c = 83.8 Å and diffracts to 1.8 Å resolution. Form III belongs to space group P2 1 , with unit-cell parameters a = 41.0, b = 37.9, c = 69.6 Å, β = 96.9°, and diffracts to 1.9 Å resolution

  11. Catalytic-site conformational equilibrium in nerve-agent adducts of acetylcholinesterase: possible implications for the HI-6 antidote substrate specificity.

    Science.gov (United States)

    Artursson, Elisabet; Andersson, Per Ola; Akfur, Christine; Linusson, Anna; Börjegren, Susanne; Ekström, Fredrik

    2013-05-01

    Nerve agents such as tabun, cyclosarin and Russian VX inhibit the essential enzyme acetylcholinesterase (AChE) by organophosphorylating the catalytic serine residue. Nucleophiles, such as oximes, are used as antidotes as they can reactivate and restore the function of the inhibited enzyme. The oxime HI-6 shows a notably low activity on tabun adducts but can effectively reactivate adducts of cyclosarin and Russian VX. To examine the structural basis for the pronounced substrate specificity of HI-6, we determined the binary crystal structures of Mus musculus AChE (mAChE) conjugated by cyclosarin and Russian VX and found a conformational mobility of the side chains of Phe338 and His447. The interaction between HI-6 and tabun-adducts of AChE were subsequently investigated using a combination of time resolved fluorescence spectroscopy and X-ray crystallography. Our findings show that HI-6 binds to tabun inhibited Homo sapiens AChE (hAChE) with an IC50 value of 300μM and suggest that the reactive nucleophilic moiety of HI-6 is excluded from the phosphorus atom of tabun. We propose that a conformational mobility of the side-chains of Phe338 and His447 is a common feature in nerve-agent adducts of AChE. We also suggest that the conformational mobility allow HI-6 to reactivate conjugates of cyclosarin and Russian VX while a reduced mobility in tabun conjugated AChE results in steric hindrance that prevents efficient reactivation. Copyright © 2013 Elsevier Inc. All rights reserved.

  12. Neutralizing activities of ethanolic extracts of six plants traditionally used in Guatemala as antidotes for the envenomation caused by the snake Bothrops asper

    Directory of Open Access Journals (Sweden)

    Patricia Saravia-Otten

    2015-07-01

    Full Text Available Many plants are reported to be used in Guatemalan traditional medicine as antidotes against various effects of the snakebite; however, very few attempts have been made to evaluate their neutralizing capacity in controlled experiments. Six plants (Acacia hindsii, Cissampelos pareira; Hamelia patens, Piper peltatum, Sansevieria hyacinthoides and Aristolochia maxima were evaluated in vitro for their ability to neutralize phospholipase A2(PLA2 and proteolytic effects of the venom of Bothrops asper, the snake responsible for approximately half of the snakebite envenomations in Central America. These effects are indicatives of the ability of B. asper venom to produce myotoxicity, hemorrhage and inflammation. Plants were collected, dried and extracted by maceration with ethanol. After pre-incubation of several amounts of each extract with a challenge dose of venom, S. hyacinthoides demonstrated a low neutralizing capacity (< DE 50 of the PLA2 effect (13.90 ± 6.41%; C. pareira (32.98 ± 5.51% and P. peltatum (24.52 ± 7.45% neutralized less than 50% of the proteolytic effect. The results suggest that neither of the tested plants should be used individually to treat the main effects of B. asper envenomation. However, the three low-active extracts might be potentiated when used in mixtures composed of several plants, as prepared by traditional healers. Given the complexity of the venom components and the multiple pathologic effects produced by B. asper envenomation, more tests are required to fully investigate the ability of this plants to neutralize the coagulant, fibrin(ogenolytic, edematizing and myotoxic effects of the venom.

  13. Evaluation of the Influence of Three Newly Developed Bispyridinium Anti-nicotinic Compounds (MB408, MB442, MB444) on the Efficacy of Antidotal Treatment of Nerve Agent Poisoning in Mice.

    Science.gov (United States)

    Kassa, Jiri; Timperley, Christopher M; Bird, Mike; Williams, Rebecca L; Green, A Christopher; Tattersall, John E H

    2018-04-01

    The influence of three newly developed bispyridinium antinicotinic compounds (the non-oximes MB408, MB442 and MB444) on the therapeutic efficacy of a standard antidotal treatment (atropine in combination with an oxime) of acute poisoning by the organophosphorus nerve agents tabun and soman was studied in mice. The therapeutic efficacy of atropine in combination with an oxime with or without one of the bispyridinium non-oximes was evaluated by determination of the LD 50 values of the nerve agents and measurement of the survival time after supralethal poisoning. Addition of all the tested non-oximes increased significantly the therapeutic efficacy of atropine in combination with an oxime against tabun poisoning. They also positively influenced the number of surviving mice 6 hr after supralethal poisoning with tabun. However, they were only slightly effective for the treatment of soman poisoning. The benefit of the tested bispyridinium non-oximes was dose-dependent. To conclude, the addition of bispyridinium non-oximes to the standard antidotal treatment of acute poisoning with tabun was beneficial regardless of the chosen non-oxime, but only slightly beneficial in the case of soman poisoning. © 2017 Nordic Association for the Publication of BCPT (former Nordic Pharmacological Society).

  14. Preventing deaths from rising opioid overdose in the US – the promise of naloxone antidote in community-based naloxone take-home programs

    Directory of Open Access Journals (Sweden)

    Straus MM

    2013-09-01

    , it is important for federal government research agencies to initiate and support independent and rigorous evaluation of these programs to inform policymakers how effective these programs can be to save lives and curb the opioid overdose public health crisis. Keywords: prescription drug abuse, fatal opioid overdose, naloxone antidote, Good Samaritan laws, naloxone take-home program

  15. The Antidotes to the Double Standard: Protecting the Healthcare Rights of Mentally Ill Inmates by Blurring the Line Between Estelle and Youngberg.

    Science.gov (United States)

    Goldberg, Rose Carmen

    2016-01-01

    This Note is an examination of mentally ill inmates' constitutional right to treatment. It has significant doctrinal and practical implications. In terms of doctrine, the Supreme Court has created distinct standards for the minimum levels of care for inmates (Estelle) and the civilly committed mentally ill (Youngberg). Under this framework mentally ill inmates are constitutionally equivalent to inmates generally, but are entitled to less care than the civilly committed even if they suffer the same illness. This Note explores this gap through the lens of equal protection and argues that mentally ill inmates are similarly situated to the civilly committed. It further contends that inmates constitute a "discrete and insular minority" and thus the standard establishing their right to care should be subject to strict scrutiny. This Note finds that Estelle fails this test. Practically, this Note brings visibility to a consequential area of the law neglected by scholarship. Over half of inmates are mentally ill and yet treatment in prisons is inadequate. The literature at the intersection of health, criminal justice, and constitutional rights has not constructively considered how doctrine should be changed to protect the wellbeing of this vulnerable population. Scholars have also provided little oversight of the judicial administration of justice in this field; there are few reviews of how judges actually apply treatment rights standards. This Note lessens this blind spot by exposing how courts fail to properly distinguish between different standards. This Note proposes that the most promising antidote to the Estelle-Youngberg double standard, counterintuitively, is not the creation of a uniform standard. A standard that puts mentally ill inmates on equal footing with the civilly committed would solve the doctrinal puzzle, but would be subject to Youngberg's inherent flaws and the judicial malpractice in this area. Recognizing the deficiencies of a purely judicial remedy

  16. Liquid chromatographic mass spectrometric (LC/MS/MS) determination of plasma hydroxocobalamin and cyanocobalamin concentrations after hydroxocobalamin antidote treatment for cyanide poisoning.

    Science.gov (United States)

    Schwertner, Harvey A; Valtier, Sandra; Bebarta, Vikhyat S

    2012-09-15

    Cyanide poisoning occurs in individuals after fire smoke inhalation and after oral ingestion of cyanide. Hydroxocobalamin (HOCbl), a hydroxylated form of vitamin B(12), is often used as an antidote to treat cyanide toxicity. It has a high affinity for cyanide and rapidly removes cyanide from tissue by forming cyanocobalamin (CNCbl). Little information is available on the pharmacokinetics of HOCbl and CNCbl largely because of the lack of analytical methods for analyzing HOCbl and CNCbl. In this study, we developed a new liquid chromatographic mass spectrometric (LC/MS/MS) method for the quantitative analysis of plasma HOCbl and CNCbl in the porcine (Sus scrofa) model. The method uses on-column extraction, reversed phase gradient chromatography, and multiple reaction monitoring (MRM) for quantitation. MRM transitions monitored were 664.7→147.3 and 664.7→359.2 for HOCbl and 678.8→147.3, 678.8→359.1 678.8→457.1 for CNCbl. The limit of detection (LOD) and the lower limit of quantitation (LLOQ) were 1.0 and 1.0 μmole/L, respectively, for plasma HOCbl and 0.1 and 0.5 μmole/L for plasma CNCbl. The within-day and between-day CVs were 4.3 and 6.4% for plasma HOCbl at 500.0 μmole/L and 5.5 and 5.7% for CNCbl at 100.0 μmole/L (n=6). The plasma HOCbl and CNCbl calibrations curves were linear from 100.0 to 2000.0 and 50.0 to 500.0 μmole/L, respectively. Based on 6 separate calibration curves the average linear regression coefficient (R(2)) for both HOCbl and CNCbl was 0.992. The LC/M/MS method was found to be accurate and precise and has been validated by determining the plasma HOCbl and CNCbl concentrations in 11 pigs that were treated with HOCbl for cyanide poisoning. Published by Elsevier B.V.

  17. Spin qubits in antidot lattices

    DEFF Research Database (Denmark)

    Pedersen, Jesper Goor; Flindt, Christian; Mortensen, Niels Asger

    2008-01-01

    We suggest and study designed defects in an otherwise periodic potential modulation of a two-dimensional electron gas as an alternative approach to electron spin based quantum information processing in the solid-state using conventional gate-defined quantum dots. We calculate the band structure a...... electron transport between distant defect states in the lattice, and for a tunnel coupling of neighboring defect states with corresponding electrostatically controllable exchange coupling between different electron spins.......We suggest and study designed defects in an otherwise periodic potential modulation of a two-dimensional electron gas as an alternative approach to electron spin based quantum information processing in the solid-state using conventional gate-defined quantum dots. We calculate the band structure...

  18. Development of Biochemical Cyanide Antidotes.

    Science.gov (United States)

    1992-03-01

    of sodium channels to inhibit high frequency discharges around epileptic foci (Willow et al., 1985). Minimal disruption of normal neuronal traffic is...549-558. Yamamoto, H. (1989). Hyperammonemia, increased brain neutral and aromauic amino acid levels and encephalopathy induced by cyanide in mice

  19. Illustrations from the Wellcome Library William Winstanley’s Pestilential Poesies in The Christians Refuge: Or Heavenly Antidotes Against the Plague in this Time of Generall Contagion to Which is Added the Charitable Physician (1665)

    Science.gov (United States)

    MILLER, KATHLEEN

    2011-01-01

    During the Great Plague of London (1665), William Winstanley veered from his better known roles as arbiter of success and failure in his works of biography or as a comic author under the pseudonym Poor Robin, and instead engaged with his reading audience as a plague writer in the rare book The Christians Refuge: Or Heavenly Antidotes Against the Plague in this Time of Generall Contagion to Which is Added the Charitable Physician (1665). From its extensive paratexts, including a table of mortality statistics and woodcut of king death, to its temporal and providential interpretation of the disease between the covers of a single text, The Christians Refuge is a compendium of contemporary understanding of plague. This article addresses The Christians Refuge as an expression of London’s print marketplace in a moment of transformation precipitated by the epidemic. The author considers the paratextual elements in The Christians Refuge that engage with the presiding norms in plague writing and publishing in 1665 and also explores how Winstanley’s authorship is expressed in the work. Winstanley has long been seen as a biographer or as a humour writer; attributing The Christians Refuge extends and challenges previous perceptions of his work. PMID:21461312

  20. The vitamin K-dependent carboxylation system in human osteosarcoma U2-OS cells. Antidotal effect of vitamin K1 and a novel mechanism for the action of warfarin.

    Science.gov (United States)

    Wallin, R; Rossi, F; Loeser, R; Key, L L

    1990-01-01

    An osteoblast-like human osteosarcoma cell line (U2-OS) has been shown to possess a vitamin K-dependent carboxylation system which is similar to the system in human HepG2 cells and in liver and lung from the rat. In an 'in vitro' system prepared from these cells, vitamin K1 was shown to overcome warfarin inhibition of gamma-carboxylation carried out by the vitamin K-dependent carboxylase. The data suggest that osteoblasts, the cells involved in synthesis of vitamin K-dependent proteins in bone, can use vitamin K1 as an antidote to warfarin poisoning if enough vitamin K1 can accumulate in the tissue. Five precursors of vitamin K-dependent proteins were identified in osteosarcoma and HepG2 cells respectively. In microsomes (microsomal fractions) from the osteosarcoma cells these precursors revealed apparent molecular masses of 85, 78, 56, 35 and 31 kDa. When osteosarcoma cells were cultured in the presence of warfarin, vitamin K-dependent 14C-labelling of the 78 kDa precursor was enhanced. Selective 14C-labelling of one precursor was also demonstrated in microsomes from HepG2 cells and from rat lung after warfarin treatment. In HepG2 cells this precursor was identified as the precursor of (clotting) Factor X. This unique 14C-labelling pattern of precursors of vitamin K-dependent proteins in microsomes from different cells and tissues reflects a new mechanism underlying the action of warfarin. Images Fig. 1. Fig. 2. Fig. 3. Fig. 4. PMID:2386486

  1. Synthesis of Antidotes for Organophosphorus Acetylcholinesterase Inhibitors

    Science.gov (United States)

    1991-08-30

    pyridinium p-toluenesulfonate (4.0 g, 10 mmol) and nicotinic acid hydrazide (1.52 g, 11 mmol) was refluxed in absolute ethanol (105 mL) for 2 h. The...Found: C, 60.16; H, 5.71; N, 6.09; S, 6.92 1,3-Dimethy1-2-[4’-(formy1)phenoxymethyl]imidazolium N-(2-imidazolinyl)- hydrazone Dibromide (BM01274; JC-I...18-A). 1,3-Dimethy1-2-[4’-(formyl)phenoxymethyl]imidazolium p-toluenesulfonate was converted to the desired hydrazone by treatment with 2-hydrazino

  2. Clar sextets in square graphene antidot lattices

    DEFF Research Database (Denmark)

    Petersen, Rene; Pedersen, Thomas Garm; Jauho, Antti-Pekka

    2011-01-01

    A periodic array of holes transforms graphene from a semimetal into a semiconductor with a band gap tuneable by varying the parameters of the lattice. In earlier work only hexagonal lattices have been treated. Using atomistic models we here investigate the size of the band gap of a square lattice...

  3. Household chemicals: management of intoxication and antidotes.

    Science.gov (United States)

    Rauber-Lüthy, Christine; Kupferschmidt, Hugo

    2010-01-01

    Exposure to household products is very common, but in industrialized countries severe or fatal poisoning with household products is rare today, due to the legal restriction of sale of hazardous household products. The big challenge for physicians, pharmacologists and toxicologists is to identify the few exceptional life-threatening situations where immediate intervention is needed. Among thousands of innocuous products available for the household only very few are hazardous. Substances found in these products include detergents, corrosives, alcohols, hydrocarbons, and some of the essential oils. The ingestion of batteries and magnets and the exposure to cyanoacrylates (super glue) can cause complications in exceptional situations. Among the most dangerous substances still present in household products are ethylene glycol and methanol. These substances cause major toxicity only through their metabolites. Therefore, initial symptoms may be only mild or absent. Treatment even in asymptomatic patients has to be initiated as early as possible to inhibit production of toxic metabolites. For all substances not only the compound itself but also the route of exposure is relevant for toxicity. Oral ingestion and inhalation generally lead to most pronounced symptoms, while dermal exposure is often limited to mild irritation. However, certain circumstances need special attention. Exposure to hydrofluoric acid may lead to fatal hypocalcemia, depending on the concentration, duration of exposure, and area of the affected skin. Accidents with hydrocarbon pressure injectors and spray guns are very serious events, which may lead to amputation of affected limbs. Button batteries normally pass the gastrointestinal tract without problems even in toddlers; in rare cases, however, they get lodged in the esophagus with the risk of localized tissue damage and esophageal perforation.

  4. Prosperity: The Antidote to Radical Islam

    Science.gov (United States)

    2009-04-01

    saying Muslim men are being labeled as “losers.” This essay is not an attack on religion, the individuals, or the Muslim culture. Indeed, it is...states, “Ultimately the demonstrated ability of technologies such as GMO to solve overwhelming problems will prevail, but the temporary delays caused

  5. Creative Reading: The Antidote to Readicide

    Science.gov (United States)

    Small, Ruth V.; Arnone, Marilyn P.

    2011-01-01

    Reading is often thought of as a skill, something to be learned and practiced. But reading can also be considered a creative art, capturing the imagination of the reader in ways that result in creative thought and expression. School librarians have a unique opportunity not only to support classroom-based reading skill building but also to serve as…

  6. Coffee as an Antidote to Knowledge Stickiness

    Science.gov (United States)

    Blackman, Deborah; Phillips, Diane

    2011-01-01

    This paper considers the concept of space and its role in both knowledge creation and overcoming knowledge stickiness. Aristotelian concepts of "freedom to" and "freedom from" are used to reconceptualise space. Informal and formal spaces, concepts and places are discussed as both specific locations and as gaps providing space for knowledge…

  7. In Vitro Screen for Cyanide Antidotes

    Science.gov (United States)

    1993-05-13

    carbamazepine is thought to be blockade of sodium channels to inhibit high frequency discharges around epileptic foci (13). Minimal disruption of...Appl. Pharmacol. 81:261-273, 1985. 2. Yamamoto, H. Hyperammonemia increased brain neutral and aromatic amino acid level and encephalopathy induced by

  8. ANTIDotE: anti-tick vaccines to prevent tick-borne diseases in Europe

    Czech Academy of Sciences Publication Activity Database

    Sprong, H.; Trentelman, J.; Seemann, I.; Grubhoffer, Libor; Rego, Ryan O. M.; Hajdušek, Ondřej; Kopáček, Petr; Šíma, Radek; Nijhof, A.M.; Anguita, J.; Winter, P.; Rotter, B.; Havlíková, S.; Klempa, B.; Schetters, T.P.; Hovius, J.W.R.

    2014-01-01

    Roč. 7, FEB 2014 (2014), s. 77 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Ixodes ricinus * vaccine * Lyme borreliosis * tick-borne encephalitis * babesiosis * public health Subject RIV: EC - Immunology Impact factor: 3.430, year: 2014

  9. Resilience, Flexibility and Adaptive Management - - Antidotes for Spurious Certitude?

    Directory of Open Access Journals (Sweden)

    Lance Gunderson

    1999-06-01

    Full Text Available In many cases, a predicate of adaptive environmental assessment and management (AEAM has been a search for flexibility in management institutions, or for resilience in the ecological system prior to structuring actions that are designed for learning. Many of the observed impediments to AEAM occur when there is little or no resilience in the ecological components (e.g., when there is fear of an ecosystem shift to an unwanted stability domain, or when there is a lack of flexibility in the extant power relationships among stakeholders. In these cases, a pragmatic solution is to seek to restore resilience or flexibility rather than to pursue a course of broad-scale, active adaptive management. Restoration of resilience and flexibility may occur through novel assessments or small-scale experiments, or it may occur when an unforeseen policy crisis allows for reformation or restructuring of power relationships among stakeholders.

  10. Apitherapy - a natural antidote for oral diseases: an overview

    OpenAIRE

    Gopal, Akkala Satya; Veluru, Lakshmi Sindhuri; K, Sai Sankar A.; Sunil, C H Ram

    2016-01-01

    Natural commodities of honeybees have various ingredients within them, which contribute to their incredible properties. These products have been used in traditional medicine since ancient times, due to its biologically active nature in preventing infections, wound healing and in promoting health. This nature is credited to their antibacterial, antioxidant, immunomodulating, anti-inflammatory and wound healing property. As natural remedies are showing promising results in management of oral di...

  11. Local School Micropolitical Agency: An Antidote to New Managerialism

    Science.gov (United States)

    Johnson, Bruce

    2004-01-01

    This paper reports research into the micropolitical strategies used by five school leadership teams in the South Australian School-based Research and Reform Project. The research challenges many of the orthodoxies of educational managerialism. For example: the use of leadership teams made up of teachers, coordinators and senior school leaders…

  12. In search of meaningfulness: nostalgia as an antidote to boredom.

    Science.gov (United States)

    van Tilburg, Wijnand A P; Igou, Eric R; Sedikides, Constantine

    2013-06-01

    We formulated, tested, and supported, in 6 studies, a theoretical model according to which individuals use nostalgia as a way to reinject meaningfulness in their lives when they experience boredom. Studies 1-3 established that induced boredom causes increases in nostalgia when participants have the opportunity to revert to their past. Studies 4 and 5 examined search for meaning as a mediator of the effect of boredom on nostalgia. Specifically, Study 4 showed that search for meaning mediates the effect of state boredom on nostalgic memory content, whereas Study 5 demonstrated that search for meaning mediates the effect of dispositional boredom on dispositional nostalgia. Finally, Study 6 examined the meaning reestablishment potential of nostalgia during boredom: Nostalgia mediates the effect of boredom on sense of meaningfulness and presence of meaning in one's life. Nostalgia counteracts the meaninglessness that individuals experience when they are bored.

  13. Antidote for Zero Tolerance: Revisiting a "Reclaiming" School.

    Science.gov (United States)

    Farner, Conrad D.

    2002-01-01

    Reports on a revisit to the Frank Lloyd Wright Middle School, which implemented strategies to deal with disciplinary problems. The school continues to progress towards creating the type of reclaiming environment necessary to ensure the needs of all students. Strategies used include alternatives to zero tolerance policy; smaller teams of students;…

  14. Moral Intelligence: An Antidote to Examination Malpractices in Nigerian Schools

    Science.gov (United States)

    Olusola, Olayiwola Idowu; Ajayi, Oluwagbemiga Samson

    2015-01-01

    Moral intelligence is the capacity to apply moral principles to one's own values, goals and actions (or the ability to see what is right and integrate it into one's life and actions) It is considered as the individual capacity to understand right from wrong, to have strong ethical convictions and to act on them to behave in the right and…

  15. Heavy metal poisoning: management of intoxication and antidotes.

    Science.gov (United States)

    Rusyniak, Daniel E; Arroyo, Anna; Acciani, Jennifer; Froberg, Blake; Kao, Louise; Furbee, Brent

    2010-01-01

    Of the known elements, nearly 80% are either metals or metalloids. The highly reactive nature of most metals result in their forming complexes with other compounds such oxygen, sulfide and chloride. Although this reactivity is the primary means by which they are toxic, many metals, in trace amounts, are vital to normal physiological processes; examples include iron in oxygen transport, manganese and selenium in antioxidant defense and zinc in metabolism. With these essential metals toxicity occurs when concentrations are either too low or too high. For some metals there are no physiological concentrations that are beneficial; as such these metals only have the potential to cause toxicity. This chapter focuses on four of these: arsenic, mercury, lead and thallium.

  16. Thallium Toxicity: The Problem; An Analytical Approach; An Antidotal Study

    Science.gov (United States)

    1993-05-15

    low body weights in newborns of Tl-in.,xicated mothers (80). 20 Teratogenicity and Carcinogenicity Thallium is teratogenic in chick embryos, causing...Placental transfer, embryo- toxicity and teratogenicity of thallium sulfate in normal and potassium-deficient rats. Toxicol Appl Pharmacol 16:120-132, 1970...neurological disturbances. In humans, maternal exposure produces detectable thallium levels in amniotic fluid and breast milk. Thallium is teratogenic in chick

  17. Is Hypercalcemic Diet A Possible Antidote To Oral Contraceptive ...

    African Journals Online (AJOL)

    These results strongly suggest that high dietary Ca2+ supplementation increases salt and water excretion in OC-treated rats and potentially moderates fluid retention and blood pressure in these animals, and may be of clinical significance in OC-induced abnormal fluid retention and perhaps OC-induced hypertension.

  18. Investigation of Possible Antidotal Effects of Activated Charcoal ...

    African Journals Online (AJOL)

    Zinc phosphide, a commonly used rat poison in Kenya was mixed with maize flour in a concentration of 0.15 % w/w and fed to a group of 60 experimental mice for 3 hours. The mice were then randomly divided into 5 equal groups, A, B, C, D and E. To group A, B, C and D was administered 1 ml of activated charcoal (3 ...

  19. Determinants of poverty among bee farmers: An antidote for ...

    African Journals Online (AJOL)

    The study examined the poverty status of bee-farmers in two ecological zones of Kwara State, Nigeria with modern bee-keeping farmers as a case study. Primary data subjected to a pre-survey which involved structured questionnaire and interview schedule were administered using multistage random technique to selected ...

  20. Animal Models for Testing Antidotes Against an Oral Cyanide Challenge

    Science.gov (United States)

    2016-08-01

    stomach and the neutral environment of the small intestine (Newhouse, 2010). The cyanide ion also combines with sulfur to form thiocyanate (SCN). SCN...of KCN and 2 mmoles of HCl were administered via stomach tube to dogs (Christel et al. , 1977; ATSDR (2006), respiratory arrest occurred within 3...minutes with a plasma cyanide concentration of 40 µmol/mL. At a plasma concentration of 70 µmol/mL, cardiac arrest occurred 5 min after respiratory

  1. Medical anthropology as an antidote for ethnocentrism in Jesus ...

    African Journals Online (AJOL)

    Test

    2011-02-02

    Feb 2, 2011 ... Medicine often has side-effects or unintended consequences that are more harmful than the original disease. ... 'careful distinction' between illness and disease is devised for cross-cultural comparison and may be applicable to the .... circles, in the sociocultural influences on personality and particularly the.

  2. The contamination of scientific literature: looking for an antidote

    Science.gov (United States)

    Liotta, Marcello

    2017-04-01

    Science may have very strong implications for society. The knowledge of the processes occurring around the society represents a good opportunity to take responsible decisions. This is particularly true in the field of geosciences. Earthquakes, volcanic eruptions, landslides, climate changes and many other natural phenomena still need to be further investigated. The role of the scientific community is to increase the knowledge. Each member can share his own ideas and data thus allowing the entire scientific community to receive a precious contribution. The latter one often derives from research activities, which are expensive in terms of consumed time and resources. Nowadays the sharing of scientific results occurs through the publication on scientific journals. The reading of available scientific literature thus represents a unique opportunity to define the state of the art on a specific topic and to address research activities towards something new. When published results are obtained through a rigorous scientific process, they constitute a solid background where each member can add his ideas and evidences. Differently, published results may be affected by scientific misconduct; they constitute a labyrinth where the scientists lose their time in the attempt of truly understanding the natural processes. The normal scientific dialectic should unmask such results, thus avoiding literature contamination and making the scientific framework more stimulating. The scientific community should look for the best practice to reduce the risk of literature contamination.

  3. An Antidote for the Faculty-IT Divide

    Science.gov (United States)

    Fernandez, Luke

    2008-01-01

    Do campus IT departments harm higher education? Wall Street Journal personal-technology columnist Walt Mossberg suggested as much during a speech he gave to high-level administrators at last June's Chronicle of Higher Education presidents' forum. Mossberg caught the attention of campus CIOs when, according to the Chronicle, he described large IT…

  4. George Herbert Mead on consciousness: antidote to Cartesian absurdities?

    DEFF Research Database (Denmark)

    Willert, Søren

    The article explicates George Herbert Mead's theory of consciousness as presented in Mind, Self and Society. According to Mead, the term consciousness may refer to three different sets of phenomena: (1) the environment as implied by our goal-directed action; Mead names this consciousness aspect...

  5. A Ghetto Land Pedagogy: An Antidote for Settler Environmentalism

    Science.gov (United States)

    Paperson, La

    2014-01-01

    A ghetto land pedagogy begins with two axioms that align it with land education more broadly, and that distinguish it from the general umbrella of environmental education. First, ghetto colonialism is a specialization of settler colonialism. Second, land justice requires decolonization, not just environmental justice. A ghetto land pedagogy thus…

  6. Orwell's shadow : The historian as an antidote to nationalism in postwar Asia and Europe

    NARCIS (Netherlands)

    de Jong, Janny

    2016-01-01

    In de roman 1984 van George Orwell speelt het verleden een belangrijke rol: ‘degene die het verleden controleert, controleert de toekomst’ is een van de partijslogans. Dit mag dan fictie zijn, maar ook in het echte leven is geschiedenis vaak een politiek middel om nationalisme in stand te houden. In

  7. The internist as clinical ethics consultant: An antidote to "the barbarism of specialisation" in hospital practice.

    Science.gov (United States)

    Real de Asúa, D; Rodriguez Del Pozo, P; Fins, J J

    2018-04-01

    The development of hospital clinical ethics in Spain depends almost exclusively on the healthcare ethics committees, which have been criticized for a lack of proximity to the patient's bedside in day-to-day ethical conflicts and for their scarce practical operation, reflected in the low number of consultations they receive. In this study, we reflect on the need to change the current healthcare model in clinical ethics so as to reactivate it and call attention to the essential role of internists as the engine for this change. To this end, we propose a model in which the healthcare ethics committees incorporate ethics consultants, who are better positioned to discuss cases at the patient's bedside. We then analyse the characteristics that these consultants should have. Copyright © 2017 Elsevier España, S.L.U. and Sociedad Española de Medicina Interna (SEMI). All rights reserved.

  8. Moral Agency, Moral Imagination, and Moral Community: Antidotes to Moral Distress.

    Science.gov (United States)

    Traudt, Terri; Liaschenko, Joan; Peden-McAlpine, Cynthia

    2016-01-01

    Moral distress has been covered extensively in the nursing literature and increasingly in the literature of other health professions. Cases that cause nurses' moral distress that are mentioned most frequently are those concerned with prolonging the dying process. Given the standard of aggressive treatment that is typical in intensive care units (ICUs), much of the existing moral distress research focuses on the experiences of critical care nurses. However, moral distress does not automatically occur in all end-of-life circumstances, nor does every critical care nurse suffer its damaging effects. What are the practices of these nurses? What specifically do they do to navigate around or through the distressing situations? The nursing literature is lacking an answer to these questions. This article reports a study that used narrative analysis to explore the reported practices of experienced critical care nurses who are skilled at and comfortable working with families and physicians regarding the withdrawal of aggressive treatment. A major finding was that these nurses did not report experiencing the damaging effects of moral distress as described in the nursing literature. The verbal communication and stated practices relevant to this finding are organized under three major themes: (1) moral agency, (2) moral imagination, and (3) moral community. Further, a total of eight subthemes are identified. The practices that constitute these themes and subthemes are further detailed and discussed in this article. Understanding these practices can help mitigate critical care nurses' moral distress. Copyright 2016 The Journal of Clinical Ethics. All rights reserved.

  9. More than Just Another Course: Service Learning as Antidote to Cultural Bias

    Science.gov (United States)

    Gökmenoglu, Tuba

    2017-01-01

    The social influence role of teachers and their awareness of their responsibilities towards society are as important as their subject matter and pedagogical knowledge. As a multilevel learning environment, teacher colleges should place significant emphasis on enhancing teacher candidates' social responsibility attitudes, knowledge, and skills. To…

  10. Managing Workplace Incivility: The Role of Conflict Management Styles--Antecedent or Antidote?

    Science.gov (United States)

    Trudel, Jeannie; Reio, Thomas G., Jr.

    2011-01-01

    The workforce of the 21st century is dealing with rapid changes and increased competition across industries. Such changes place stress on management and workers alike, increasing the potential for workplace conflict and deviant workplace behaviors, including incivility. The importance of effective conflict management in the workplace has been…

  11. Acute ethanol administration reduces the antidote effect of N-acetylcysteine after acetaminophen overdose in mice

    DEFF Research Database (Denmark)

    Dalhoff, K; Hansen, P B; Ott, P

    1991-01-01

    given ethanol or saline alone only 7% and 3%, respectively, survived 96 h. 4. The data suggest that the protective effect of N-acetylcysteine on acetaminophen-induced toxicity in fed mice is reduced by concomitant administration of ethanol. This may explain the clinical observation that ingestion...

  12. Ephedrine QoS: An Antidote to Slow, Congested, Bufferless NoCs

    Directory of Open Access Journals (Sweden)

    Juan Fang

    2014-01-01

    Full Text Available Datacenters consolidate diverse applications to improve utilization. However when multiple applications are colocated on such platforms, contention for shared resources like networks-on-chip (NoCs can degrade the performance of latency-critical online services (high-priority applications. Recently proposed bufferless NoCs (Nychis et al. have the advantages of requiring less area and power, but they pose challenges in quality-of-service (QoS support, which usually relies on buffer-based virtual channels (VCs. We propose QBLESS, a QoS-aware bufferless NoC scheme for datacenters. QBLESS consists of two components: a routing mechanism (QBLESS-R that can substantially reduce flit deflection for high-priority applications and a congestion-control mechanism (QBLESS-CC that guarantees performance for high-priority applications and improves overall system throughput. We use trace-driven simulation to model a 64-core system, finding that, when compared to BLESS, a previous state-of-the-art bufferless NoC design, QBLESS, improves performance of high-priority applications by an average of 33.2% and reduces network-hops by an average of 42.8%.

  13. Prussian blue as an antidote for radioactive thallium and cesium poisoning

    Directory of Open Access Journals (Sweden)

    Altagracia-Martinez M

    2012-06-01

    Full Text Available Marina Altagracia-Martínez, Jaime Kravzov-Jinich, Juan Manuel Martínez-Núñez, Camilo Ríos-Castañeda, Francisco López-NaranjoDepartments of Biological Systems and Health Care, Biological and Health Sciences Division, Universidad Autónoma Metropolitana-Xochimilco, Mexico DF, MexicoBackground: Following the attacks on the US on September 11, 2001, potentially millions of people might experience contamination from radioactive metals. However, before the specter of such accidents arose, Prussian blue was known only as an investigational agent for accidental thallium and cesium poisoning. The purpose of this review is to update the state of the art concerning use of Prussian blue as an effective and safe drug against possible bioterrorism attacks and to disseminate medical information in order to contribute to the production of Prussian blue as a biodefense drug.Methods: We compiled articles from a systematic review conducted from January 1, 1960 to March 30, 2011. The electronic databases consulted were Medline, PubMed, the Cochrane Library, and Scopus.Results: Prussian blue is effective and safe for use against radioactive intoxications involving cesium-137 and thallium. The US Food and Drug Administration has approved Prussian blue as a drug, but there is only one manufacturer providing Prussian blue to the US. Based on the evidence, Prussian blue is effective for use against radioactive intoxications involving cesium-137 and thallium, but additional clinical research on and production of Prussian blue are needed.Keywords: Prussian blue, radioactive cesium, thallium, intoxication, biodefense drug

  14. Assessment of The Emergence of E-Books As Antidotes To Paucity ...

    African Journals Online (AJOL)

    The increasing penetration of the internet in all areas of life has led to the evolution of Electronic Books which has significantly changed the reading patterns and reading behaviours of people across the globe. Using a self administered questionnaire, a study was undertaken in the campuses of Five (5) tertiary institutions in ...

  15. Plasmon induced modification of the transverse magneto-optical response in Fe antidot arrays

    Energy Technology Data Exchange (ETDEWEB)

    Torrado, J.F.; Armelles, G.; Garcia-Martin, A. [IMM - Instituto de Microelectronica de Madrid (CNM-CSIC), Isaac Newton 8, PTM, 28760 Tres Cantos, Madrid (Spain); Papaioannou, E.T. [Department of Physics and Astronomy, Uppsala University, 75121 Uppsala (Sweden); Ctistis, G. [Complex Photonic Systems (COPS), MESA+ Institute for Nanotechnology, University of Twente (Netherlands); Patoka, P.; Giersig, M. [Helmholtz-Zentrum Berlin fuer Materialien und Energie GmbH, 14109 Berlin (Germany)

    2010-10-15

    In this Letter we present the effects that the excitation of plasmon-like modes in periodically perforated Fe films have over the Transverse Magneto-Optical Kerr Effect (TMOKE). The excitation of the modes gives rise to clear signatures in the TMOKE spectra. We analyze the spectral position of the structures as a function of both the polar and azimuth angle. Schematic representation of the system, and TMOKE signal for a Fe membrane along {phi}=0 . (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  16. Biomedical Effects of Chemical-Threat-Agent Antidote and Pretreatment Drugs. An Abstracted Bibliography. Volume 1.

    Science.gov (United States)

    1986-04-01

    route [expired air]." Or (Cont’d) 500 "An effective reabsorption from the gut prevents atropine or its metabolic products from being excreted in the...Cats were injected with HS-6, and the pressor response of carotid artery occlusion was measured. The results of selective superior cervical ganglion

  17. Teaching Sensitive Issues: Psychological Literacy as an Antidote to Pedagogic Frailty

    Science.gov (United States)

    Winstone, Naomi E.; Kinchin, Ian M.

    2017-01-01

    Many topics within the psychology curriculum can be described as "sensitive", with potential for students to experience distress and discomfort. Given the pressure experienced by academics in Higher Education, the potential for student distress or complaints might lead lecturers to adopt a risk-averse approach to teaching, which is well…

  18. Calcium channel antagonist and beta-blocker overdose: antidotes and adjunct therapies.

    Science.gov (United States)

    Graudins, Andis; Lee, Hwee Min; Druda, Dino

    2016-03-01

    Management of cardiovascular instability resulting from calcium channel antagonist (CCB) or beta-adrenergic receptor antagonist (BB) poisoning follows similar principles. Significant myocardial depression, bradycardia and hypotension result in both cases. CCBs can also produce vasodilatory shock. Additionally, CCBs, such as verapamil and diltiazem, are commonly ingested in sustained-release formulations. This can also be the case for some BBs. Peak toxicity can be delayed by several hours. Provision of early gastrointestinal decontamination with activated charcoal and whole-bowel irrigation might mitigate this. Treatment of shock requires a multimodal approach to inotropic therapy that can be guided by echocardiographic or invasive haemodynamic assessment of myocardial function. High-dose insulin euglycaemia is commonly recommended as a first-line treatment in these poisonings, to improve myocardial contractility, and should be instituted early when myocardial dysfunction is suspected. Catecholamine infusions are complementary to this therapy for both inotropic and chronotropic support. Catecholamine vasopressors and vasopressin are used in the treatment of vasodilatory shock. Optimizing serum calcium concentration can confer some benefit to improving myocardial function and vascular tone after CCB poisoning. High-dose glucagon infusions have provided moderate chronotropic and inotropic benefits in BB poisoning. Phosphodiesterase inhibitors and levosimendan have positive inotropic effects but also produce peripheral vasodilation, which can limit blood pressure improvement. In cases of severe cardiogenic shock and/or cardiac arrest post-poisoning, extracorporeal cardiac assist devices have resulted in successful recovery. Other treatments used in refractory hypotension include intravenous lipid emulsion for lipophilic CCB and BB poisoning and methylene blue for refractory vasodilatory shock. © 2015 The British Pharmacological Society.

  19. Real GPA and Real SET: Two Antidotes to Greed, Sloth and Cowardice in the College Classroom

    Science.gov (United States)

    Koper, Peter T.; Felton, James; Sanney, Kenneth J.; Mitchell, John B.

    2015-01-01

    Recently published evidence of limited learning among American college students confirms the damage done when students, faculty and institutions pursue interests that conflict with the educational process. The "disengagement compact" in which faculty tacitly trade lenient workloads and grading for higher student evaluation of teaching…

  20. Unraveling the pharmacokinetic interaction of ticagrelor and MEDI2452 (Ticagrelor antidote) by mathematical modeling

    Science.gov (United States)

    Almquist, J; Penney, M; Pehrsson, S; Sandinge, A‐S; Janefeldt, A; Maqbool, S; Madalli, S; Goodman, J; Nylander, S

    2016-01-01

    The investigational ticagrelor‐neutralizing antibody fragment, MEDI2452, is developed to rapidly and specifically reverse the antiplatelet effects of ticagrelor. However, the dynamic interaction of ticagrelor, the ticagrelor active metabolite (TAM), and MEDI2452, makes pharmacokinetic (PK) analysis nontrivial and mathematical modeling becomes essential to unravel the complex behavior of this system. We propose a mechanistic PK model, including a special observation model for post‐sampling equilibration, which is validated and refined using mouse in vivo data from four studies of combined ticagrelor‐MEDI2452 treatment. Model predictions of free ticagrelor and TAM plasma concentrations are subsequently used to drive a pharmacodynamic (PD) model that successfully describes platelet aggregation data. Furthermore, the model indicates that MEDI2452‐bound ticagrelor is primarily eliminated together with MEDI2452 in the kidneys, and not recycled to the plasma, thereby providing a possible scenario for the extrapolation to humans. We anticipate the modeling work to improve PK and PD understanding, experimental design, and translational confidence. PMID:27310493

  1. The thrill of being violent as an antidote to posttraumatic stress disorder in Rwandese genocide perpetrators.

    Science.gov (United States)

    Weierstall, Roland; Schaal, Susanne; Schalinski, Inga; Dusingizemungu, Jean-Pierre; Elbert, Thomas

    2011-01-01

    The cumulative exposure to life-threatening events increases the risk for posttraumatic stress disorder (PTSD). However, over the course of evolutionary adaptation, intra-species killing may have also evolved as an inborn strategy leading to greater reproductive success. Assuming that homicide has evolved as a profitable strategy in humans, a protective mechanism must prevent the perpetrator from getting traumatised by self-initiated violent acts. We thus postulate an inverse relation between a person's propensity toward violence and PTSD. We surveyed a sample of 269 Rwandan prisoners who were accused or convicted for crimes related to the 1994 genocide. In structured interviews we assessed traumatic event types, types of crimes committed, the person's appetitive violence experience with the Appetitive Aggression Scale (AAS) and PTSD symptom severity with the PSS-I. Using path-analysis, we found a dose-response effect between the exposure to traumatic events and the PTSD symptom severity (PSS-I). Moreover, participants who had reported that they committed more types of crimes demonstrated a higher AAS score. In turn, higher AAS scores predicted lower PTSD symptom severity scores. This study provides first empirical support that the victim's struggling can be an essential rewarding cue for perpetrators. The results also suggest that an appetitive aggression can inhibit PTSD and trauma-related symptoms in perpetrators and prevent perpetrators from getting traumatised by their own atrocities.

  2. Risks for Religiously Infused Violence in Muslim Youth and Successful Antidotes through Correct Islamic Teaching

    Science.gov (United States)

    Harun, Sahmuddeen Saleh

    2014-01-01

    This project aims to change corrupt mindsets in my community. Working on this project has enhanced my ability to lead my community by example, to employ a pragmatic approach, to demonstrate my teaching skills, and to assert my commitment to pedagogy. This project introduces correct Islamic teachings that can deal with religiously infused violence.…

  3. Humanistic Antidotes to Social Media/Cell Phone Addiction in the College Classroom

    OpenAIRE

    Elliot Benjamin

    2016-01-01

    This article describes “humanistic antidotes” to offset the widespread social media/cell phone addiction prevalent in current US college classrooms. The inappropriate use of cell phones to engage in social media in college classrooms is a pervasive problem that many college instructors have complained about.  The dominant focus of this article is in humanistic education, in which the author's efforts at getting psychology college students to put away their cell phones, “talk with each other,”...

  4. Effect of potential antidotes on the acute toxicity, tissue disposition and elimination of selenium in rats.

    Science.gov (United States)

    Paul, M; Mason, R; Edwards, R

    1989-12-01

    Treatment of male Wistar rats with sodium selenate (2.24 mg Se/kg, s.c.) inhibited their body weight gain for 24 hr, after which the animals recovered. Intraperitoneal injections of sodium-2,3-dimercaptopropane-1-sulphonic acid (60 mg/kg), meso-2,3-dimercaptosuccinic acid (50.9 mg/kg) and calcium disodium ethylenediamine-tetraacetate (500 mg/kg) 15 min after Se had no protective effect, whilst 2,3-dimercaptopropanol (15 mg/kg) inhibited the recovery of the Se-treated animal. Sodium diethyldithiocarbamate (DDTC, 70 mg/kg, i.p.) reduced the Se-induced loss of body weight but had no effect on the tissue disposition of 75Se when injected 15 min, 3 hr or 6 hr after a s.c. injection of sodium [75Se] selenite (50 microCi, 17.4 micrograms Se/kg). The citrate salts of bismuth (2.5 and 5 mg Bi/kg, s.c.), antimony (1.5 and 3 mg Sb/kg, s.c.) and germanium (40 mg Ge/kg, s.c.) also reduced the selenate-induced loss of body weight, whilst germanium citrate (40 mg Ge/kg) and bis-carboxyethyl germanium sesquioxide (80, 200 and 400 mg Ge/kg) promoted significant dose-related increases in the 24 hr urinary excretion of 75Se when given 15 min after sodium [75Se] selenite (30 microCi, 0.5 mg Se/kg, s.c.).

  5. Effect of potential antidotes on the acute toxicity, tissue disposition and elimination of selenium in rats

    Energy Technology Data Exchange (ETDEWEB)

    Paul, M.; Mason, R.; Edwards, R. (Toxicology Research Unit (Medical Research Council of New Zealand), Dunedin (New Zealand))

    1989-12-01

    Treatment of male Wistar rats with sodium selenate (2.24 mg Se/kg, s.c.) inhibited their body weight gain for 24 hr, after which the animals recovered. Intraperitoneal injections of sodium-2,3-dimercaptopropane-1-sulphonic acid (60 mg/kg), meso-2,3-dimercaptosuccinic acid (50.9 mg/kg) and calcium disodium ethylenediamine-tetraacetate (500 mg/kg) 15 min after Se had no protective effect, while 2,3-dimercaptopropanol (15 mg/kg) inhibited the recovery of the Se-treated animal. Sodium diethyldithiocarbamate (DDTC, 70 mg/kg, i.p.) reduced the Se-induced loss of body weight but had no effect on the tissue disposition of {sup 75}Se when injected 15 min, 3 hr or 6 hr after a s.c. injection of sodium ({sup 75}Se) selenite (50 microCi, 17.4 micrograms Se/kg). The citrate salts of bismuth (2.5 and 5 mg Bi/kg, s.c.), antimony (1.5 and 3 mg Sb/kg, s.c.) and germanium (40 mg Ge/kg, s.c.) also reduced the selenate-induced loss of body weight, while germanium citrate (40 mg Ge/kg) and bis-carboxyethyl germanium sesquioxide (80, 200 and 400 mg Ge/kg) promoted significant dose-related increases in the 24 hr urinary excretion of {sup 75}Se when given 15 min after sodium ({sup 75}Se) selenite (30 microCi, 0.5 mg Se/kg, s.c.).

  6. Boxes of Poison: Baroque Technique as Antidote to Simple Views of Literacy

    Science.gov (United States)

    Burnett, Cathy; Merchant, Guy

    2016-01-01

    Rich and complex meaning making experiences, such as those associated with virtual play, sit uneasily with the view of literacy reflected in and sustained by current systems of accountability in education. This article develops a baroque perspective as a way of destabilizing the "regime of truth" associated with simple models of…

  7. U.S. Productivity Growth: History as Antidote for Both Hysteria and Complacency.

    Science.gov (United States)

    Baumol, William J.

    1985-01-01

    An historical analysis of U.S. productivity policy shows that there is no justification for panic. But history also tells us that the vanguard is a vulnerable place. It may take enormous investment and innovation efforts for the United States to maintain its standing as the first among productivity leaders. (RM)

  8. Arsenic and Old Language: A Habermasian Antidote for the Lethal Tobacco Ideology.

    Science.gov (United States)

    Lagergren, Paul

    The recent success of the United States antismoking movement has produced a marked decline in the U.S. smoking population. A study employed Jurgen Habermas' communicative competency theory to examine United States smoking controversy discourse and identify the most successful appeals of the antismoking movement. Analysis revealed that primary…

  9. Building a Consonance Between Religion and Science: an Antidote for the Seeming Conflict

    OpenAIRE

    Omomia O. Austin

    2014-01-01

    It is commonly argued by a school of thought that there is no relationship between religion and science. This extreme position has led to a lasting conflict, which has pitched religion against science and science against religion. The attempt in this paper is to articulate the fact that there can be an enduring consonance between religion and science. No doubt, the conflict and debate on the subject of religion and science has taken the front burner in both religious and philosophical discuss...

  10. Building a Consonance Between Religion and Science: an Antidote for the Seeming Conflict

    Directory of Open Access Journals (Sweden)

    Omomia O. Austin

    2014-05-01

    Full Text Available It is commonly argued by a school of thought that there is no relationship between religion and science. This extreme position has led to a lasting conflict, which has pitched religion against science and science against religion. The attempt in this paper is to articulate the fact that there can be an enduring consonance between religion and science. No doubt, the conflict and debate on the subject of religion and science has taken the front burner in both religious and philosophical discusses. Some scholars have argued that science has no role in religious or theological domain, while others contest that all religious concerns and considerations must be exposed to empirical investigations, and, proven by the dynamics of our intellect or reason. This paper, therefore, attempts to examine how religion and science complement each other. The author applied philosophical, sociological and historical methodology in his research. It is recommended that there is the need for dialogue between religion and science.

  11. Evidence-Informed Practice: Antidote to Propaganda in the Helping Professions?

    Science.gov (United States)

    Gambrill, Eileen

    2010-01-01

    The most concerning issue affecting the quality of practices and policies in the helping professions is the play of propaganda, which misleads us regarding what is a problem, how (or if) it can be detected, its causes, and how (or if) it can be remedied. Propaganda is defined as encouraging beliefs and actions with the least thought possible.…

  12. The Mustard Consortium’s Elucidation of the Pathophysiology of Sulfur Mustard and Antidote Development

    Science.gov (United States)

    2006-09-01

    A. M. Hossini, L. F. Fecker, C. E. Orfanos, and B. Tebbe (2002). The role of nuclear factor-kappa B and melanogenesis in tumor necrosis factor...chemical warfare agents. A further goal in conjunction with consortium members is to design rat and mouse microarrays and QPCR reagents , which will be

  13. Saffron as an antidote or a protective agent against natural or chemical toxicities

    OpenAIRE

    Razavi, Bibi Marjan; Hosseinzadeh, Hossein

    2015-01-01

    Saffron (Crocus sativus) is an extensively used food additive for its color and taste. Since ancient times this plant has been introduced as a marvelous medicine throughout the world. The wide spectrum of saffron pharmacological activities is related to its major constituents including crocin, crocetin and safranal. Based on several studies, saffron and its active ingredients have been used as an antioxidant, antiinflammatory and antinociceptive, antidepressant, antitussive, anticonvulsant, m...

  14. Reflective Writing for Medical Students on the Surgical Clerkship: Oxymoron or Antidote?

    Science.gov (United States)

    Liu, Geoffrey Z; Jawitz, Oliver K; Zheng, Daniel; Gusberg, Richard J; Kim, Anthony W

    2016-01-01

    Reflective writing has emerged as a solution to declining empathy during clinical training. However, the role for reflective writing has not been studied in a surgical setting. The aim of this proof-of-concept study was to assess receptivity to a reflective-writing intervention among third-year medical students on their surgical clerkship. The reflective-writing intervention was a 1-hour, peer-facilitated writing workshop. This study employed a pre-post-intervention design. Subjects were surveyed on their experience 4 weeks before participation in the intervention and immediately afterwards. Surveys assessed student receptivity to reflective writing as well as self-perceived empathy, writing habits, and communication behaviors using a Likert-response scale. Quantitative responses were analyzed using paired t tests and linear regression. Qualitative responses were analyzed using an iterative consensus model. Yale-New Haven hospital, a tertiary care academic center. All medical students of Yale School of Medicine, rotating on their surgical clerkship during a 9-month period (74 in total) were eligible. In all, 25 students completed this study. The proportion of students desiring more opportunities for reflective writing increased from 32%-64%. The proportion of students receptive to a mandatory writing workshop increased from 16%-40%. These differences were both significant (p = 0.003 and p = 0.001). In all, 88% of students also reported new insight as a result of the workshop. In total, 39% of students reported a more positive impression of the surgical profession after participation. Overall, the workshop was well-received by students and improved student attitudes toward reflective writing and the surgical profession. Larger studies are required to validate the effect of this workshop on objective empathy measures. This study demonstrates how reflective writing can be incorporated into a presurgical curriculum. Copyright © 2015 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

  15. Ethylene glycol or methanol intoxication : Which antidote should be used, fomepizole or ethanol?

    NARCIS (Netherlands)

    Rietjens, S. J.; de Lange, D. W.; Meulenbelt, J.

    2014-01-01

    Ethylene glycol (EG) and methanol poisoning can cause life-threatening complications. Toxicity of EG and methanol is related to the production of toxic metabolites by the enzyme alcohol dehydrogenase (ADH), which can lead to metabolic acidosis, renal failure (in EG poisoning), blindness (in methanol

  16. Nanometric MIL-125-NH2 metal–organic framework as a potential nerve agent antidote carrier

    NARCIS (Netherlands)

    Vilela, S.M.F.; Salcedo-Abraira, P; Colinet, I.; Salles, F.; Koning, M.C. de; Joosen, M.J.A.; Serre, C.; Horcajada, P.

    2017-01-01

    The three-dimensional (3D) microporous titanium aminoterephthalate MIL-125-NH_2 (MIL: Material of Institut Lavoisier) was successfully isolated as monodispersed nanoparticles, which are compatible with intravenous administration, by using a simple, safe and low-cost synthetic approach (100 °C/32 h

  17. Mechanism of organophosphates (nerve gases and pesticides) and antidotes: electron transfer and oxidative stress.

    Science.gov (United States)

    Kovacic, Peter

    2003-12-01

    Evidence indicates that nerve gas toxins operate in ways in addition to inhibition of acetylcholine esterase. Alternative bioactivities are discussed with focus on electron transfer. The main class, including pralidoxime (2-PAM), incorporates conjugated iminium and oxime moieties that are electron affinic. Various physiological properties of iminium and oxime species are reviewed. The organophosphates encompass both nerve gases and insecticides, possessing similar properties, but different activities. Toxic manifestations are apparently due, in part, to oxidative stress. Alkylation of DNA takes place which may lead to generation of reactive oxygen species. Structure-activity relationships are examined, including reduction potentials and the captodative effect.

  18. Antidotes for Ricin Intoxication. Effects of Ricin on the Vascular Neuroeffector System

    Science.gov (United States)

    1992-10-25

    demonstrated by Harper et at (1980). Their experiments confirmed a retrograde transport of ricin from the submandibular gland of rats to neuronal bodies...solid cancers or malignant lymphomas who were no longer candidates for conventional therapy. Ricin was given in doses calculated to be one-third the... cancer were treated with the immunocon- jugate (260F9-ricin A) and evaluated for side effects and effect on the disease. One patient had a clinical

  19. Commitment as an Antidote to the Tension and Turnover Consequences of Organizational Politics.

    Science.gov (United States)

    Hochwarter, Wayne A.; Perrewe, Pamela L.; Ferris, Gerlad R.; Guercio, Rachel

    1999-01-01

    Surveys of 141 upper/middle managers and 418 university employees demonstrated that higher organizational commitment decreased the link between organizational politics and job tension. For managers, commitment decreased the effect of politics on intention to quit. (SK)

  20. John Baptist de la Salle and Interior Prayer: Humility as an Antidote to "Curiositas" in the Hospitable Classroom

    Science.gov (United States)

    Stratman, Jacob

    2017-01-01

    This article explores a relationship which is related to recognition, hospitality, and the classroom, but does not get a lot of attention: the relationship between the teacher and the subject of study. How does the teacher's stance towards knowledge affect relationships between students, the relationship between the student and the teacher, and…

  1. TECHNICAL AND VOCATIONAL EDUCATION AND TRAINING SKILLS: AN ANTIDOTE FOR JOB CREATION AND SUSTAINABLE DEVELOPMENT OF NIGERIAN ECONOMY

    Directory of Open Access Journals (Sweden)

    James Edomwonyi Edokpolor

    2017-12-01

    Full Text Available The research is aimed at assessing the important role of TVET on job creation and sustainable development of Nigerian economy. Two research questions were answered using mean and standard deviation statistics, while two hypotheses were tested using t-test statistic. A survey method was employed for the research. A four-point scale questionnaire was employed as the instrument for collection of data. The population consists of 332 TVET lecturers in 3 universities and 4 colleges of education in Edo and Delta States. There was no need to adopt sampling technique, nor select any sample size, since the entire population is of a manageable size. The instrument was validated by two experts and its reliability coefficient value using Cronbach alpha method was 0.81. The research revealed that TVET can equip students with skills for job creation and sustainable development of Nigerian economy. It also revealed that there was no significant difference between the mean ratings of TVET lecturers in Edo and Delta States on the extent to which TVET can equip students with skills for job creation. It further revealed that there was no significant difference between the mean ratings of male and female TVET lecturers on the extent to which TVET can equip students with skills for sustainable development of Nigerian economy. Optimizing sufficient amount of financial resources, regular supplies of state-of-the-art facilities, sourcing for qualified manpower, and organization of advocacy programme, that would help in effective management delivery of TVET were further recommended.

  2. Onion and garlic extracts as potential antidotes for cadmium-induced biochemical alterations in prostate glands of rats.

    Science.gov (United States)

    Ola-Mudathir, F K; Suru, S M

    2015-11-01

    Cadmium (Cd) has been implicated in increased prostate gland malignancy risk in both wildlife and humans. This study examines the chemoprotective roles of onion and garlic extracts on Cd-induced biochemical alterations in the prostate glands of rats. Adult male Wistar rats were randomly divided into nine groups: control group received double distilled water; Cd group received Cd alone (1.5 mg/100 g bwt per day); extract-treated groups were pre-treated with varied doses of onion and/or garlic extract (0.5 ml and 1.0 ml/100 g bwt per day) for 1 week and then co-treated with Cd (1.5 mg/100 g bwt per day) for additional 3 weeks. Oxidant/antioxidant status and acid phosphatase (ACPtotal and ACPprostatic ) activity were examined in prostate glands. Cd intoxication caused a marked (P garlic extract significantly minimised these alterations. The onion extract offered a dose-dependent protection. Our findings suggest a chemoprotective capability for onion and garlic extracts against Cd-induced biochemical alteration in the prostate glands. © 2014 Blackwell Verlag GmbH.

  3. From topical antidote against skin irritants to a novel counter-irritating and anti-inflammatory peptide

    International Nuclear Information System (INIS)

    Brodsky, Berta; Erlanger-Rosengarten, Avigail; Proscura, Elena; Shapira, Elena; Wormser, Uri

    2008-01-01

    The primary purpose of the present study was to investigate the mechanism of the counter-irritating activity of topical iodine against skin lesions induced by chemical and thermal stimuli. The hypothesis that iodine exerts its activity by inducing an endogenous anti-inflammatory factor was confirmed by exposing guinea pig skin to heat stimulus followed by topical iodine treatment and skin extraction. Injection of the extract into naive guinea pigs reduced heat-induced irritation by 69%. The protective factor, identified as a new nonapeptide (histone H2A 36-44, H-Lys-Gly-Asn-Tyr-Ala-Glu-Arg-Ileu-Ala-OH), caused reduction of 40% in irritation score in heat-exposed guinea pigs. The murine analog (H-Lys-Gly-His-Tyr-Ala-Glu-Arg-Val-Gly-OH, termed IIIM1) reduced sulfur mustard (SM)-induced ear swelling at a dose-dependent bell-shape manner reaching peak activity of 1 mg/kg. Cultured keratinocytes transfected with the peptide were more resistant towards SM than the control cells. The peptide suppressed oxidative burst in activated neutrophils in a concentration-dependent manner. In addition, the peptide reduced glucose oxidase-induced skin edema in mice at a dose-dependent bell-shape manner. Apart from thermal and chemical-induced skin irritation this novel peptide might be of potential use in chronic dermal disorders such as psoriasis and pemphigus as well as non-dermal inflammatory diseases like multiple sclerosis, arthritis and colitis

  4. Commitment to a purpose in life: an antidote to the suffering by individuals with social anxiety disorder.

    Science.gov (United States)

    Kashdan, Todd B; McKnight, Patrick E

    2013-12-01

    Recent acceptance- and mindfulness-based cognitive-behavioral interventions explicitly target the clarification and commitment to a purpose in life. Yet, scant empirical evidence exists on the value of purpose as a mechanism relevant to psychopathology or well-being. The present research explored daily (within-person) fluctuations in purposeful pursuits and well-being in a community sample of 84 adults with (n = 41) and without (n = 43) the generalized subtype of social anxiety disorder (SAD). After completing an idiographic measure of purpose in life, participants monitored their effort and progress toward this purpose, along with their well-being each day. Across 2 weeks of daily reports, we found that healthy controls reported increased self-esteem, meaning in life, positive emotions, and decreased negative emotions. People with SAD experienced substantial boosts in well-being indicators on days characterized by significant effort or progress toward their life purpose. We found no evidence for the reverse direction (with well-being boosting the amount of effort or progress that people with SAD devote to their purpose), and effects could not be attributed to comorbid mood or anxiety disorders. Results provide evidence for how commitment to a purpose in life enriches the daily existence of people with SAD. The current study supports principles that underlie what many clinicians are already doing with clients for SAD.

  5. Additive effect of DL-penicillamine plus Prussian blue for the antidotal treatment of thallotoxicosis in rats.

    Science.gov (United States)

    Montes, Sergio; Pérez-Barrón, Gabriela; Rubio-Osornio, Moisés; Ríos, Camilo; Diaz-Ruíz, Araceli; Altagracia-Martínez, Marina; Monroy-Noyola, Antonio

    2011-11-01

    DL-penicillamine (DL-P) and Prussian blue (PB) given alone or in combination were tested as possible treatments against acute thallium toxicity. Rats were intoxicated by i.p. injection of thallium (I) acetate at LD(50) (32 mg/kg). A day later, pharmacological treatment was administered until day 4 as follows: (1) vehicles, (2) PB 50mg/kg, by oral route, twice a day, (3) DL-P 25mg/kg i.p. route, twice daily and (4) PB+DL-P. The Estimated Probability Survival (EPS) was recorded during the experiment for each treatment. DL-P alone did not show a significant effect on survival. However, when it was used in combination with PB, it increased the survival significantly (EPS=0.8, PThallium I acetate, the metal levels were analyzed in blood, body organs and brain regions after treatments. DL-P given alone decreased slightly the thallium content in blood, organs and brain. Meanwhile, its administration in combination with PB diminished the thallium levels significantly (Pthallium toxicity, because this chelating agent given alone did not cause thallium redistribution to the brain. When given in combination with PB it has an additive effect in the treatment of acute thallotoxicosis. Copyright © 2011 Elsevier B.V. All rights reserved.

  6. Antidotal or protective effects of Curcuma longa (turmeric) and its active ingredient, curcumin, against natural and chemical toxicities: A review.

    Science.gov (United States)

    Hosseini, Azar; Hosseinzadeh, Hossein

    2018-03-01

    Curcuma longa is a rhizomatous perennial herb that belongs to the family Zingiberaceae, native to South Asia and is commonly known as turmeric. It is used as herbal remedy due to the prevalent belief that the plant has medical properties. C. longa possesses different effects such as antioxidant, anti-tumor, antimicrobial, anti-inflammatory, wound healing, and gastroprotective activities. The recent studies have shown that C. longa and curcumin, its important active ingredient, have protective effects against toxic agents. In this review article, we collected in vitro and animal studies which are related to protective effects of turmeric and its active ingredient against natural and chemical toxic agents. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  7. RAPID MULTICOMPONENT ANALYSIS OF HEMOGLOBIN DERIVATIVES FOR CONTROLLED ANTIDOTAL USE OF METHEMOGLOBIN-FORMING AGENTS IN CYANIDE POISONING

    NARCIS (Netherlands)

    ZIJLSTRA, WG

    When cyanide poisoning is treated with a methemoglobin-forming agent, oxidative metabolism is protected at the expense of the oxygen capacity of the blood.The affinity of methemoglobin for CN- is high enough to compete with cytochrome oxidase, which protects the latter from becoming blocked, but all

  8. Cyanide poisoning is a possible cause of cardiac arrest among fire victims, and empiric antidote treatment may improve outcomes.

    Science.gov (United States)

    Kaita, Yasuhiko; Tarui, Takehiko; Shoji, Takahiro; Miyauchi, Hiroshi; Yamaguchi, Yoshihiro

    2018-01-22

    Carbon monoxide and cyanide poisoning are important causes of death due to fire. Carbon monoxide is more regularly assessed than cyanide at the site of burn or smoke inhalation treatment due to its ease in assessment and simplicity to treat. Although several forensic studies have demonstrated the significance of cyanide poisoning in fire victims using blood cyanide levels, the association between the cause of cardiac arrest and the concentration of cyanide among fire victims has not been sufficiently investigated. This study aimed to investigate the frequency of cyanide-induced cardiac arrest in fire victims and to assess the necessity of early empiric treatment for cyanide poisoning. This study was a retrospective analysis of fire victims with cardiac arrest at the scene who were transported to a trauma and critical care center, Kyorin University Hospital, from January 2014 to June 2017. Patients whose concentration of cyanide was measured were included. Five patients were included in the study; all died despite cardiopulmonary resuscitation. Three of these victims were later found to have lethal cyanide levels (>3 μg/ml). Two of the patients had non-lethal carboxyhemoglobin levels under 50% and might have been saved if hydroxocobalamin had been administered during resuscitation. According to our results, cyanide-induced cardiac arrest may be more frequently present among fire victims than previously believed, and early empiric treatment with hydroxocobalamin may improve outcomes for these victims in cases where cardiac arrest is of short duration. Copyright © 2018 Elsevier Inc. All rights reserved.

  9. Antidotal impact of extra virgin olive oil against genotoxicity, cytotoxicity and immunotoxicity induced by hexavalent chromium in rat

    Directory of Open Access Journals (Sweden)

    Samah Khalil

    2013-12-01

    Full Text Available An in vivo study was carried out to verify whether extra-virgin olive oil (EVOO has the potential to modulate alterations resulted from exposure to hexavalent chromium (CrVI as potassium dichromate in rats. For this purpose, CrVI was injected intraperitoneally (i.p. at a dose of 0.4 mg/kg bw/day, EVOO was given orally at a dose of 300 μl daily either a lone or co-treated with CrVI at the same doses, routes and duration (26 days. At the end of the experiment, blood and spleen samples were collected. Genotoxicity, cytotoxicity and immunotoxicity biomarkers induced by CrVI were evaluated. Also, histopathological and immunohistochemical investigations of spleen tissue were conducted. A significant increase in genotoxicity and cytotoxicity biomarkers (micronucleus frequency, 8-hydroxy-2-deoxyguanosine level and lactate dehydrogenase activity were recorded in CrVI treated rats. In addition, the immunotoxicity biomarkers showed a significant decrease in phagocytic%, stimulated nitric oxide production and decrease in the serum lysozyme activity. Histopathological and immunohistochemical studies support the cytotoxicity study. Oral administration of EVOO can ameliorate those effects but not restored to control level. Thus, authors recommend that regular consumption of this oil in the diet provides a constant supply of potential antioxidants that could reduce these alterations.

  10. A Structural Biology and Protein Engineering Approach to the Development of Antidotes Against the Inhibition of Human Acetylcholinesterase by OP-based Nerve Agents

    Science.gov (United States)

    2015-05-01

    and will be reacted with coumarin . Synthesis of the pure chiral forms of the coumarin surrogate of VX, both the toxic Sp isomer, and the much less...Characterization of rhAChET • Deglycosylation of rhAChET • Tetramerization of DG-rhAChET • Synthesis of the pure chiral forms of the coumarin

  11. Social Economy as Antidote to Criminal Economy: How Social Cooperation is Reclaiming Commons in the Context of Campania’s Environmental Conflicts

    Directory of Open Access Journals (Sweden)

    Monica Caggiano

    2015-07-01

    Full Text Available This article contributes to ongoing debates on how bottom-up social cooperation can halt and reverse processes of environmental and human degradation, dispossession and impoverishment, by proposing a synchronization of resistance and of commoning practices. The article moves from the empirical case of social and ecological conflicts currently unfolding in the so-called Land of Fires, an area in Southern Italy infamous for the socio-environmental impacts of two decades of waste disposal, mismanagement and contamination. Within this context, a coalition of grassroots movements is struggling to resist livelihoods degradation through an alliance with anti-Mafia social cooperatives. We provide an in-depth analysis of emerging social and economic networks that connect the strategies of grassroots movements for environmental justice with the work of social cooperatives that reclaim lands and assets confiscated to Mafia. The interests of environmental activists meet the interests of social cooperatives at the crossroad of territory reclamation with the spheres of social and economic production and reproduction. Framing the case as a cultural and physical re-appropriation of territory, we provide an analysis of strategies and limits for a symbolic and practical project of social re-appropriation of the commons (De Angelis 2012.

  12. Fingerprints of transversal and longitudinal coupling between induced open quantum dots in the longitudinal magneto-conductance through anti-dot lattices

    Energy Technology Data Exchange (ETDEWEB)

    Ujevic, Sebastian [Universidade Federal Fluminense (EEIMVR/UFF), Volta Redonda, RJ (Brazil). Escola de Engenharia Industrial e Metalurgica de Volta Redonda; Mendoza, Michel [Universidade Federal do ABC (UFABC), Santo Andre, SP (Brazil). Centro de Ciencias Naturais e Humanas

    2011-07-01

    Full text. We propose numerical simulations of longitudinal magneto conductance through a finite anti dot lattice located inside an open quantum dot with a magnetic field applied perpendicular to the plane. The system is connected to reservoirs using quantum point contacts. We discuss the relationship between the longitudinal magneto conductance and the generation of transversal couplings between the induced open quantum dots in the system. The system presents longitudinal magneto conductance maps with crossovers (between transversal bands) and closings (longitudinal decoupling) of fundamental quantum states related to the open quantum dots induced by the anti dot lattice. A relationship is observed between the distribution of anti dots and the formed conductance bands, allowing a systematic follow-up of the bands as a function of the applied magnetic field and quantum point contact width. We observed a high conductance intensity (between n- and (n + 1)-quantum of conductance, n = 1; 2...) in the regions of crossover and closing of states. This suggests transversal couplings between the induced open quantum dots of the system that can be modulated by varying both the anti dots potential and the quantum point contact width. A new continuous channel (not expected) is induced by the variation of the contact width and generate Fano resonances in the conductance. These resonances can be manipulated by the applied magnetic field

  13. Using the Venom of a Snake for an Antidote: exploring strategies and services for sex workers in preparation for the World Cup 2014.

    Science.gov (United States)

    Ewen, Janine Elizabeth

    2015-07-01

    This article considers the public health implications that were predicted by sex workers a year prior to the FIFA World Cup 2014, with considerations towards the Olympic Games in 2016. Primary research conducted in 2013 in Brazil's second largest city, Rio de Janeiro, gave sex workers and civil society organizations the opportunity to voice concerns of the everyday disadvantages faced by those involved in the sex industry, with emphasis on what could cause further detriments from acting as a double draw international sporting host. This research largely took place through invitation at the 2013 Rio State Conference on HIV/AIDS, Equality and Human Rights. Mixed methods research - pre-arrival questionnaires and interviews led by a semi-structured interview guide - was deemed suitable for the primary research collection. The use of the research software NVivo allowed data to be categorised into key themes to form the basis of this research article. Working with a Portuguese translator, case studies of transsexual sex workers and civil society organizations were developed. Police violence was the main re-occurring theme expressed as a continued fear, alongside the added increase of security measures that the games would bring, to reduce organized crime, and through the Pacification programme. The majority of sex workers and organizations believed that there was no support from the Brazilian government to continue to provide services of high demand, including social care and legal assistance. Sex workers also felt prejudice in receiving HIV/AIDS treatment from government-led health services. A desirable outcome for the sex worker community would be for the government to consider the following: recommendations devised for further health and well being support; an act or law of non-violence against them; and recommendations to decimalize the sex industry. The Brazilian government has received global recognition for its response to the HIV/AIDS epidemic, however the treatment based and contraception promotion does not extend itself to consider the social implications that put sex workers at huge public health risks, especially physical violence. This research provides an important case for explicit revisions of policies in Brazil regarding the health and safety of sex workers. © Royal Society for Public Health 2014.

  14. [Treatment with inhibitors of new oral direct anticoagulants in patients with severe bleedings or urgent surgical procedures. The new dabigatran antidote: the place of idarucizumab in clinical practice].

    Science.gov (United States)

    Boda, Zoltán

    2016-03-20

    Only vitamin K antagonists could be applied as oral anticoagulants over the past six decades. Coumarols have narrow therapeutic range, and unpredictable anticoagulant effects are resulted by multiple drug interactions. Therefore, regular routine monitoring of the international normalized ratio is necessary. There are two groups of factor-specific anticoagulants: molecules with anti-FIIa (dabigatran) and anti-FXa (rivaroxaban, apixaban and edoxaban) effect. Author summarizes the most important clinical features of the new oral anticoagulants, their indications and the possibilities of laboratory controls. Bleedings are the most important side effects of anticoagulants. This review summarizes the current published evidences for new oral anticoagulants reversal (non-specific and specific) agents, especially in cases with severe acute bleedings or urgent surgery procedures. It reports on how to use inhibitors, the recommended doses and the most important clinical results. The review focuses on idarucizumab - already approved by the U.S. Food and Drug Administration and the European Medicines Agency - which has a key role as the first specific inhibitor of dabigatran.

  15. Bioanalytical Method to Determine the Effects of Cyanide, Cyanide Metabolites and Cyanide Antidotes on the Activity of Cytochrome C Oxidase Immobilized in an Electrode Supported Lipid Bilayer Membrane

    Science.gov (United States)

    2006-06-01

    cytochrome oxidase and its effect on glycolysis and on the high energy phosphorus compounds in the brain. J. Biol. Chem. 1946, 164, 45-51. 39...M.; Chen, K. K., Hydroxocobalamine and acute cyanide poisoning in dogs . Life Sci. 1965, 4, 1785-1789. 49. Way, J. L., Cyanide intoxication and its

  16. Functional Cardiorespiratory Toxicity Screening of Candidate Antiparasitic Drugs and Antidotes for Chemical Poisons. Study of the Effects of Drugs Upon the Cardiovascular and Respiratory Systems

    Science.gov (United States)

    1988-06-01

    which are designated 100. Several variables are plotted as mean absolute values. Mean blood gases and hematocrit are given In tabular form...high dose group. Baseline venous blood hematocrit ranged from 39W2 to 42t3 percent cells. Hematocrit appeared to rise with the infusion of...effector organs; (2) stimulation, followed by depression or paraly- sis, of all autonomic ganglia and skeletal muscle ( nicotinic actions); and 3

  17. When the GERM Hosts the Antidote: The Surprising New Birth of Israel's Anti-GERM Pre-K Policy

    Science.gov (United States)

    Bialik, Gadi; Shefi, Noa

    2017-01-01

    Since the 1970s, Israel's educational policy has been undergoing a change generated by the neo-liberal agenda. In this light, it is not surprising that since the 1990s, Israel's education system has adopted the main characteristics of the Global Education Reform Movement (GERM). In light of this, the current research will focus on a newly born…

  18. Dialectic Antidotes to Critics of the Technology Acceptance Model: Conceptual, Methodological, and Replication Treatments for Behavioural Modelling in Technology-Mediated Environments

    Directory of Open Access Journals (Sweden)

    Weng Marc Lim

    2018-01-01

    Full Text Available The technology acceptance model (TAM is a prominent and parsimonious conceptual lens that is often applied for behavioural modelling in technology-mediated environments. However, TAM has received a great deal of criticism in recent years. This article aims to address some of the most pertinent issues confronting TAM through a rejoinder that offers dialectic antidotes—in the form of conceptual, methodological, and replication treatments—to support the continued use of TAM to understand the peculiarities of user interactions with technology in technology-mediated environments. In doing so, this article offers a useful response to a common but often inadequately answered question about how TAM can continue to be relevant for behavioural modelling in contemporary technology-mediated environments.

  19. Optimization as side-effect of evolving allelopathic diversity

    NARCIS (Netherlands)

    Pagie, L.; Hogeweg, P.

    2001-01-01

    Many bacteria carry gene complexes that code for a toxin-antidote pair, e.g. colicin systems. Such gene complexes can be advantageous for its host by killing competitor bacteria while the antidote protects the host. However, in order to evolve a novel and useful toxin first a proper antidote must

  20. Overview of Poisoning

    Science.gov (United States)

    ... sometimes used. With this procedure, a solution containing sodium bicarbonate (the chemical in baking soda) is given by vein to make the urine ... acetaminophen (antidote is N - acetylcysteine ), aspirin (antidote is sodium bicarbonate), and heroin (antidote is naloxone ). Some poisonous bites ...

  1. The principles of antipode therapy in the case of radionuclide incorporation

    International Nuclear Information System (INIS)

    Krasnyuk, V.I.; Ivannikov, A.T.

    2001-01-01

    General principles of antidote therapy to be applied for reducing internal exposure of the patients in the case of an accidental radionuclide incorporation are developed. Clinical and pharmacological properties of some antidotes counteracting radionuclide incorporation in the human body are evaluated accounting for medical and experimental experience. General principles of antidote therapy of the patients following an accidental incorporation of radionuclides in the human body are formulated. A pharmacological specification and classification of modern radionuclide antidotes licensed for clinical use are set up. Clinical examples of antidote treatment of patients are presented [ru

  2. The vitamin K-dependent carboxylation system in human osteosarcoma U2-OS cells. Antidotal effect of vitamin K1 and a novel mechanism for the action of warfarin.

    OpenAIRE

    Wallin, R; Rossi, F; Loeser, R; Key, L L

    1990-01-01

    An osteoblast-like human osteosarcoma cell line (U2-OS) has been shown to possess a vitamin K-dependent carboxylation system which is similar to the system in human HepG2 cells and in liver and lung from the rat. In an 'in vitro' system prepared from these cells, vitamin K1 was shown to overcome warfarin inhibition of gamma-carboxylation carried out by the vitamin K-dependent carboxylase. The data suggest that osteoblasts, the cells involved in synthesis of vitamin K-dependent proteins in bon...

  3. Submicrometric 2D ratchet effect in magnetic domain wall motion

    Energy Technology Data Exchange (ETDEWEB)

    Castán-Guerrero, C., E-mail: ccastan@unizar.es [Instituto de Ciencia de Materiales de Aragón (ICMA), CSIC – Universidad de Zaragoza, E-50009 Zaragoza (Spain); Dpto. de Física de la Materia Condensada, Universidad de Zaragoza, E-50009 Zaragoza (Spain); Herrero-Albillos, J. [Fundación ARAID, E-50004 Zaragoza (Spain); Centro Universitario de la Defensa, E-50090 Zaragoza (Spain); Instituto de Ciencia de Materiales de Aragón (ICMA), CSIC – Universidad de Zaragoza, E-50009 Zaragoza (Spain); Sesé, J. [Instituto de Nanociencia de Aragón, Laboratorio de Microscopías Avanzadas, Universidad de Zaragoza, E-50018 Zaragoza (Spain); Dpto. de Física de la Materia Condensada, Universidad de Zaragoza, E-50009 Zaragoza (Spain); Bartolomé, J.; Bartolomé, F. [Instituto de Ciencia de Materiales de Aragón (ICMA), CSIC – Universidad de Zaragoza, E-50009 Zaragoza (Spain); Dpto. de Física de la Materia Condensada, Universidad de Zaragoza, E-50009 Zaragoza (Spain); Hierro-Rodriguez, A.; Valdés-Bango, F.; Martín, J.I.; Alameda, J.M. [Dpto. Física, Universidad de Oviedo, Asturias (Spain); CINN (CSIC – Universidad de Oviedo – Principado de Asturias), Asturias (Spain); García, L.M. [Instituto de Ciencia de Materiales de Aragón (ICMA), CSIC – Universidad de Zaragoza, E-50009 Zaragoza (Spain); Dpto. de Física de la Materia Condensada, Universidad de Zaragoza, E-50009 Zaragoza (Spain)

    2014-12-15

    Strips containing arrays of submicrometric triangular antidots with a 2D square periodicity have been fabricated by electron beam lithography. A clear ratchet effect of 180° domain wall motion under a varying applied field parallel to the walls has been observed. The direction is determined by the direction of the triangle vertices. In contrast, no ratchet effect is observed when the antidot array is constituted by symmetric rhomb-shaped antidots.

  4. Plaadid / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2005-01-01

    Uutest heliplaatidest Saint Etienne "Tales From Turnpike House", "Team Sleep", Jamiroquai "Dynamite", Life Of Agony "Broken Valley", The Wallflowers "Rebel, Sweetheart", morcheeba "The Antidote", Amerie "Touch"

  5. Treating exposure to chemical warfare agents: Implications for health care providers and community emergency planning

    Energy Technology Data Exchange (ETDEWEB)

    Munro, N.B.; Watson, A.P.; Ambrose, K.R.; Griffin, G.D. (Oak Ridge National Lab., TN (USA))

    1990-11-01

    Current treatment protocols for exposure to nerve and vesicant agents found in the US stockpile of unitary chemical weapons are summarized, and the toxicities of available antidotes are evaluated. The status of the most promising of the new nerve agent antidotes is reviewed. In the US, atropine and pralidoxime compose the only approved antidote regimen for organophosphate nerve agent poisoning. Diazepam may also be used if necessary to control convulsions. To avoid death, administration must occur within minutes of substantial exposure together with immediate decontamination. Continuous observation and repeated administration of antidotes are necessary as symptoms warrant. Available antidotes do not necessarily prevent respiratory failure or incapacitation. The toxicity of the antidotes themselves and the individualized nature of medical care preclude recommending that autoinjectors be distributed to the general public. In addition, precautionary administration of protective drugs to the general population would not be feasible or desirable. No antidote exists for poisoning by the vesicant sulfur mustard (H, HD, HT); effective intervention can only be accomplished by rapid decontamination followed by palliative treatment of symptoms. British anti-Lewisite (BAL) (2,3-dimercapto-1-propanol) is the antidote of choice for treatment of exposure to Lewisite, another potent vesicant. Experimental water-soluble BAL analogues have been developed that are less toxic than BAL. Treatment protocols for each antidote are summarized in tabular form for use by health care providers.

  6. Original Article

    African Journals Online (AJOL)

    rats, mice and chicks; and also to use conventional antidotes to treat intoxication in rats due to JC poisoning. The LD50 of the ... addition, acute behavioral and CNS toxicity studies of JC including antidotal therapy against JC poisoning were done. The data ..... exclusion of females and young children from most therapeutic ...

  7. A pilot study on the management and outcomes of self-poisoning in a rural Ugandan Emergency Centre

    Directory of Open Access Journals (Sweden)

    Vinodinee Dissanayake

    2018-03-01

    Discussion: In resource-limited settings where antidotes and resuscitative capabilities are scarce, decontamination needs to be studied further. Repeat atropine use without indication may lead to depletion of an essential antidote. Future directions include a public health education programme and an algorithm to help guide clinical decisions.

  8. Interventions for paracetamol (acetaminophen) overdoses. Protocol for a Cochrane Review

    DEFF Research Database (Denmark)

    Brok, J; Buckley, N; Gluud, C

    2001-01-01

    Poisoning with paracetamol (acetaminophen) is a common cause of hepatotoxicity in the Western World. Inhibition of absorption, removal from the vascular system, antidotes, and liver transplantation are interventions for paracetamol poisoning.......Poisoning with paracetamol (acetaminophen) is a common cause of hepatotoxicity in the Western World. Inhibition of absorption, removal from the vascular system, antidotes, and liver transplantation are interventions for paracetamol poisoning....

  9. Acute Cyanide Poisoning: Hydroxocobalamin and Sodium Thiosulfate Treatments with Two Outcomes following One Exposure Event

    Directory of Open Access Journals (Sweden)

    Andrew Meillier

    2015-01-01

    Full Text Available Cyanide is rapidly reacting and causes arrest of aerobic metabolism. The symptoms are diffuse and lethal and require high clinical suspicion. Remediation of symptoms and mortality is highly dependent on quick treatment with a cyanide antidote. Presently, there are two widely accepted antidotes: sodium thiosulfate and hydroxocobalamin. These treatments act on different components of cyanide’s metabolism. Here, we present two cases resulting from the same source of cyanide poisoning and the use of both antidotes separately used with differing outcomes.

  10. Magnetic stripes and holes: Complex domain patterns in perforated films with weak perpendicular anisotropy

    Directory of Open Access Journals (Sweden)

    F. Valdés-Bango

    2017-05-01

    Full Text Available Hexagonal antidot arrays have been patterned on weak perpendicular magnetic anisotropy NdCo films by e-beam lithography and lift off. Domain structure has been characterized by Magnetic Force Microscopy at remanence. On a local length scale, of the order of stripe pattern period, domain configuration is controlled by edge effects within the stripe pattern: stripe domains meet the hole boundary at either perpendicular or parallel orientation. On a longer length scale, in-plane magnetostatic effects dominate the system: clear superdomains are observed in the patterned film with average in-plane magnetization along the easy directions of the antidot array, correlated over several antidot array cells.

  11. Magnetic stripes and holes: Complex domain patterns in perforated films with weak perpendicular anisotropy

    Science.gov (United States)

    Valdés-Bango, F.; Vélez, M.; Alvarez-Prado, L. M.; Alameda, J. M.; Martín, J. I.

    2017-05-01

    Hexagonal antidot arrays have been patterned on weak perpendicular magnetic anisotropy NdCo films by e-beam lithography and lift off. Domain structure has been characterized by Magnetic Force Microscopy at remanence. On a local length scale, of the order of stripe pattern period, domain configuration is controlled by edge effects within the stripe pattern: stripe domains meet the hole boundary at either perpendicular or parallel orientation. On a longer length scale, in-plane magnetostatic effects dominate the system: clear superdomains are observed in the patterned film with average in-plane magnetization along the easy directions of the antidot array, correlated over several antidot array cells.

  12. Fluctuations in serum ethanol concentration in the treatment of acute methanol poisoning: a prospective study of 21 patients

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Navrátil, Tomáš; Salek, T.; Kurcová, I.; Pelclová, D.

    2015-01-01

    Roč. 159, č. 4 (2015), s. 666-676 ISSN 1213-8118 Institutional support: RVO:61388955 Keywords : methanol poisoning * ethanol * antidote Subject RIV: CG - Electrochemistry Impact factor: 0.924, year: 2015

  13. Combating Terrorism Chemical and Biological Medical Supplies Are Poorly Managed

    National Research Council Canada - National Science Library

    Bascetta, Cynthia

    2000-01-01

    .... As a result, the inventory we conducted identified a number of items, such as antidotes and antibiotics, that were stocked below required levels or had expired, as well as excesses of other items like sterile gloves...

  14. Fomepizole versus ethanol in the treatment of acute methanol poisoning: Comparison of clinical effectiveness in a mass poisoning outbreak

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Pelclová, D.; Navrátil, Tomáš; Běláček, J.; Komarc, M.; Edleston, M.; Hovda, K. E.

    2015-01-01

    Roč. 53, č. 8 (2015), s. 797-806 ISSN 1556-3650 Institutional support: RVO:61388955 Keywords : clinical effectiveness * hospital treatment * antidote administration Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.886, year: 2015

  15. Quantum Computing With Quasiparticles of the Fractional Quantum Hall Effect

    National Research Council Canada - National Science Library

    Averin, Dmitri

    2001-01-01

    The focus of this project was the theoretical study of quantum computation based on controlled transfer of individual quasiparticles in systems of quantum antidots in the regime of the Fractional Quantum Hall Effect (FQHE...

  16. Structure-Based Design of Inhibitors to the Cytotoxin RICIN. Addendum

    National Research Council Canada - National Science Library

    Robertus, Jon

    2008-01-01

    Ricin is a cytotoxin and a known bioterrorist weapon. The Army is pursuing anti-ricin vaccines, but plans to develop an efficacious antidote to the toxin for cases where vaccination is not appropriate...

  17. Protection Against Chemical Agent-Induced, Seizure-Related Neuronal Cell Death

    National Research Council Canada - National Science Library

    Ballough, Gerald P; Filbert, Margaret G

    2002-01-01

    .... While seizure-related brain damage can be prevented by administration of an anticonvulsant drug, battlefield conditions may preclude prompt administration of the convulsant antidote for nerve agents (CANA...

  18. Protein (Cyanobacteria): 440680064 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007154859.1 NC_019775 1117:3991 ... 1161:5387 ... 1162:6232 1163:4927 1165:626 272123:626 ... putative addicti...on module antidote protein Anabaena cylindrica PCC 7122 MALTKDFKETVNARIQRDPDFAIVLLDEAISLFLNGELETARLILRNMLNLSHF

  19. Computer Simulation Lends New Insights Into Cyanide-Caused Cardiac Toxicity

    National Research Council Canada - National Science Library

    Zoltani, C. K; Platoff, G. E; Baskin, S. I

    2004-01-01

    The development of antidotes against cyanide (CN) poisoning for the protection of the warfighter is still hampered by a lack of detailed understanding of the modulation of CN-affected cellular processes...

  20. Interventions for paracetamol (acetaminophen) overdoses

    DEFF Research Database (Denmark)

    Brok, J; Buckley, N; Gluud, C

    2002-01-01

    Self-poisoning with paracetamol (acetaminophen) is a common cause of hepatotoxicity in the Western World. Interventions for paracetamol poisoning encompass inhibition of absorption, removal from the vascular system, antidotes, and liver transplantation....

  1. Availability of treatment resources for the management of acute toxic exposures and poisonings in emergency departments among various types of hospitals in Palestine: a cross-sectional study

    OpenAIRE

    Zyoud, Sa’ed H; Al-Jabi, Samah W; Bali, Yara I; Al-Sayed, Afnan M; Sweileh, Waleed M; Awang, Rahmat

    2014-01-01

    Background Poisoning exposures continue to be a significant cause of morbidity and mortality worldwide. The lack of facilities, treatment resources, and antidotes in hospitals may affect the treatments provided and outcomes. This study aimed to determine the availability of gastrointestinal (GI) decontamination, stabilisation, elimination enhancement resources, and antidotes for the management of acute toxic exposures and poisonings in emergency departments (EDs) among various types of govern...

  2. In Search of an Effective in vivo Reactivator for Organophosphorus Nerve Agent-Inhibited Acetylcholinesterase in the Central Nervous System

    Science.gov (United States)

    2012-01-01

    induced by OP compounds. Furthermore, this compound possesses a pronounced antidotal action in acute poisoning with OP and carbamate pesticides of... new antidote drug combination (Atropine-HI-6-prodiazepam) for treatment of organophosphate poisoning, Eur. J. Pharm. Sci., 9(2000), 259–263. [9] J...Kokshareva, S.D. Kovtum, Yu.S. Kagan, I.G. Mizyukova and B.M. Medvedev, Effect of a new cholinesterase reactivator, diethyxime, on the central nervous

  3. Interventions for paracetamol (acetaminophen) overdoses

    DEFF Research Database (Denmark)

    Brok, J; Buckley, N; Gluud, C

    2002-01-01

    Self-poisoning with paracetamol (acetaminophen) is a common cause of hepatotoxicity in the Western World. Interventions for paracetamol poisoning encompass inhibition of absorption, removal from the vascular system, antidotes, and liver transplantation.......Self-poisoning with paracetamol (acetaminophen) is a common cause of hepatotoxicity in the Western World. Interventions for paracetamol poisoning encompass inhibition of absorption, removal from the vascular system, antidotes, and liver transplantation....

  4. Europe-Wide Meta-Analysis of Borrelia burgdorferi Sensu Lato Prevalence in Questing Ixodes ricinus Ticks

    Czech Academy of Sciences Publication Activity Database

    Strnad, Martin; Hönig, Václav; Růžek, Daniel; Grubhoffer, Libor; Rego, Ryan O. M.

    2017-01-01

    Roč. 83, č. 15 (2017), č. článku e00609-17. ISSN 0099-2240 EU Projects: European Commission(XE) 278976 - ANTIGONE; European Commission(XE) 602272 - ANTIDotE Institutional support: RVO:60077344 Keywords : Borrelia burgdorferi sensu lato * tick * Ixodes ricinus * genospecies * meta-analysis * Lyme borreliosis * Lyme disease Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.807, year: 2016

  5. Quantum information processing using designed defect states in

    DEFF Research Database (Denmark)

    Pedersen, Jesper; Flindt, Christian; Mortensen, Niels Asger

    2007-01-01

    We propose a new physical implementation of spin qubits for quantum information processing, namely defect states in antidot lattices de¯ned in the two-dimensional electron gas at a semiconductor heterostructure. Calculations of the band structure of the periodic antidot lattice are presented. A p......-coupled defect states is calculated numerically.We ¯nd results reminiscent of double quantum dot structures, indicating that the suggested structure is a feasible physical implementation of spin qubits....

  6. Antagonism of cyanide toxicity by isosorbide dinitrate: possible role of nitric oxide.

    Science.gov (United States)

    Sun, P; Borowitz, J L; Kanthasamy, A G; Kane, M D; Gunasekar, P G; Isom, G E

    1995-12-15

    In a search for improved cyanide antidotes, the efficacy of isosorbide dinitrate (ISDN), was compared with that of the known cyanide antidote, NaNO2. ISDN was as effective as an optimal dose of NaNO2 in protecting mice against cyanide lethality. To study the mechanism involved, the extent of formation of the cyanide scavenger, methemoglobin, in the action of ISDN was determined. ISDN (300 mg/kg, p.o.) increased methemoglobin from 5 to 10% of total hemoglobin, while, in contrast, NaNO2 (100 mg/kg, i.p.) increased methemoglobin levels to 50% of total hemoglobin. Lowering the dose of NaNO2 to 30 mg/kg reduced methemoglobin levels to approximately 10% of total hemoglobin and in turn nearly abolished its antidotal effect. Decreasing methemoglobin to less than control levels using methylene blue failed to abolish cyanide antagonism by ISDN. Thus, methemoglobin formation by ISDN does not account for its antidotal action. Further studies comparing the respiratory depressant effects of cyanide in the presence of ISDN or NaNO2 also indicated that these two antidotes have different mechanisms of action. Efforts to produce tolerance to the antidotal effect of ISDN against cyanide toxicity were unsuccessful. It is suggested that the well-known ability of ISDN to generate nitric oxide may account for the noted cyanide antagonism.

  7. Sodium thiosulfate or hydroxocobalamin for the empiric treatment of cyanide poisoning?

    Science.gov (United States)

    Hall, Alan H; Dart, Richard; Bogdan, Gregory

    2007-06-01

    Cyanide poisoning must be seriously considered in victims of smoke inhalation from enclosed space fires; it is also a credible terrorism threat agent. The treatment of cyanide poisoning is empiric because laboratory confirmation can take hours or days. Empiric treatment requires a safe and effective antidote that can be rapidly administered by either out-of-hospital or emergency department personnel. Among several cyanide antidotes available, sodium thiosulfate and hydroxocobalamin have been proposed for use in these circumstances. The evidence available to assess either sodium thiosulfate or hydroxocobalamin is incomplete. According to recent safety and efficacy studies in animals and human safety and uncontrolled efficacy studies, hydroxocobalamin seems to be an appropriate antidote for empiric treatment of smoke inhalation and other suspected cyanide poisoning victims in the out-of-hospital setting. Sodium thiosulfate can also be administered in the out-of-hospital setting. The efficacy of sodium thiosulfate is based on individual case studies, and there are contradictory conclusions about efficacy in animal models. The onset of antidotal action of sodium thiosulfate may be too slow for it to be the only cyanide antidote for emergency use. Hydroxocobalamin is being developed for potential introduction in the United States and may represent a new option for emergency personnel in cases of suspected or confirmed cyanide poisoning in the out-of-hospital setting.

  8. Pediatric cyanide poisoning: causes, manifestations, management, and unmet needs.

    Science.gov (United States)

    Geller, Robert J; Barthold, Claudia; Saiers, Jane A; Hall, Alan H

    2006-11-01

    Confirmed cases of childhood exposure to cyanide are rare despite multiple potential sources including inhalation of fire smoke, ingestion of toxic household and workplace substances, and ingestion of cyanogenic foods. Because of its infrequent occurrence, medical professionals may have difficulty recognizing cyanide poisoning, confirming its presence, and treating it in pediatric patients. The sources and manifestations of acute cyanide poisoning seem to be qualitatively similar between children and adults, but children may be more vulnerable than adults to poisoning from some sources. The only currently available antidote in the United States (the cyanide antidote kit) has been used successfully in children but has particular risks associated with its use in pediatric patients. Because hemoglobin kinetics vary with age, methemoglobinemia associated with nitrite-based antidotes may be excessive at standard adult dosing in children. A cyanide antidote with a better risk/benefit ratio than the current agent available in the United States is desirable. The vitamin B12 precursor hydroxocobalamin, which has been used in Europe, may prove to be an attractive alternative to the cyanide antidote kit for pediatric patients. In this article we review the available data on the sources, manifestations, and treatment of acute cyanide poisoning in children and discuss unmet needs in the management of pediatric cyanide poisoning.

  9. Survey of treatment practices for sexual dysfunction(s) associated with anti-depressants.

    Science.gov (United States)

    Balon, Richard; Segraves, R Taylor

    2008-01-01

    There are many management strategies and antidotes available for sexual dysfunction associated with antidepressants available. However, only a few of these strategies and antidotes were tested in rigorous trials and most of them probably will not be rigorously tested. Surveying the prescribing practices of experts in this area provides another opportunity to evaluate these strategies and antidotes. The authors surveyed 29 (of 50) "expert" psychiatrists in the area of sexual dysfunction associated with antidepressants. Switching to another antidepressant, decreasing the dose of an antidepressant, and adding oral agents such as bupropion, phosphodiesterase-5 inhibitors, and some dopaminergic agents (dextroamphetamine, methylphenidate) and a testosterone patch in some dysfunctions (libido, orgasm) are management strategies most frequently used by the experts. The experts also consider these strategies as the most effective ones. These findings are compared with other studies and discussed with regard to the evidence from clinical trials.

  10. An engineered bacterium auxotrophic for an unnatural amino acid: a novel biological containment system

    Directory of Open Access Journals (Sweden)

    Yusuke Kato

    2015-09-01

    Full Text Available Biological containment is a genetic technique that programs dangerous organisms to grow only in the laboratory and to die in the natural environment. Auxotrophy for a substance not found in the natural environment is an ideal biological containment. Here, we constructed an Escherichia coli strain that cannot survive in the absence of the unnatural amino acid 3-iodo-L-tyrosine. This synthetic auxotrophy was achieved by conditional production of the antidote protein against the highly toxic enzyme colicin E3. An amber stop codon was inserted in the antidote gene. The translation of the antidote mRNA was controlled by a translational switch using amber-specific 3-iodo-L-tyrosine incorporation. The antidote is synthesized only when 3-iodo-L-tyrosine is present in the culture medium. The viability of this strain rapidly decreased with less than a 1 h half-life after removal of 3-iodo-L-tyrosine, suggesting that the decay of the antidote causes the host killing by activated colicin E3 in the absence of this unnatural amino acid. The contained strain grew 1.5 times more slowly than the parent strains. The escaper frequency was estimated to be 1.4 mutations (95% highest posterior density 1.1–1.8 per 105 cell divisions. This containment system can be constructed by only plasmid introduction without genome editing, suggesting that this system may be applicable to other microbes carrying toxin-antidote systems similar to that of colicin E3.

  11. Characterization of Ixodes ricinus fibrinogen-related proteins (Ixoderins) discloses their function in the tick innate immunity

    Czech Academy of Sciences Publication Activity Database

    Hönig Mondeková, Helena; Šíma, Radek; Urbanová, Veronika; Kovář, Vojtěch; Rego, Ryan O. M.; Grubhoffer, Libor; Kopáček, Petr; Hajdušek, Ondřej

    2017-01-01

    Roč. 7, DEC (2017), č. článku 509. ISSN 2235-2988 R&D Projects: GA ČR GA17-27386S; GA ČR GA17-27393S; GA ČR GJ15-12006Y; GA ČR GA13-11043S EU Projects: European Commission(XE) 602272 - ANTIDotE Institutional support: RVO:60077344 Keywords : Fibrinogen-related protein * Ixoderin * Ixodes * Lectin * RNAi * Tick Subject RIV: EC - Immunology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.300, year: 2016

  12. Availability of treatment resources for the management of acute toxic exposures and poisonings in emergency departments among various types of hospitals in Palestine: a cross-sectional study.

    Science.gov (United States)

    Zyoud, Sa'ed H; Al-Jabi, Samah W; Bali, Yara I; Al-Sayed, Afnan M; Sweileh, Waleed M; Awang, Rahmat

    2014-02-21

    Poisoning exposures continue to be a significant cause of morbidity and mortality worldwide. The lack of facilities, treatment resources, and antidotes in hospitals may affect the treatments provided and outcomes. This study aimed to determine the availability of gastrointestinal (GI) decontamination, stabilisation, elimination enhancement resources, and antidotes for the management of acute toxic exposures and poisonings in emergency departments (EDs) among various types of governmental and private hospitals in Palestine. A cross-sectional study using semi-structured questionnaire was performed. Data were collected based on hospital resources; GI decontamination, stabilisation, elimination enhancement resources and antidotes from Palestinian hospitals. Eighteen hospitals (94.7%) have responded. Among them, paracetamol poisoning was the most frequently reported cases by EDs (mean frequency score = 7.6 ± 2.1), followed by bee stings (mean = 6.9 ± 2.7) and organophosphate poisoning (mean = 6.7 ± 2.7). The availabilities of most resources related to GI decontamination items varied substantially with hospital type, but these differences were not statistical significant. The availability of stabilisation resources was not significantly different between hospitals types. For the availability of techniques used to enhance the elimination of toxic substances, there were variations between the hospitals types. However, these differences were not statistical significant, except for haemodialysis (p = 0.003) which was more available in governmental hospitals. For the availability of antidotes, none of the hospitals had sufficient stock of all antidotes listed. In relation to hospital type, there was variability in the availability of antidotes, but this did not reach statistical significance, except for deferoxamine (p treatment resources and antidotes in Palestinian hospitals was not adequate except for stabilisation resources. The availability of such resources acts as a

  13. Reversal Strategies for NOACs

    DEFF Research Database (Denmark)

    Husted, Steen; Verheugt, Freek; Comuth, Willemijn

    2015-01-01

    The non-vitamin K antagonist oral anticoagulants (NOACs) are used for thromboembolic prophylaxis of patients with atrial fibrillation and in the treatment as well as secondary prophylaxis of patients with venous thromboembolism. Even though NOACs have a better safety profile than vitamin K...... including NOACs is currently undergoing phase II trials. For use of these specific antidotes, it is desirable that measurements for coagulation activity with a short response delay are widely available for the different NOACs and further research in this field is needed. Furthermore, guidelines for antidote...

  14. Cyanide intoxication as part of smoke inhalation - a review on diagnosis and treatment from the emergency perspective

    Directory of Open Access Journals (Sweden)

    Hyldegaard Ole

    2011-03-01

    Full Text Available Abstract This paper reviews the current literature on smoke inhalation injuries with special attention to the effects of hydrogen cyanide. It is assumed that cyanide poisoning is still an overlooked diagnosis in fire victims. Treatment against cyanide poisoning in the emergency setting should be given based on the clinical diagnosis only. Oxygen in combination with a recommended antidote should be given immediately, the first to reduce cellular hypoxia and the second to eliminate cyanide. A specific antidote is hydroxycobalamin, which can be given iv. and has few side effects.

  15. Hyperbaric oxygen therapy or hydroxycobalamin attenuates surges in brain interstitial lactate and glucose; and hyperbaric oxygen improves respiratory status in cyanide-intoxicated rats

    DEFF Research Database (Denmark)

    Lawson-Smith, P; Olsen, Niels Vidiendal; Hyldegaard, O

    2011-01-01

    Cyanide (CN) intoxication inhibits cellular oxidative metabolism and may result in brain damage. Hydroxycobalamin (OHCob) is one among other antidotes that may be used following intoxication with CN. Hyperbaric oxygen (HBO2) is recommended when supportive measures or antidotes fail. However...... to four groups receiving potassium CN (KCN) 5.4 mg/kg or vehicle intra-arterially: 1) vehicle-treated control rats; 2) KCN-poisoned rats; 3) KCN-poisoned rats receiving hydroxycobalamin (25 mg); and 4) KCN-poisoned rats treated with HBO2 (284 kPa for 90 minutes). KCN alone caused a prompt increase...

  16. Noninvasive monitoring of treatment response in a rabbit cyanide toxicity model reveals differences in brain and muscle metabolism

    Science.gov (United States)

    Kim, Jae G.; Lee, Jangwoen; Mahon, Sari B.; Mukai, David; Patterson, Steven E.; Boss, Gerry R.; Tromberg, Bruce J.; Brenner, Matthew

    2012-10-01

    Noninvasive near infrared spectroscopy measurements were performed to monitor cyanide (CN) poisoning and recovery in the brain region and in foreleg muscle simultaneously, and the effects of a novel CN antidote, sulfanegen sodium, on tissue hemoglobin oxygenation changes were compared using a sub-lethal rabbit model. The results demonstrated that the brain region is more susceptible to CN poisoning and slower in endogenous CN detoxification following exposure than peripheral muscles. However, sulfanegen sodium rapidly reversed CN toxicity, with brain region effects reversing more quickly than muscle. In vivo monitoring of multiple organs may provide important clinical information regarding the extent of CN toxicity and subsequent recovery, and facilitate antidote drug development.

  17. Enhanced pinning in superconducting thin films with graded pinning landscapes

    Science.gov (United States)

    Motta, M.; Colauto, F.; Ortiz, W. A.; Fritzsche, J.; Cuppens, J.; Gillijns, W.; Moshchalkov, V. V.; Johansen, T. H.; Sanchez, A.; Silhanek, A. V.

    2013-05-01

    A graded distribution of antidots in superconducting a-Mo79Ge21 thin films has been investigated by magnetization and magneto-optical imaging measurements. The pinning landscape has maximum density at the sample border, decreasing linearly towards the center. Its overall performance is noticeably superior than that for a sample with uniformly distributed antidots: For high temperatures and low fields, the critical current is enhanced, whereas the region of thermomagnetic instabilities in the field-temperature diagram is significantly suppressed. These findings confirm the relevance of graded landscapes on the enhancement of pinning efficiency, as recently predicted by Misko and Nori [Phys. Rev. B 85, 184506 (2012)].

  18. Patterned FePt nanostructures using ultrathin self-organized templates

    Science.gov (United States)

    Deng, Chen Hua; Zhang, Min; Wang, Fang; Xu, Xiao Hong

    2018-02-01

    Patterned magnetic thin films are both scientifically interesting and technologically useful. Ultrathin self-organized anodic aluminum oxide (AAO) template can be used to fabricate large area nanodot and antidot arrays. The magnetic properties of these nanostructures may be tuned by the morphology of the AAO template, which in turn can be controlled by synthetic parameters. In this work, ultrathin AAO templates were used as etching masks for the fabrication of both FePt nanodot and antidot arrays with high areal density. The perpendicular magnetic anisotropy of L10 FePt thin films are preserved in the nanostructures.

  19. Tick thioester-containing proteins and phagocytosis do not affect transmission of Borrelia afzelii from the competent vector ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Veronika; Hajdušek, Ondřej; Hönig Mondeková, Helena; Šíma, Radek; Kopáček, Petr

    2017-01-01

    Roč. 7, MAR (2017), č. článku 73. ISSN 2235-2988 R&D Projects: GA ČR GJ15-12006Y; GA ČR GA13-11043S; GA ČR GA17-27386S; GA ČR GA17-27393S EU Projects: European Commission(XE) 602272 - ANTIDotE Institutional support: RVO:60077344 Keywords : Borrelia * complement * Ixodes * phagocytosis * thioester-containing proteins Subject RIV: EC - Immunology OBOR OECD: Immunology Impact factor: 4.300, year: 2016

  20. Robust band gap and half-metallicity in graphene with triangular perforations

    DEFF Research Database (Denmark)

    Gregersen, Søren Schou; Power, Stephen; Jauho, Antti-Pekka

    2016-01-01

    . The inclusion of spin polarization within a mean-field Hubbard approach gives rise to a large overall magnetic moment at each antidot due to the sublattice imbalance imposed by the triangular geometry. Half-metallic behavior arises from the formation of spin-split dispersive states near the Fermi energy...... disorders. Here we study a rectangular array of triangular antidots with zigzag edge geometries and show that their band gap behavior qualitatively differs from the standard behavior which is exhibited, e.g., by rectangular arrays of armchair-edged triangles. In the spin unpolarized case, zigzag......, and furthermore, of exploiting the strong spin dependence of the system for spintronic applications....

  1. Muligt klinisk potentiale ved revertering af neuromuskulær blokade med sugammadex ved anæstesi og kirurgi

    DEFF Research Database (Denmark)

    Øberg, Emilie; Claudius, Casper

    2013-01-01

    Neuromuscular blockers (NMBs) provide good conditions for endotracheal intubation and surgery. NMBs have been associated with higher morbidity and mortality, mainly due to post-operative residual neuromuscular block. This may become history with the advent of sugammadex - an antidote to the NMB r...

  2. Mind the Gap: Infilling Stiegler's Philosophico-Educational Approach to Social Innovation

    Science.gov (United States)

    Reveley, James; Peters, Michael A.

    2016-01-01

    According to Bernard Stiegler, social innovations in the educational field are an antidotical cure for social pathologies wrought by the digitalisation of society. This article explores how Stiegler's social pharmacology links to the human-technical co-constitution thesis that he first expounded in "Technics and Time, 1." Not only do we…

  3. Special Topic/Still Teaching in Spite of It All

    Science.gov (United States)

    Nieto, Sonia

    2015-01-01

    For those who believe in the promise of public education, here's an antidote to the many negative messages that educators have been receiving. In doing research for her new book, "Why Teachers Teach Now" (Teachers College Press, 2014), Sonia Nieto contacted teacher educators from across the United States and asked each to nominate a…

  4. 1,2-dibromoethane--a toxicological review.

    Science.gov (United States)

    Humphreys, S D; Rees, H G; Routledge, P A

    1999-08-01

    DBE is transported in the UK in road tankers and there is always the possibility of an accident. The consequences could be serious, since this chemical is absorbed by all routes, rapidly penetrates clothing and there is no effective antidote. Severe cases of poisoning are difficult to treat and there is a high mortality. Prevention of exposure is therefore essential.

  5. Nanostructured superconductors

    National Research Council Canada - National Science Library

    Moshchalkov, V. V; Fritzsche, Joachim

    2011-01-01

    ... through nanostructuring and for developing a variety of novel fluxonics devices based on vortex manipulation. Nanostructuring can, in fact, create such conditions for the flux pinning by arrays of nanofabricated antidots or magnetic dots, which could maximize the second important superconducting critical parameter (critical current) up to its theoretical limit ...

  6. Extravasation of chemotherapy

    DEFF Research Database (Denmark)

    Langer, Seppo W

    2010-01-01

    to the development of international guidelines that have proven useful tools in daily clinical practice. Moreover, the tissue destruction in one of the most dreaded types of extravasation (ie, anthracycline extravasation) now can effectively be prevented with a specific antidote, dexrazoxane....

  7. Antimicrobial and toxicological studies of Epa-ijebu. a “wonder – cure”

    African Journals Online (AJOL)

    'Epa-ijebu' is regarded as a “wonder cure” concoction used in curing many diseases and as an antidote to scorpion and snake bites among the Yoruba's in South West, Nigeria. Initial report had indicated antibacterial activity of the concoction against some common bacterial pathogens. This present study screened for ...

  8. An Essay Is Being Written: Between Aggression and "Just Words"

    Science.gov (United States)

    Farley, Lisa

    2012-01-01

    If education tends to be viewed as an antidote to social violence, this paper turns to Freud's study of the "beating fantasy" to consider the fictional representation of psychical aggression in scenes of schooling and being schooled. It is argued that such representations both express and fend off libidinal passions at the heart of…

  9. BKR 27(2) pp. 76-84 (Mordi et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-06-30

    Jun 30, 2015 ... be able to ameliorate CdCl2- induced toxicity (which is dose dependent) and this supports its usage in local treatment as an antidote ..... mechanisms against oxidative stress caused by toxicants, long term exposure to .... chemistry, enzyme working Group of the German society for clinical chemistry. Eur.

  10. Medical Management of Chemical Toxicity in Pediatrics

    Science.gov (United States)

    2009-01-01

    skin with some differences including immaturity of collagen, hair follicles , and sebaceous glands. While newborns and young children are often...fatal methe - moglobinemia. Another antidote, hydroxocobalamin, may gain favor over time as the treatment of choice for pediatric cyanide exposures

  11. Fulltext PDF

    Indian Academy of Sciences (India)

    The tree is a host of lac insects which secrete a resinous substance that yields shellac or lac. A ruby-coloured gum known as Bengal Kino is collected from the incisions made in the bark. The wood, resistant to water, is used in water-well work. The seeds are used as anthelmintic and as an antidote for snake-bite.

  12. Download this PDF file

    African Journals Online (AJOL)

    egyptian hak

    On many Polynesian islands the bitter raw tubers are used to treat stomach ailments, mainly diarrhoea and dysentery (Kay 1987), as well as guinea worm infection, hepatitis and an antidote for snake bite. The root starch is used to stiffen fabrics on some islands (Ukpabi et al. 2009), and has great potential for making alcohol ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 701 - 750 of 1199 ... An Overview of Niger Delta Oil Producing Communities in Nigeria, Abstract PDF. IT Ajibade, AA Awomuti. Vol 10, No 2 (2016), PHCN, Please Help Clean Nigeria. “Ise Ni Ounise, Mura Si Ise Ore Mi” - Work Is an Antidote for Poverty: An Exhibition of Paintings by Master Water Colourist/ Artist and ...

  14. Dabigatran and its reversal with recombinant factor VIIa and prothrombin complex concentrate

    DEFF Research Database (Denmark)

    Sølbeck, Sacha; Nilsson, Caroline U; Engström, Martin

    2014-01-01

    OBJECTIVE: Dabigatran is a new oral direct thrombin inhibitor. No specific antidote exists in the event of hemorrhage, but prothrombin complex concentrate (PCC) and recombinant activated factor VII (rFVIIa) are suggested therapies. Sonoclot is a bedside viscoelastic instrument for monitoring...

  15. Reversal Strategies for NOACs: State of Development, Possible Clinical Applications and Future Perspectives.

    Science.gov (United States)

    Husted, Steen; Verheugt, Freek W A; Comuth, Willemijn J

    2016-01-01

    The non-vitamin K antagonist oral anticoagulants (NOACs) are used for thromboembolic prophylaxis of patients with atrial fibrillation and in the treatment as well as secondary prophylaxis of patients with venous thromboembolism. Even though NOACs have a better safety profile than vitamin K antagonists (VKAs), there will still be bleeding complications on NOAC treatment. In some cases, stopping the NOAC and non-drug-related management such as manual compression and interventional endoscopy will be sufficient to stop the bleeding. In more serious bleeding events and before acute surgery, coagulation factor concentrates or NOAC-specific antidotes could be used. Coagulation factor concentrates can be used in patients with haemophilia and to reverse the effect of VKAs but, in NOAC-treated patients, results are inconsistent and these agents could potentially have pro-thrombotic effects. Specific antidotes for NOACs are expected to be on the market soon. Phase III clinical trials with a humanized antibody fragment directed against dabigatran (idarucizumab) and recombinant, modified factor Xa (andexanet alfa) are ongoing. A molecule (aripazine) with broad activity against various anticoagulants including NOACs is currently undergoing phase II trials. For use of these specific antidotes, it is desirable that measurements for coagulation activity with a short response delay are widely available for the different NOACs and further research in this field is needed. Furthermore, guidelines for antidote use, including general measures for the treatment of NOAC-related bleeding, should be available.

  16. On the principles of vortex localization and motion in superconductor thin films with artifically patterned cavities

    Czech Academy of Sciences Publication Activity Database

    Yurchenko, Vitaliy; Jirsa, Miloš; Stupakov, Oleksandr; Wördenweber, R.

    2005-01-01

    Roč. 139, 1/2 (2005), s. 331-338 ISSN 0022-2291. [NATO Advanced Research Workshop. Yalta Crimea , 13.09.2004-17.09.2004] Institutional research plan: CEZ:AV0Z1010914 Keywords : superconducting thin films * antidots * vortex dynamics * vortex pinning * relaxation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.753, year: 2005

  17. Cordia dichotomoa Forst. f Syn. C. obliqua Willd. (English: Sebesten ...

    Indian Academy of Sciences (India)

    ropes, cordage and paper pulp. The fruit is an astringent and is used in affections o.f urinary passages, diseases o.llllngs and spleen. The decoction of bark is used infevers. The kernels are used in treating ring-worm. The leaves are used in treating ulcers and headache. The plant is used as an antidote to snake-bite.

  18. Using Education and Time Maximization for Effective Study Habits of ...

    African Journals Online (AJOL)

    It also x-rays time management as an antidote to students and national development, and it has to be utilized wisely by students, leaders, individuals, and so on. The paper recommended, among others, that Nigerian students should shun all forms of time-wasting activities through sincerity, honesty, and accountability in ...

  19. The possible role of intravenous lipid emulsion in the treatment of chemical warfare agent poisoning

    Directory of Open Access Journals (Sweden)

    Arik Eisenkraft

    Full Text Available Organophosphates (OPs are cholinesterase inhibitors that lead to a characteristic toxidrome of hypersecretion, miosis, dyspnea, respiratory insufficiency, convulsions and, without proper and early antidotal treatment, death. Most of these compounds are highly lipophilic. Sulfur mustard is a toxic lipophilic alkylating agent, exerting its damage through alkylation of cellular macromolecules (e.g., DNA, proteins and intense activation of pro-inflammatory pathways. Currently approved antidotes against OPs include the peripheral anticholinergic drug atropine and an oxime that reactivates the inhibited cholinesterase. Benzodiazepines are used to stop organophosphate-induced seizures. Despite these approved drugs, efforts have been made to introduce other medical countermeasures in order to attenuate both the short-term and long-term clinical effects following exposure. Currently, there is no antidote against sulfur mustard poisoning. Intravenous lipid emulsions are used as a source of calories in parenteral nutrition. In recent years, efficacy of lipid emulsions has been shown in the treatment of poisoning by fat-soluble compounds in animal models as well as clinically in humans. In this review we discuss the usefulness of intravenous lipid emulsions as an adjunct to the in-hospital treatment of chemical warfare agent poisoning. Keywords: Intravenous lipid emulsion, Organophosphates, Sulfur mustard, Antidotes, Poisoning, Chemical Warfare agents

  20. In-Vitro Adsorption of Fluoroquinolones on Some Pharmaceutical ...

    African Journals Online (AJOL)

    Purpose: Drug overdose and poisoning are common clinical problems and could occur with the fluoroquinolones – a new series of synthetic antimicrobial agents. It therefore becomes important to study the adsorption of the fluoroquinolones on pharmaceutical adsorbents which could serve as possible antidotes for the ...

  1. Jungle Juice: Knowledge and Usage Among Kenyan Surgical Teams

    African Journals Online (AJOL)

    Regarding the specific antidote for severe local anesthetic toxicity and its dosage, 3.2% of surgeons and 18.2% of anesthesiologists had good awareness. Intralipid Emulsion was available in operating theaters to 3.9% of surgeons and 18.2% of anesthesiologists. Conclusions: Most of the Kenyan surgical teams had poor ...

  2. Cura animarum as hope care: Towards a theology of the ...

    African Journals Online (AJOL)

    The following critical questions are posed: is hope the antidote of dread and despair or a kind of escapism from the harsh realities of anguish and suffering? What is meant by hope in Christian spirituality and how is hope connected to a theology of the resurrection? Is resurrection hope merely a kind of cheap ...

  3. U.S. Army Aeromedical Research Laboratory Annual Progress Report: FY 84

    Science.gov (United States)

    1984-10-01

    antidotes and pretreat- ment therapies on aviator performance program ....... 97 Technical participation ................................... 99 Air...upper respiratory disease syndrome, feline infectious anemia, and heartworms. Adult heartworms in cats have never been documented before. Cats have an... radio system for the medical monitor. m The support provided for the heat stress study included installation and maintenance of the helicopter instrument

  4. Nanostructured graphene for spintronics

    DEFF Research Database (Denmark)

    Gregersen, Søren Schou; Power, Stephen; Jauho, Antti-Pekka

    2017-01-01

    Zigzag edges of the honeycomb structure of graphene exhibit magnetic polarization, making them attractive as building blocks for spintronic devices. Here, we show that devices with zigzag-edged triangular antidots perform essential spintronic functionalities, such as spatial spin splitting or spin...

  5. Phytochemical and Pharmacological Studies of the Genus Tacca : A ...

    African Journals Online (AJOL)

    Tacca is an important genus comprising of approximately 15 species of the medicinal plants (Taccaceae). The plants are used in traditional medicine to relieve pains of the body and stomach, as an antidote for food poisoning as well as for their analgesic, antipyretic and anti-inflammatory activities. Chemical studies have ...

  6. Synthesis of reference compounds related to Chemical Weapons Convention for verification and drug development purposes – a Brazilian endeavour

    Science.gov (United States)

    Cavalcante, S. F. A.; de Paula, R. L.; Kitagawa, D. A. S.; Barcellos, M. C.; Simas, A. B. C.; Granjeiro, J. M.

    2018-03-01

    This paper deals with challenges that Brazilian Army Organic Synthesis Laboratory has been going through to access reference compounds related to the Chemical Weapons Convention in order to support verification analysis and for research of novel antidotes. Some synthetic procedures to produce the chemicals, as well as Quality Assurance issues and a brief introduction of international agreements banning chemical weapons are also presented.

  7. Use of Spices in Foods

    African Journals Online (AJOL)

    treatment of wide range of ailments including digestive disorder, rheumatism, cholera and flatulence (ShibamOto and. Biedanes, 1993). .R'osengarten (1969) reports that spices were also used as perfumes, antidotes against poisons and cosrnetics and ointments. He also notes that it \\vasiuptil lsf'century AD in Rome.

  8. Who Cares about Caring in Early Childhood Teacher Education Programs?

    Science.gov (United States)

    McNamee, Abigail; Mercurio, Mia; Peloso, Jeanne M.

    2007-01-01

    The ability to care for oneself, near and distant others, animals, plants, human-made objects, and even ideas is an antidote for violence in its many forms as experienced in childhood as well as adulthood. This article makes a case for facilitating the development of the ability to care as children develop. The authors emphasize the importance of…

  9. Baroque Allegory Comedia

    DEFF Research Database (Denmark)

    Kluge, Sofie

    contain certain tragic elements, but is still securely rooted in a metaphysical ethics and, hence, essentially a divine comedy. The Baroque ostracism of tragedy appears as a central element of the period’s revitalization of the Christian tradition as an antidote to contemporary decadence...

  10. Effect of Megaphrynium Macrostachyum Leaf Extract on some ...

    African Journals Online (AJOL)

    It can be used as an antidote against arthropod or snake poisoning and venoms. This study was designed to investigate the effects of Megaphrynium macrostachyum extract on some haematological parameters using albino rats. Materials/Method: Sixteen albino rats were divided into three groups with group 1 and 2 ...

  11. Effect of methanolicstem-bark extract of Commiphora pedunculata ...

    African Journals Online (AJOL)

    Several medicinal plants have been used in Nigerian communities as antidotes for snakebite complications without scientific validation. In this study, the effect of the methanolic extract of Commiphora pedunculata on recalcification time of bovine, caprine, ovine and came lid plasma treated with Najani gricollis venom was ...

  12. The School Uniform Movement and What It Tells Us about American Education: A Symbolic Crusade

    Science.gov (United States)

    Brunsma, David L.

    2004-01-01

    This book represents the most thorough exposition on the present understanding of the impetuses, debates, legalities, and effectiveness of school uniform policies that have rapidly entered the discourse of school reform in the United States. In it, David Brunsma provides an antidote to the ungrounded, anecdotal components that define the…

  13. Use of continuous renal replacement therapy in acute aluminum phosphide poisoning: a novel therapy.

    Science.gov (United States)

    Nasa, Prashant; Gupta, Ankur; Mangal, Kishore; Nagrani, S K; Raina, Sanjay; Yadav, Rohit

    2013-09-01

    Aluminum phosphide is most common cause of poisoning in northern India. There is no specific antidote available and management of such cases is mainly supportive with high mortality. We present two cases of severe acute aluminium phosphide poisoning where continuous renal replacement therapy (CRRT) was started early along with other resuscitative measures and both the patients survived.

  14. Successful management of aluminium phosphide poisoning using intravenous lipid emulsion: Report of two cases.

    Science.gov (United States)

    Baruah, Udismita; Sahni, Ameeta; Sachdeva, Harish C

    2015-12-01

    Aluminum phosphide (ALP) is a cheap, easily available agricultural pesticide which causes lethal poisoning by liberation of phosphine and inhibition of cytochrome c oxidase thereby leading to cellular hypoxia. Although there is no known specific antidote, clinical trials are still going on. We present here two cases of ALP poisoning who were successfully managed by treatment with lipid emulsion and intravenous magnesium sulfate.

  15. Effect and Management of acute dichlovos poisoning in Wistar Rats ...

    African Journals Online (AJOL)

    Dichlorvos; organophosphorus pesticide is among the most widely used pesticides for insect control. In Nigeria and most other developing countries it is used indiscriminately by people with little or no knowledge of its toxic effects as a household and agricultural insecticide. The acute effect and antidotal therapy of ...

  16. :Ffowering 'Trees-

    Indian Academy of Sciences (India)

    The tree is a host of lac insects which secrete a resinous substance that yields shellac or lac. A ruby-coloured gum known as Bengal Kino is collected from the incisions made in the bark. The wood, resistant to water, is used in water-well work. The seeds are used as anthelmintic and as an antidote for snake-bite.

  17. Artocarpus heterophyllus Lam. (lackfruit tree; Hindi: Katha!) of ...

    Indian Academy of Sciences (India)

    The entire female inflorescence together with parts of individual flowers forms a large multiple fruit. The sepals and petals become fleshy and juicy to form the edible part of the fruit. The timber is hard and durable and usedfor making various wooden articles. The leaves are used in skin diseases and as an antidote to snake ...

  18. Mario Bunge's Materialist Theory of Mind and Contemporary Cognitive Science

    Science.gov (United States)

    Slezak, Peter

    2012-01-01

    Bunge's writings on the mind-body problem provide a rigorous, analytical antidote to the persistent anti-materialist tendency that has characterized the history of philosophy and science. Bunge gives special attention to dualism and its shortcomings, and this attention is welcome in view of the resurgence of the doctrine today. However, I focus my…

  19. 21 CFR 522.1004 - Fomepizole.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS...) Conditions of use in dogs—(1) Amount. 20 milligrams per kilogram (mg/kg) of body weight intravenously... antidote for ethylene glycol (antifreeze) poisoning in dogs who have ingested or are suspected of having...

  20. 21 CFR 522.1862 - Sterile pralidoxime chloride.

    Science.gov (United States)

    2010-04-01

    ....1862 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED...) Conditions of use. (1) It is used in horses, dogs, and cats as an antidote in the treatment of poisoning due... in horses, dogs, and cats. (2) It is administered as soon as possible after exposure to the poison...

  1. 151 | Page A CASE FOR GLOBAL ENFORCEABLE PRENUPTIAL ...

    African Journals Online (AJOL)

    Fr. Ikenga

    2009-05-14

    May 14, 2009 ... and gender discrimination often observed in the sharing of marital property in court actions, led to the emergence and popularity of prenuptial agreements in many jurisdictions as a legal antidote to some of these flaws. The writer evaluates the obstinate and uncompromising attitude of the English judges.

  2. Download this PDF file

    African Journals Online (AJOL)

    Investigation of Possible Antidotal Effects of Activated Charcoal, Sodium Bicarbonate, Hydrogen. Peroxide and Potassium Permanganate in Zinc Phosphide Poisoning. C.K. MAITAI'*, D.K. NJOROGE', K.O. ABUGA~, A.M. MWAURA' AND R.W. MUNENGE'. I Department of Pharmacology and Pharmacognosy, Faculty of ...

  3. East and Central African Journal of Pharmaceutical Sciences - Vol 5 ...

    African Journals Online (AJOL)

    Investigation of Possible Antidotal Effects of Activated Charcoal, Sodium Bicarbonate, Hydrogen Peroxide and Potassium Permanganate in Zinc Phosphide Poisoning · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CK Maitai, DK Njoroge, KO Abuga, AM Mwaura, ...

  4. Review article: management of cyanide poisoning.

    Science.gov (United States)

    Reade, Michael C; Davies, Suzanne R; Morley, Peter T; Dennett, Jennifer; Jacobs, Ian C

    2012-06-01

    Cyanide poisoning is uncommon, but generates interest because of the presumed utility of an antidote immediately available in those areas with a high risk of cyanide exposure. As part of its regular review of guidelines, the Australian Resuscitation Council conducted a systematic review of the human evidence for the use of various proposed cyanide antidotes, and a narrative review of the relevant pharmacological and animal studies. There have been no relevant comparative or placebo-controlled human trials. Nine case series were identified. Treatment with hydroxocobalamin was reported in a total of 361 cases. No serious adverse effects of hydroxocobalamin were reported, and many patients with otherwise presumably fatal poisoning survived. Sodium thiosulphate use was reported in two case series, similarly with no adverse effects. Treatment with a combination of sodium nitrite, amyl nitrite and sodium thiosulphate was reported in 74 patients, with results indistinguishable from those of hydroxocobalamin and sodium thiosulphate. No case series using dicobalt edetate or 4-dimethylaminophenol were identified, but successful use in single cases has been reported. Hydroxocobalamin and sodium thiosulphate differ from alternatives in having negligible adverse effects, and on the basis of current evidence are the antidotes of choice. The indications for the use of an antidote, the requirements for supportive care and a recommended approach for workplaces where there is a risk of cyanide poisoning are presented. © 2012 The Authors. EMA © 2012 Australasian College for Emergency Medicine and Australasian Society for Emergency Medicine.

  5. Therapeutic problems in cyanide poisoning

    NARCIS (Netherlands)

    van Heijst, A. N.; Douze, J. M.; van Kesteren, R. G.; van Bergen, J. E.; van Dijk, A.

    1987-01-01

    In three patients with severe acute cyanide poisoning, a cyanosis was observed instead of the bright pink skin coloration often mentioned as a sign in textbooks. Treatment of cardiopulmonary insufficiency is as essential as antidotal therapy and the use of sodium nitrite and 4-DMAP is not without

  6. Development of sulfanegen for mass cyanide casualties.

    Science.gov (United States)

    Patterson, Steven E; Moeller, Bryant; Nagasawa, Herbert T; Vince, Robert; Crankshaw, Daune L; Briggs, Jacquie; Stutelberg, Michael W; Vinnakota, Chakravarthy V; Logue, Brian A

    2016-06-01

    Cyanide is a metabolic poison that inhibits the utilization of oxygen to form ATP. The consequences of acute cyanide exposure are severe; exposure results in loss of consciousness, cardiac and respiratory failure, hypoxic brain injury, and dose-dependent death within minutes to hours. In a mass-casualty scenario, such as an industrial accident or terrorist attack, currently available cyanide antidotes would leave many victims untreated in the short time available for successful administration of a medical countermeasure. This restricted therapeutic window reflects the rate-limiting step of intravenous administration, which requires both time and trained medical personnel. Therefore, there is a need for rapidly acting antidotes that can be quickly administered to large numbers of people. To meet this need, our laboratory is developing sulfanegen, a potential antidote for cyanide poisoning with a novel mechanism based on 3-mercaptopyruvate sulfurtransferase (3-MST) for the detoxification of cyanide. Additionally, sulfanegen can be rapidly administered by intramuscular injection and has shown efficacy in many species of animal models. This article summarizes the journey from concept to clinical leads for this promising cyanide antidote. © 2016 New York Academy of Sciences.

  7. A Phenomenological Study of the Experience of Respondents in Campus-Based Restorative Justice Programs

    Science.gov (United States)

    Meagher, Peter J.

    2009-01-01

    The focus of this dissertation was the use of restorative justice practices in the collegiate setting. Some have expressed concern with the legal nature of campus conduct processes. Restorative practices have been implemented in criminal justice and K-12 settings and are seen by some as an antidote to overly legalistic campus conduct processes.…

  8. Nnamdi Azikiwe University Journal of International Law and ...

    African Journals Online (AJOL)

    Streamlining the Powers and Duties of a Receiver/Manager and Liquidator in the Organization of a Company: An Antidote for Corporate Governance · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. OM Adefi ...

  9. Medicinal plants used to treat Snake bite by Fulani Herdsmen in ...

    African Journals Online (AJOL)

    Dr. Ameen

    Fulani herdsmen for the treatment of snake bites. Preliminary investigations on the potentials of some plants as antidotes against snake bite have been promising. The extract of the leaves of Guiera senegalensis was found to detoxify (in vitro) venom from two common northern Nigerian snake species, Echis carinatus and ...

  10. Poison centre network saves lives | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2010-10-27

    Oct 27, 2010 ... Snakebites, food poisoning, exposure to toxic chemicals: all are potentially fatal if the correct antidote isn't identified and applied — fast. Since 1988, INTOX, a computer-based program involving a global network of poison centres, has been providing those life-saving capabilities in minutes.

  11. Publications | Page 361 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 3601 - 3610 of 6384 ... Research carried out using ecosystem approaches to human health, pioneered by IDRC in the 1990s, has significantly improved health and welfare around ... Snakebites, food poisoning, exposure to toxic chemicals: all are potentially fatal if the correct antidote isn't identified and applied — fast.

  12. Mimusops elengi L. (Bulletwood tree; Hindi: Bakul or Maulsari) of ...

    Indian Academy of Sciences (India)

    tree is often cultivated in parks and as an avenue tree. The fascicled flowers are small, white and sweet-scented. The ovoid berries are edible. The bark is astringent, tonic and used in fevers. Leaves are an antidote to snake-bite. The pulp of the fruit is used in curing chronic dysentery. Powder of dried flowers is a brain tonic.

  13. "Peer Pressure" and the Group Process: Building Cultures of Concern

    Science.gov (United States)

    Tate, Thomas F.; Copas, Randall L.

    2010-01-01

    Peer group treatment has been subject to two main lines of criticism. Some suggest any program which aggregates antisocial youth inevitably fosters negative peer influence. Others are concerned that certain peer programs are based on coercive peer confrontation. Positive Peer Culture [PPC] is an antidote to both of these varieties of toxic group…

  14. Limited Evidence That Competitive Food and Beverage Practices Affect Adolescent Consumption Behaviors

    Science.gov (United States)

    Vericker, Tracy C.

    2013-01-01

    Childhood obesity is emerging as a considerable public health problem with no clear antidote. The school food environment is a potential intervention point for policy makers, with competitive food and beverage regulation as a possible policy lever. This research examines the link between competitive food and beverage availability in school and…

  15. Anti-inflammatory and Analgesic Activities of Amorphophallus bulbifer

    African Journals Online (AJOL)

    HP

    Small pieces of fresh petiole and bulbils of this plant are cooked as vegetable with dry fish and taken with rice once a day for 10 - 12 days for rheumatic muscular and joint pain while crushed tubers are used as antidote to poisoning from animal bites [3,4]. Water soluble amino acids [5], alkaloids from the dried entire plant [6] ...

  16. Recommendations for the role of extracorporeal treatments in the management of acute methanol poisoning

    DEFF Research Database (Denmark)

    Roberts, Darren M; Yates, Christopher; Megarbane, Bruno

    2015-01-01

    to methanol: coma, seizures, new vision deficits, metabolic acidosis with blood pH ≤7.15, persistent metabolic acidosis despite adequate supportive measures and antidotes, serum anion gap higher than 24 mmol/L; or, serum methanol concentration 1) greater than 700 mg/L (21.8 mmol/L) in the context...

  17. Search Results | Page 47 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2007-01-01

    Results 461 - 470 of 8490 ... Democracy requires a functioning public administration. Published date. January 1, 2007. Studies. -. Democracy is the antidote against extremism. Published date. January 1, 2007. Studies. -. Applied research is important for building solid democracies. Published date. January 1, 2007. Studies. - ...

  18. Enhancing public health preparedness for a terrorist attack involving cyanide.

    Science.gov (United States)

    Eckstein, Marc

    2008-07-01

    The US government considers cyanide to be among the most likely agents of chemical terrorism. Cyanide differs from many other biological or chemical agents for which little or no defense is available because its individual and public health effects are largely remediable through appropriate preparedness and response. Because the toxicity of the cyanide antidote currently available in the United States renders it ill-suited for use in terrorist incidents and other situations requiring rapid out-of-hospital treatment, hydroxocobalamin--an effective and safe cyanide antidote being used in other countries--has been introduced in the United States. Unlike the other available cyanide antidote, hydroxocobalamin can be administered at the scene of a cyanide disaster, and it need not be reserved for cases of confirmed cyanide poisoning but can be administered in cases of suspected poisoning. Both of these attributes facilitate the rapid intervention necessary for saving lives. To realize the potential benefits of hydroxocobalamin, progress also needs to be realized in other aspects of readiness, including but not limited to developing plans for ensuring local and regional availability of antidote, educating emergency responders and health care professionals in the recognition and management of cyanide poisoning, and raising public awareness of the potential for a chemical weapons attack and of how to respond.

  19. King Saul's mysterious malady

    African Journals Online (AJOL)

    2012-01-20

    Jan 20, 2012 ... frame of mind so that the body could stimulate its own healing mechanisms. • Originally cultivated in Assyria and found in Israel, laurel or sweet bay (Laurus nobilis) seed was used as an antidote for seizures (possibly epileptic). The leaves and fruit were believed to have narcotic properties (Jacob 1993:40).

  20. Understanding Leadership: An Experimental-Experiential Model

    Science.gov (United States)

    Hole, George T.

    2014-01-01

    Books about leadership are dangerous to readers who fantasize about being leaders or apply leadership ideas as if they were proven formulas. As an antidote, I offer an experimental framework in which any leadership-management model can be tested to gain experiential understanding of the model. As a result one can gain reality-based insights about…

  1. Confronting the Pedagogical Challenge of Cyber Safety

    Science.gov (United States)

    Hanewald, Ria

    2008-01-01

    Cyber violence and the antidote of cyber safety are fast becoming a global concern for governments, educational authorities, teachers, parents and children alike. Despite substantial funding for information dissemination on preventative strategies and the development of electronic responses to hinder perpetrators, the phenomenon of cyber violence…

  2. To Market, to Market to Buy a...Middle-Class Life? Insecurity, Anxiety, and Neoliberal Education in Michigan

    Science.gov (United States)

    Lyon-Callo, Vincent

    2010-01-01

    Corporatisation of universities and restructurings of K-12 schooling in the United States occurred during a period of broad economic, social and political restructurings, which have transformed the lives of middle-class Americans. Community and individual level investments in education are frequently represented as antidotes to increased…

  3. Plasmon-mediated Coulomb drag between graphene waveguides

    DEFF Research Database (Denmark)

    Shylau, Artsem A.; Jauho, Antti-Pekka

    2014-01-01

    We analyze theoretically charge transport in Coulomb coupled graphene waveguides (GWGs). The GWGs are defined using antidot lattices, and the lateral geometry bypasses many technological challenges of earlier designs. The drag resistivity ρD, which is a measure of the many-particle interactions...

  4. EXPERIMENTS IN IMMOBILISING UNGULATE MAMMALS The ...

    African Journals Online (AJOL)

    The technique of immobilising wild mammals by injecting them with drugs has received more attention in East Africa ... The drugs were administered either by means of standard projectile syringes fired from a. Cap-Chur gun .... Another unsatisfactory feature of the drug was that initial intramuscular injections of the antidote ...

  5. The efficacy and adverse effects of dicobalt edetate in cyanide poisoning.

    Science.gov (United States)

    Marrs, Timothy Clive; Thompson, John Paul

    2016-09-01

    Dicobalt edetate is one of a number of cobalt compounds that have been studied in the treatment of cyanide poisoning, their efficacy being based upon the fact that cyanide combines with cobalt to form relatively non-toxic complexes. Inorganic cobalt salts are quite toxic (cyanide and cobalt antagonise one another's toxicity) and complexes such as dicobalt edetate were studied with the aim of identifying compounds that were less acutely toxic, but which retained the antidotal properties of cobalt salts. The proprietary preparation, Kelocyanor™, contains free cobalt and glucose as well as dicobalt edetate. The aim of this study was to evaluate the published evidence for the efficacy and adverse effects of dicobalt edetate. A Pubmed search was undertaken for the period 1961-September 2015. The search terms were "dicobalt edetate", "cobalt edetate" and "Kelocyanor", which produced 24 relevant citations. A review of the references in four relevant books (L'intoxication cyanhydrique et son traitement, Clinical and Experimental Toxicology of Cyanides, Antidotes for Poisoning by Cyanide and Antidotes) produced three further relevant papers, making a total of 27 papers. Efficacy of dicobalt edetate: There is evidence from animal pharmacodynamic studies that dicobalt edetate is an effective cyanide antidote in experimental animals. Some 39 cases of human poisoning treated with dicobalt edetate have been reported, but in only nine cases were blood cyanide concentrations measured, although administration of dicobalt edetate procured survival in four of the seven patients with concentrations in the lethal range (>3.0 mg/L). It is unlikely that death in any of the adequately documented fatal cases was attributable to treatment failure with dicobalt edetate, as it is probable that they all had suffered anoxic brain damage before treatment could be initiated. Furthermore, in one case, acute gold toxicity contributed substantially to death. Adverse effects of dicobalt edetate

  6. Role of hydroxocobalamin in acute cyanide poisoning.

    Science.gov (United States)

    Shepherd, Greene; Velez, Larissa I

    2008-05-01

    To review the recently approved cyanide antidote, hydroxocobalamin, and describe its role in therapy. Relevant publications were identified through a systematic search of PubMed using the MeSH terms and key words hydroxocobalamin and cyanide. This search was then limited to human studies published since 2000. Systematic searches were conducted through January 2008. References from identified articles were reviewed for additional pertinent human studies. The literature search retrieved 7 studies on the safety and/or efficacy of hydroxocobalamin in humans. Four new studies were identified by the search and 3 studies were identified from the references. Studies of antidote efficacy in humans are ethically and logistically difficult. A preclinical study demonstrated that intravenous doses of hydroxocobalamin 5 g are well tolerated by volunteer subjects. Hydroxocobalamin has been shown to reduce cyanide concentrations in controlled studies of nitroprusside therapy and in heavy smokers. A retrospective study of 14 acute cyanide poisonings also demonstrated hydroxocobalamin's safety and efficacy. Two studies examining hydroxocobalamin for smoke inhalation-associated cyanide poisoning indicated a possible benefit, but they are insufficient to establish definitive criteria for use in this setting. Randomized controlled trials of hydroxocobalamin and traditional cyanide antidotes (nitrites/thiosulfate) are lacking. Cyanide poisoning can rapidly cause death. Having an effective antidote readily available is essential for facilities that provide emergency care. In cases of cyanide ingestion, both the nitrite/thiosulfate combination and hydroxocobalamin are effective antidotes. Hydroxocobalamin offers an improved safety profile for children and pregnant women. Hydroxocobalamin also appears to have a better safety profile in the setting of cyanide poisoning in conjunction with smoke inhalation. However, current data are insufficient to recommend the empiric administration of

  7. Human and experimental toxicology of diquat poisoning: Toxicokinetics, mechanisms of toxicity, clinical features, and treatment.

    Science.gov (United States)

    Magalhães, N; Carvalho, F; Dinis-Oliveira, R J

    2018-01-01

    Diquat (1,1'-ethylene-2,2'-bipyridinium ion; DQ) is a nonselective quick-acting herbicide, which is used as contact and preharvest desiccant to control terrestrial and aquatic vegetation. Several cases of human poisoning were reported worldwide mainly due to intentional ingestion of the liquid formulations. Its toxic potential results from its ability to produce reactive oxygen and nitrogen species through redox cycling processes that can lead to oxidative stress and potentially cell death. Kidney is the main target organ due to DQ toxicokinetics and redox cycling. There is no antidote against DQ intoxications, and the efficacy of treatments currently applied is still unsatisfactory. The aim of this work was to review the most relevant human and experimental findings related to DQ, characterizing its chemistry, activity as herbicide, mechanisms of toxicity, consequences of poisoning, and potential therapeutic approaches taking into account previous experience in developing antidotes for paraquat, a more toxic bipyridinium herbicide.

  8. Development of new Czech autoinjector with oxime HI-6 DMS

    International Nuclear Information System (INIS)

    Kuca, K; Jun, D.; Kassa, J.; Marek, J.; Stodulka, P.; Musilek, K.; Dolezal, D.; Povraznik, J.

    2009-01-01

    Oxime HI-6 (1-(2-(hydroxyiminomethyl)pyridinium) -3-(4-carbamoylpyridinium)-2-oxapropane) is considered to be currently the most universal oxime for the potential use as antidote against nerve agents (sarin, cyclosarin, VX, etc.). None of other commercially available oximes (pralidoxime, obidoxime, trimedoxime, MMB4) has broader antidotal effect. Due to this, development of the appropriate salt of this oxime together with its application form (eg. autoinjector) was the main aim of our departments and several private Czech companies (VAKOS XT as., Decomkov Praha sro., ChemProtect as.). In our contribution, we would like to summarize all the steps which were already done. We would like to thank to the Ministry of Industry and Trade of the Czech Republic for the Project No. FIIM2/104.(author)

  9. Magnetic Properties of Large-Scale Nanostructured Graphene Systems

    DEFF Research Database (Denmark)

    Gregersen, Søren Schou

    The on-going progress in two-dimensional (2D) materials and nanostructure fabrication motivates the study of altered and combined materials. Graphene—the most studied material of the 2D family—displays unique electronic and spintronic properties. Exceptionally high electron mobilities, that surpass...... those in conventional materials such as silicon, make graphene a very interesting material for high-speed electronics. Simultaneously, long spin-diffusion lengths and spin-life times makes graphene an eligible spin-transport channel. In this thesis, we explore fundamental features of nanostructured...... graphene systems using large-scale modeling techniques. Graphene perforations, or antidots, have received substantial interest in the prospect of opening large band gaps in the otherwise gapless graphene. Motivated by recent improvements of fabrication processes, such as forming graphene antidots and layer...

  10. wtf

    Science.gov (United States)

    Nuckolls, Nicole L; Bravo Núñez, María Angélica; Eickbush, Michael T; Young, Janet M; Lange, Jeffrey J; Yu, Jonathan S; Smith, Gerald R; Jaspersen, Sue L; Malik, Harmit S; Zanders, Sarah E

    2017-06-20

    Meiotic drivers are selfish genes that bias their transmission into gametes, defying Mendelian inheritance. Despite the significant impact of these genomic parasites on evolution and infertility, few meiotic drive loci have been identified or mechanistically characterized. Here, we demonstrate a complex landscape of meiotic drive genes on chromosome 3 of the fission yeasts Schizosaccharomyces kambucha and S. pombe . We identify S. kambucha wtf4 as one of these genes that acts to kill gametes (known as spores in yeast) that do not inherit the gene from heterozygotes. wtf4 utilizes dual, overlapping transcripts to encode both a gamete-killing poison and an antidote to the poison. To enact drive, all gametes are poisoned, whereas only those that inherit wtf4 are rescued by the antidote. Our work suggests that the wtf multigene family proliferated due to meiotic drive and highlights the power of selfish genes to shape genomes, even while imposing tremendous costs to fertility.

  11. A review of acute cyanide poisoning with a treatment update.

    Science.gov (United States)

    Hamel, Jillian

    2011-02-01

    Cyanide causes intracellular hypoxia by reversibly binding to mitochondrial cytochrome oxidase a(3). Signs and symptoms of cyanide poisoning usually occur less than 1 minute after inhalation and within a few minutes after ingestion. Early manifestations include anxiety, headache, giddiness, inability to focus the eyes, and mydriasis. As hypoxia progresses, progressively lower levels of consciousness, seizures, and coma can occur. Skin may look normal or slightly ashen, and arterial oxygen saturation may be normal. Early respiratory signs include transient rapid and deep respirations. As poisoning progresses, hemodynamic status may become unstable. The key treatment is early administration of 1 of the 2 antidotes currently available in the United States: the well-known cyanide antidote kit and hydroxocobalamin. Hydroxocobalamin detoxifies cyanide by binding with it to form the renally excreted, non-toxic cyanocobalamin. Because it binds with cyanide without forming methemoglobin, hydroxocobalamin can be used to treat patients without compromising the oxygen-carrying capacity of hemoglobin.

  12. Acute cyanide poisoning in prehospital care: new challenges, new tools for intervention.

    Science.gov (United States)

    Guidotti, Tee

    2006-01-01

    Effective management of cyanide poisoning from chemical terrorism, inhalation of fire smoke, and other causes constitutes a critical challenge for the prehospital care provider. The ability to meet the challenge of managing cyanide poisoning in the prehospital setting may be enhanced by the availability of the cyanide antidote hydroxocobalamin, currently under development for potential introduction in the United States. This paper discusses the causes, recognition, and management of acute cyanide poisoning in the prehospital setting with emphasis on the emerging profile of hydroxocobalamin, an antidote that may have a risk:benefit ratio suitable for empiric, out-of-hospital treatment of the range of causes of cyanide poisoning. If introduced in the U.S., hydroxocobalamin may enhance the role of the U.S. prehospital responder in providing emergency care in a cyanide incident.

  13. Toxic industrial chemicals and chemical weapons: exposure, identification, and management by syndrome.

    Science.gov (United States)

    Tomassoni, Anthony J; French, Robert N E; Walter, Frank G

    2015-02-01

    Toxidromes aid emergency care providers in the context of the patient presenting with suspected poisoning, unexplained altered mental status, unknown hazardous materials or chemical weapons exposure, or the unknown overdose. The ability to capture an adequate chemical exposure history and to recognize toxidromes may reduce dependence on laboratory tests, speed time to delivery of specific antidote therapy, and improve selection of supportive care practices tailored to the etiologic agent. This article highlights elements of the exposure history and presents selected toxidromes that may be caused by toxic industrial chemicals and chemical weapons. Specific antidotes for toxidromes and points regarding their use, and special supportive measures, are presented. Copyright © 2015 Elsevier Inc. All rights reserved.

  14. Intravenous paracetamol overdose: two case reports and a change to national treatment guidelines.

    Science.gov (United States)

    Beringer, Richard M; Thompson, John P; Parry, Sarah; Stoddart, Peter A

    2011-03-01

    Two cases of 10-fold accidental overdose with intravenous paracetamol are presented. Case 1: A 5-month-old child with intussusception received 90 mg/kg intravenous paracetamol over an 8 h period. She was not initially treated with an antidote and developed hepatic impairment. Case 2: A 6-month-old child received a single dose of 75 mg/kg intravenous paracetamol. The child was treated with N-acetylcysteine and remained well without hepatic impairment. Therapeutic errors such as 10-fold overdosing are relatively common in children. Case 1 demonstrates that intravenous paracetamol is a potentially dangerous drug. This should be taken into consideration when prescribing the intravenous formulation. The concentration-time nomogram used following oral paracetamol overdose should be used with caution following intravenous overdose. Significant overdose should be discussed with the National Poisons Information Service whose guidance suggests intervention with antidote following an overdose above 60 mg/kg.

  15. Human-in-the-loop Artificial Intelligence

    OpenAIRE

    Zanzotto, Fabio Massimo

    2017-01-01

    Little by little, newspapers are revealing the bright future that Artificial Intelligence (AI) is building. Intelligent machines will help everywhere. However, this bright future has a dark side: a dramatic job market contraction before its unpredictable transformation. Hence, in a near future, large numbers of job seekers will need financial support while catching up with these novel unpredictable jobs. This possible job market crisis has an antidote inside. In fact, the rise of AI is sustai...

  16. Gustatory detection of tetrodotoxin and saxitoxin, and its competitive inhibition by quinine and strychnine in freshwater fishes.

    Science.gov (United States)

    Hara, Toshiaki J

    2011-01-01

    Fish detect extremely low levels of marine toxins tetrodotoxin (TTX) and saxitoxin (STX) via the specialized gustatory receptor(s). Physiological and pharmacological studies show that receptor(s) for TTX and STX are distinct from those which detect feeding stimulant amino acids and bile acids, and that TTX and STX do not share the same receptor populations, while interacting with quinine and strychnine in a competitive fashion suggestive of an antidotal relationship.

  17. In Vivo Protection against Strychnine Toxicity in Mice by the Glycine Receptor Agonist Ivermectin

    OpenAIRE

    Maher, Ahmed; Radwan, Rasha; Breitinger, Hans-Georg

    2014-01-01

    The inhibitory glycine receptor, a ligand-gated ion channel that mediates fast synaptic inhibition in mammalian spinal cord and brainstem, is potently and selectively inhibited by the alkaloid strychnine. The anthelminthic and anticonvulsant ivermectin is a strychnine-independent agonist of spinal glycine receptors. Here we show that ivermectin is an effective antidote of strychnine toxicity in vivo and determine time course and extent of ivermectin protection. Mice received doses of 1 mg/kg ...

  18. International Conference: Paraoxonases - Basic and Clinical Directions of Current Research (1st) Held in Ann Arbor, Michigan on April 22-24, 2004

    Science.gov (United States)

    2005-04-01

    protein of 354 aminoacids with a molecular mass of 43 kDa. Mature PONI retains its N-terminal hydrophobic signal sequence, which may be needed for... antagonizes the lethal effects of paraoxon resulting in a therapeutic increase in the LD50 of greater than 150 times. The therapeutic antidotal protection was...not as effective as the prophylactic antagonism , where over 1000LD5 0 protection was obtained. Protection of free enzyme and encapsulated enzyme was

  19. Naloxone Administration in US Emergency Departments, 2000���2011

    OpenAIRE

    Frank, Joseph W.; Levy, Cari; Calcaterra, Susan L.; Hoppe, Jason A.; Binswanger, Ingrid A.

    2015-01-01

    Rates of opioid overdose and opioid-related emergency department (ED) visits have increased dramatically. Naloxone is an effective antidote to potentially fatal opioid overdose, but little is known about naloxone administration in ED settings. We examined trends and correlates of naloxone administration in ED visits nationally from 2000 to 2011. Using data from the National Hospital Ambulatory Medical Care Survey, we examined ED visits involving (1) the administration of naloxone or (2) a dia...

  20. Infabric - "Dive into the fabric of opinion"

    CERN Multimedia

    CERN. Geneva

    2017-01-01

    "Why should I trust this article and not that one? Why the hell do you think something sooo stupid!?" I want to build an interactive online publishing platform promoting fact-based structured argumentation designed to act as an antidote for problems of the post-truth society. I'm looking for people who would like to help me to create a prototype right now.

  1. Gustatory Detection of Tetrodotoxin and Saxitoxin, and Its Competitive Inhibition by Quinine and Strychnine in Freshwater Fishes

    Directory of Open Access Journals (Sweden)

    Toshiaki J. Hara

    2011-11-01

    Full Text Available Fish detect extremely low levels of marine toxins tetrodotoxin (TTX and saxitoxin (STX via the specialized gustatory receptor(s. Physiological and pharmacological studies show that receptor(s for TTX and STX are distinct from those which detect feeding stimulant amino acids and bile acids, and that TTX and STX do not share the same receptor populations, while interacting with quinine and strychnine in a competitive fashion suggestive of an antidotal relationship.

  2. Differentiated NSC-34 cells as an in vitro Cell Model for VX

    Science.gov (United States)

    2014-09-11

    for the sensitive detection of organophosphate pesticides , carbamates and nerve agents. Biosens Bioelectron 25:832–8. Zhang Y, Bhavnani BR. (2006...potential candidate drugs/antidotes. The development of an in vitro cellular model to aid in discovering new NA therapeutics would be highly beneficial...therapeutic effect (McDonough & Shih, 1997). One of the obstacles in developing new therapeutics is the lack of an in vitro model that can be used to

  3. Methemoglobinemia caused by dapsone overdose: Which treatment is best?

    Directory of Open Access Journals (Sweden)

    Ibrahim Toker

    2015-12-01

    Full Text Available Increase of methemoglobin level is named as methemoglobinemia characterized by functional anemia and tissue hypoxia. Methemoglobinemia can be congenital, but acquired form are more often caused by various drugs and toxins. Methylene blue is the most effective antidote for acquired methemoglobinemia. When methylene blue is not available, alternative treatments such as ascorbic acid and hyperbaric oxygen can be useful. In this paper we presented a case of methomoglobinemia due to dapsone overdose. Keywords: Dapsone overdose, Emergency medicine, Methemoglobinemia

  4. CYBERBULLING AND REAL REALITY

    OpenAIRE

    Marzano, Gilberto; Lubkina, Velta

    2015-01-01

    There are various risks tied to cyberspace. Some of them are social risks because they are cultural risks, being related to new forms of relationships and interactions among people. In the last decade, toxic evils like cyberbullying and other malicious cyber violence are growing, and the search of antidotes is becoming a common concern for governments, educational authorities, teachers, parents and children alike. The available data shows clear evidence that the number of persons affected by ...

  5. Prussian blue analogue copper hexacyanoferrate : Synthesis, structure characterization and its applications as battery electrode and CO2 adsorbent

    OpenAIRE

    Ojwang, Dickson Odhiambo

    2017-01-01

    Prussian blue (PB) and Prussian blue analogues (PBAs) are compounds with potential applications in a large variety of fields such as gas storage, poison antidotes, electrochromism, electrochemistry and molecular magnets. The compounds are easy to synthesize, cheap, environmentally friendly and have been pursued for both fundamental research and industrial purposes. Despite the multifunctionality of PB and PBAs, they have complicated compositions, which are largely dependent on the synthesis m...

  6. Myopathic Alterations in Extraocular Muscle of Rats Subchronically Fed Pyridostigmine Bromide

    Science.gov (United States)

    1990-01-01

    pre- soleus and extensor digitorum longus , the myopathy exposure antidote for nerve poisons that irreversibly consists of large diameter vacuoles in...By transmission electron microscopy, 35- diaphragm, extensor digitorum longus and soleusrat EoM Bny tranpsiss i lectons icroscopymuscles of the rat...end plates of rat soleus and extensor muscles. Macmillan Pub. Co., New York, p. 123. Exp. Neurol. 89: 96-114. Fcesion ’or INTIS CRA& VIC TAD El U d’-OU

  7. Transforming impostors into heroes. Metaphors for innovative nursing education.

    Science.gov (United States)

    Heinrich, K T

    1997-01-01

    Nurses negotiating professional transitions, whether they are entering an academic program or assuming a new role in the workplace, often feel like impostors. The metaphor of the hero can serve as an "antidote" to the impostor syndrome. The author describes an educational experience shaped around the impostor and hero metaphors that integrates feminist process with expressive methods to transform nurses' perceptions of themselves from impostors into heroes.

  8. A one-year observational study of all hospitalized acute poisonings in Oslo: complications, treatment and sequelae

    Science.gov (United States)

    2012-01-01

    Objectives Changes in poisoning trends may affect both complications and outcomes in patients with acute poisoning. This study reports the treatments given and the frequency of complications, also related to treatment, mortality and sequelae related to various toxic agents. Methods All acute poisonings in adults (≥16 years) admitted to the five hospitals in Oslo were included consecutively during one year (2008 to 2009) in an observational cross-sectional multicenter study. A standardized form was completed by the treating physician, which covered the study aims. Results There were 1065 admissions in 912 patients. The median length of hospital stay was one day, and 49% were observed in an intensive care unit (ICU). Active treatment was given to 83%, and consisted of supportive therapy (70%), antidote(s) (38%), activated charcoal (16%) and gastric lavage (9%). The most commonly used antidotes were flumazenil (19%), naloxone (17%) and N-acetylcysteine (11%). The rate of treatment-related complications was 2.4% (21/884). Neither flumazenil, naloxone, nor the combination, was associated with convulsions or other complications. Among those receiving N-acetylcysteine, 5% (6/120) developed allergic reactions, one of which mandated discontinuation of treatment. Nineteen percent presented in a coma. Complications developed in 30%, compared with 18% in a 2003 study, mainly respiratory depression (12%), prolonged QTc interval (6%) and hypotension (5%). Eight patients died (0.8%) and five (0.5%) survived with permanent sequelae, mainly anoxic brain damage. Discussion Few patients stayed more than two days. The use of the ICU was liberal, considering that only one out of five presented in a coma. Antidotes were frequently given diagnostically. Although N-acetylcysteine induced allergic reactions, most were mild and treatment discontinuation was only necessary once. The frequency of complications had almost doubled in five years, although the poisoning pattern was largely

  9. Notes on flying and dying.

    Science.gov (United States)

    Meyer, B C

    1983-07-01

    Focused on selected details in the lives and creative works of Samuel Johnson, Edgar Allan Poe, and Houdini, this paper explores a seeming antinomy between claustrophobic annihilation and aviation. At first glance the latter appears as an antidote to the threat of entrapment and death. On a deeper level the distinction fades as the impression arises that in the examples cited, flying may represent an unconscious expression of a wish for death and ultimate reunion.

  10. Effectiveness of isosorbide dinitrate in cyanide poisoning as a function of the administration timing

    OpenAIRE

    Lavon, Ophir; Avrahami, Amit; Eisenkraft, Arik

    2017-01-01

    Background Better and safer antidotes against cyanide poisoning are needed. Prior study has shown a favorable effect of isosorbide dinitrate (ISDN) on the survival of cyanide-poisoned rabbits when administered as early as 1?min after poisoning. The aim of the current study was to further evaluate the efficacy of intravenous ISDN administered in clinically relevant timing for first responders. Methods A comparative animal study using 24 rabbits in 4 randomized study groups was performed. Anima...

  11. Conceptualization of actors’ emerging-object-of-activities as hidden exploitative resource for managing organizational change

    OpenAIRE

    Sanda, Mohammed-Aminu

    2011-01-01

    This paper discusses the concept of an “actor’s emerging-object-of-activity” and its potential use towards increased understanding and learning of the complexity of organizational change management in organizations. The argument that organizations, as activity systems, offers managers of organizational change an antidote to simplistic interpretations of the nature of individual knowledge and action, and organizational cultures and competencies was critically appraised. Paths for understanding...

  12. Occupational exposure to hydrogen sulfide: management of hydrogen sulfide exposure victims (Preprint No. SA-5)

    International Nuclear Information System (INIS)

    Srivastava, P.P.

    1989-04-01

    National Institute of Occupational Safety and Health, U.S.A. has listed 73 industries with potential exposure to hydrogen sulphide. Though the toxicity of hydrogen sulfide is known to mankind since the beginning of seventeenth century the exact mode of its toxicity and effective therapeutic regimen remains unclear as yet. This paper presents current thoughts on the toxicity of this substance and a discussion on the role of various antidotes used in H 2 S poisoning. (autho r)

  13. The Influence of Creative Tourism on Sustainable Development of Tourism and Reduction of Seasonality – Case Study of Óbidos

    OpenAIRE

    Musikyan, Srbuhi

    2016-01-01

    Tourism remains one of the most fast growing and important industries in the world. It is hard to underestimate the importance and the spectrum of the benefits that tourism provides. On the other hand, nowadays, the increasing growth of tourism poses a range of challenges and problems that need to be solved. These challenges resonate in the emergence of the so called 'alternative' or sustainable forms of tourism, which deem to be an antidote against the harms the traditional forms of tourism ...

  14. Overdose prevention training with naloxone distribution in a prison in Oslo, Norway: a preliminary study

    OpenAIRE

    Petterson, Aase Grønlien; Madah-Amiri, Desiree

    2017-01-01

    Background Prison inmates face a ten times increased risk of experiencing a fatal drug overdose during their first 2 weeks upon release than their non-incarcerated counterparts. Naloxone, the antidote to an opioid overdose, has been shown to be feasible and effective when administered by bystanders. Given the particular risk that newly released inmates face, it is vital to assess their knowledge about opioid overdoses, as well as the impact of brief overdose prevention trai...

  15. Chemical Terrorism for the Intensivist

    Science.gov (United States)

    2012-05-01

    The very rapid evolution of the signs and symptoms is a useful diagnostic clue.6 Adjunct studies are essential in confirming cyanide poison - ing. The...changes. Cyanide poisoning victims require intubation if they have decreased level of consciousness, frequent seizures, apnea, hypoxemic or...States, cyanide poisoning is treated by administering the Lilly Antidote Kit, which contains sodium nitrite and thiosulfate.5 Nitrite forms methemoglobin

  16. Cobinamide is superior to other treatments in a mouse model of cyanide poisoning.

    Science.gov (United States)

    Chan, Adriano; Balasubramanian, Maheswari; Blackledge, William; Mohammad, Othman M; Alvarez, Luis; Boss, Gerry R; Bigby, Timothy D

    2010-08-01

    Cyanide is a rapidly acting cellular poison, primarily targeting cytochrome c oxidase, and is a common occupational and residential toxin, mostly via smoke inhalation. Cyanide is also a potential weapon of mass destruction, with recent credible threats of attacks focusing the need for better treatments, as current cyanide antidotes are limited and impractical for rapid deployment in mass casualty settings. We have used mouse models of cyanide poisoning to compare the efficacy of cobinamide (Cbi), the precursor to cobalamin (vitamin B(12)), to currently approved cyanide antidotes. Cbi has extremely high affinity for cyanide and substantial solubility in water. We studied Cbi in both an inhaled and intraperitoneal model of cyanide poisoning in mice. We found Cbi more effective than hydroxocobalamin, sodium thiosulfate, sodium nitrite, and the combination of sodium thiosulfate-sodium nitrite in treating cyanide poisoning. Compared to hydroxocobalamin, Cbi was 3 and 11 times more potent in the intraperitoneal and inhalation models, respectively. Cobinamide sulfite (Cbi-SO(3)) was rapidly absorbed after intramuscular injection, and mice recovered from a lethal dose of cyanide even when given at a time when they had been apneic for over 2 min. In range-finding studies, Cbi-SO(3) at doses up to 2000 mg/kg exhibited no clinical toxicity. These studies demonstrate that Cbi is a highly effective cyanide antidote in mouse models, and suggest it could be used in a mass casualty setting, because it can be given rapidly as an intramuscular injection when administered as Cbi-SO(3). Based on these animal data Cbi-SO(3) appears to be an antidote worthy of further testing as a therapy for mass casualties.

  17. Intravenous versus intramuscular cobinamide compared to intravenous saline (control) in the treatment of acute, survivable, hydrogen sulfide toxicity in swine (Sus Scrofa).

    Science.gov (United States)

    2017-11-09

    shown that cobinamide successfully reverses cyanide poisoning in an animal model. Moreover, cobinamide can be administered via the IM route making it an...toxicity and ease with which it can be produced. Several potential antidotes have been proposed for hydrogen sulfide poisoning , but none have been...completely successful. Our studies indicate that cobinamide can successfully reverse hydrogen sulfide poisoning in an animal model. We have also

  18. Julia Kristeva’s Maternal Passions

    Directory of Open Access Journals (Sweden)

    Kelly Oliver

    2010-01-01

    Full Text Available This article critically engages Julia Kristeva’s latest work on maternal passion as an antidote to what she calls “feminine fatigue.”  Oliver elaborates, criticizes, and expands Kristeva’s view that maternity can be a model for thinking about passion and its relation to creativity and even to ethics.  She relates Kristeva’s thinking about feminine fatigue to contemporary feminism in the United States. 

  19. Department of Defense Chemical, Biological, Radiological, and Nuclear Defense Program, Annual Report to Congress, 2004

    Science.gov (United States)

    2004-05-01

    schedule, costs, specific warfighter payoffs (stated quantitatively against two or more metrics), and the customers for whom the technology is being...ABN Corps, and MEDCOM. The “Command and Staff Awareness Training” ( CSAT ) exercises became a new vehicle for the commanders and their staffs to use for...Nerve Agent Antidote Kit with single autoinjector. Accomplishments: • Production line upgrade with a custom -built high-speed autoinjector filling

  20. Pattern of Poisoning Cases in a Tertiary Hospital in Bangladesh

    OpenAIRE

    AKM Rafique Uddin; Md Imran Ali; Nazmul Haque; Naser Ahmed; Rukhsana Parvin

    2011-01-01

    Background: Poisoning with various substances is a global problem. It is one of the most important reasons for emergency admission in the hospital. The earlier the initial resuscitations, gastric decontamination and use of specific antidotes, the better is the outcome. Epidemiology of poisoning differs from region to region. This study was carried out to determine the pattern and severity of poisoning in a tertiary care hospital. Objective: To characterize the poisoning cases admitted in Enam...

  1. USE OF LIQUID FERTILIZER TO REDUCE THE PHYTOTOXIC EFFECTS OF GLYPHOSATE ON EUCALYPTUS

    OpenAIRE

    MACHADO, MILER SOARES; FERREIRA, LINO ROBERTO; PAULA, JOSÉ LUCAS DE; PEREIRA, GUSTAVO ANTÔNIO MENDES; GONÇALVES, VALDINEI ARAÚJO

    2017-01-01

    ABSTRACT Glyphosate is a non-selective herbicide used for weed control in eucalyptus forests. Glyphosate drifts are common and may cause serious damage to crops. An alternative to reduce such effects is to use antidotes capable of protecting eucalyptus. An experiment was conducted to evaluate the effects of the application of liquid fertilizer on eucalyptus plants subjected to a glyphosate drift simulation. The treatments were arranged in a 5 x 5 factorial design. The first corresponding fact...

  2. Trip hazards: drug-related crisis, peer support and control at transformational festivals

    OpenAIRE

    Ruane, Deirdre

    2017-01-01

    In the growing global scene surrounding transformational festivals, psychedelics and other 'party drugs' are used to facilitate experiences of connection and sociability which their devotees see as antidotes to the increasing isolation of society as a whole. Yet the openness and suggestibility that potentiates these experiences can also cause painful, alienating 'psychedelic crises'. Peer support projects within the scene attempt to address this problem by providing 'care spaces': comfortable...

  3. Treatment of experimental extravasation of amrubicin, liposomal doxorubicin, and mitoxantrone with dexrazoxane

    DEFF Research Database (Denmark)

    Langer, Seppo W; Thougaard, Annemette V; Sehested, Maxwell

    2012-01-01

    Dexrazoxane is an established treatment option in extravasation of the classic anthracyclines such as doxorubicin, epirubicin, and daunorubicin. However, it is not known whether the protection against the devastating tissue injuries extends into extravasation with new types of anthracyclines......, the anthracenediones, or the liposomal pegylated anthracycline formulations. We therefore tested the antidotal efficacy of dexrazoxane against extravasation of amrubicin, mitoxantrone, and liposomal pegylated doxorubicin in mice....

  4. Homicidal acute formalin poisoning in an infant from a rural sericulture family presenting with multisystem failure.

    Science.gov (United States)

    Y C, Beeregowda; A, Srihari; Pradan, Shashi K; P, Susheela; Y C, Manjunatha

    2013-05-01

    Acute poisoning of formalin is rare because of its strong irritating effect and alarming odor. Although few cases of acute poisoning in adults have been reported in literature, to our knowledge, this is the first case report of formalin poisoning in an infant presenting with multisystem failure. Despite proper supportive treatment in the absence of antidote, the infant died within 13 hours after deliberate poisoning.

  5. Aluminium phosphide induced acute kidney injury

    Directory of Open Access Journals (Sweden)

    Quaiser Saif

    2015-01-01

    Full Text Available Aluminium phosphide is one of the most common agricultural poisons being consumed in north India. Consumption of a fresh tablet is lethal as no antidote is available. Acute intoxication primarily presents with cardiovascular collapse due to myocardial toxicity. We report here a case of acute severe poisoning along with cardiovascular collapse and oliguria. The patient developed acute kidney injury during the illness (a rare entity in aluminium phosphide poisoning, which completely resolved following prompt conservative treatment.

  6. RAICS AS ADVANCED CLOUD BACKUP TECHNOLOGY IN TELECOMMUNICATION NETWORKS

    OpenAIRE

    Luntovskyy, Andriy; Vasyutynskyy, Volodymyr; Spillner, Josef

    2014-01-01

    Data crashes can cause unpredictable and even hard-out effects for an enterprise or authority. Backup strategies as antidote uni-fy a complex of organizational and technical measures that are necessary for data restoring, processing and transfer as well as for data security and defense against its loss, crash and tampering. High-performance modern Internet allows delivery of back-up functions and is complemented by attractive (mobile) services with a Quality of Service comparable to that in L...

  7. Screening of plants acting against Heterometrus laoticus scorpion venom activity on fibroblast cell lysis.

    Science.gov (United States)

    Uawonggul, Nunthawun; Chaveerach, Arunrat; Thammasirirak, Sompong; Arkaravichien, Tarinee; Chuachan, Chattong; Daduang, Sakda

    2006-01-16

    The aqueous extracts of 64 plant species, listed as animal- or insect-bite antidotes in old Thai drug recipes were screened for their activity against fibroblast cell lysis after Heterometrus laoticus scorpion venom treatment. The venom was preincubated with plant extract for 30 min and furthered treated to confluent fibroblast cells for 30 min. More than 40% efficiency (test/control) was obtained from cell treatment with venom preincubated with extracts of Andrographis paniculata Nees (Acanthaceae), Barringtonia acutangula (L.) Gaertn. (Lecythidaceae), Calamus sp. (Palmae), Clinacanthus nutans Lindau (Acanthaceae), Euphorbia neriifolia L. (Euphorbiaceae), Ipomoea aquatica Forssk (Convolvulaceae), Mesua ferrea L. (Guttiferae), Passiflora laurifolia L. (Passifloraceae), Plectranthus amboinicus (Lour.) Spreng. (Labiatae), Ricinus communis L. (Euphorbiaceae), Rumex sp. (Polygonaceae) and Sapindus rarak DC. (Sapindaceae), indicating that they had a tendency to be scorpion venom antidotes. However, only Andrographis paniculata and Barringtonia acutangula extracts provided around 50% viable cells from extract treatments without venom preincubation. These two plant extracts are expected to be scorpion venom antidotes with low cytotoxicity.

  8. ["Lingue di seripi", "serpents' tongues" and "glossopetrae". Highlights from the history of popular "cult" medicine in early modern times].

    Science.gov (United States)

    Freller, T

    1997-01-01

    In the 16th, 17th and 18th century "Glossopetrae", popularly known as "Lingue di Serpi", found on the Mediterranean island of Malta, were extensively used for medical purposes as antidotes. These fossil teeth, including specimens of the "Carcharodon Megalodon" (an extinct variant of the great white shark), were ground to powder or used as amulet pendants and "credence" and exported to pharmacies and shops in various cities of Europe. In antiquity, authors like Plinius or Solinus, excluding any religious connotations, had regarded "Glossopetrae" as objects "fallen from heaven on dark moonless nights". However, from the beginning of the 16th century the miraculous antidotic power of the specimens found at Malta was very strongly connected with the Pauline cult there. This cult owed ist origin to the excerpt of the shipwreck of the Apostle of the Gentiles on this island, as recorded in the New Testament. As in so many cases found in medieval and early modern medicine and pharmacy, the renown, collection, distribution and use of the antidote "Glossopetrae" or "Lingue di Serpi" was never limited to its real chemical and pharmaceutical properties. In the period of enlightenment and secular thinking mythic medicine as "Glossopetrae" had lost ist "magical" power. Consequently, with beginning of the late 18th century also the Maltese "Glossopetrae" featured in literature merely as exotic objects of curiosity or symbols of an age bound to medical superstition.

  9. Ethnomedicinal plants used for snakebite in India: a brief overview

    Directory of Open Access Journals (Sweden)

    Sughosh V. Upasani

    2017-06-01

    Full Text Available The result of human interface and assortment of the most desirable, influential, and successful plant species found in the immediate environment at a precise circumstance is attributable to indigenous knowledge of plant species. India has a rich variety of medicinal plants growing under different geographical and ecological conditions; 1500 out of 15,000 privileged plant species have been reported to have medicinal uses. Snakebite is a severe medical, social, and economic problem in many parts of the world, chiefly in tropical and subtropical nations where majority of the world’s dangerous snakes are found and where access to treatment is limited. In India, a range of medicinal plants are used as antidotes for snakebites, used either singly or in combination with other agents. The present study makes an effort to assemble information on medicinal plants that are grown and used for snakebite treatment in India. From a range of literature sources, data have been compiled with emphasis on the plants, family, parts used, etc., depending on the availability of information. This paper enumerates 523 plant species belonging to 122 families that act as antidotes against snakebites. We believe this study of herbal antidotes against snake venom is of substantial significance to society.

  10. Czech mass methanol outbreak 2012: epidemiology, challenges and clinical features.

    Science.gov (United States)

    Zakharov, Sergey; Pelclova, Daniela; Urban, Pavel; Navratil, Tomas; Diblik, Pavel; Kuthan, Pavel; Hubacek, Jaroslav A; Miovsky, Michal; Klempir, Jiri; Vaneckova, Manuela; Seidl, Zdenek; Pilin, Alexander; Fenclova, Zdenka; Petrik, Vit; Kotikova, Katerina; Nurieva, Olga; Ridzon, Petr; Rulisek, Jan; Komarc, Martin; Hovda, Knut Erik

    2014-12-01

    Methanol poisonings occur frequently globally, but reports of larger outbreaks where complete clinical and laboratory data are reported remain scarce. The objective of the present study was to report the data from the mass methanol poisoning in the Czech Republic in 2012 addressing the general epidemiology, treatment, and outcomes, and to present a protocol for the use of fomepizole ensuring that the antidote was provided to the most severely poisoned patients in the critical phase. A combined prospective and retrospective case series study of 121 patients with confirmed methanol poisoning. From a total of 121 intoxicated subjects, 20 died outside the hospital and 101 were hospitalized. Among them, 60 survived without, and 20 with visual/CNS sequelae, whereas 21 patients died. The total and hospital mortality rates were 34% and 21%, respectively. Multivariate regression analysis found pH 0.05). Severity of metabolic acidosis, state of consciousness, and serum ethanol on admission were the only significant parameters associated with mortality. The type of dialysis or antidote did not appear to affect mortality. Recommendations that were issued for hospital triage of fomepizole administration allowed conservation of valuable antidote in this massive poisoning outbreak for those patients most in need.

  11. Management of poisoning with ethylene glycol and methanol in the UK: a prospective study conducted by the National Poisons Information Service (NPIS).

    Science.gov (United States)

    Thanacoody, Ruben H K; Gilfillan, Claire; Bradberry, Sally M; Davies, Jeremy; Jackson, Gill; Vale, Allister J; Thompson, John P; Eddleston, Michael; Thomas, Simon H L

    2016-01-01

    Poisoning with methanol and ethylene glycol can cause serious morbidity and mortality. Specific treatment involves the use of antidotes (fomepizole or ethanol) with or without extracorporeal elimination techniques. A prospective audit of patients with methanol or ethylene glycol poisoning reported by telephone to the National Poisons Information Service (NPIS) in the UK was conducted during the 2010 calendar year and repeated during the 2012 calendar year. The study was conducted to determine the frequency of clinically significant systemic toxicity and requirement for antidote use and to compare outcomes and rates of adverse reaction and other problems in use between ethanol and fomepizole. The NPIS received 1315 enquiries involving methanol or ethylene glycol, relating to 1070 individual exposures over the 2-year period. Of the 548 enquiries originating from hospitals, 329 involved systemic exposures (enteral or parenteral as opposed to topical exposure), of which 216 (66%) received an antidote (204 for ethylene glycol and 12 for methanol), and 90 (27%) extracorporeal treatment (86 for ethylene glycol and 4 for methanol). Comparing ethanol with fomepizole, adverse reactions (16/131 vs. 2/125, p methanol results in hospitalisation at least 2-3 times per week on average in the UK. No difference in outcome was detected between ethanol and fomepizole-treated patients, but ethanol was associated with more frequent adverse reactions.

  12. Cisplatin Analogs Confer Protection against Cyanide Poisoning.

    Science.gov (United States)

    Nath, Anjali K; Shi, Xu; Harrison, Devin L; Morningstar, Jordan E; Mahon, Sari; Chan, Adriano; Sips, Patrick; Lee, Jangwoen; MacRae, Calum A; Boss, Gerry R; Brenner, Matthew; Gerszten, Robert E; Peterson, Randall T

    2017-05-18

    Cisplatin holds an illustrious position in the history of chemistry most notably for its role in the virtual cure of testicular cancer. Here we describe a role for this small molecule in cyanide detoxification in vivo. Cyanide kills organisms as diverse as insects, fish, and humans within seconds to hours. Current antidotes exhibit limited efficacy and are not amenable to mass distribution requiring the development of new classes of antidotes. The binding affinity of the cyanide anion for the positively charged metal platinum is known to create an extremely stable complex in vitro. We therefore screened a panel of diverse cisplatin analogs and identified compounds that conferred protection from cyanide poisoning in zebrafish, mice, and rabbits. Cumulatively, this discovery pipeline begins to establish the characteristics of platinum ligands that influence their solubility, toxicity, and efficacy, and provides proof of concept that platinum-based complexes are effective antidotes for cyanide poisoning. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Management of novel oral anticoagulants in emergency and trauma surgery.

    Science.gov (United States)

    Pinho-Gomes, Ana-Catarina; Hague, Adam; Ghosh, Jonathan

    2016-08-01

    The compelling safety, efficacy and predictable effect of novel oral anticoagulants (NOACs) is driving a rapid expansion in their therapeutic indications. Management of the increasing number of patients on those new agents in the setting of emergency or trauma surgery can be challenging and the absence of specific reversal agents has been a matter of concern. This review summarises the key principles that underpin the management of those patients with a particular emphasis on the recent development of specific antidotes. As of 2015, a new line of antidotes, specific for these drugs, are at different stages of their development with their release imminent. However, as NOACs are innately reversible due to their short half-life, the use of reversal agents will probably be restricted to a few exceptional cases. Post-marketing surveillance will be paramount to better clarify the role of these promising drugs. Management of patients on NOACs in the context of emergency or trauma surgery relies on best supportive care in combination with the blood products and/or specific antidotes as required. Familiarity with the new reversal agents is essential but further evidence on their indications, safety and efficacy as well as consensus guidelines are warranted prior to widespread adoption. Copyright © 2016 Royal College of Surgeons of Edinburgh (Scottish charity number SC005317) and Royal College of Surgeons in Ireland. Published by Elsevier Ltd. All rights reserved.

  14. A Systematic Review of Ethanol and Fomepizole Use in Toxic Alcohol Ingestions

    Directory of Open Access Journals (Sweden)

    Lorri Beatty

    2013-01-01

    Full Text Available Objectives. The optimal antidote for the treatment of ethylene glycol or methanol intoxication is not known. The objective of this systematic review is to describe all available data on the use of ethanol and fomepizole for methanol and ethylene glycol intoxication. Data Source. A systematic search of MEDLINE and EMBASE was conducted. Study Selection. Published studies involving the use of ethanol or fomepizole, or both, in adults who presented within 72 hours of toxic alcohol ingestion were included. Our search yielded a total of 145 studies for our analysis. There were no randomized controlled trials, and no head-to-head trials. Data Extraction. Variables were evaluated for all publications by one independent author using a standardized data collection form. Data Synthesis. 897 patients with toxic alcohol ingestion were identified. 720 (80.3% were treated with ethanol (505 Me, 215 EG, 146 (16.3% with fomepizole (81 Me, 65 EG, and 33 (3.7% with both antidotes (18 Me, 15 EG. Mortality in patients treated with ethanol was 21.8% for Me and 18.1% for EG. In those administered fomepizole, mortality was 17.1% for Me and 4.1% for EG. Adverse events were uncommon. Conclusion. The data supporting the use of one antidote is inconclusive. Further investigation is warranted.

  15. Treatment of patients with ethylene glycol or methanol poisoning: focus on fomepizole.

    Science.gov (United States)

    Mégarbane, Bruno

    2010-01-01

    Ethylene glycol (EG) and methanol are responsible for life-threatening poisonings. Fomepizole, a potent alcohol dehydrogenase (ADH) inhibitor, is an efficient and safe antidote that prevents or reduces toxic EG and methanol metabolism. Although no study has compared its efficacy with ethanol, fomepizole is recommended as a first-line antidote. Treatment should be started as soon as possible, based on history and initial findings including anion gap metabolic acidosis, while awaiting measurement of alcohol concentration. Administration is easy (15 mg/kg-loading dose, either intravenously or orally, independent of alcohol concentration, followed by intermittent 10 mg/kg-doses every 12 hours until alcohol concentrations are methanol-related visual and neurological injuries. When administered prior to the onset of significant acidosis or organ injury, fomepizole may obviate the need for hemodialysis. When dialysis is indicated, 1 mg/kg/h-continuous infusion should be provided to compensate for its elimination. Side-effects are rarely serious and with a lower occurrence than ethanol. Fomepizole is contraindicated in case of allergy to pyrazoles. It is both efficacious and safe in the pediatric population, but is not recommended during pregnancy. In conclusion, fomepizole is an effective and safe first-line antidote for EG and methanol intoxications.

  16. A Systematic Review of Ethanol and Fomepizole Use in Toxic Alcohol Ingestions

    Science.gov (United States)

    Beatty, Lorri; Green, Robert; Magee, Kirk; Zed, Peter

    2013-01-01

    Objectives. The optimal antidote for the treatment of ethylene glycol or methanol intoxication is not known. The objective of this systematic review is to describe all available data on the use of ethanol and fomepizole for methanol and ethylene glycol intoxication. Data Source. A systematic search of MEDLINE and EMBASE was conducted. Study Selection. Published studies involving the use of ethanol or fomepizole, or both, in adults who presented within 72 hours of toxic alcohol ingestion were included. Our search yielded a total of 145 studies for our analysis. There were no randomized controlled trials, and no head-to-head trials. Data Extraction. Variables were evaluated for all publications by one independent author using a standardized data collection form. Data Synthesis. 897 patients with toxic alcohol ingestion were identified. 720 (80.3%) were treated with ethanol (505 Me, 215 EG), 146 (16.3%) with fomepizole (81 Me, 65 EG), and 33 (3.7%) with both antidotes (18 Me, 15 EG). Mortality in patients treated with ethanol was 21.8% for Me and 18.1% for EG. In those administered fomepizole, mortality was 17.1% for Me and 4.1% for EG. Adverse events were uncommon. Conclusion. The data supporting the use of one antidote is inconclusive. Further investigation is warranted. PMID:23431453

  17. [Clinical perspectives on the management of bleeding in patients on oral anticoagulants: the DECOVER Study (DElphi Consensus on oral COagulation and therapy action reVERsal)].

    Science.gov (United States)

    Vicente, Vicente; Martín, Alfonso; Lecumberri, Ramón; Coll-Vinent, Blanca; Suero, Coral; González-Porras, José Ramón; Marco, Pascual; Mateo, José; Roldán, Vanesa; Soulard, Stéphane; Crespo, Carlos; Camats, Míriam

    2017-02-01

    To evaluate the level of agreement between hematologists and emergency medicine physicians regarding the best clinical practices for managing bleeding and anticoagulant reversal. Nationwide Spanish multicenter Delphi method study with a panel of experts on anticoagulation and the management of bleeding. Two survey rounds were carried out between April and September 2015. Consensus was reached when more than 75% of the panelists scored items in the same tertile. Fifteen hematologists and 17 emergency medicine specialists from 14 Spanish autonomous communities participated. Consensus was reached on the use of both hemodialysis and an activated prothrombin complex concentrate (PCC) to antagonize significant/major bleeding in patients taking dabigatran. Use of an activated PCC was considered sufficient for patients on rivaroxaban or apixaban. The panel did not consider any PCC to be both effective and safe. Tests for activated partial thromboplastin, thrombin, diluted thrombin, and ecarin clotting times were considered useful in patients treated with dabigatran. A specific anti-Xa activity assay was suggested for patients who developed bleeds while treated with rivaroxaban or apixaban. Specific antidotes for direct-acting oral anticoagulants would be useful when severe bleeding occurs according to 97% of the panelists. Such antidotes would substantially change current treatment algorithms. The points of consensus were generally in line with clinical practice guidelines, but the Delphi process revealed that there are aspects of the clinical management of bleeding that require unified criteria. The need for specific antidotes for direct-acting oral anticoagulants was emphasized.

  18. The Toxiscape Hunt: An Escape Room-Scavenger Hunt for Toxicology Education

    Directory of Open Access Journals (Sweden)

    Megan Boysen-Osborn

    2018-01-01

    Full Text Available Audience: This scavenger hunt/escape room is a didactic activity for emergency medicine residents or fourth-year medical students rotating in emergency medicine. Introduction: Between 2008-2011, 1.1 million patients presented to U.S. emergency departments each year for poisonings,1 including acute ingestions, envenomations, occupational exposures, and overdoses. Toxicologic exposures are considered part of the core curriculum for emergency medicine (EM residents, who must understand the presentation and treatment of such patients.2 Educating residents in a unique, engaging format such as an “escape room” activity provides an alternative to the didactic format of teaching this material, which may build medical knowledge and team rapport amongst residents.3 Objectives: By the end of the activity, learners should be able to: Calculate an anion and osmolal gap. Recognize poisonings amenable to hemodialysis. Interpret EKG changes related to a variety of ingestions, including beta-blockers and calcium channel blockers, digitalis, and tricyclic antidepressants. Recognize poisonous plants and their clinical toxidromes. Calculate loading dose of N-acetylcysteine as antidote for acute acetaminophen ingestion. Collaborate as a team to arrive at solutions of problems. Recognize poisons that have available antidotes Know the clinical effect of various types of snake envenomations. Recognize the toxicity associated with at least four household chemicals. Know the antidotes for six common poisonings. Methods: This didactic exercise is a small group activity, utilizing puzzles to apply toxicology knowledge.

  19. Nanopatterning of Co/Pt-multilayers via self-assembled block-copolymer micelles; Magnetische Nanostrukturen basierend auf Co/Pt-Multilagen, hergestellt mittels selbstorganisierter Masken aus Blockcopolymer-Micellen

    Energy Technology Data Exchange (ETDEWEB)

    Stillrich, H.

    2007-07-01

    The production and characterization of magnetic nanostructures based on Co/Ptmultilayers are described in this thesis. Nanostructure arrays of Co/Pt multilayer films are generated utilizing the self-assembly of block copolymer micelles with a few 10nm diameter. For an understanding of the magnetic properties of nanostructures the properties of Co/Pt-multilayer films are examined first. The films are grown via different sputter techniques. The structural and magnetic properties are investigated depending on the deposition technique. The sources of magnetic anisotropy are discussed based on these investigations. One major topic concerning Co/Pt-multilayers is the reorientation of the easy axis of magnetization from perpendicular to in-plane as a function of the cobalt and platinum layer thicknesses. Combining averaging magnetization measurements and high resolution magnetic imaging, the canting of magnetization within the reorientation transition and a canted domain structure were found. The basis for magnetic nanostructures are Co/Pt-multilayers that were optimized for strong magnetic anisotropy. Magnetic antidot and dot arrays are generated from Co/Pt-multilayers via novel methods utilizing block copolymer micelle masks and ion milling. The generation of nanostructure arrays is proven by the morphologic and topographic properties, combined with the evolution of magneto-optic signals. Two different approaches for the generation of antidot arrays are shown. The magnetic properties of antidot arrays with perpendicular and in-plane easy magnetization are investigated. Magnetic dot arrays are produced utilizing the cores of SiO{sub 2} filled block copolymer micelles. The dot arrays consist of single domain particles. The switching field distribution of the dot arrays is analysed and described using the size distribution of the magnetic particles. Magnetic nanostructures in the region of the superparamagnetic limit are investigated. (orig.)

  20. A phase II clinical trial to assess the safety of clonidine in acute organophosphorus pesticide poisoning

    Directory of Open Access Journals (Sweden)

    Karunatilake Harindra

    2009-08-01

    Full Text Available Abstract Background An estimated 2–3 million people are acutely poisoned by organophosphorus pesticides each year, mostly in the developing world. There is a pressing need for new affordable antidotes and clonidine has been shown to be effective in animal studies. Our aim was to determine the safety of clonidine given as an antidote in adult patients presenting with signs or symptoms of acute organophosphate ingestion. Methods This study was a dose finding, open-label, multicentre, phase II trial. Forty eight patients with acute organophosphate poisoning were randomized to receive either clonidine or placebo: Four to receive placebo and twelve to receive clonidine at each dose level. The first dose level was an initial loading dose of 0.15 mg followed by an infusion of 0.5 mg of clonidine over 24 hours. The initial loading dose was increased to 0.3 mg, 0.45 and 0.6 mg. at all dosing levels however the subsequent infusion remained at 0.5 mg of clonidine over 24 hours. Results The baseline characteristics of both groups were similar. The trial was stopped after completion of the 3rd dosing level. At the 1st and 2nd dosing level there were no reported adverse drug reactions. At the 3rd dosing level 5 patients (42% developed significant hypotension during clonidine treatment that responded to intravenous fluids. There were no statistical differences in ventilation rate, pre and post GCS, and mortality rates over all levels. Conclusion Our findings suggest use of moderate doses of clonidine in acute organophosphate poisoning can be used without causing frequent clinical problems but that higher doses are associated with a high incidence of hypotension requiring intervention. Further studies are needed to study the efficacy of clonidine as an antidote in organophosphate poisoning. Trial registration Current Controlled Trial ISRCTN89917816.

  1. The combination of cobinamide and sulfanegen is highly effective in mouse models of cyanide poisoning.

    Science.gov (United States)

    Chan, Adriano; Crankshaw, Daune L; Monteil, Alexandre; Patterson, Steven E; Nagasawa, Herbert T; Briggs, Jackie E; Kozocas, Joseph A; Mahon, Sari B; Brenner, Matthew; Pilz, Renate B; Bigby, Timothy D; Boss, Gerry R

    2011-06-01

    Cyanide is a component of smoke in residential and industrial fires, and accidental exposure to cyanide occurs in a variety of industries. Moreover, cyanide has the potential to be used by terrorists, particularly in a closed space such as an airport or train station. Current therapies for cyanide poisoning must be given by intravenous administration, limiting their use in treating mass casualties. We are developing two new cyanide antidotes--cobinamide, a vitamin B(12) analog, and sulfanegen, a 3-mercaptopyruvate prodrug. Both drugs can be given by intramuscular administration, and therefore could be used to treat a large number of people quickly. We now asked if the two drugs would have an augmented effect when combined. We used a non-lethal and two different lethal models of cyanide poisoning in mice. The non-lethal model assesses neurologic recovery by quantitatively evaluating the innate righting reflex time of a mouse. The two lethal models are a cyanide injection and a cyanide inhalation model. We found that the two drugs are at least additive when used together in both the non-lethal and lethal models: at doses where all animals died with either drug alone, the combination yielded 80 and 40% survival in the injection and inhalation models, respectively. Similarly, drug doses that yielded 40% survival with either drug alone, yielded 80 and 100% survival in the injection and inhalation models, respectively. As part of the inhalation model, we developed a new paradigm in which animals are exposed to cyanide gas, injected intramuscularly with an antidote, and then re-exposed to cyanide gas. This simulates cyanide exposure of a large number of people in a closed space, because people would remain exposed to cyanide, even after receiving an antidote. The combination of cobinamide and sulfanegen shows great promise as a new approach to treating cyanide poisoning.

  2. Hydroxocobalamin in cyanide poisoning.

    Science.gov (United States)

    Thompson, John P; Marrs, Timothy C

    2012-12-01

    On theoretical grounds, hydroxocobalamin is an attractive antidote for cyanide poisoning as cobalt compounds have the ability to bind and detoxify cyanide. This paper reviews the pharmacokinetic and pharmacodynamic aspects of hydroxocobalamin, its efficacy in human cyanide poisoning and its adverse effects. PubMed was searched for the period 1952 to April 2012. A total of 71 papers were identified in this way; and none was excluded. PHARMACOKINETICS AND PHARMACODYNAMICS: Pharmacokinetic studies in dogs and humans suggest a two-compartment model, with first order elimination kinetics. Pharmacodynamic studies in animals suggest that hydroxocobalamin would be a satisfactory antidote for human cyanide poisoning. EFFICACY IN HUMAN POISONING: There is limited evidence that hydroxocobalamin alone is effective in severe poisoning by cyanide salts. The evidence for the efficacy of hydroxocobalamin in smoke inhalation is complicated by lack of evidence for the importance of cyanide exposure in fires and the effects of other chemicals as well as confounding effects of other therapeutic measures, including hyperbaric oxygen. Evidence that hydroxocobalamin is effective in poisoning due to hydrogen cyanide alone is lacking; extrapolation of efficacy from poisoning by ingested cyanide salts may not be valid. The rate of absorption may be greater with inhaled hydrogen cyanide and the recommended slow intravenous administration of hydroxocobalamin may severely limit its clinical effectiveness in these circumstances. Both animal and human data suggest that hydroxocobalamin is lacking in clinically significant adverse effects. However, in one human volunteer study, delayed but prolonged rashes were observed in one-sixth of subjects, appearing 7 to 25 days after administration of 5 g or more of hydroxocobalamin. Rare adverse effects have included dyspnoea, facial oedema, and urticaria. Limited data on human poisonings with cyanide salts suggest that hydroxocobalamin is an effective

  3. French contribution to develop Prussian blue.

    Science.gov (United States)

    Besse Bardot, Isabelle; Bardot, Sebastien; Menetrier, Florence; Leiterer, Alexandra; Pech, Annick

    2014-11-01

    Prussian blue is an antidote indicated for the treatment of internal cesium radioisotope contamination. The French armed forces develop and manufacture some antidotal drugs meeting regulatory, analytical and pharmaceutical requirements in order to submit marketing authorization documentation. Prior to an initial meeting with the French National Agency for Medicines and Health Products Safety (ANSM) in 2011, the authors were following regulatory developments in free cyanide release, active pharmaceutical ingredient (API) synthesis, API specifications, ability of cesium/Prussian blue binding products and collection of pre-clinical data. Free cyanide release was assessed by ultraviolet-visible (UV-Vis) spectrometry at 615 nm. The kinetics of cesium were evaluated in vitro by flame atomic absorption. Good laboratory practice (GLP) and mutagenic assays were examined in rat studies to assess 'no absorption'. A validated method makes it possible to assess the free cyanide in API according to the published tolerability in humans. The French synthesizer meets good manufacturing practice (GMP) to give a drug that is compliant with all specifications, ensuring its high quality. Two standard mutagenic assays showed mutagenic potential, leading to further tests to obtain more information on any induced chromosomal aberrations. Absorption could be an important factor in determining the risk posed by the drug. The French health service provides the country with several antidotal drugs reducing Chemical, Biological, Radiological and Nuclear (CBRN) risks. Using their GMP manufacturing facilities and pharmaceutical expertise, the French armed forces have contributed to developing drugs with marketing authorization, such as pentetate calcium trisodium (Ca-DTPA) for infusion, or under development with the French Alternative Energies and Atomic Energy Commission (CEA), such as Ca-DTPA by inhalation.

  4. The safety of ethanol infusions for the treatment of methanol or ethylene glycol intoxication: an observational study.

    Science.gov (United States)

    Wedge, Mary Kate; Natarajan, Sabrina; Johanson, Christel; Patel, Rakesh; Kanji, Salmaan

    2012-09-01

    Methanol or ethylene glycol ingestion may result in significant morbidity or death without prompt treatment. Despite traditional and widespread use of intravenous ethanol as an antidote, its safety is not well described. An evaluation of the safety and ease of titrating ethanol infusions is necessary given the availability of an alternative antidote. To evaluate the safety and ease of titrating ethanol infusions for the treatment of methanol or ethylene glycol ingestion. We reviewed the hospital records of adults treated with ethanol at The Ottawa Hospital for methanol or ethylene glycol ingestion over a 9-year period. Using a standardized case report form, a single reviewer identified prespecified adverse events that developed after the start of ethanol therapy and classified dose adjustments during ethanol therapy as appropriate or inappropriate based on a priori criteria. Forty-nine cases of methanol or ethylene glycol ingestion treated with ethanol were included in the analysis, of which 45 underwent hemodialysis, 38 were admitted to the intensive care unit, and 4 died. At least one adverse event was identified in 45 (92%) cases, including 35 (71%) with agitation requiring chemical or physical restraints and 10 (20%) with a depressed level of consciousness treated with intubation. The median number of ethanol concentration measurements per treatment course was 6 (range 0-24), of which only 27% were within the target range of 22 to 30 mmol/L and 47% were below. When measured concentrations were outside the target, the adjustment in ethanol dosing (or lack thereof) was deemed inappropriate 59% of the time, including 69% of the time during hemodialysis. Based on actual practice in a large academic centre, adverse events occur frequently with intravenous ethanol infusions, and ethanol titration is inefficient. The safety profile and therapeutic drug monitoring considerations for ethanol should be considered when choosing an antidote for methanol or ethylene glycol

  5. Original Article. Protection studies of new bis quaternary 2-(hydroxyimino-N-(pyridin-3yl acetamide derivatives (HNK-series oximes against acute poisoning by dichlorvos (DDVP in Swiss albino mice

    Directory of Open Access Journals (Sweden)

    Kumar Pravin

    2016-12-01

    Full Text Available The available antidotal therapy against acute poisoning by organophosphates involves the use of atropine alone or in combination with one of the oximes, e.g. 2-PAM, Obidoxime, TMB-4 or HI-6. Each of these oximes has some limitation, raising the question of the universal antidotal efficacy against poisoning by all OPs/nerve agents. In the present study, newly synthesized bis quaternary 2-(hydroxyimino-N-(pyridin-3yl acetamide derivatives (HNK-series oximes were evaluated for their antidotal efficacy against DDVP intoxicated Swiss mice, in terms of the Protection Index (PI and AChE reactivation in brain and serum. The inhibition concentration (IC50 was determined in brain and serum after optimizing the time point for maximum inhibition (60 min post DDVP exposure. AChE reactivation efficacy of the HNK series was evaluated at IC50 and compared with 2-PAM. HNK-102 showed a ~2 times better Protection Index (PI as compared to 2-PAM against DDVP toxicity. IC50 at 60 min DDVP post exposure was found to be approximately one fifth and one half of the LD50 dose for brain and serum AChE, respectively. Out of three HNK oximes, HNK-102 & 106 at 0.20 LD50 dose significantly reactivated DDVP intoxicated brain AChE (p<0.05 as compared to 2-PAM at double IC50 dose of DDVP. In light of double PI and higher AChE reactivation, HNK 102 was found to be a better oxime than 2-PAM in the treatment of acute poisoning by DDVP.

  6. Treatment of patients with ethylene glycol or methanol poisoning: focus on fomepizole

    Directory of Open Access Journals (Sweden)

    Bruno Mégarbane

    2010-08-01

    Full Text Available Bruno MégarbaneRéanimation Médicale et Toxicologique, Hôpital Lariboisière and Université Paris-Diderot, Paris, FranceAbstract: Ethylene glycol (EG and methanol are responsible for life-threatening poisonings. Fomepizole, a potent alcohol dehydrogenase (ADH inhibitor, is an efficient and safe antidote that prevents or reduces toxic EG and methanol metabolism. Although no study has compared its efficacy with ethanol, fomepizole is recommended as a first-line antidote. Treatment should be started as soon as possible, based on history and initial findings including anion gap metabolic acidosis, while awaiting measurement of alcohol concentration. Administration is easy (15 mg/kg-loading dose, either intravenously or orally, independent of alcohol concentration, followed by intermittent 10 mg/kg-doses every 12 hours until alcohol concentrations are <30 mg/dl. There is no need to monitor fomepizole concentrations. Administered early, fomepizole prevents EG-related renal failure and methanol-related visual and neurological injuries. When administered prior to the onset of significant acidosis or organ injury, fomepizole may obviate the need for hemodialysis. When dialysis is indicated, 1 mg/kg/h-continuous infusion should be provided to compensate for its elimination. Side-effects are rarely serious and with a lower occurrence than ethanol. Fomepizole is contraindicated in case of allergy to pyrazoles. It is both efficacious and safe in the pediatric population, but is not recommended during pregnancy. In conclusion, fomepizole is an effective and safe first-line antidote for EG and methanol intoxications.Keywords: ethanol, hemodialysis, metabolic acidosis

  7. Cobalt-rich alloys electrodeposited on silicon; Filmes de ligas ricas em cobalto eletrodepositado sobre silicio

    Energy Technology Data Exchange (ETDEWEB)

    Spada, E.R.; Dotto, M.E.R.; Sartorelli, M.L. [Universidade Federal de Santa Catarina (UFSC), Florianopolis, SC (Brazil). Departamento de Fisica. Lab. de Sistemas Nanoestruturados; Paula, F.R. de, E-mail: depaula@dfq.feis.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Ilha Solteira, SP (Brazil). Departamento de Fisica e Quimica

    2014-07-01

    We report the electrodeposition (ED) of cobalt-rich alloy films on n-type Si (100) substrates in aqueous solution. A small amount of copper sulphate in the bath improved the quality of cobalt-rich films. The bath proved to be appropriate for the production of electrodeposited magnetic antidote structures prepared by nanosphere lithography technique. X-ray measurements indicate a mixture of hcp and fcc CoCu structures and strong texture in the (001) hcp and (111) fcc direction. Magnetic behavior was shown to be dependent on the thickness, which directly affects the domain wall pinning and the presence of superparamagnetism. (author)

  8. The portrayal of the menstruating woman in menstrual product advertisements.

    Science.gov (United States)

    Coutts, L B; Berg, D H

    1993-01-01

    Because menstrual product advertisements act as mediators of a subset of meanings of femininity linked to menstruation, we performed a comparative conceptual analysis of these advertisements to explicate media-constructed realities of contemporary women. We sought to understand the portrayed women's definition of menstruation and their status as menstruating women. Textual and conceptual analyses led us to conclude that the portrayed women, in an attempt to avoid others' discovery of their menstruation, employed a complex menstrual management system, which often includes feminized menstrual products, to act as an antidote to a tainted state of femininity.

  9. Nice Teams Finish Last The Secret to Unleashing Your Team's Maximum Potential

    CERN Document Server

    Miller, Brian Cole

    2010-01-01

    Don't rock the boat. Don't make waves. Don't offend anyone. There's a palpable feeling that clouds many team meetings and keeps them from being productive: over-politeness. And while the conflict that naturally exists in most organizations hasn't gone away, it manifests itself in passive-aggression, mediocrity, and a molasses-like inability to get anything done. Nice Teams Finish Last provides the antidote to this all-too-common tendency, giving managers, team leaders and members, and facilitators the practical support they need to battle "the nice trap" and start getting results! The book hel

  10. ORGANIZED CRIME: A NEW STRUGGLE FOR DOMINANCE OF TERRITORIALITY

    Directory of Open Access Journals (Sweden)

    Jose Divanilson Cavalcanti Junior

    2016-10-01

    Full Text Available The fundamental right to security, constitutionally provided is an increasingly distant reality. The formal agencies such as the judiciary, the prosecution, the police, the prison system, among others, are antidotes ineffective in reducing crime. We will review the form of organized crime operating in the territory dominated by analyzing your current situation and positioning of scholars. The work shows aspects that can aid the understanding of the historical and sociological context of the theme, aiming to support the organs of public security, enabling a more effective role in combating and preventing violent conflicts that result from this mode.

  11. Cholestatic liver injury as a side-effect of dabigatran and the use of coagulation tests in dabigatran intoxication and after reversal by idarucizumab in bleeding and sepsis

    DEFF Research Database (Denmark)

    Comuth, Willemijn J; Haase, Anne-Mette; Henriksen, Linda Ø

    2018-01-01

    Idarucizumab, an antidote specific for dabigatran, became available recently. Dabigatran is not associated with increased risk of hepatotoxicity in comparison with warfarin, but it is seen as a rare side-effect. Cases of cholestatic liver injury due to dabigatran have not been reported previously...... and cholestatic liver injury was seen as a possible rare side-effect of dabigatran treatment........ We present a case of severe gastro-intestinal bleeding with underlying dabigatran intoxication in a patient with renal failure and the effect of reversal of dabigatran using idaruzicumab on coagulation assays. International normalized ratio (INR) and activated partial thromboplastin time (APTT...

  12. Transdermal carbamate poisoning – a case of misuse

    Directory of Open Access Journals (Sweden)

    Lalit Kumar Rajbanshi

    2017-01-01

    Full Text Available Acute pesticide poisoning is a common mode of intentional self harm. Oral ingestion is the usual mode of poisoning. However, inhalation, accidental or occupational transdermal exposure leading to acute or chronic poisoning can be the other route of poisoning. It has been seen that the purpose of poising is suicidal intensity in most of the cases. We report an unusual case where the victim had acute pesticide poisoning through transdermal route that was intended for non suicidal purpose. The patient was managed successfully with immediate decontamination and adequate antidote.

  13. Selling Yourself without Selling Out A Leader's Guide to Ethical Self-Promotion

    CERN Document Server

    (CCL), Center for Creative Leadership; McLaughlin, Cindy

    2011-01-01

    High-performing individuals and groups are often not adequately recognized for their contributions. The antidote to being overlooked or underestimated is self-promotion-the act of generating personal visibility in service of your work and career. In this guidebook, we discuss how you can benefit from self-promotion and maintain your integrity and authenticity. We help you reframe common beliefs that get in the way of effective self-promotion, and we provide numerous strategies and activities that can become part of your repertoire.

  14. Emergency management and treatment of the poisoned small animal patient.

    Science.gov (United States)

    Lee, Justine A

    2013-07-01

    This article reviews management of the acutely poisoned veterinary patient, including initial telephone triage, appropriate communication and history gathering from the pet owner, decontamination methods (including the use of appropriate emetic agents and dosing of activated charcoal), and general treatment of the poisoned patient. Symptomatic and supportive care of the poisoned patient includes the use of fluid therapy, gastrointestinal support (eg, antacids), central nervous system support (eg, muscle relaxants, anticonvulsants), sedatives/reversal agents (eg, phenothiazines, naloxone, flumazenil), hepatoprotectants, and miscellaneous antidotal therapy. Copyright © 2013 Elsevier Inc. All rights reserved.

  15. Do herbal medicines have potential for managing snake bite envenomation?

    Science.gov (United States)

    Gupta, Y K; Peshin, S S

    2012-05-01

    Snake envenomation is a global public health problem, with highest incidence in Southeast Asia. Inadequate health services, difficult transportation and consequent delay in antisnake venom administration are the main reasons for high mortality. Adverse drug reactions and inadequate storage conditions limit the use of antisnake venom. The medicinal plants, available locally and used widely by traditional healers, therefore need attention. A wide array of plants and their active principles have been evaluated for pharmacological properties. However, numerous unexplored plants claimed to be antidotes in folklore medicine need to be studied. The present article reviews the current status of various medicinal plants for the management of snake bite.

  16. Analysis of nine cases of acute thallium poisoning.

    Science.gov (United States)

    Wang, Qiwei; Huang, Xiaojiang; Liu, Liang

    2007-04-01

    In this study nine cases of thallium poisoning in a series of homicidal poisoning were analyzed in order to provide more information concerning thallium poisoning. It was found that the most common clinical feature of thallium poisoning was peripheral neuropathy and paraesthesia was more common than amyasthenia. Understanding of these clinical characteristics of thallium poisoning was helpful to early identification and differential diagnosis. Since the early administration of Prussian Blue, as a specific antidote for thallium poisoning, can substantially improve the prognosis, it is of great importance to establish a correct and early diagnosis.

  17. Practice Trends in the Use of Extracorporeal Treatments for Poisoning in Four Countries

    DEFF Research Database (Denmark)

    Ghannoum, Marc; Lavergne, Valery; Gosselin, Sophie

    2016-01-01

    Extracorporeal treatments (ECTRs) such as hemodialysis (HD), enhance the elimination of a small number of toxins. Changes in overdose trends, prescribing practices, antidotes, and dialysis techniques may alter the indications and rates of ECTR use over time. This study analyzed trends in ECTR...... rates per 100,000 exposures with stratification per types of ECTR and toxins. The data collection varied by countries. United States, 1985-2014; United Kingdom, 2011-2013; Denmark, 2005-2014, and regions of Canada as follows: Alberta, 1991-2015; Saskatchewan, 2001-2015; Nova Scotia-PEI, 2006...

  18. Reactivation of Paraoxon-inhibited Acetylcholinesterase by Monoquaternary Pyridinium Oximes with N-Alkylbromide Side Chains

    International Nuclear Information System (INIS)

    Lee, Hyun Myung; Shin, Jin Soo; Han, Soo Bong; Jung Yu Kyung; Kim, Meeheyin; Lee, Sang-Ho; Jung, Young-Sik; Hur, Gyeunghaeng

    2016-01-01

    Organophosphorus nerve agents cause neurotoxicity through the inhibition of acetylcholinesterase (AChE) in the human body. Various oxime reactivators were found to reactivate the inhibited AChE. Pralidoxime (2-PAM) is one such representative oxime antidotes. However, its reactivation ability, as well as its action on the inhibited AChE of the central nervous system, is not sufficient, and therefore the discovery of new oximereactivators is required. Here, oximes with N-bromoalkyl groups were synthesized, and their reactivationpotency on AChE inhibited by paraoxon was evaluated.

  19. Geometrically controlled ratchet effect with collective vortex motion

    International Nuclear Information System (INIS)

    Rouco, V; Palau, A; Obradors, X; Puig, T; Monton, C; Del-Valle, N; Navau, C; Sanchez, A

    2015-01-01

    Rectified flux motion arising from the collective effect of many interacting vortices is obtained in a specially designed superconducting device. Ratchet structures with different asymmetric pinning potentials are generated by tuning the size, depth, and distribution of triangular blind-antidots in a high-temperature superconducting film. We experimentally and theoretically demonstrate that the amplitude and sign of the rectified vortex motion can be finely tuned with the pattern geometry. Two different dynamical regimes depending on the nature of vortices initiating the dissipation are identified, which can control the rectified vortex motion. (paper)

  20. Dgroup: DG01152 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available DG01152 Chemical ... DGroup Edetate ... D00052 ... Edetic acid (NF/INN) D00571 ... Edetate calcium disodium... anhydrous (USP) D01802 ... Edetate disodium (USP); Disodium edetate hydrate (JP17) D03943 ... Edetate calcium disodium... (USP); Calcium sodium edetate hydrate (JP17); Sodium calcium edetate (INN) ... D03944 ... Ed...etate dipotassium (USAN) D03945 ... Disodium edetate D03946 ... Edetate sodium (USAN) D03947 ... Edetate trisodium... (USAN) D07934 ... Edetate calcium disodium D07935 ... Dicobalt edetate (INN) Other ... DG01692 ... Chelator ATC code: V03AB03 Antidotes, Chelating agents ...

  1. «Tu, solo, con la storia alle spalle». Durs Grünbein e la DDR: un bilancio critico

    Directory of Open Access Journals (Sweden)

    Daniele Vecchiato

    2011-10-01

    Full Text Available This paper analyses some of the most significant (post-GDR poems by Grünbein and traces the development of aesthetic and poetological issues that are central to the poet’s oeuvre. It provides an articulated overview of Grünbein’s poetics by examining funda­mental themes like the love/hate attitude towards his hometown Dresden, the comple­mentary concepts of history and memory, and the materialism of the body as an antidote to utopias.

  2. Food, Risk and Politics: Scare, scandal and crisis - insights into the risk politics of food safety

    OpenAIRE

    Randall, Ed J.

    2009-01-01

    This book is about the risk politics of food safety. Food-related risks regularly grab the headlines in ways that threaten reasoned debate and obstruct sensible policy making. The author explains why this is the case. He goes on to make the case for a properly informed and fully open public debate about food safety issues. He argues that this is the true antidote to the politics of scare, scandal and crisis.\\ud \\ud The book skilfully weaves together the many different threads of food safety a...

  3. Dabigatran som årsag til svær gastrointestinal blødning hos et Jehovas Vidne

    DEFF Research Database (Denmark)

    Holm, Jakob; Taskiran, Mustafa

    2013-01-01

    We report a case of severe gastrointestinal bleeding in a Jehovah's Witness patient after ten days of treatment with dabigatran. The patient refused to have a blood transfusion due to belief. An endoscopic examination showed diffuse bleeding from her colonic mucosa, which is typical for medical...... induced bleedings. The patient was in a life-threatening condition and the haemoglobin level fell to nadir 2 mmol/l, before the bleeding stopped after one week's pause of dabigatran therapy. Since an antidote to dabigatran does not exist, precaution is needed when treating patients, who might refuse...

  4. Transport Properties of Nanostructured Graphene

    DEFF Research Database (Denmark)

    Jauho, Antti-Pekka

    2017-01-01

    Despite of its many wonderful properties, pristine graphene has one major drawback: it does not have a band gap, which complicates its applications in electronic devices. Many routes have been suggested to overcome this difficulty, such as cutting graphene into nanoribbons, using chemical methods...... device operation. In this talk I elaborate these ideas and review the state-of-the-art both from the theoretical and the experimental points of view. I also introduce two new ideas: (1) triangular antidots, and (2) nanobubbles formed in graphene. Both of these nanostructuring methods are predicted...

  5. Acute neurotoxicology of drugs of abuse.

    Science.gov (United States)

    Traub, S J; Levine, M D

    2017-01-01

    Many substances can affect the central nervous system, and may cause patients to become critically ill. Acute central neurotoxicologic syndromes associated with drugs of abuse are usually caused by an overdose of sedative-hypnotic agents (including alcohol) or opioids, withdrawal from sedative-hypnotic agents, or an overdose of anticholinergic or sympathomimetic agents. Clinical findings are often syndromic, making physical examination the most important diagnostic tool in the approach to the patient with an unknown ingestion. Treatment focusses on supportive care as the most important intervention for all such patients, augmented by antidotal therapy when appropriate. © 2017 Elsevier B.V. All rights reserved.

  6. Le proposte di legge Santanchè-Palmizio sul registro delle moschee e l’albo degli imam: un tentativo di refurbishment della legge n. 1159/1929?

    Directory of Open Access Journals (Sweden)

    Antonello De Oto

    2018-01-01

    ABSTRACT: The article examines and comments the contents of the legislative proposals c. 2976 and c. 3421 (Garnero-Santanchè and Palmizio and their unconstitutionality profiles . At the end of this parliamentary term, this examination is also the basis for thinking about political and normative necessity of another approach to Islam and, at the same time, revitalizing the Agreements instrument and the general law of religious freedom, so that they can constitute a concrete antidote to the slow and creeping drift of the normative reorganization of the law on the admitted cults.

  7. Accidental Phosphine Gas Poisoning with Fatal Myocardial Dysfunction in Two Families

    International Nuclear Information System (INIS)

    Akhtar, S.; Rehman, A.; Haque, A.; Bano, S.

    2015-01-01

    Aluminum phosphide is commonly used as a rodenticide and insecticide and is one of the most fatal poisons. The active ingredient is Phosphine gas which inhibits cytochrome oxidase and cellular oxygen utilization. The clinical symptoms are due to multiorgan involvement including cardiac toxicity which is the most common cause of mortality. Severity of clinical manifestations depends upon the amount of the gas to which a person is exposed. There is no specific antidote available. High index of suspicion and early aggressive treatment is the key to success. We report 2 cases of aluminum phosphide toxicity in 2 families due to incidental exposure after fumigation. (author)

  8. Determination of metal ion contents of two antiemetic clays use in Geophagy

    Directory of Open Access Journals (Sweden)

    Solomon E. Owumi

    2015-01-01

    Specifically, our result indicates unacceptably high levels of aluminum in Eko and Omumu (>10-fold greater than the highest desirable levels set by the USEPA. The aluminum concentrations were influenced by the pH condition in which the samples were digested. Dietary exposure to aluminum at such high levels may be deleterious to maternal health and fetal development. Therefore consumption of Eko and Omumu as an antidote to reduce nausea during pregnancy should be discouraged. Future studies are planned to investigate specific impacts on fetal and maternal health and likely teratogenicity in rodent models.

  9. POISONING WITH GAMMA-HYDROXYBUTYRATE, GAMMA-BUTYROLACTONE AND 1.4-BUTANDIOL

    Directory of Open Access Journals (Sweden)

    Miran Brvar

    2002-09-01

    Full Text Available Background. Gamma-hydroxybutyrate (GHB is a popular recreational drug. GHB overdose typically presents with decreased level of consciousness, miosis, bradycardia, respiratory depression and death. Typically, combativeness, confusion and vomiting occur once the patient begins to recover. Gamma-butyrolactone (GBL and 1.4-butandiol (1.4-BD are the prodrugs of GHB and have similar clinical presentation. We present the case of GHB poisoning in Ljubljana.Conclusions. Physicians should suspect GHB poisoning in young ravers who present with CNS depression. Treatment is symptomatic. There is no specific antidote. Gastric lavage is not beneficial but activated charcoal is recommended.

  10. Effects of acetamide on experimentally-induced Palicourea marcgravii (St Hill) poisoning in rats.

    Science.gov (United States)

    Gorniak, S L; Palermo-Neto, J; Spinosa, H S

    1994-04-01

    High indices of mortality in cattle have been reported in Brazil as a consequence of Palicourea marcgravii (Pm) acute intoxications. It has been established that Pm leaves contain monofluoroacetic acid (MFA), the active toxic principle of the plant. Rational therapy for MFA poisoning involves the use of a substance that might prevent fluorocitric acid formation. The present work was undertaken to verify if acetamide, a MFA antidote and an acetate donor, protects rats against both Pm and MFA intoxications. It was verified that acetamide protected rats from both convulsions and death. Future experiments should be carried out on cattle to examine the efficiency of acetamide, and particularly under field conditions.

  11. Utilization of Bamboo Charcoal as Additives in Cakes

    Directory of Open Access Journals (Sweden)

    Ronald O. Ocampo

    2015-12-01

    Full Text Available Charcoal has been used for healing various diseases, as antidote to poisoning and as purifying agent to filtered water. This study is conducted to utilize charcoal as additives in making cakes. Specifically, it is intended to determine the acceptable level of charcoal when used as additives in the production of brownies, dark brown chocolate, and chiffon cakes. It can be concluded that an addition of 1 tablespoon of bamboo charcoal gave the highest sensory evaluation to brownies and 3 tablespoon to dark brown chocolate .The control ( no charcoal added is still the best treatment for chiffon cake.

  12. Effects of hyperbaric oxygenation on survival time of aluminum phosphide intoxicated rats

    OpenAIRE

    Hossein Saidi; Farhad Shokraneh; Hamed-Basir Ghafouri; Shayan Shojaie

    2011-01-01

    Background: Aluminium phosphide (AlP) is used as a fumigant. It produces phosphine gas which is a mitochondrial poison. Although this poisoning has been repeatedly reported in literature with a high mortality rate, there is no known antidote for AlP intoxication. In the present study, we studied the effects of hyperbaric oxygenation (HBO) on the survival time of AlP intoxicated rats. Methods: Intoxicated rats with AlP (11.5 mg/kg, oral gavage) were placed in hyperbaric oxygenation with di...

  13. A simplified acute physiology score in the prediction of acute aluminum phosphide poisoning outcome

    OpenAIRE

    Shahin Shadnia; Omid Mehrpour; Kambiz Soltaninejad

    2010-01-01

    Background : Aluminum phosphide (AlP) is used as a fumigant. It produces phosphine gas, which is a mitochondrial poison. Unfortunately, there is no known antidote for AlP intoxication, and also, there are few data about its prognostic factors. AIMS: The aim of this study was to determine the impact of the Simplified Acute Physiology Score II (SAPS II ) in the prediction of outcome in patients with acute AlP poisoning requiring admission to the Intensive Care Unit (ICU). Materials and Methods ...

  14. Human biomonitoring in civil defense; Humanbiomonitoring im Bevoelkerungsschutz

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Michael; Schmiechen, Katharina [Universitaetsmedizin Goettingen (Germany). Arbeits-, Sozial- und Umweltmedizin

    2012-07-01

    The booklet on human biomonitoring (HBM) in civil defense covers the following issues within two sections: (1) general part: definition and importance of human biomonitoring; application in civil defense; practice in a CBRN (chemical, biological, radiation, nuclear) scenario; sampling following a CBRN assignment; HBM for antidote administration; peculiarities of sampling in case of biological agents; microbiological detection procedure; human biomonitoring of radioactive metal isotopes. (2) Special part: substance profiles; list of HBM laboratories; list of poison information centers; questionnaire for exposure assessment in case of dangerous substance accidents; agreement for human biomonitoring examination.

  15. Poisoining with Tricyclic Antidepressants and Current Treatment

    Directory of Open Access Journals (Sweden)

    Muge Gulen

    2016-12-01

    Full Text Available Poisoning with tricyclic antidepressants is one of the main causes of morbidity and mortality compared to all the antidepressants. Main toxic effects are on the cardiovascular system and central nervous system and manifests itself as anticholinergic symptoms. There is no antidote known to be used in the treatment. But sodium bicarbonate treatment is effective in preventing ventricular arrhythmias and hypotension, and resolving metabolic acidosis. There are some treatments that has been used for relief of symptoms and some of them still are in research stage. The drugs that are used can be customized according to the patients symptoms. [Archives Medical Review Journal 2016; 25(4.000: 608-621

  16. Toxic alcohol ingestion: prompt recognition and management in the emergency department [digest].

    Science.gov (United States)

    Beauchamp, Gillian A; Valento, Matthew; Kim, Jeremy

    2016-09-22

    Identifying patients with potential toxic alcohol exposure and initiating appropriate management is critical to avoid significant patient morbidity. Sources of toxic alcohol exposure include ethylene glycol, methanol, diethylene glycol, propylene glycol, and isopropanol. Treatment considerations include the antidotes fomepizole and ethanol, and hemodialysis for removal of the parent compound and its toxic metabolites. Additional interventions include adjunctive therapies that may improve acidosis and enhance clearance of the toxic alcohol or metabolites. This issue reviews common sources of alcohol exposure, basic mechanisms of toxicity, physical examination and laboratory findings that may guide rapid assessment and management, and indications for treatment. [Points & Pearls is a digest of Emergency Medicine Practice].

  17. [Suicidal poisoning with cyanide bought on the internet--case report].

    Science.gov (United States)

    Sommerfeld, Karina; Łukasik-Głebocka, Magdalena; Górny, Jacek; Tobolski, Jarosław; Zielińska-Psuja, Barbara

    2012-01-01

    Cyanides are relatively rare cause of acute poisonings. The majority of data on toxic effects of cyanide compounds on the human body, come from the experiences gained from accidental poisonings in the workplace, with fire smokes or during chemical incidents. However, from immemorial time, cyanides were also used in suicide attempts. The aim of this paper is to present the case of suicidal cyanide poisoning of 26-year-old woman, who was admitted to the toxicology department one hour after ingestion of unknown cyanogenic compound, probably bought on the Internet. Despite intensive symptomatic treatment and antidote administration (hydroxocobalamine), patient died after 78 hours of treatment.

  18. Sodium Azide Associated Acute Hyperkalemia in a Swine Model of Sodium Azide Toxicity

    Science.gov (United States)

    2017-06-16

    hours after poisoning . Antidotes to cyanide have been used for sodium azide poisonings but have had limited success. To describe the clinical course of...34 . t ’ . ’,"’.f’ -./ "\\ , ’ ~ nR NaN3- poisoned swine acutely develop hyperkalemia. We speculate that the hyperkalemia is due, in part, to the...consistent apnea but not sustained apnea. Sodium azide (NaN3) poisonings are rare but extremely deadly. There is very little in the literature regarding

  19. Venomous bites, stings, and poisoning.

    Science.gov (United States)

    Warrell, David A

    2012-06-01

    This article discusses the epidemiology, prevention, clinical features, first aid and medical treatment of venomous bites by snakes, lizards, and spiders; stings by fish, jellyfish, echinoderms, and insects; and poisoning by fish and molluscs, in all parts of the world. Of these envenoming and poisonings, snake bite causes the greatest burden of human suffering, killing 46,000 people each year in India alone and more than 100,000 worldwide and resulting in physical handicap in many survivors. Specific antidotes (antivenoms/antivenins) are available to treat envenoming by many of these taxa but supply and distribution is inadequate in many tropical developing countries. Copyright © 2012. Published by Elsevier Inc.

  20. Strain-induced fermi contour anisotropy of GaAs 2D holes.

    Science.gov (United States)

    Shabani, J; Shayegan, M; Winkler, R

    2008-03-07

    We report measurements of magnetoresistance commensurability peaks, induced by a square array of antidots, in GaAs (311)A two-dimensional holes as a function of applied in-plane strain. The data directly probe the shapes of the Fermi contours of the two spin subbands that are split thanks to the spin-orbit interaction and strain. The experimental results are in quantitative agreement with the predictions of accurate energy band calculations, and reveal that the majority spin subband has a severely distorted Fermi contour whose anisotropy can be tuned with strain.

  1. Spirituality matters: creating a time and place for hope.

    Science.gov (United States)

    Revheim, Nadine; Greenberg, William M

    2007-01-01

    Individuals with serious psychiatric disabilities may become demoralized or hopeless consequent to longstanding disability and stigma. Potential antidotes are social support from the religious community and use of personal spiritual resources as coping mechanisms. The "Spirituality Matters Group" offers comfort and hope through structured and innovative exercises focusing on spiritual beliefs and coping. Activities facilitate verbal expression and appropriate social interaction, and build a sense of community. Activities and themes from selected group sessions are discussed within a recovery-oriented "emotion-focused coping" framework.

  2. [On roman philonium].

    Science.gov (United States)

    Delgado-García, Guillermo; Rodríguez-Návarez, Carolina; Estañol, Bruno

    The roman philonium (Philonium Romanum) is an example of pharmacological poetry. This opiate was conceived by Philo of Tarsus, who was active during the first century of the Common Era. His antidote was written in elegiac couplets. The conservation of these couplets is owed to Galen, who reproduced them in the ninth book of On the Composition of Medicines according to the Places. Most of this Galenic treatise has not been translated into Spanish. For the first time, we offer this prescription in our language from a French version of the fin de siècle. Additionally, we attempt an exegesis of Philo's poem.

  3. An evaluation of the osmole gap as a screening test for toxic alcohol poisoning

    Directory of Open Access Journals (Sweden)

    Abu-Laban Riyad B

    2008-04-01

    Full Text Available Abstract Background The osmole gap is used routinely as a screening test for the presence of exogenous osmotically active substances, such as the toxic alcohols ethylene glycol and methanol, particularly when the ability to measure serum concentrations of the substances is not available. The objectives of this study were: 1 to measure the diagnostic accuracy of the osmole gap for screening for ethylene glycol and methanol exposure, and 2 to identify whether a recently proposed modification of the ethanol coefficient affects the diagnostic accuracy. Methods Electronic laboratory records from two tertiary-care hospitals were searched to identify all patients for whom a serum ethylene glycol and methanol measurement was ordered between January 1, 1996 and March 31, 2002. Cases were eligible for analysis if serum sodium, blood urea nitrogen, glucose, ethanol, ethylene glycol, methanol, and osmolality were measured simultaneously. Serum molarity was calculated using the Smithline and Gardner equation and ethanol coefficients of 1 and 1.25 mOsm/mM. The diagnostic accuracy of the osmole gap was evaluated for identifying patients with toxic alcohol levels above the recommended threshold for antidotal therapy and hemodialysis using receiver-operator characteristic curves, likelihood ratios, and positive and negative predictive values. Results One hundred and thirty-one patients were included in the analysis, 20 of whom had ethylene glycol or methanol serum concentrations above the threshold for antidotal therapy. The use of an ethanol coefficient of 1.25 mOsm/mM yielded higher specificities and positive predictive values, without affecting sensitivity and negative predictive values. Employing an osmole gap threshold of 10 for the identification of patients requiring antidotal therapy resulted in a sensitivity of 0.9 and 0.85, and a specificity of 0.22 and 0. 5, with equations 1 and 2 respectively. The sensitivity increased to 1 for both equations for the

  4. An evaluation of the osmole gap as a screening test for toxic alcohol poisoning.

    Science.gov (United States)

    Lynd, Larry D; Richardson, Kathryn J; Purssell, Roy A; Abu-Laban, Riyad B; Brubacher, Jeffery R; Lepik, Katherine J; Sivilotti, Marco L A

    2008-04-28

    The osmole gap is used routinely as a screening test for the presence of exogenous osmotically active substances, such as the toxic alcohols ethylene glycol and methanol, particularly when the ability to measure serum concentrations of the substances is not available. The objectives of this study were: 1) to measure the diagnostic accuracy of the osmole gap for screening for ethylene glycol and methanol exposure, and 2) to identify whether a recently proposed modification of the ethanol coefficient affects the diagnostic accuracy. Electronic laboratory records from two tertiary-care hospitals were searched to identify all patients for whom a serum ethylene glycol and methanol measurement was ordered between January 1, 1996 and March 31, 2002. Cases were eligible for analysis if serum sodium, blood urea nitrogen, glucose, ethanol, ethylene glycol, methanol, and osmolality were measured simultaneously. Serum molarity was calculated using the Smithline and Gardner equation and ethanol coefficients of 1 and 1.25 mOsm/mM. The diagnostic accuracy of the osmole gap was evaluated for identifying patients with toxic alcohol levels above the recommended threshold for antidotal therapy and hemodialysis using receiver-operator characteristic curves, likelihood ratios, and positive and negative predictive values. One hundred and thirty-one patients were included in the analysis, 20 of whom had ethylene glycol or methanol serum concentrations above the threshold for antidotal therapy. The use of an ethanol coefficient of 1.25 mOsm/mM yielded higher specificities and positive predictive values, without affecting sensitivity and negative predictive values. Employing an osmole gap threshold of 10 for the identification of patients requiring antidotal therapy resulted in a sensitivity of 0.9 and 0.85, and a specificity of 0.22 and 0. 5, with equations 1 and 2 respectively. The sensitivity increased to 1 for both equations for the identification of patients requiring dialysis. In

  5. Limited evidence that competitive food and beverage practices affect adolescent consumption behaviors.

    Science.gov (United States)

    Vericker, Tracy C

    2013-02-01

    Childhood obesity is emerging as a considerable public health problem with no clear antidote. The school food environment is a potential intervention point for policy makers, with competitive food and beverage regulation as a possible policy lever. This research examines the link between competitive food and beverage availability in school and adolescent consumption patterns using data from the Early Childhood Longitudinal Study, Kindergarten Class of 1998-1999. Results from value-added multivariate regression models reveal limited evidence that competitive food policy affects fruit and vegetable consumption. Findings suggest a stronger link between competitive beverage policy and consumption of sweetened beverages for population subgroups.

  6. Sodium Monofluoroacetate (1080) Hazards to Fish, Wildlife, and Invertebrates: A Synoptic Review

    Science.gov (United States)

    Eisler, R.

    1995-01-01

    Sodium monofluoroacetate (CH2FCOONa), also known as 1080, domestic use is currently restricted to livestock-protection collars on sheep and goats to selectively kill depredating coyotes. The chemical is readily absorbed by ingestion or inhalation. At lethal doses, metabolic conversion of fluoroacetate to fluorocitrate results in the accumulation of citrate in the tissues and death within 24 h from ventricular fibrillation or from respiratory failure; no antidote is available. At sublethal doses, the toxic effects of 1080 are reversible. Primary and secondary poisoning of nontarget vertebrates may accompany the use of 1080. The use of 1980 seems warranted in the absence of suitable alternative control methods.

  7. Interpretation of architectural identity through landmark architecture: The case of Prishtina, Kosovo from the 1970s to the 1980s

    Directory of Open Access Journals (Sweden)

    Teuta Jashari-Kajtazi

    2017-12-01

    The current study aims to consider important thoughts about architectural identity and its categories in general but specific to the context of Kosovo. The history of the region has a critical story of influences toward its formation. Although several philosophies were accepted by the mass, others produced the antidote of the actual input. This study considers the importance of finding the best possible interpretation of Kosovo's architectural identity, such that Kosovo can be well known in the future as it was in the past.

  8. Hair dye poisoning and rhabdomyolysis.

    Science.gov (United States)

    Bokutz, Munira; Nasir, Nosheen; Mahmood, Faisal; Sajid, Sara

    2015-04-01

    Hair dye ingestion is a rare cause of toxicity in Pakistan. We are presenting the case report of a 55 year old male who presented with accidental hair dye ingestion and developed laryngeal oedema requiring emergent tracheostomy. He had also developed aspiration pneumonitis and chemical oesophagitis. However, the most alarming manifestation was rhabdomyolysis. Hair dye toxicity can be fatal if not recognized early. There is no antidote available. Rhabdomyolysis is a complication and needs to be managed aggressively in order to prevent long term morbidity.

  9. The Beef Jerky Blues: Methemoglobinemia From Home Cured Meat.

    Science.gov (United States)

    Theobald, Jillian L; Spoelhof, Rachel; Pallasch, Erin M; Mycyk, Mark B

    2016-09-30

    Methemoglobinemia can result from ingestion of nitrite- or nitrate-containing foods. Here, we report a case where an adolescent girl and her father developed clinically significant methemoglobinemia after ingestion of "homemade" beef jerky prepared with sodium nitrate salt purchased at a local grocery store. Both had palpitations, dyspnea, and visible mucosal cyanosis. The daughter had a methemoglobin level of 44.2% and the father's methemoglobin level was 34.2%. Prompt recognition of methemoglobinemia is important for initiating antidotal therapy with methylene blue.

  10. Overexpression of Human Selenoprotein H in Neuronal Cells Ameliorates Ultraviolet Irradiation Induced Damage by Modulating Cell Signaling Pathways

    OpenAIRE

    Mendelev, Natalia; Witherspoon, Sam; Li, P. Andy

    2009-01-01

    Selenoprotein H (SelH) is one of the 25 so far identified selenoproteins. Selenoproteins may function as antioxidants, heavy metal antidotes, and neural survival factors. Previous studies have shown that overexpression of SelH in HT22 cells protected the cells from UVB irradiation-induced death by reducing superoxide formation. The objective of this study was to determine the effects of SelH on cell signaling pathways after UVB irradiation. We exposed both human SelH- and vector-transfected H...

  11. Magnetic-field asymmetry of nonlinear thermoelectric and heat transport

    International Nuclear Information System (INIS)

    Hwang, Sun-Yong; Sánchez, David; López, Rosa; Lee, Minchul

    2013-01-01

    Nonlinear transport coefficients do not obey, in general, reciprocity relations. We here discuss the magnetic-field asymmetries that arise in thermoelectric and heat transport of mesoscopic systems. Based on a scattering theory of weakly nonlinear transport, we analyze the leading-order symmetry parameters in terms of the screening potential response to either voltage or temperature shifts. We apply our general results to a quantum Hall antidot system. Interestingly, we find that certain symmetry parameters show a dependence on the measurement configuration. (paper)

  12. GUIDELINES FOR PARACETAMOL POISONING TREATMENT

    Directory of Open Access Journals (Sweden)

    Lucija Sarc

    2014-04-01

    Full Text Available Paracetamol overdose results in an accumulation of the reactive, hepatotoxic metabolite N-acetyl-p-benzoquinoneimin (NAPKQI which can cause serious liver injury. Recognition of paracetamol overdose, hepatotoxicity risk estimation and early treatment are crutial in paracetamol poisoniong management. In ingestion of potential hepatotoxic dose of paracetamol decontamination and early treatment with N-acetylcysteine (NAC are indicated. Both, 20-hours intravenous and 72-hurs oral regimes of NAC administration are successful. By antidote regime selection we should consider patient condition and time after paracetamol overdose. In severe hepatotoxicity, criteria for liver transplantation should be regularly evaluated and mechanisms for liver transplantation must be activated in time. 

  13. Biological and Pathological Studies of Rosmarinic Acid as an Inhibitor of Hemorrhagic Trimeresurus flavoviridis (habu Venom

    Directory of Open Access Journals (Sweden)

    Masatake Niwa

    2010-10-01

    Full Text Available In our previous report, rosmarinic acid (RA was revealed to be an antidote active compound in Argusia argentea (family: Boraginaceae. The plant is locally used in Okinawa in Japan as an antidote for poisoning from snake venom, Trimeresurus flavoviridis (habu. This article presents mechanistic evidence of RA’s neutralization of the hemorrhagic effects of snake venom. Anti-hemorrhagic activity was assayed by using several kinds of snake venom. Inhibition against fibrinogen hydrolytic and collagen hydrolytic activities of T. flavoviridis venom were examined by SDS-PAGE. A histopathological study was done by microscopy after administration of venom in the presence or absence of RA. RA was found to markedly neutralize venom-induced hemorrhage, fibrinogenolysis, cytotoxicity and digestion of type IV collagen activity. Moreover, RA inhibited both hemorrhage and neutrophil infiltrations caused by T. flavoviridis venom in pathology sections. These results demonstrate that RA inhibited most of the hemorrhage effects of venom. These findings indicate that rosmarinic acid can be expected to provide therapeutic benefits in neutralization of snake venom accompanied by heat stability.

  14. [Medical management in the chemical terrorism scene].

    Science.gov (United States)

    Krivoy, Amir; Rotman, Eran; Layish, Ido; Goldberg, Avi; Horvitz, Ariel; Yehezkelli, Yoav

    2005-04-01

    The Tokyo subway sarin attack in March 1995 demonstrated the importance of preparedness toward a chemical terrorist attack. Emergency medical teams on the scene are valuable, beside the medical treatment of casualties, in the cognition of toxicant involvement and later in the recognition of the specific toxidrome involved. The chemical terrorism scene is a contaminated area; therefore, first responders have to be protected from both percutaneous and inhalational exposure to toxic materials. This protection is also against secondary evaporation (gas-off) from contaminated casualty, hence the importance of disrobing casualties on the scene as soon as possible. Once the recognition of toxicological involvement have been made, the next crucial decision is whether the clinical toxidrome is of cholinergic toxicity (e.g. organophosphate or carbamate intoxication) in which there are automatic injectors for treatment available on the scene, or any other toxidrome (such as irritation or vesicants) in which, beside general measures, like oxygen delivery and airway support, there is not a specific antidotal treatment on the scene. The clinical detection and identification of the chemical toxidrome involved is of utmost importance since it promotes the antidotal treatment quickly and efficiently. The key to the medical management of such events is based on decisions that have to be taken as soon as possible according to the clinical judgment of medical teams on the scene.

  15. Ashwagandha (Withania somnifera supercritical CO2 extract derived withanolides mitigates Bisphenol A induced mitochondrial toxicity in HepG2 cells

    Directory of Open Access Journals (Sweden)

    Satyakumar Vidyashankar

    2014-01-01

    Full Text Available Bisphenol A (BPA safety aspects on human health are debated extensively for long time. In the present study, we have studied the toxicity induced by BPA at no observed adverse effect level (NOAEL using HepG2 cells. We report that BPA at 100 nM induced cytotoxicity to HepG2 cells as determined by MTT assay at 0–72 h. The toxicity was result of reduced oxygen consumption and reduced mitochondrial membrane potential associated with decreased ATP production. The BPA treatment resulted in increase of malondialdehyde (MDA content with decreased glutathione and other antioxidant enzymes. BPA derived toxicity is a concern to human health and alternative non-toxic natural products/derivatives or adjuvants that serve as antidote will be relevant. In this context, Ashwagandha (Withania somnifera a widely used herb to treat arthritis, rheumatism and to improve longevity for time immemorial is investigated for its antidote effect. Ashwagandha supercritical CO2 extract derived Withanolides (ADW at 100 μg/ml protect HepG2 cells from BPA induced toxicity by suppressing mitochondrial damage and increased ATP production. Further, cellular MDA content was significantly suppressed with increased non-enzymic and antioxidant enzyme activities. These findings derived from the present study suggest the beneficial effect of ADW in mitigating BPA induced mitochondrial toxicity in HepG2 cells.

  16. New Direct Oral Anticoagulants (DOAC and Their Use Today

    Directory of Open Access Journals (Sweden)

    Heike Schwarb

    2016-03-01

    Full Text Available The ideal anticoagulant is oral, has a wide therapeutic range, predictable pharmacokinetics and pharmacodynamics, a rapid onset of action, an available antidote, minimal side effects and minimal interactions with other drugs or food. With the development of the novel direct oral anticoagulants (DOAC, we now have an alternative to the traditional vitamin K antagonists (VKA for the prevention and treatment of thrombosis. DOACs have limited monitoring requirements and very predictable pharmacokinetic profiles. They were shown to be non-inferior or superior to VKA in the prophylaxis or treatment of thromboembolic events. Particularly in terms of safety they were associated with less major bleeding, including intracranial bleeding, thus providing a superior benefit for the prevention of stroke in patients with atrial fibrillation. Despite these advantages, there are remaining limitations with DOACs: their dependence on renal and hepatic function for clearance and the lack of an approved reversal agent, whereas such antidotes are successively being made available. DOACs do not need regular monitoring to assess the treatment effect but, on the other hand, they interact with other drugs and interfere with functional coagulation assays. From a practical point of view, the properties of oral administration, simple dosing without monitoring, a short half-life allowing for the possibility of uncomplicated switching or bridging, and proven safety overwhelm the disadvantages, making them an attractive option for short- or long-term anticoagulation.

  17. Paraquat intoxication and associated pathological findings in three dogs in South Africa

    Directory of Open Access Journals (Sweden)

    June H. Williams

    2016-11-01

    Full Text Available Paraquat is a bipyridylium non-selective contact herbicide commonly used worldwide. When ingestion occurs by humans and animals either accidentally, intentionally or maliciously, paraquat selectively accumulates in the lungs resulting in the production of oxygen-free radicals, causing membrane damage and cell death. Intoxicated subjects typically show progressive and fatal pulmonary haemorrhage, collapse and oedema. In individuals surviving the acute phase, pulmonary fibrosis develops. Gastrointestinal-, renal- and central nervous system clinical signs may also occur. Owing to the lack of effective treatment and absence of an antidote, the prognosis is poor. The clinical presentation, clinicopathological findings and treatment are briefly described of three dogs from one South African household, intoxicated with paraquat. Macroscopic and microscopic lesions in one dog that was necropsied, as well as pulmonary ultrastructure are detailed and illustrated for academic reference. All dogs presented with tachypnoea and dyspnoea 2–3 days after accidental paraquat ingestion. Treatment was aimed at reducing gastrointestinal absorption, enhancing elimination by diuresis and avoiding further oxidative damage by administration of antioxidants. All dogs, however, became progressively hypoxic despite treatment and were euthanised. Paraquat toxicity should be a differential diagnosis in dogs with unexplained progressive respiratory and gastrointestinal signs and renal failure. The local veterinary profession should be aware of accidental or intentional paraquat toxicity of animals. Existing literature, variations possible in canine clinical signs, measured parameters, lesions, as well as possible treatments, promising experimental antidotes and management options are discussed.

  18. Intravenous lipid emulsion in the resuscitation of cocaine-induced cardiovascular arrest in a rat model.

    Science.gov (United States)

    Chai, Peter R; Hack, Jason B

    2016-08-01

    Intravenous lipid emulsion (ILE) is a potential antidote for severe overdose of certain lipophilic drugs. Cocaine overdose is often fatal and has no antidote. The use of ILE after cocaine-induced cardiac arrest has been suggested but is not well characterized. The objective of the study is to determine if ILE would reverse cocaine-induced cardiac arrest in a rat model. Twelve Sprague-Dawley rats with intra-arterial and intravenous access were sedated with isoflurane and split into 2 cocaine dose groups, then given either ILE or normal saline (NS) intravenously (IV)-group A, 7 animals received cocaine (10 mg/kg IV) with 6 of 7 given ILE (15 mg/kg IV) and 1 of 7 given NS (equal volume); group B, 5 animals received cocaine (5 mg/kg IV) with 3 of 5 given ILE (15 mg/kg IV) and 2 of 5 given NS (equal volume). Closed chest compressions were initiated for asystole and continued for 15 minutes with rhythm checks every minute. All 12 rats experienced cardiac arrest after cocaine bolus. Resuscitation was successful in 1 of 7 rats in group A and 0 of 5 in group B. Intravenous lipid emulsion administration did not affect outcome of cocaine-induced cardiac arrest compared with control in this model. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Mustard Group Chemical War Agents from Preventive Medicine Perspective

    Directory of Open Access Journals (Sweden)

    Muharrem Ucar

    2007-06-01

    Full Text Available Although many preventive efforts and treaties, chemical warfare agents have still been a severe assault form against both military and civilian individuals. The most important chemical warfare agents sulphur mustard and others are easy to handle and cheap those the important reasons to accept sulphur mustard as a chemical warfare agent. Many individuals attacked by sulphur mustard have severe health problems such as respiratory system diseases. After ten years of sulphur mustard exposure, several health problems such as respiratory tract problems (%42.5, eye problems (%40 and other systemic diseases have been observed to insist on induviduals when examined. Exposure of even single sulphur mustard exposure has been seen to result high level of disability and early deaths. In spite of the fact that there is no available antidote and/or remedy against sulphur mustard exposure, our country has an incremental chemical assault threat for both military personels and civilians because of its jeopolitics position. Experimental studies regarding sulphur mustard toxicity will be helpful for novel preventive strategies and antidot devolepment. [TAF Prev Med Bull 2007; 6(3.000: 209-214

  20. Insulin versus Lipid Emulsion in a Rabbit Model of Severe Propranolol Toxicity: A Pilot Study

    Directory of Open Access Journals (Sweden)

    Martyn Harvey

    2011-01-01

    Full Text Available Background and objective. Beta-blocker overdose may result in intractable cardiovascular collapse despite conventional antidotal treatments. High dose insulin/glucose (ING, and more recently intravenous lipid emulsion (ILE, have been proposed as potentially beneficial therapies in beta blocker intoxication. We compare efficacy of the novel antidotes ING, with ILE, in a rabbit model of combined enteric/intravenous propranolol toxicity. Methods. Sedated, mechanically ventilated and invasively monitored New Zealand White rabbits underwent mini-laparotomy and enterostomy formation with 40 mg/kg propranolol instilled into the proximal small bowel. At 30 minutes propranolol infusion was commenced at 4 mg/kg/hr and continued to a target mean arterial pressure (MAP of 50% baseline MAP. Animals were resuscitated with insulin at 3 U/kg plus 0.5 g/kg glucose (ING group, or 10 mL/kg 20% Intralipid (ILE group. Results. Rate pressure product (RPP; RPP = heart rate × mean arterial pressure was greatest in the ING group at 60 minutes (P<.05. A trend toward greater heart rate was observed in the ING group (P=.06. No difference was observed in survival between groups (4/5 ING versus 2/5 ILE; P=.524. Conclusions. High dose insulin resulted in greater rate pressure product compared with lipid emulsion in this rabbit model of severe enteric/intravenous propranolol toxicity.

  1. Mutagenicity and antimutagenicity studies of DRDE-07 and its analogs against sulfur mustard in the in vitro Ames Salmonella/microsome assay.

    Science.gov (United States)

    Vijayan, Vinod; Pathak, Uma; Meshram, Ghansham Pundilikji

    2014-10-01

    Sulfur mustard (bis(2-chloroethyl) sulfide, SM), a chemical warfare agent, is classified as a class I human carcinogen by IARC. No effective antidote against this agent is available. The synthetic aminothiol, amifostine, earlier known as WR-2721, has been extensively used as a chemical radioprotector for normal tissues in cancer radiotherapy and chemotherapy. SM is a radiomimetic agent; this prompted us to evaluate the protective efficacy of amifostine and three of its analogs, DRDE-07 [S-2(2-aminoethylamino) ethyl phenyl sulphide], DRDE-30 [S-2(2-aminoethyl amino) ethyl propyl sulphide] and DRDE-35 [S-2(2-aminoethyl amino) ethyl butyl sulphide], against sulfur mustard-induced mutagenicity in the Ames Salmonella/microsome assay. The antidotes were also evaluated for possible mutagenic activity. DRDE-07 was mutagenic in strain TA104 in the absence of S9; DRDE-30 was mutagenic in strain TA100; amifostine and DRDE-35 did not show mutagenic activity in any of the five tester strains used. SM is mutagenic in strains TA97a and TA102, with or without S9 activation. In the antimutagenicity studies, DRDE-07 and DRDE-35 showed promising antimutagenic activity against SM in the absence of S9, in comparison to amifostine. DRDE-07 and DRDE-35 are promising protective agents against SM-induced mutagenicity. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. Optimal Choice of Acetylcholinesterase Reactivators for Antidoral Treatment of Nerve Agent Intoxication

    Directory of Open Access Journals (Sweden)

    Jiří Bajgar

    2010-01-01

    Full Text Available The studies dealing with mechanism of organophosphates (OP/nerve agent action, prophylaxis and treatment of intoxications is a very hot topic at present. Though the research is very intensive, unfortunately, up to now, there is not universal or significantly better reactivator sufficiently effective against all nerve agents/OP when compared with presently available oximes (pralidoxime, methoxime, obidoxime, trimedoxime, HI-6. The use of the most effective reactivator (HI-6 using simple type of autoinjector (e.g. ComboPen is strictly limited because of decomposition of HI-6 in solution. Thanks to better solubility it is clear that another salt of HI-6 (dimethanesulfonate, HI-6 DMS is more convenient for the use as antidote against nerve agents in the autoinjector than HI-6 chloride (Cl. It was clearly demonstrated that reactivation potency of HI-6 DMS in comparison with HI-6 Cl in vivo was the same and bioavailability of HI-6 DMS is better than that of HI-6 Cl. Three chambered autoinjector allows administration of all three antidotes (atropine, reactivator, diazepam simultaneously. Moreover, the content of chambers can be changed according to proposed requirements. Possible way to solve the problem of universal reactivator could be the use of two reactivators. Three chambered autoinjector is an ideal device for this purpose.

  3. Glyphosate ingestion causing multiple organ failure: a near-fatal case report.

    Science.gov (United States)

    Picetti, Edoardo; Generali, Michela; Mensi, Francesca; Neri, Giampaolo; Damia, Roberta; Lippi, Giuseppe; Cervellin, Gianfranco

    2018-01-16

    A 55 years old man self-presented to our Emergency Department (ED) reporting an attempted suicide by cutting the left forearm veins and ingesting approximately 200 mL of an herbicide (Myrtos®, containing 36% of glyphosate as isopropylamine salt). Laboratory tests showed metabolic acidosis. Hydration with normal saline and alkalinization with sodium bicarbonate was started according to suggestion of the poison control center, since an antidote was unavailable. Cardiorespiratory condition gradually worsened, so that non-invasive positive pressure ventilation (NIPPV) was applied and infusion of fluids was established. Nevertheless, the patient deteriorated and he needed to be transferred to the Intensive Care Unit (ICU), where he underwent orotracheal intubation and invasive mechanical ventilation. Noradrenaline and adrenaline were infused and fluid resuscitation with crystalloids was incremented. An esophagogastroduodenoscopy (EGD) showed diffuse mucosal erosions of upper digestive tract. No signs of visceral perforation were found during ICU stay. In the following days, the clinical conditions improved and a new EGD showed marked improvement of erosive lesions. After 12 days of ICU stay, the patient was extubated and then transferred to the Psychiatric Unit, in good clinical conditions. Gliphosate ingestion is associated with rapid development of multiple organ failure (MOF). Since an effective antidote is unavailable, major attention should be placed to aggressive life-support care and careful monitoring of complications.

  4. Unravelling the tunable exchange bias-like effect in magnetostatically-coupled two dimensional hybrid (hard/soft) composites

    International Nuclear Information System (INIS)

    Hierro-Rodriguez, A; Teixeira, J M; Rodriguez-Rodriguez, G; Rubio, H; Vélez, M; Álvarez-Prado, L M; Martín, J I; Alameda, J M

    2015-01-01

    Hybrid 2D hard-soft composites have been fabricated by combining soft (Co 73 Si 27 ) and hard (NdCo 5 ) magnetic materials with in-plane and out-of-plane magnetic anisotropies, respectively. They have been microstructured in a square lattice of CoSi anti-dots with NdCo dots within the holes. The magnetic properties of the dots allow us to introduce a magnetostatic stray field that can be controlled in direction and sense by their last saturating magnetic field. The magnetostatic interactions between dot and anti-dot layers induce a completely tunable exchange bias-like shift in the system’s hysteresis loops. Two different regimes for this shift are present depending on the lattice parameter of the microstructures. For large parameters, dipolar magnetostatic decay is observed, while for the smaller one, the interaction between the adjacent anti-dot’s characteristic closure domain structures enhances the exchange bias-like effect as clarified by micromagnetic simulations. (paper)

  5. Clinical and Pathological Findings Associated with Aerosol Exposure of Macaques to Ricin Toxin

    Directory of Open Access Journals (Sweden)

    Seth H. Pincus

    2015-06-01

    Full Text Available Ricin is a potential bioweapon that could be used against civilian and military personnel. Aerosol exposure is the most likely route of contact to ricin toxin that will result in the most severe toxicity. Early recognition of ricin exposure is essential if specific antidotes are to be applied. Initial diagnosis will most likely be syndromic, i.e., fitting clinical and laboratory signs into a pattern which then will guide the choice of more specific diagnostic assays and therapeutic interventions. We have studied the pathology of ricin toxin in rhesus macaques exposed to lethal and sublethal ricin aerosols. Animals exposed to lethal ricin aerosols were followed clinically using telemetry, by clinical laboratory analyses and by post-mortem examination. Animals exposed to lethal aerosolized ricin developed fever associated with thermal instability, tachycardia, and dyspnea. In the peripheral blood a marked neutrophilia (without immature bands developed at 24 h. This was accompanied by an increase in monocytes, but depletion of lymphocytes. Red cell indices indicated hemoconcentration, as did serum chemistries, with modest increases in sodium and blood urea nitrogen (BUN. Serum albumin was strikingly decreased. These observations are consistent with the pathological observations of fluid shifts to the lungs, in the form of hemorrhages, inflammatory exudates, and tissue edema. In macaques exposed to sublethal aerosols of ricin, late pathologic consequences included chronic pulmonary fibrosis, likely mediated by M2 macrophages. Early administration of supportive therapy, specific antidotes after exposure or vaccines prior to exposure have the potential to favorably alter this outcome.

  6. Quantitative Assessment of the Influence of Rhizoma Zingiberis on the Level of Aconitine in Rat Gut Sacs and Qualitative Analysis of the Major Influencing Components of Rhizoma Zingiberis on Aconitine Using UPLC/MS.

    Directory of Open Access Journals (Sweden)

    Yang Xin

    Full Text Available This study attempted to clarify the material basis for the detoxification of Rhizoma Zingiberis (RZ on aconitine, an analgesic drug, by quantitatively assessing the influence of RZ on the in vitro intestinal concentration of aconitine using an everted gut sac model and by qualitatively identifying the components in the RZ extract. To quantify aconitine in rat everted gut sacs, both an accurate processing method and a sensitive detection method were required. We developed a three-step sample processing method to protect the components from decomposition and applied ultra-performance liquid chromatography coupled with triple quadrupole mass spectrometry (UPLC/TQMS to quantify aconitine, glucose and digoxin. In addition, ultra-performance liquid chromatography coupled with linear ion trap mass spectrometry (UPLC/ITMS was applied to detect the potential antidotal components in the RZ extract. Finally, the RZ extract reduced the level of aconitine in everted gut sacs, and eleven gingerols were successfully identified, which could be considered potential antidotal components for aconitine. This study demonstrated the application of two UPLC/MS methods for analyzing the material basis for the reciprocity between Chinese medicine components in everted gut sacs.

  7. Acetaminophen overdose associated with double serum concentration peaks

    Directory of Open Access Journals (Sweden)

    Cristian Papazoglu

    2015-12-01

    Full Text Available Acetaminophen is the most commonly used analgesic–antipyretic medication in the United States. Acetaminophen overdose, a frequent cause of drug toxicity, has been recognized as the leading cause of fatal and non-fatal hepatic necrosis. N-Acetylcysteine is the recommended antidote for acetaminophen poisoning. Despite evidence on the efficacy of N-acetylcysteine for prevention of hepatic injury, controversy persists about the optimal duration of the therapy. Here, we describe the case of a 65-year-old male with acetaminophen overdose and opioid co-ingestion who developed a second peak in acetaminophen serum levels after completing the recommended 21-hour intravenous N-acetylcysteine protocol and when the standard criteria for monitoring drug levels was achieved. Prolongation of N-acetylcysteine infusion beyond the standard protocol, despite a significant gap in treatment, was critical for successful avoidance of hepatotoxicity. Delay in acetaminophen absorption may be associated with a second peak in serum concentration following an initial declining trend, especially in cases of concomitant ingestion of opioids. In patients with acetaminophen toxicity who co-ingest other medications that may potentially delay gastric emptying or in those with risk factors for delayed absorption of acetaminophen, we recommend close monitoring of aminotransferase enzyme levels, as well as trending acetaminophen concentrations until undetectable before discontinuing the antidote therapy.

  8. A Rare but Potentially Fatal Poisoning; Aluminum Phosphide Poisoning

    Directory of Open Access Journals (Sweden)

    Orkun Tolunay

    2017-04-01

    Full Text Available Phosphide, a very toxic gas, is used in our country as aluminium phosphide tablets impregnated in clay. It is widely used since it has a very high diffusion capacity, whereby it can eradicate all living creatures in any form of their life cycle and does not leave any remnants in agricultural products. Aluminum phosphide poisoning is among intoxications for which there are still no true antidotes. Mortality rate varies between 30% and 100%. This paper presents a case of aluminum phosphide poisoning caused by the uncompleted suicide attempt. A 14-year-old girl, who swallowed aluminum phosphate tablets, was brought to the emergency department with the complaints of nausea and vomiting. The patient was treated with gastric lavage and activated charcoal. Since the patient ingested a lethal amount of aluminum phosphide, she was referred to the pediatric intensive care unit. The patient was discharged in stable condition after supportive care and monitoring. Specific antidotes are life-saving in poisonings. However, this case was presented to show how general treatment principles and quick access to health services affect the result of treatment. Also, we aimed to highlight the uncontrolled selling of aluminum phosphate, which results in high mortality rates in case of poisoning.

  9. Magnetic moment jumps in flat and nanopatterned Nb thin-walled cylinders

    Energy Technology Data Exchange (ETDEWEB)

    Tsindlekht, M.I., E-mail: mtsindl@vms.huji.ac.il [The Racah Institute of Physics, The Hebrew University of Jerusalem, 91904 Jerusalem (Israel); Genkin, V.M.; Felner, I.; Zeides, F.; Katz, N. [The Racah Institute of Physics, The Hebrew University of Jerusalem, 91904 Jerusalem (Israel); Gazi, Š.; Chromik, Š. [The Institute of Electrical Engineering SAS, Dúbravská cesta 9, 84104 Bratislava (Slovakia); Dobrovolskiy, O.V. [Physikalisches Institut, Goethe University, 60438 Frankfurt am Main (Germany); Physics Department, V. Karazin Kharkiv National University, 61077 Kharkiv (Ukraine); Sachser, R.; Huth, M. [Physikalisches Institut, Goethe University, 60438 Frankfurt am Main (Germany)

    2017-02-15

    Highlights: • Magnetization curves of as-prepared and patterned thin-walled cylinders were measured in magnetic fields applied parallel to cylinders axis. • Magnetic moment jumps were observed in magnetic fields lower and above Hc1. • Critical current density in isthmus between two antidots is higher than in a film itself. - Abstract: Penetration of magnetic flux into hollow superconducting cylinders is investigated by magnetic moment measurements. The magnetization curves of a flat and a nanopatterned thin-walled superconducting Nb cylinders with a rectangular cross section are reported for the axial field geometry. In the nanopatterned sample, a row of micron-sized antidots (holes) was milled in the film along the cylinder axis. Magnetic moment jumps are observed for both samples at low temperatures for magnetic fields not only above H{sub c1}, but also in fields lower than H{sub c1}, i. e., in the vortex-free regime. The positions of the jumps are not reproducible and they change from one experiment to another, resembling vortex lattice instabilities usually observed for magnetic fields larger than H{sub c1}. At temperatures above 0.66T{sub c} and 0.78T{sub c} the magnetization curves become smooth for the patterned and the as-prepared sample, respectively. The magnetization curve of a reference flat Nb film in the parallel field geometry does not exhibit jumps in the entire range of accessible temperatures.

  10. Management of Cyanide Intoxication with Extracorporeal Membrane Oxygenation and Continuous Renal Replacement Therapy

    Directory of Open Access Journals (Sweden)

    Jin Park

    2015-08-01

    Full Text Available Cyanide intoxication results in severe metabolic acidosis and catastrophic prognosis with conventional treatment. Indications of extracorporeal membrane oxygenation (ECMO and continuous renal replacement therapy (CRRT are expanding to poisoning cases. A 50-year-old male patient arrived in the emergency room due to mental change after ingestion of cyanide as a suicide attempt 30 minutes prior. He was comatose, and brain stem reflexes were absent. Initial laboratory analysis demonstrated severe metabolic acidosis with increased lactic acid of 25 mM/L. Shock and acidosis were not corrected despite a large amount of fluid resuscitation with high-dose norepinephrine and continuous renal replacement therapy. We decided to apply ECMO and CRRT to allow time for stabilization of hemodynamic status. After administration of antidote infusion, although the patient had the potential to progress to brain death status, vital signs were improved with correction of acidosis. We considered the evaluation for organ donation. We report a male patient who showed typical cyanide intoxication as lethal metabolic acidosis and cardiac impairment, and the patient recovered after antidote administration during vital organ support through ECMO and CRRT.

  11. Cyanide poisoning caused by ingestion of apricot seeds.

    Science.gov (United States)

    Akyildiz, B N; Kurtoğlu, S; Kondolot, M; Tunç, A

    2010-01-01

    To report diagnostic, clinical and therapeutic aspects of cyanide intoxication resulting from ingestion of cyanogenic glucoside-containing apricot seeds. Thirteen patients admitted to the Pediatric Intensive Care Unit (PICU) of Erciyes University between 2005 and 2009 with cyanide intoxication associated with ingestion of apricot seeds were reviewed retrospectively. Of the 13 patients, four were male. The mean time of onset of symptoms was 60 minutes (range 20 minutes to 3 hours). On admission, all patients underwent gastric lavage and received activated charcoal. In addition to signs of mild poisoning related to cyanide intoxication, there was severe intoxication requiring mechanical ventilation (in four cases), hypotension (in two), coma (in two) and convulsions (in one). Metabolic acidosis (lactic acidosis) was detected in nine patients and these were treated with sodium bicarbonate. Hyperglycaemia occurred in nine patients and blood glucose levels normalised spontaneously in six but three required insulin therapy for 3-6 hours. Six patients received antidote treatment: high-dose hydroxocobalamin in four and two were treated with a cyanide antidote kit in addition to high-dose hydroxocobalamin. One patient required anticonvulsive therapy. All patients recovered and were discharged from the PICU within a mean (SD, range) 3.1 (1.7, 2-6) days. Cyanide poisoning associated with ingestion of apricot seeds is an important poison in children, many of whom require intensive care.

  12. Sodium Nitrite and Sodium Thiosulfate Are Effective Against Acute Cyanide Poisoning When Administered by Intramuscular Injection.

    Science.gov (United States)

    Bebarta, Vikhyat S; Brittain, Matthew; Chan, Adriano; Garrett, Norma; Yoon, David; Burney, Tanya; Mukai, David; Babin, Michael; Pilz, Renate B; Mahon, Sari B; Brenner, Matthew; Boss, Gerry R

    2017-06-01

    The 2 antidotes for acute cyanide poisoning in the United States must be administered by intravenous injection. In the out-of-hospital setting, intravenous injection is not practical, particularly for mass casualties, and intramuscular injection would be preferred. The purpose of this study is to determine whether sodium nitrite and sodium thiosulfate are effective cyanide antidotes when administered by intramuscular injection. We used a randomized, nonblinded, parallel-group study design in 3 mammalian models: cyanide gas inhalation in mice, with treatment postexposure; intravenous sodium cyanide infusion in rabbits, with severe hypotension as the trigger for treatment; and intravenous potassium cyanide infusion in pigs, with apnea as the trigger for treatment. The drugs were administered by intramuscular injection, and all 3 models were lethal in the absence of therapy. We found that sodium nitrite and sodium thiosulfate individually rescued 100% of the mice, and that the combination of the 2 drugs rescued 73% of the rabbits and 80% of the pigs. In all 3 species, survival in treated animals was significantly better than in control animals (log rank test, Pcyanide poisoning in 3 clinically relevant animal models of out-of-hospital emergency care. Copyright © 2016 American College of Emergency Physicians. Published by Elsevier Inc. All rights reserved.

  13. Acute cyanide poisoning among jewelry and textile industry workers.

    Science.gov (United States)

    Coentrão, Luís; Moura, Daniel

    2011-01-01

    Limited work has focused on occupational exposures that may increase the risk of cyanide poisoning by ingestion. A retrospective chart review of all admissions for acute cyanide poisoning by ingestion for the years 1988 to 2008 was conducted in a tertiary university hospital serving the largest population in the country working in jewelry and textile facilities. Of the 9 patients admitted to the hospital during the study period, 8 (7 males, 1 female; age 36 ± 11 years, mean ± SD) attempted suicide by ingestion of potassium cyanide used in their profession as goldsmiths or textile industry workers. Five patients had severe neurologic impairment and severe metabolic acidosis (pH 7.02 ± 0.08, mean ± SD) with high anion gap (23 ± 4 mmol/L, mean ± SD). Of the 5 severely intoxicated patients, 3 received antidote therapy (sodium thiosulfate or hydroxocobalamin) and resumed full consciousness in less than 8 hours. All patients survived without major sequelae. Cyanide intoxication by ingestion in our patients was mainly suicidal and occurred in specific jobs where potassium cyanide is used. Metabolic acidosis with high anion is a good surrogated marker of severe cyanide poisoning. Sodium thiosulfate and hydroxocobalamin are both safe and effective antidotes. Copyright © 2011 Elsevier Inc. All rights reserved.

  14. Poisoning and suicide by cyanide jewelry cleaner in the US Hmong community: a case series.

    Science.gov (United States)

    Garlich, Fiona M; Alsop, Judith Ann; Anderson, Deborah L; Geller, Richard J; Kalugdan, Theresa Thao; Roberts, David J; Thomas, Lindsey C

    2012-02-01

    Over 200 000 persons of Hmong ethnicity live in the United States. The majority of this Southeast Asian ethnic group live in California, Minnesota and Wisconsin. Tradition plays a strong role in the Hmong population, and difficulty in assimilation into "Western ways" has been reported to result in depression and suicide attempts. Some products sold at Southeast Asian ethnic markets are well-known within the Hmong community to be lethal but are essentially unknown to the outside community. We describe eight cases in which cyanide-containing products were ingested by Hmong patients. Seven cases were suicide attempts involving the ingestion of a locally-purchased substance intended for cleaning metal, coins, or jewelry. One case involved the fatal ingestion of a cyanide-containing "herbal" cure. In the majority of the cases, cyanide was not initially suspected, and treatment was delayed due to lack of information regarding the product ingested. In the two patients who survived, the cyanide antidote kit (sodium nitrite, amyl nitrite, and sodium thiosulfate) was administered early. Clinicians should be aware that unusual and potentially lethal products are easily available at ethnic markets. Cyanide toxicity should be suspected, and empiric antidote therapy initiated early, in patients of Hmong or Southeast Asian descent who present with sudden and unexplained cardiovascular collapse and metabolic acidosis, especially in the setting of a suspected suicidal ingestion.

  15. Cyanide poisoning and cardiac disorders: 161 cases.

    Science.gov (United States)

    Fortin, Jean-Luc; Desmettre, Thibault; Manzon, Cyril; Judic-Peureux, Virginie; Peugeot-Mortier, Caroline; Giocanti, Jean-Pascal; Hachelaf, Mohamed; Grangeon, Marie; Hostalek, Ulrike; Crouzet, Julien; Capellier, Gilles

    2010-05-01

    Inhalation of hydrogen cyanide from smoke in structural fires is common, but cardiovascular function in these patients is poorly documented. The objective was to study the cardiac complications of cyanide poisoning in patients who received early administration of a cyanide antidote, hydroxocobalamin (Cyanokit; Merck KGaA, Darmstadt, Germany [in the United States, marketed by Meridian Medical Technologies, Bristol, TN]). The medical records of 161 fire survivors with suspected or confirmed cyanide poisoning were reviewed in an open, multicenter, retrospective review of cases from the Emergency Medical Assistance Unit (Service d'Aide Médical d'Urgence) in France. Cardiac arrest (61/161, 58 asystole, 3 ventricular fibrillation), cardiac rhythm disorders (57/161, 56 supraventricular tachycardia), repolarization disorders (12/161), and intracardiac conduction disorders (5/161) were observed. Of the total 161 patients studied, 26 displayed no cardiac disorder. All patients were given an initial dose of 5 g of hydroxocobalamin. Non-responders received a second dose of 5 g of hydroxocobalamin. Of the patients initially in cardiac arrest, 30 died at the scene, 24 died in hospital, and 5 survived without cardiovascular sequelae. Cardiac disorders improved with increasing doses of hydroxocobalamin, and higher doses of the antidote seem to be associated with a superior outcome in patients with initial cardiac arrest. Cardiac complications are common in cyanide poisoning in fire survivors. Copyright (c) 2010 Elsevier Inc. All rights reserved.

  16. Paraquat intoxication and associated pathological findings in three dogs in South Africa.

    Science.gov (United States)

    Williams, June H; Whitehead, Zandri; Van Wilpe, Erna

    2016-11-09

    Paraquat is a bipyridylium non-selective contact herbicide commonly used worldwide. When ingestion occurs by humans and animals either accidentally, intentionally or maliciously, paraquat selectively accumulates in the lungs resulting in the production of oxygen-free radicals, causing membrane damage and cell death. Intoxicated subjects typically show progressive and fatal pulmonary haemorrhage, collapse and oedema. In individuals surviving the acute phase, pulmonary fibrosis develops. Gastrointestinal-, renal- and central nervous system clinical signs may also occur. Owing to the lack of effective treatment and absence of an antidote, the prognosis is poor. The clinical presentation, clinicopathological findings and treatment are briefly described of three dogs from one South African household, intoxicated with paraquat. Macroscopic and microscopic lesions in one dog that was necropsied, as well as pulmonary ultrastructure are detailed and illustrated for academic reference. All dogs presented with tachypnoea and dyspnoea 2-3 days after accidental paraquat ingestion. Treatment was aimed at reducing gastrointestinal absorption, enhancing elimination by diuresis and avoiding further oxidative damage by administration of antioxidants. All dogs, however, became progressively hypoxic despite treatment and were euthanised. Paraquat toxicity should be a differential diagnosis in dogs with unexplained progressive respiratory and gastrointestinal signs and renal failure. The local veterinary profession should be aware of accidental or intentional paraquat toxicity of animals. Existing literature, variations possible in canine clinical signs, measured parameters, lesions, as well as possible treatments, promising experimental antidotes and management options are discussed.

  17. Saudi medicinal plants for the treatment of scorpion sting envenomation

    Directory of Open Access Journals (Sweden)

    Abdulrahman Al-Asmari

    2017-09-01

    Full Text Available Scorpion sting envenoming poses major public health problems. The treatment modalities include antivenoms, chemical antidotes and phytotherapy, with varying degrees of effectiveness and side effects. In this investigation, we reviewed the use of Saudi medicinal plants for the treatment of scorpion sting patients. The relevant literature was collected using the online search engines including Science Direct, Google and PubMed with the help of specific keywords. We also used the printed and online resources at our institutional library to gather the relevant information on the use of medicinal plants for the treatment of scorpion sting patients. A descriptive statistics was used for data compilation and presentation. The results of this survey showed the use of at least 92 medicinal plants with beneficial effects for treating victims of stings of different scorpion species. These commonly used herbs spanned to 37 families whilst different parts of these plants were employed therapeutically for alleviation of envenomation symptoms. The application of leaves (41% was preferred followed by roots (19%, whole plant (14% and seeds (9%. The use of latex (4%, stem (3%, flowers (3% and bark (3% was also reported. In some cases, tannin (2%, rhizome (1% and shoot (1% were also used. In conclusion, herbal medicines are effectively used for the treatment of patients with scorpion envenomation. This type of medication is free from side effects as observed with chemical antidotes or antivenom therapy. It is important to identify the active ingredients of herbal drugs for improving their therapeutic potential in traditional medicine.

  18. The iron chelating agent, deferoxamine detoxifies Fe(Salen-induced cytotoxicity

    Directory of Open Access Journals (Sweden)

    Masanari Umemura

    2017-08-01

    Full Text Available Iron-salen, i.e., μ-oxo-N,N′-bis(salicylideneethylenediamine iron (Fe(Salen was a recently identified as a new anti-cancer compound with intrinsic magnetic properties. Chelation therapy has been widely used in management of metallic poisoning, because an administration of agents that bind metals can prevent potential lethal effects of particular metal. In this study, we confirmed the therapeutic effect of deferoxamine mesylate (DFO chelation against Fe(Salen as part of the chelator antidote efficacy. DFO administration resulted in reduced cytotoxicity and ROS generation by Fe(Salen in cancer cells. DFO (25 mg/kg reduced the onset of Fe(Salen (25 mg/kg-induced acute liver and renal dysfunction. DFO (300 mg/kg improves survival rate after systematic injection of a fatal dose of Fe(Salen (200 mg/kg in mice. DFO enables the use of higher Fe(Salen doses to treat progressive states of cancer, and it also appears to decrease the acute side effects of Fe(Salen. This makes DFO a potential antidote candidate for Fe(Salen-based cancer treatments, and this novel strategy could be widely used in minimally-invasive clinical settings.

  19. Structure and magnetic properties of Co/Pd multilayers prepared on porous nanotubular TiO{sub 2} substrate

    Energy Technology Data Exchange (ETDEWEB)

    Maximenko, A. [Institute of Nuclear Physics Polish Academy of Sciences, PL 31-342 Krakow (Poland); Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya str. 11, 220030 Minsk (Belarus); Marszałek, M., E-mail: marta.marszalek@ifj.edu.pl [Institute of Nuclear Physics Polish Academy of Sciences, PL 31-342 Krakow (Poland); Fedotova, J. [Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya str. 11, 220030 Minsk (Belarus); Zarzycki, A.; Zabila, Y. [Institute of Nuclear Physics Polish Academy of Sciences, PL 31-342 Krakow (Poland); Kupreeva, O.; Lazarouk, S. [Belarusian State University of Informatics and Radioelectronics, P.Brovka str. 6, 220013 Minsk (Belarus); Kasiuk, J. [Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya str. 11, 220030 Minsk (Belarus); Zavadski, S. [Belarusian State University of Informatics and Radioelectronics, P.Brovka str. 6, 220013 Minsk (Belarus)

    2017-07-15

    Highlights: • nanotubular templates of TiO{sub 2} were applied for fabrication of Co/Pd antidot arrays. • morphology of porous multilayers followed the features of the initial template. • the formation of Co0.4Pd0.6 alloy at the Co/Pd interface. • the conservation of perpendicular magnetic anisotropy in the CoPd porous film. • change of the magnetization reversal from domain wall motion to coherent rotation. - Abstract: We used porous nanotubular templates of TiO{sub 2} for fabrication of Co/Pd antidot arrays with strong perpendicular magnetic anisotropy. The morphology of porous multilayers followed the features of the initial template demonstrating a pronounced relief consisting of the cells with periodic pores with small inclination. We confirmed the formation of Co{sub 0.4}Pd{sub 0.6} alloy at the Co/Pd interface. We observed the conservation of perpendicular magnetic anisotropy in the Co/Pd porous film with coercive field H{sub C} = 2.7 kOe, enhanced with respect to the continuous film due to the pinning of magnetic moments on the nanopore edges. From angular dependence of the coercive field H{sub C} we deduced the change of the magnetization reversal mechanism from domain wall motion in the continuous film to the predominantly coherent rotation mechanism in the porous film.

  20. Toxicology and metabolism of nickel compounds. Progress report, December 1, 1975--November 30, 1976. [Tests made with rats and hamsters

    Energy Technology Data Exchange (ETDEWEB)

    Sunderman, F.W. Jr.

    1976-08-15

    The toxicology and metabolism of nickel compounds (NiCl/sub 2/, Ni/sub 3/S/sub 2/, NiS, Ni powder, and Ni(CO)/sub 4/) were investigated in rats and hamsters. Triethylenetetramine (TETA) and d-penicillamine are more effective than other chelating agents (Na-diethyldithiocarbamate, CaNa/sub 2/-versenate, diglycylhistidine-N-methylamide and ..cap alpha..-lipoic acid) as antidotes for acute Ni(II)-toxicity in rats. The antidotal efficacy of triethylenetetramine (TETA) in acute Ni(II)-toxicity is mediated by rapid reduction of the plasma concentration of Ni(II), consistent with renal clearance of the TETA-Ni complex at a rate more than twenty times greater than the renal clearance of non-chelated Ni(II). Fischer rats are more susceptible than other rat strains (Wistar-Lewis, Long-Evans and NIH-Black) to induction of erythrocytosis after an intrarenal injection of Ni/sub 3/S/sub 2/, and elucidation of the serial pathologic changes that occur in rats after an intrarenal injection of Ni/sub 3/S/sub 2/. When amorphous nickel monosulfide (NiS) and nickel subsulfide (Ni/sub 3/S/sub 2/) were administered by im injection to randomly selected Fischer rats in equivalent amounts under identical conditions, NiS did not induce any tumors whereas Ni/sub 3/S/sub 2/ induced sarcomas in almost all of the rats.

  1. A Lipid Base Formulation for Intramuscular Administration of a Novel Sulfur Donor for Cyanide Antagonism.

    Science.gov (United States)

    Kovacs, Kristof; Jayanna, Prashanth K; Duke, Anna; Winner, Brittany; Negrito, Melaeni; Angalakurthi, Siva; Yu, Jorn C C; Füredi, Petra; Ludányi, Krisztina; Sipos, Peter; Rockwood, Gary A; Petrikovics, Ilona

    2016-01-01

    This study represents a new formulation of the novel Cyanide (CN) antidote, Dimethyl trisulfide (DMTS), for intramuscular administration. This is a naturally occurring organosulfur molecule with the capability of reacting with CN more efficiently than the present sulfur donor type CN therapy of Thiosulfate (TS). Two types of micelles (PEG2000-DSPE and PEG2000-DSPE/TPGS) were prepared and tested for their ability to encapsulate the liquid, highly lipophilic and volatile drug, DMTS. The micellar encapsulation for DMTS does not only eliminate the possible muscle necrosis at the injection sites, but the rate of evaporation within the micelles is suppressed, that can provide a level of stability for the formulation. The method of micelle preparation was optimized and it was demonstrated that the PEG2000-DSPE preparation can dissolve up to 2.0 mg/ml of the antidote candidate. Keeping the injection volume minimized this could provide a maximum DMTS dose of 12.5 mg/kg. However, even this low dose of DMTS showed a remarkable in vivo therapeutic efficacy (2 X LD50 protection) in a mice model when injected intramuscularly. These in vitro and in vivo findings proved the efficacy of DMTS in combating CN intoxication, and the presented work gives valuable insight to micelle preparation and sets the bases for a more advanced future formulation of DMTS.

  2. A comprehensive evaluation of the efficacy of leading oxime therapies in guinea pigs exposed to organophosphorus chemical warfare agents or pesticides

    Energy Technology Data Exchange (ETDEWEB)

    Wilhelm, Christina M., E-mail: wilhelmc@battelle.org [Battelle, 505 King Avenue, JM-7, Columbus, OH 43201-2693 (United States); Snider, Thomas H., E-mail: snidert@battelle.org [Battelle, 505 King Avenue, JM-7, Columbus, OH 43201-2693 (United States); Babin, Michael C., E-mail: babinm@battelle.org [Battelle, 505 King Avenue, JM-7, Columbus, OH 43201-2693 (United States); Jett, David A., E-mail: jettd@ninds.nih.gov [National Institutes of Health/National Institute of Neurological Disorders and Stroke, Bethesda, MD 20892 (United States); Platoff, Gennady E., E-mail: platoffg@niaid.nih.gov [National Institutes of Health/National Institute of Allergy and Infectious Diseases, Bethesda, MD 20892 (United States); Yeung, David T., E-mail: dy70v@nih.gov [National Institutes of Health/National Institute of Neurological Disorders and Stroke, Bethesda, MD 20892 (United States)

    2014-12-15

    The currently fielded pre-hospital therapeutic regimen for the treatment of organophosphorus (OP) poisoning in the United States (U.S.) is the administration of atropine in combination with an oxime antidote (2-PAM Cl) to reactivate inhibited acetylcholinesterase (AChE). Depending on clinical symptoms, an anticonvulsant, e.g., diazepam, may also be administered. Unfortunately, 2-PAM Cl does not offer sufficient protection across the range of OP threat agents, and there is some question as to whether it is the most effective oxime compound available. The objective of the present study is to identify an oxime antidote, under standardized and comparable conditions, that offers protection at the FDA approved human equivalent dose (HED) of 2-PAM Cl against tabun (GA), sarin (GB), soman (GD), cyclosarin (GF), and VX, and the pesticides paraoxon, chlorpyrifos oxon, and phorate oxon. Male Hartley guinea pigs were subcutaneously challenged with a lethal level of OP and treated at approximately 1 min post challenge with atropine followed by equimolar oxime therapy (2-PAM Cl, HI-6 DMS, obidoxime Cl{sub 2}, TMB-4, MMB4-DMS, HLö-7 DMS, MINA, and RS194B) or therapeutic-index (TI) level therapy (HI-6 DMS, MMB4-DMS, MINA, and RS194B). Clinical signs of toxicity were observed for 24 h post challenge and blood cholinesterase [AChE and butyrylcholinesterase (BChE)] activity was analyzed utilizing a modified Ellman's method. When the oxime is standardized against the HED of 2-PAM Cl for guinea pigs, the evidence from clinical observations, lethality, quality of life (QOL) scores, and cholinesterase reactivation rates across all OPs indicated that MMB4 DMS and HLö-7 DMS were the two most consistently efficacious oximes. - Highlights: • First comprehensive evaluation of leading AChE oxime reactivators • All oximes are compared against current U.S. therapy 2-PAM Cl. • Relative therapeutic oxime efficacies against OP CWNA and pesticides • Contribution to more effective

  3. Acute Organophosphate Poisonings: Therapeutic Dilemmas and New Potential Therapeutic Agents

    International Nuclear Information System (INIS)

    Vucinic, S.; Jovanovic, D.; Vucinic, Z.; Todorovic, V.; Segrt, Z.

    2007-01-01

    It has been six decades since synthesis of organophosphates, but this chapter has not yet come to a closure. Toxic effects of organophosphates are well known and the current therapeutic scheme includes supportive therapy and antidotes. There is a dilemma on whether and when to apply gastric lavage and activated charcoal. According to Position Statement (by EAPCCT) it should be applied only if the patient presents within one hour of ingestion, with potentially lethal ingested dose. Atropine, a competitive antagonist of acetylcholine at m-receptors, which antagonizes bronchosecretion and bronchoconstriction, is the corner stone of acute organophosphate poisoning therapy. There were many attempts to find a more efficient drug, including glycopyrrolate which has been used even in clinical trials, but it still can not replace atropine. The only dilemma about atropine usage which still exists, concerns usage of high atropine dose and scheme of application. The most efficient atropinization is achieved with bolus doses of 1-2mg of atropine i.v push, with repeating the dose on each 5 minutes until signs of atropinization are registered. Diazepam, with its GABA stabilizing effect, reduces central nervous system damage and central respiratory weakness. Oximes reactivate phosphorylated acetylcholinesterase, which still has not gone ageing, reducing acetylcholine concentration and cholinergic crisis. These effects are clearly demonstrated in experimental conditions, but the clinical significance of oximes is still unclear and there are still those who question oxime therapy. For those who approve it, oxime dosage, duration of therapy, the choice of oxime for certain OP is still an open issue. We need new, more efficient antidotes, and those that are in use are only the small part of the therapy which could be used. Experimental studies show favorable therapeutic effect of many agents, but none of them has been introduced in standard treatment of OPI poisoning in the last 30

  4. Does amyl nitrite have a role in the management of pre-hospital mass casualty cyanide poisoning?

    Science.gov (United States)

    Lavon, Ophir; Bentur, Yedidia

    2010-07-01

    Amyl nitrite has been recommended as a cyanide antidote for several decades. Its antidotal properties were initially attributed to induction of methemoglobin and later to a nitric oxide mediated hemodynamic effect. The ease of administration and alleged rapid clinical effect would recommend its wide use in the pre-hospital management of mass casualty cyanide poisoning; yet there are concerns regarding the use of amyl nitrite for this indication. Review the data on amyl nitrite in cyanide poisoning and evaluate its efficacy and safety in mass casualty cyanide poisoning. A literature search utilizing PubMed, Toxnet, textbooks in toxicology and pharmacology, and the bibliographies of the articles retrieved identified 17 experimental studies and human reports on the use of amyl nitrite in cyanide poisoning, and 40 additional articles on amyl nitrite's properties and adverse effects. One paper was excluded as it was a conference abstract with limited data. The antidotal properties of amyl nitrite were attributed initially to induction of methemoglobinemia and later to nitric oxide mediated vasodilation. Animal studies on the use of amyl nitrite in cyanide poisoning are limited, and their results are inconsistent, which makes their extrapolation to humans questionable. Clinical reports are limited in number and the part played by amyl nitrite relative to the other treatments administered (e.g. life support, sodium nitrite, and sodium thiosulfate) is unclear. Amyl nitrite can be associated with potentially serious adverse reactions such as hypotension, syncope, excessive methemoglobinemia, and hemolysis in G6PD deficient patients. These effects are more pronounced in young children, in the elderly, and in patients with cardiac and pulmonary disorders. Dose regimen. The method of administration of amyl nitrite (breaking pearls into gauze or a handkerchief and applying it intermittently to the victim's nose and mouth for a few minutes) is not easily controlled, might result

  5. Intravenous cobinamide versus hydroxocobalamin for acute treatment of severe cyanide poisoning in a swine (Sus scrofa) model.

    Science.gov (United States)

    Bebarta, Vikhyat S; Tanen, David A; Boudreau, Susan; Castaneda, Maria; Zarzabal, Lee A; Vargas, Toni; Boss, Gerry R

    2014-12-01

    Hydroxocobalamin is a Food and Drug Administration-approved antidote for cyanide poisoning. Cobinamide is a potential antidote that contains 2 cyanide-binding sites. To our knowledge, no study has directly compared hydroxocobalamin with cobinamide in a severe, cyanide-toxic large-animal model. Our objective is to compare the time to return of spontaneous breathing in swine with acute cyanide-induced apnea treated with intravenous hydroxocobalamin, intravenous cobinamide, or saline solution (control). Thirty-three swine (45 to 55 kg) were intubated, anesthetized, and instrumented (continuous mean arterial pressure and cardiac output monitoring). Anesthesia was adjusted to allow spontaneous breathing with FiO2 of 21% during the experiment. Cyanide was continuously infused intravenously until apnea occurred and lasted for 1 minute (time zero). Animals were then randomly assigned to receive intravenous hydroxocobalamin (65 mg/kg), cobinamide (12.5 mg/kg), or saline solution and monitored for 60 minutes. A sample size of 11 animals per group was selected according to obtaining a power of 80%, an α of .05, and an SD of 0.17 in mean time to detect a 20% difference in time to spontaneous breathing. We assessed differences in time to death among groups, using Kaplan-Meier estimation methods, and compared serum lactate, blood pH, cardiac output, mean arterial pressure, respiratory rate, and minute ventilation time curves with repeated-measures ANOVA. Baseline weights and vital signs were similar among groups. The time to apnea and cyanide dose required to achieve apnea were similar. At time zero, mean cyanide blood and lactate concentrations and reduction in mean arterial pressure from baseline were similar. In the saline solution group, 2 of 11 animals survived compared with 10 of 11 in the hydroxocobalamin and cobinamide groups (Pcyanide concentrations became undetectable at the end of the study in both antidote-treated groups, and no statistically significant differences

  6. Cyanide Toxidrome. A Cluster of Nonspecific Signs May Be a Clue

    International Nuclear Information System (INIS)

    Baud, F. J.; Megarbane, B.

    2007-01-01

    Introduction: One of the major concerns regarding a mass disaster is to clarify the involved class of toxicant. Hydrocyanic acid and its derivatives are considered a likelihood threat. However, cyanide-induced signs and symptoms are described as nonspecific, precluding any characterization at the scene. Chemical disaster may result in the exposure, at the same time, of a large number of casualties. In such a condition, not only the nature of signs and symptoms (qualitative knowledge), but also their frequency and magnitude of occurrence (quantitative knowledge) would be of value for a presumptive diagnosis. Therefore, we attempted at quantifying signs and symptoms of cyanide poisoning at the time of presentation in order to improve its recognition and, therefore, the rapidity of antidote supply. Methods: cases of pure cyanide poisoning published in the medical literature and on which the authors consulted were reviewed. Smoke inhalations were excluded. Clinical data were collected before any antidotal treatment except for oxygen. Results are expressed as percentage or median [extremes] Results: Data on 149 acute pure cyanide poisonings described since 1950 were extracted and summarized. Cyanide poisonings primarily resulted from suicide attempts by ingestion. Median time between exposure and onset of symptoms was 30 minutes (1-1140). An abnormal odour was looked for in only 24 out of the 149 cases and was reported in 16 cases (67%). Acute cyanide poisoning was characterized by abnormal neurological status (82%) including coma (66%), dilated pupils (78%), and abnormal respiratory pattern (93%) including hyperpnoea, polypnea, and bradypnea. Muscular tone was nonspecific. Seizures were witnessed in only 26% of poisonings, premature ventricular contractions in 16%, and pulmonary edema in 5%. Median heart rate was 95 bpm [0-176], and median systolic blood pressure was 90 mmHg [0-168]. Arterial pH was 7.20 [6.40-7.60], PaCO2 was 25.2 mmHg [9-53.6], and plasma lactate was

  7. Reported ingested dose of paracetamol as a predictor of risk following paracetamol overdose.

    Science.gov (United States)

    Leang, Y; Taylor, D M; Dargan, P I; Wood, D M; Greene, S L

    2014-12-01

    To evaluate reported ingested dose of paracetamol as a risk assessment tool in acute paracetamol overdose. Data was retrospectively obtained from a clinical toxicology database linked to one Australian and two United Kingdom hospitals. Plasma paracetamol concentrations (PPCs) of adult patients presenting with acute single ingestion, non-staggered paracetamol deliberate self-poisoning between 2006 and 2012 were recorded and plotted on a treatment nomogram to determine accuracy of reported dose ingested as an indicator for antidotal treatment. PPC plotted on a treatment nomogram with a line intersecting a 4-h concentration of 100 mg/L [667 μmol/L] was considered an indication for antidotal treatment in the UK; the corresponding Australasian population utilised a line intersecting 150 mg/L [1000 μmol/L]. Of 1246 patients, 65.7 % were female and 88 % were from the UK. Fifty-two percent of patients reporting ingestion of ≥8 g paracetamol had a PPC above the 100 mg/L treatment line; PPV 52 % [95 % confidence interval (CI) 49 %, 55 %], sensitivity 81 % [95 %CI 78 %, 85 %]. Forty-four of patients reporting percent ingestion of ≥10 g had a PPC above the 150 mg/L treatment line; PPV 44 % [95 % CI 41 %, 49 %], sensitivity 85 % [95 % CI 78 %, 89 %], 72 % of patients reporting ingestion of ≥16 g had a PPC above the 100 mg/L treatment line; PPV 72 % [95% CI 67 %, 77 %], sensitivity 50 % [95 % CI 45 %, 54 %]. Overall, there was moderate correlation (R = 0.58) between reported paracetamol dose ingested and extrapolated 4-h PPC. There is a positive correlation between reported ingested dose of paracetamol and subsequent chance of a PPC being above a defined treatment line; however, ingested dose of paracetamol alone is a poor risk assessment tool in accurately determining need for treatment with an antidote.

  8. Antibodies, synthetic peptides and related constructs for planetary health based on green chemistry in the Anthropocene.

    Science.gov (United States)

    C Caoili, Salvador Eugenio

    2018-03-01

    The contemporary Anthropocene is characterized by rapidly evolving complex global challenges to planetary health vis-a-vis sustainable development, yet innovation is constrained under the prevailing precautionary regime that regulates technological change. Small-molecule xenobiotic drugs are amenable to efficient large-scale industrial synthesis; but their pharmacokinetics, pharmacodynamics, interactions and ultimate ecological impact are difficult to predict, raising concerns over initial testing and environmental contamination. Antibodies and similar agents can serve as antidotes and drug buffers or vehicles to address patient safety and decrease dosing requirements. More generally, peptidic agents including synthetic peptide-based constructs exemplified by vaccines can be used together with or instead of nonpeptidic xenobiotics, thus enabling advances in planetary health based on principles of green chemistry from manufacturing through final disposition.

  9. Increased anticoagulant activity of thrombin-binding DNA aptamers by nanoscale organization on DNA nanostructures

    DEFF Research Database (Denmark)

    Rangnekar, Abhijit; Zhang, Alex M.; Shiyuan Li, Susan

    2012-01-01

    by a flexible single-strand linker, have been shown to possess anticoagulant activity. Here, we link multiple aptamers at programmed positions on DNA nanostructures to optimize spacing and orientation of the aptamers and thereby to maximize anticoagulant activity in functional assays. By judicious engineering...... of the DNA nanostructures, we have created a novel, functional DNA nanostructure, which is a multi-aptamer inhibitor with activity eightfold higher than free aptamer. Reversal of the thrombin inhibition was also achieved by the use of single-stranded DNA antidotes, thus enabling significant control over......Control over thrombin activity is much desired to regulate blood clotting in surgical and therapeutic situations. Thrombin-binding RNA and DNA aptamers have been used to inhibit thrombin activity and thus the coagulation cascade. Soluble DNA aptamers, as well as two different aptamers tethered...

  10. Is bleeding a necessary evil? The inherent risk of antithrombotic pharmacotherapy used for stroke prevention in atrial fibrillation.

    Science.gov (United States)

    Myat, Aung; Ahmad, Yousif; Haldar, Shouvik; Tantry, Udaya S; Redwood, Simon R; Gurbel, Paul A; Lip, Gregory Yh

    2013-08-01

    Current European atrial fibrillation (AF) guidelines have assigned a strong recommendation for the initiation of antithrombotic therapy to prevent thromboembolism in all but those AF patients at low risk (or with contraindications). Furthermore, the selection of antithrombotic therapy is based on the absolute risks of thromboembolism and bleeding, and the relative risk and benefit for a given patient. By their very mechanism of action, antithrombotic agents used for stroke prevention in AF will potentially increase the risk of bleeding events. Moreover, the introduction of novel oral anticoagulation agents have introduced new, hitherto ill-defined, deficiencies in the authors' knowledge with respect to anticoagulation monitoring, availability of direct antidotes, drug-drug interactions and the ability to appropriately control and reverse their actions if bleeding events occur. The authors present a comprehensive review on all aspects of bleeding related to currently licensed antithrombotic agents used for stroke prevention in patients with AF.

  11. El afecto como antídoto contra la privatización y despolitización de la memoria

    Directory of Open Access Journals (Sweden)

    Anthony Nuckols

    2016-01-01

    Full Text Available Some of the critical analyses of the so-called “memory boom” literature in Spain point to a privatization of memory and a depoliticization of this theme in narrative, both processes occurring also in Spanish society. In this article, we propose an analysis of the novelSanto Diablo (2004 by Ernesto Pérez Zúñiga and the play El cartógrafo: Varsovia (1:400.000 (2010 by Juan Mayorga, keeping in mind the Spinozan notion of affect (by way of Deleuze as well as more recent contributions, as an antidote for privatization and depoliticization. Through affect, we offer a reading of these works that (transnationalizes the concept of memory and (reintroduces politics in the narratives about the recent violent past.

  12. Privatisation in Nigeria: A critical analysis of the virtues and vices

    Directory of Open Access Journals (Sweden)

    Dare E. Arowolo

    2012-12-01

    Full Text Available The twin-problems of mismanagement and corruption encountered by the state-owned corporations constitute the impetus for the recent privatisation of those corporations in Nigeria. Private sector seems, however, inseparable from public sector as viable public sector serves as guide for the private sector. It goes on to reason that a decaying public sector would give rise to inefficient private sector. Also, private sector has its own inherent contradictions as privatization in itself is not an antidote to corruption and mismanagement of which the public sector is being accused. The controversy and the contradictions in this topical issue aroused the interest and concern of this paper. The focus of the paper, therefore, is to present the two sides of the arguments on the viability of privatisation. The paper adopted content analysis in driving home its points.

  13. Anti-histamine effect of Rubia tibetica, used to treat anaphylaxis caused by tick bites in the Pamir Mountains, Afghanistan

    DEFF Research Database (Denmark)

    Jeppesen, Anne S.; Kristiansen, Uffe; Soelberg, Jens

    2012-01-01

    Ethnopharmacological relevance: The roots of Rubia tibetica are chewed as an antidote to anaphylaxis caused by bites of the tick Ornithodoros lahorensis by the Wakhi people in Afghanistan. Aims of the study: To test whether Rubia tibetica possess anti-histamine effect. Materials and methods: Water...... and ethanol extracts of roots of Rubia tibetica were tested for anti-histamine effect on the H 1-receptor in the guinea pig ileum assay. Fixed concentrations of plant extract with increasing concentrations of histamine were examined. Mepyramine was used as control. Results and conclusion: The ethanol extract...... of Rubia tibetica showed dose-dependent anti-histamine effect, whereas the water extract had little activity. The chewing of Rubia tibetica roots may alleviate the fatal swelling of the tongue during anaphylaxis....

  14. [Management of new oral anticoagulants in gastrointestinal bleeding and endoscopy].

    Science.gov (United States)

    del Molino, Fátima; Gonzalez, Isabel; Saperas, Esteve

    2015-10-01

    New oral direct anticoagulants agents are alternatives to warfarin for long-term anticoagulation in a growing number of patients that require long-term anticoagulation for atrial fibrillation, deep venous thrombosis and pulmonary embolism. These new agents with predictable pharmacokinetic and pharmacodynamics profiles offer a favorable global safety profile, but increased gastrointestinal bleeding compared to the vitamin K antagonists. Many gastroenterologists are unfamiliar and may be wary of these newer drugs, since Clinical experience is limited and no specific antidote is available to reverse their anticoagulant effect. In this article the risk of these new agents and, how to manage these agents in both the presence of acute gastrointestinal bleeding and in patients undergoing endoscopic procedures is reviewed. Copyright © 2014 Elsevier España, S.L.U. and AEEH y AEG. All rights reserved.

  15. Farewell to reality how modern physics has betrayed the search for scientific truth

    CERN Document Server

    Baggott, Jim

    2013-01-01

    From acclaimed science author Jim Baggott, a pointed critique of modern theoretical physics. In this stunning new volume, Jim Baggott argues that there is no observational or experimental evidence for many of the ideas of modern theoretical physics: super-symmetric particles,super strings, the multiverse, the holographic principle,or the anthropic cosmological principle. These theories are not only untrue, it is not even science. It is fairy-tale physics: fantastical, bizarre and often outrageous, perhaps even confidence-trickery. This book provides a much-needed antidote. Informed,comprehensive, and balanced, it offers lay readers the latest ideas about the nature of physical reality while clearly distinguishing between fact and fantasy. With its engaging portraits of many central figures of modern physics, including Paul Davies, John Barrow, Brian Greene, Stephen Hawking, and Leonard Susskind, it promises to be essential reading for all readers interested in what we know and don’t know about the nature of...

  16. Effect of N-acetylcysteine on the accuracy of the prothrombin time assay of plasma coagulation factor II plus VII plus X activity in subjects infused with the drug. Influence of time and temperature

    DEFF Research Database (Denmark)

    Thorsen, S.; Teisner, A.; Jensen, S.A.

    2009-01-01

    Objectives: The prothrombin time (PT) assay of factor II+VII+X activity is an important predictor of liver damage in paracetamol poisoned patients. It complicates interpretation of results that the antidote, acetylcysteine (NAC) depresses this activity. The aim was to investigate if NAC influences...... added to plasma in vitro decreased factor II+VII+X activity at 37 degrees C in a time-dependent manner. This effect was quenched at temperatures 24 degrees C. Activity lost at 37 degrees C could partly be recovered by subsequent incubation at 5 or 20 degrees C. Incubation at 37 degrees C prior to assay...... led to a significant additional depression of factor II+VII+X activity in plasma from subjects infused with NAC during the first 3h of infusion indicating that it contained reactive NAC. The risk that this NAC interfered with the accuracy of the PT assay was considered minimal with samples stored...

  17. Simplified captopril analogues as NDM-1 inhibitors.

    Science.gov (United States)

    Li, Ningning; Xu, Yintong; Xia, Qiang; Bai, Cuigai; Wang, Taiyi; Wang, Lei; He, Dingdi; Xie, Nannan; Li, Lixin; Wang, Jing; Zhou, Hong-Gang; Xu, Feng; Yang, Cheng; Zhang, Quan; Yin, Zheng; Guo, Yu; Chen, Yue

    2014-01-01

    Captopril is a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 value of 7.9μM. It is composed of two units: a 3-mercapto-2-methylpropanoyl fragment and a proline residue. In this study, we synthesized simple amide derivatives of 3-mercapto-2-methylpropanoic acid, and then tested them as NDM-1 inhibitors in order to identify the pharmacophore for NDM-1 inhibition. We found that the lead compound 22 had an IC50 value of 1.0μM. Further structure simplification provided compounds 31 and 32, which had IC50 values of 15 and 10μM, respectively. As compound 32 is a clinically used antidote for metal poisoning, it has great potential to be repurposed to treat bacterial infections. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. [Mushroom poisoning--classification, symptoms and therapy].

    Science.gov (United States)

    Kohn, R; Mot'ovská, Z

    1997-04-01

    The most serious poisonings are the hepatotoxic ones which are caused above all by Amanita phalloides, virosa, verna, Lepiota helveola, Galerina marginata, Gyromitra esculenta, Hypholoma fasciculare, and nephroptoxic intoxications which are caused above all by Cortinarius orrelanus and Paxillus involutus. Neurotoxic and psychotropic intoxications develop after ingestion of Inocybe, Clitocybe, Amanita-panterina, muscaria and Psilocybe. Most frequently the gastroenteric type of mushroom poisoning is encountered which is caused by many species e.g. Boletus satanas, Entoloma sinuatum and others. In the diagnosis anamnestic data are used, the clinical picture, mycological and toxicological examinations of residues of mushrooms, their spores and toxins. Therapeutic strategy comprises elimination methods gastric lavage, intestinal lavage and administration of large amounts of animal charcoal, forced diuresis, haemoperfusion, haemodialysis or peritoneal dialysis, administration of antidotes and symptomatic treatment, i.e. mainly rehydration and restoration of the mineral balance. Early and comprehensive treatment are important.

  19. The moral geography of home care.

    Science.gov (United States)

    Liaschenko, J

    1994-12-01

    One result of the historical division of labor between nurses and physicians is that nurses became the eyes and ears of the physician, extending their perceptual capabilities across space and time. This "gaze of medicine" has evolved with the rise of technology, hospitals, and the medical profession to a sort of scientific totalitarianism. Protecting and enhancing patient agency, which is part of the moral work of nursing practice, can be difficult under such circumstances. Yet the geography of sickness is changing as patients move from the hospital back to the home. Because home is thought of as private, as the patient's domain, nurses may think that supporting patient agency will be easier with this transformation of health care. But that assumption may not be warranted since the gaze of medicine will follow patients and change the landscape of the home. The challenge for nursing will be to sharpen the "gaze of nursing," which is an antidote to the strictly biomedical understanding of disease.

  20. The "Splendid Isolation" of Aaron T. Beck.

    Science.gov (United States)

    Rosner, Rachael I

    2014-12-01

    Aaron T. Beck's Cognitive Therapy (CT) is a school of psychotherapy, conceived in the 1960s, that is celebrated by many clinicians for having provided the scientific antidote to all that was wrong with psychoanalysis. This essay situates the origins of CT in the crisis of legitimacy in psychiatry in the 1960s and 1970s, when, among many charges, psycho- analysts had to face the accusation that analysis was not adequately scientific. Beck actually began his career as both a psychoanalyst and an experimentalist. Contrary to common triumphalist accounts, Beck created CT to be a neutral space, not a partisan one, in turbulent times. Other notable psychoanalysts also sought compromise, rather than partisanship, to bridge the transition to biomedical science. The biographical approach of this essay to the origins of Beck's CT both situates him historiographically and articulates the complex experiences of a generation of psychoanalysts otherwise opaque to standard narratives.