WorldWideScience

Sample records for anticuerpos monoclonales a3

  1. Seguridad post-comercialización de los anticuerpos monoclonales antineoplásicos

    OpenAIRE

    González Iglesias, Verónica

    2015-01-01

    INTRODUCCIÓN: Los primeros anticuerpos monoclonales comercializados en España han sido rituximab, trastuzumab, bevacizumab, cetuximab y panitumumab, en este orden. El estudio de su seguridad en los primeros años postcomercialización es fundamental para definir su relación beneficio/riesgo en las condiciones de uso autorizadas. JUSTIFICACIÓN Y OBJETIVOS: Con el fin de estudiar la seguridad postcomercialización de los anticuerpos monoclonales nos planteamos como objetivos: 1) Analizar las s...

  2. Anticuerpos monoclonales contra la Gonadotropina Corionica Humana (HCG) y su empleo en el diagnóstico precoz del embarazo.

    OpenAIRE

    Torres E.; N. Pentón; Blanco, R. (Raimundo); N. Abad; A. Triguero; L. Sorell; J. Gavilondo

    2006-01-01

    Se describe la obtención y caracterización de anticuerpos monoclonales contra la hormona gonadotropina cariónica humana (HCG), seleccionados de la inmunización subcutánea en ratones BALB/c. Se reporta también el desarrollo del sistema rápido HeberFast Line® Embarazo, para la detección de la hormona en muestras de orina, basado en los anticuerpos obtenidos y la tecnología del flujo lateral desarrollada en membranas de nitrocelulosa como soporte sólido. El nivel de sensibilidad alcanzado con es...

  3. Detección de pepsinógeno mediante el uso de antisueros y anticuerpos monoclonales.

    Directory of Open Access Journals (Sweden)

    Oscar Orozco

    2000-02-01

    Full Text Available

    El pepsinógeno (PGA y PGC es una aspartato proteasa secretada por células principales gástricas que a pH ácido se convierte en pepsina. Los niveles séricos de dicha enzima se han postulado como indicadores del estado de la mucosa gástrica ya que dependiendo de la patología de base estos pueden encontrarse elevados o disminuidos. Así, en la gastritis superficial y úlcera duodenal los niveles de PGA se encuentran aumentados, mientras que en la gastritis atrófica y cáncer gástrico se encuentran disminuidos. Se planteó como objetivo de este trabajo producir anticuerpos policlonales y monoclonales anti-pepsinógeno con el fin de ser empleados en el diseño de sistemas de cuantificación de pepsinógeno sérico, ya que los sistemas de cuantificación comerciales son muy costosos y de difícil acceso. Para la producción de los anticuerpos se empleó pepsina A porcina como inmunógeno teniendo en cuenta que presenta una alta homología en la secuencia de aminoácidos (86% con la pepsina A humana y además tienen una estructura secundaria idéntica. Anticuerpos policlonales fueron obtenidos de conejos Nueva Zelanda inmunizados vía subcutánea con pepsina A porcina y los anticuerpos monoclonales a partir de células de bazo de los ratones BALB/c inmunizados con pepsina A vía intraperitoneal. Los anticuerpos tanto policlonales como monoclonales fueron purificados por precipitación con sulfato de amonio y posteriormente cromatografía de intercambio iónico a partir del suero o líquido ascítico respectivamente. Los anticuerpos purificados, tanto policlonales como monoclonales, son capaces de reconocer pepsina porcina y pepsinógeno humano presente en sonicados de biopsias gástricas en ensayos de ELISA y western blot. En ensayos de inmunohistoquímica realizados sobre cortes de biopsias gástricas los anticuerpos monoclonales detectan el pepsinógeno presente en el

  4. Anticuerpos monoclonales contra la Gonadotropina Corionica Humana (HCG y su empleo en el diagnóstico precoz del embarazo.

    Directory of Open Access Journals (Sweden)

    Torres E

    2006-03-01

    Full Text Available Se describe la obtención y caracterización de anticuerpos monoclonales contra la hormona gonadotropina cariónica humana (HCG, seleccionados de la inmunización subcutánea en ratones BALB/c. Se reporta también el desarrollo del sistema rápido HeberFast Line® Embarazo, para la detección de la hormona en muestras de orina, basado en los anticuerpos obtenidos y la tecnología del flujo lateral desarrollada en membranas de nitrocelulosa como soporte sólido. El nivel de sensibilidad alcanzado con este sistema diagnóstico es de 20 UI/L de HCG en muestra de orina, y no se observó reactividad cruzada en analitos similares conteniendo concentraciones de las glicohormonas relacionadas; 1000 IU de LH, 5000 IU de FSH, y 1000 µIU de TSH respectivamente. Los estudios de estabilidad arrojaron, que el diagnosticador mantine las características de funcionalidad por un tiempo de 15 meses a temperaturas entre 2 y 30 ºC, conformando este el tiempo de vigencia del sistema. De poseer en Farmacias, Consultorios Médicos de la Familia y Hospital Gineco-Obstétricos, un sistema rápido y sencillo como el establecido en este trabajo, se pueden evitar todos los riesgos e inconvenientes que acarrean los procesos de interrupción del embarazo en la mujer.

  5. Obtención de anticuerpos monoclonales de ratón contra proteasa de cisteína 5 recombinante de Entamoeba histolytica

    Directory of Open Access Journals (Sweden)

    Juanita Trejos S.

    2012-08-01

    Full Text Available Objetivo. Obtener anticuerpos monoclonales de ratón contra la proteasas de cisteína 5 (EhCP5 de Entamoeba histolytica. Materiales y métodos. Se inmunizaron ratones BALB/c por vía intraperitoneal con adyuvante de Freund completo e incompleto con la proteína recombinante EhCP5 obtenida a partir del cultivo de E.coli DH5α trasfectada con el vector recombinante pJC45 que expresa dicha proteína. Se seleccionó el animal con mejor respuesta de anticuerpos. Al cual se le extrajo su bazo como fuente de linfocitos B, los cuales se fusionaron utilizando PEG con células de mieloma de ratón SP2-0/Ag14. Se procedió a selección de los hibridomas y a la evaluación de los sobrenadantes de las colonias que crecieron a los 7 días mediante ELISA. Los hibridomas con valores más altos de anticuerpos específicos contra la proteína EhCP5r se seleccionaron, y los clones obtenidos por diluciones limitantes fueron expandidos. Resultados. A partir de un clon secretor estable se purifico el anticuerpo monoclonal anti EhCP5r del isotipo IgG1 por cromatografía de afinidad con proteína G. Los clones fueron expandidos in vivo e in vitro. Con el anticuerpo purificado se diseñaron tres sistemas de captura para evaluar la aplicabilidad del anticuerpo monoclonal anti EhCP5r como método inmunodiagnóstico. Conclusiones. Se logro la producción de un anticuerpo monoclonal específico contra EhCP5r que permite diferenciar Entamoeba histolytica de Entamoeba dispar.

  6. Generación de anticuerpos monoclonales contra el antígeno específico de próstata (psa)para la detección del psa y su purificación

    OpenAIRE

    Acevedo Castro, Boris Ernesto

    2012-01-01

    El cáncer de próstata en Cuba es un problema de salud (2 672 casos diagnosticados y 2 769 defunciones en el 2007). Varios métodos diagnósticos se han implementado para la detección y manejo de esta enfermedad, destacando entre ellos la determinación serológica del antígeno específico de próstata (PSA). En el presente trabajo se generó y caracterizó un panel de 11 anticuerpos monoclonales (AcMs) IgG1 que detectan con alta afinidad los epítopos principales descritos del PSA, tanto en solución c...

  7. Diagnóstico rápido de citomegalovirus (CMV en pacientes inmunocomprometidos mediante anticuerpos monoclonales que reconocen proteinas precoces virales Rapid diagnosis of cytomegalovirus infection in immunocompromised patients by using monoclonal antibodies against early viral antigens

    Directory of Open Access Journals (Sweden)

    Maritza Alvarez

    1989-06-01

    Full Text Available Se aplicó la técnica de detección de antigenos precoces fluorescentes (DAPF usando el anticuerpo monoclonal E-13 McAb, mediante el cual se lograron detectar 15 casos positivos a CMV de 75 muestras de orina o sangre ("buffy coat" tomadas de 52 pacientes inmunocomprometidos ingresados en el Instituto de Nefrología de ciudad Habana. Aplicando las técnicas clásicas de aislamiento en fibroblastos humanos diploides (MRC-5, se lograron aislar 12 cepas de CMV de casos previamente positivos por DAPF; lográndose además un aislamiento en una muestra reportada negativa por fluorescencia. Se observó una coincidencia de un 80% entre ambas técnicas. Se detectó la presencia de anticuerpos IgG contra CMV en todos los casos estudiados, utilizando para ello la técnica ELISA.A technique was applied to detect early fluorescent antigens (DEFA of cytomegalovirus (CMV using the E13 monoclonal antibodies in 52 immunocompromised patients hospitalized in the Nephrology Institute of Havana. Of the 75 urine or blood (buffy coat samples taken, 15 were found positive to CMV. Using classical diploide human fibroblast isolation technique, 12 CMV strains were isloation of previously detected positive samples by DEFA. In addition, CMV was isolated from one sample reported to be negative by DEFA. A coincidence of 80% was found between both techniques. With the ELISA test, all the sample studied have IgG antibodies to CMV.

  8. Anticuerpo anticitrulina y manifestaciones extra articulares en artritis reumatoidea

    Directory of Open Access Journals (Sweden)

    María Jezabel Haye Salinas

    2013-02-01

    Full Text Available Los pacientes con artritis reumatidea (AR pueden desarrollar manifestaciones extra articulares (MExA, relacionadas a su morbi-mortalidad. Los anticuerpos anti-péptidos citrulinados cíclicos (ACCP son específicos para la AR y estan relacionados con el daño articular; y podrían tener rol patogénico en las MExA. Nuestro objetivo fue determinar la relación entre los anticuerpos ACCP y MExA en pacientes con AR. Se incluyeron 74 pacientes con diagnóstico de AR (ACR 1987 mayores de 18 años, de más de 6 meses de evolución, con MExA, y un control apareado por sexo y edad sin MExA por cada paciente. Las variables demográficas, clínicas y de laboratorio se compararon con test t, chi cuadrado o Mann-Whitney. Se realizó análisis multivariado; p ≤ 0.05. Los pacientes con MExA presentaron mayor título de anticuerpo ACCP (116 vs. 34, p < 0.01 y de factor reumatoideo (FR (108 vs. 34.5, p < 0.01. En el análisis multivariado hubo asociación entre la presencia de MExA y tabaquismo activo (p = 0.02, OR: 3.78, IC 95%: 1.17-12.2, FR positivo (p = 0.04, OR: 3.23, IC95%: 1.04-11.8 y anticuerpo ACCP positivo (p = 0.04, OR: 3.23, IC 95%: 1.04-10. Presentaron mayor título de anticuerpo ACCP que los controles los pacientes con xerostomía (109 vs. 34, p = 0.04, xeroftalmia (150 vs. 34, p < 0.01, nódulos sub-cutáneos (NSC (141 vs. 34, p < 0.01 y fibrosis pulmonar (158 vs. 34, p = 0.04. En conclusión, el anticuerpo ACCP positivo, el FR positivo y el tabaquismo activo fueron factores de riesgo independientes para el desarrollo de MExA.

  9. Trasplante renal en pacientes con anticuerpos dirigidos contra donante

    Directory of Open Access Journals (Sweden)

    Federico Cicora

    2014-10-01

    Full Text Available En trasplante renal, los anticuerpos donante-específicos por ensayos de fase sólida predicen el rechazo temprano mediado por anticuerpos, incluso con resultados negativos de citometría de flujo o citotoxicidad dependiente del complemento. Aquí se describen los protocolos de inmunosupresión y los resultados a diez meses de cuatro pacientes en los que se detectó anticuerpos donante-específicos anti-antígenos leucocitarios humanos (HLA por Luminex®, pero no detectados por el método de citotoxicidad dependiente de complemento (CDC ni por citometría de flujo. Los cuatro pacientes recibieron tratamiento de inducción con 5 dosis de timoglobulina de 1.25 mg/kg y 5 dosis de inmunoglobulina intravenosa (IVIG de 400 mg/kg. Además, uno recibió 20 mg de basiliximab el mismo día del trasplante y el día 4 postrasplante; otro recibió 3 sesiones de plasmaféresis en los días -5, -3, y -1 y eculizumab en dosis de 1200 mg antes del trasplante, 900 mg el día 1, and 600 mg por semana durante un mes. En todos los casos, la inmunosupresión de mantenimiento consistió en tacrolimus, micofenolato y deltisona. Todos presentaron buenos resultados en el corto plazo. Nuestra experiencia sugiere que los pacientes con anticuerpos donante-específicos anti-HLA detectados solo por Luminex® deben recibir un seguimiento estricto y que en esta población se pueden obtener buenos resultados a partir del uso de terapia de inducción con timoglobulina e IVIG.

  10. Antisperm autoantibodies and infertility Anticuerpos antiespermatozoides e infertilidad

    Directory of Open Access Journals (Sweden)

    Jorge Eliécer Ossa Londoño

    1997-02-01

    Full Text Available Fourteen human infertile couples were studied along with seven fertile control couples in order to determine the presence of antisperm au. toantibodies and to correlate results with their clinical reproductive status, spermogram parameters and the quality of cervical mucus. Immunoglobulins of IgG and IgA isotypes were evaluated on spermatozoa by the direct immunobead technique and in serum and cervical mucus by the indirect method. The following differences were found: Nine of 14 male patients but only 1 of 7 male controls had IgG on spermatozoa (p= 0.042 and OR= 10.8. Seven out of 14 male patiens and 1 of 7 controls were positive for IgA on spermatozoa (p= 0.12. Infertile males had a higher frequency of abnormal spermogram parameters as compared to controls (p= 0.0029 and OR= 3.32. Interestingly, the presence of only IgG in serum appeared to be a "protective factor" against IgG on sperm; only one out of the 16 positive males contradicted this observation. Para determinar la presencia de anticuerpos antiespermatozoides y correlacionarla con la situación reproductiva, el espermograma y la calidad del moco cervical, se estudiaron 7 parejas sanas, con hijos, y 14 infértiles. Se determinaron por las técnicas directa e indirecta de inmunoesferas los anticuerpos de los isotipos IgG e IgA en espermatozoides, suero y moco cervical. En 9 de los 14 hombres infértiles y en 1 de los 7 fértiles se encontraron anticuerpos IgG en la superficie de los espermatozoides (p= 0.042 y una Razón de disparidad [RD] = 10.8 y 8 de éstos también tuvieron IgA en los espermatozoides. El número de pruebas alteradas en el espermograma de los hombres infértiles fue significativamente mayor (p= 0.0029 y RD = 3.32. Tanto en los hombres infértiles como en los fértiles la presencia de sólo IgG en el suero parece ser un "factor de protección" contra IgG en los espermatozoides; de los 16 hombres que presentaron anticuerpos, fuera en el suero o en los espermatozoides, s

  11. Thyroid autoantibodies in autoimmune diseases Anticuerpos antitiroideos en enfermedades autoinmunes

    Directory of Open Access Journals (Sweden)

    Regina M. Innocencio

    2004-06-01

    Full Text Available Abnormalities in the thyroid function and thyroid autoantibodies have been frequently described in patients with autoimmune diseases but seldom in antiphospholipid syndrome patients. In order to determine the prevalence of thyroid function and autoimmune abnormalities, we compared serum thyrotropin (TSH, serum free thyroxine (T4 levels, thyroid antithyroglobulin (TgAb and antithyroperoxidase (TPOAb levels of 25 patients with systemic sclerosis, 25 patients with rheumatoid arthritis and 13 patients with antiphospholipid syndrome to a control group of 113 healthy individuals. Evaluation included a thorough clinical examination with particular attention to thyroid disease and a serologic immune profile including rheumatoid factor, antinuclear and anticardiolipin antibody measurements. Subclinical hypothyroidism (4.2Ciertas anormalidades en la función tiroidea y anticuerpos antitiroideos han sido frecuentemente descriptos en pacientes con enfermedades autoinmunes, y más raramente en pacientes con el síndrome antifosfolipídico. Para determinar la prevalencía de anormalidades en la función tiroidea y de autoinmunidad, comparamos los niveles séricos de tirotropina (TSH tiroxina libre en suero (T4 anticuerpos antitiroglobulina (TgAb y antitiroperoxidasa (TPOAb en 25 pacientes con esclerosis sistémica, 25 pacientes con artritis reumatoidea y 13 pacientes con el síndrome antifosfolipídico con un grupo control de 113 individuos aparentemente sanos. La evaluación incluyó un completo examen clínico con particular atención para las enfermedades de la tiroides y una evaluación inmunológica incluyendo dosaje del factor reumatoideo, anticuerpos antinucleares y anticardiolipina. Hipotiroidismo subclínico (4.2anticuerpos anti-tiroglobulina (TgAb y/o anti-peroxidasa (TPOAb estaban presentes en 21/63 (33% de los

  12. Anticuerpos derivados de pacientes se dirigen a células tumorales

    Science.gov (United States)

    Artículo del blog Temas y relatos de un anticuerpo derivado de pacientes que destruye células tumorales en estirpes celulares de varios tipos de cáncer e hizo lento el crecimiento en modelos murinos de cáncer de cerebro y pulmón sin signo de efectos.

  13. Rearreglos de genes de cadenas pesadas de las inmunoglobulinas en las gammapatías monoclonales Immunoglobulin heavy chain gene rearrangements in the monoclonal gammopathies

    Directory of Open Access Journals (Sweden)

    Andrea Bosaleh

    2005-06-01

    Full Text Available Las neoplasias de células plasmáticas resultan de la expansión de un clon de células B que secreta inmunoglobulinas, conocido como componente monoclonal o componente M. Las neoplasias malignas incluyen al mieloma múltiple y la macroglobulinemia de Waldenström, y la condición premaligna comprende las gammapatías monoclonales de significado incierto (MGUS. El MGUS presenta un componente monoclonal sin evidencia de mieloma múltiple, macroglobulinemia de Waldenström, amiloidosis primaria u otros desórdenes. El diagnóstico se basa en la combinación de características patológicas, radiológicas y clínicas. Aproximadamente el 25% de las gammapatías monoclonales de significado incierto desarrollarán mieloma múltiple, amiloidosis sistémica, macroglobulinemia o enfermedades linfoproliferativas malignas, indicando que sería una condición premielomatosa. El objetivo del presente trabajo es establecer la utilidad clínica de la inmunofenotipificación por citometría de flujo (CF y la detección de clonalidad por biología molecular. Se estudiaron 32 pacientes, siete con diagnóstico de mieloma múltiple y veinticinco con gammapatía monoclonal en estudio, los cuales fueron divididos en cuatro grupos basados en los datos clínicos y los resultados de CF. En el grupo de pacientes con CF no diagnóstica, se realizó la detección de los rearreglos de los genes de las cadenas pesadas de las inmunoglobulinas mediante reacción en cadena de la polimerasa (PCR, detectándose monoclonalidad en el 59% de los casos. El estudio de los rearreglos de los genes de las cadenas pesadas de las IgH mediante PCR incrementa la sensibilidad de detección de monoclonalidad.Plasma cell neoplasia occurs as a result of the expansion of an immunoglobulin-secreting B-cells clones, known as monoclonal component or M component. Malignant neoplasias include multiple myeloma and Waldenström macroglobulinemia, while premalignant conditions comprise monoclonal

  14. Diagnóstico diferencial en la encefalitis por anticuerpos contra el receptor NMDA

    Science.gov (United States)

    González-Valcárcel, J.; Rosenfeld, M.R.; Dalmau, J.

    2011-01-01

    Resumen Introducción La encefalitis por anticuerpos contra el receptor de NMDA (NMDAR) suele desarrollarse como un síndrome característico de evolución multifásica y diagnóstico diferencial amplio. Pacientes Presentamos a 2 pacientes diagnosticadas de encefalitis por anticuerpos NMDAR con un cuadro clínico típico, pero que inicialmente señaló otras etiologías. Discusión La afectación frecuente de pacientes jóvenes con manifestaciones psiquiátricas prominentes indica frecuentemente otras consideraciones diagnósticas; las más frecuentes son las encefalitis virales, los procesos psiquiátricos y el síndrome neuroléptico maligno. Varios síndromes previamente definidos de manera parcial o descriptiva en adultos y pacientes pediátricos probablemente eran casos de encefalitis anti-NMDAR. Conclusiones La encefalitis anti-NMDAR debe considerarse en pacientes jóvenes con manifestaciones psiquiátricas subagudas, movimientos anormales y alteraciones autonómicas. La caracterización clínica e inmunológica de esta enfermedad ha llevado a la identificación de nuevos anticuerpos que afectan a procesos de memoria, aprendizaje, conducta y psicosis. PMID:20964986

  15. Asociación entre enfermedad cardiovascular y anticuerpos contra Chlamydia pneumoniae

    Directory of Open Access Journals (Sweden)

    García-Elorriaga Guadalupe de los A

    2002-01-01

    Full Text Available Objetivo. Precisar si existe asociación entre enfermedad cardiovascular (ECV y anticuerpos contra Chlamydia en población mexicana. Material y métodos. Estudio transversal, realizado en la Unidad de Investigación en Inmunología e Infectología -Hospital de Infectología del Centro Médico Nacional La Raza (CMNR- y en el Servicio de Cirugía Cardiovascular y Asistencia Circulatoria, del Hospital General del CMNR, Instituto Mexicano del Seguro Social (IMSS, de agosto de 1998 a abril de 2000. Se determinaron anticuerpos IgG e IgM contra C. psittaci, C. trachomatis y C. pneumoniae mediante microinmunofluorescencia, en suero de 70 pacientes con ECV hospitalizados en el CMNR, mayores de 30 años, de uno u otro sexo, y se compararon con 140 sanos, pareados por edad y sexo. Se utilizaron muestras aleatorias simples, con un tamaño poblacional de 110, una prevalencia de 50% y un nivel de confianza de 99%. Para establecer la diferencia entre las proporciones de los títulos se utilizó ji cuadrada y se calculó la razón de momios. Resultados. El 94.3% (66/70 de los pacientes presentó IgG en contra de C. pneumoniae vs 37% (52/140 de los individuos sanos (p<0.001. Conclusiones. Existe una fuerte asociación entre anticuerpos IgG hacia C. pneumoniae y ECV.

  16. Inmunodeficiencias primarias por déficit de anticuerpos en adultos

    Directory of Open Access Journals (Sweden)

    María Mercedes Bello Rodríguez

    2014-10-01

    Full Text Available Se realizó una investigación sobre los pacientes con inmunodeficiencias primarias por déficit de anticuerpos, atendidos en el servicio de inmunología del Hospital General “Dr. Ernesto Guevara” de Las Tunas, con el objetivo de caracterizar las inmunodeficiencias por déficit de anticuerpos en pacientes adultos, atendiendo al tipo de inmunoglobulina afectada, el sexo y la edad, así como las principales manifestaciones clínicas. Se evaluaron un total de diez pacientes tratados por esta causa entre los años 2005 y 2013. Para la evaluación de los resultados se utilizó el análisis de frecuencias simple. Las inmunodeficiencias diagnosticadas se correspondieron en un 50% con el déficit de las tres clases de inmunoglobulinas. Predominó el sexo masculino en un 70% y las edades más afectadas se correspondieron con la cuarta y quinta décadas de la vida. Las infecciones respiratorias y digestivas fueron las más frecuentes (80%, tanto por gérmenes bacterianos como virales, la infección por Giardia lamblia también apareció muy frecuentemente en los pacientes estudiados

  17. DETECCIÓN DE ANTICUERPOS IgM A LEPTOSPIRA EN HUMANOS EN RIESGO OCUPACIONAL EN VILLAVICENCIO, META

    Directory of Open Access Journals (Sweden)

    Luz Díaz P

    2008-04-01

    Full Text Available Objetivo. Determinar la seroprevalencia a la infección por leptospira en una población humana y los factores de riesgo ocupacional asociados en Villavicencio, Meta. Materiales y métodos. Se aplicó un modelo epidemiológico transversal con selección por conveniencia de grupos e individuos dentro de grupos. Se obtuvieron muestras de sangre por punción cubital de 273 personas correspondientes a 8 grupos de riesgo. Se obtuvo información de factores de riesgo mediante entrevista. Se determinaron anticuerpos IgM mediante ELISA indirecta. Se utilizó una prueba de c2 mediante el programa SPSS 11.0 para Windows. Resultados. La seroprevalencia general fue 19%. Por grupos fue para trabajadores de matadero 7%, veterinarios y auxiliares de clínica de pequeños animales 17%, estudiantes de último año de MVZ 17%, ordeñadores 21%, trabajadores de arrozales 23%, trabajadores de granjas porcícolas 35%, trabajadores de piscícolas 48%. Se encontraron 3 factores asociados, el estrato rural p = 0.0005 ICCR 1.50 a 3.83, tenencia de mascota canina p = 0.046 ICCR 1.03 a 3.26 y contacto con roedores en el trabajo p = 0.000037 ICCR = 1.73 a 4.75. Conclusiones. Se encontró una alta seroprevalencia general de infectados por Leptospira, siendo los grupos de más alta prevalencia los trabajadores piscícolas y de granjas porcícolas. Se reconoce una vez más el carácter ocupacional de la infección posiblemente por falta de medidas de higiene y protección laboral.

  18. OBTENCIÓN DE ANTICUERPOS POLICLONALES IgY ANTIPARVOVIRUS CANINO A PARTIR DE YEMA DE HUEVO DE GALLINA

    Directory of Open Access Journals (Sweden)

    Pinto, J.

    2005-06-01

    Full Text Available Inmunizando un grupo de diez gallinas de postura raza Lohmann de 16 semanas de edad con parvovirus canino (CPV cepa vacunal, se obtuvieron anticuerpos IgY policlonales contra CPV en yema de huevo.En la extracción de los anticuerpos de la yema se requirieron dos pasos, el primero para la remoción de lípidos y el segundo para la precipitación de proteínas. Para la remoción de lípidos se usó el método PBS:Cloroformo y para la precipitación de los anticuerpos solubles (Inmunoglobulinas-IgY se usó el método de salting-out con sulfato de amonio ((NH42SO4. La evaluación del proceso se efectuó empleando el método comercial estándar “EGGstract IgY Purification System®” de PROMEGA.La metodología empleada permitió la obtención de anticuerpos IgY policlonales contra CPV a partir de yema de huevo de gallina en concentraciones altas por mililitro de yema, con una pureza aceptable y títulos altos; los resultados fueron comparables con el método comercial.

  19. Anticuerpos séricos contra la enfermedad de Newcastle e Influenza Aviar en aves rapaces de Chile.

    Directory of Open Access Journals (Sweden)

    Daniel González-Acuña

    2012-12-01

    Full Text Available Objetivo. Detectar la presencia de anticuerpos séricos sanguíneos contra los virus de la Enfermedad de Newcastle (ENC e Influenza aviar (IA, para comprender la contribución de las aves silvestres en la transmisión de estos virus en Chile. Materiales y métodos. Se analizaron 63 aves pertenecientes a los órdenes Falconiformes y Strigiformes desde centros de rehabilitación de aves de las zonas central y sur de Chile. Se realizaron las pruebas de inhibición de la hemoaglutinación (IHA para detectar anticuerpos contra el virus ENC e inmunodifusión en gel agar (IDGA y ELISA para IA. Resultados. Se detectaron 14 aves positivas (22.2% para anticuerpos séricos contra el virus de la ENC. En cambio, no se registraron anticuerpos séricos sanguíneos para el virus de la IA. Conclusiones. La presencia de aves rapaces positivas en los centros de rescate a los anticuerpos séricos contra el virus de la ENC puede ser explicada por el consumo de carne de pollos que han sido vacunados contra ENC o consumo de aves que han adquirido directamente el virus vacunal a través de los distintos procedimientos de administración (aerosoles, bebederos de la vacuna o por el ingreso a los centros de rescate de aves rapaces migratorias, las que podrían facilitar la diseminación de la infección desde los países de origen, hecho que debe ser investigado.

  20. Producción de un anticuerpo IgY específico contra el antígeno CD41 humano

    OpenAIRE

    Esteban J. Gutiérrez Calzado; Marlene Toledano Heredia; Hans Bäumler; Rüdiger Schade

    2009-01-01

    Desde hace dos décadas, la comunidad científica muestra un gran interés hacia la generación de anticuerpos en gallinas ponedoras por las ventajas que estas aportan al compararse con otros métodos tradicionales para este fin, sobre todo, en el hecho de lograrse en ellas, mejores respuestas de anticuerpos hacia antígenos de mamíferos muy conservados en la filogenia entre los que se encuentran glicoproteínas de membrana celular. El objetivo de este trabajo fue la generación de anticuerpos especí...

  1. Seroprevalencia de anticuerpos anti-Toxoplasma gondii en pacientes con afecciones Oncohematológicas

    Directory of Open Access Journals (Sweden)

    Dailín Cobos Valdes

    2009-01-01

    Full Text Available Se analiza la reactividad de 23 muestras de suero de pacientes con hemopatías malignas provenientes de la sala de hematología del Hospital Clínico Quirúrgico de Holguín, mediante la técnica de Inmunofluorescencia Indirecta, reportándose un 65,2% de seroprevalencia. La Toxoplasmosis es una enfermedad causada por el agente etiológico Toxoplasma gondii, parásito intracelular obligado ampliamente distribuido en todo el mundo y capaz de infectar un gran número de huéspedes, incluida la especie humana. Numerosas han sido las investigaciones sobre la presencia de anticuerpos anti- Toxoplasma gondii en individuos inmunodeficientes, donde los pacientes con enfermedades oncohematológicas son un grupo representativo dentro de esta población.

  2. Evaluación de la respuesta de anticuerpos hacia antígenos de Pseudomonas aeruginosa.

    Directory of Open Access Journals (Sweden)

    Aniel Moya

    2007-04-01

    Full Text Available Pseudomonas aeruginosa es un patógeno extracelular que genera una respuesta de anticuerpos específicos con utilidad para el diagnóstico y vacunas. En el presente estudio nos propusimos evaluar en suero humano los niveles de anticuerpos contra antígenos relevantes de P. aeruginosa. Realizamos la determinación de anticuerpos IgG contra tres exoenzimas, consideradas como factores de virulencia de mayor importancia en infecciones. Este resultado dio paso a la evaluación del reconocimiento de IgG e IgA hacia antígenos de la envoltura celular bacteriana por ELISA de células enteras. Todos los sueros evaluados mostraron títulos de IgG e IgA superiores a los individuos sanos, con excepción de dos muestras de pacientes que no mostraron alto título. Este ensayo permitió analizar el nivel de reconocimiento hacia los antígenos más expuestos de la bacteria que incluyen principalmente LPS y proteínas de membrana externa. Se encontró diferencias entre los valores de densidad óptica a 450 nm de individuos sanos y enfermos. El método usado permitió seleccionar dos sueros de pacientes de diferentes tipos de infecciones que fueron comparados por Western blot. Se observó que aunque los sueros tenían reacción hacia distintos serotipos de P. aeruginosa, la intensidad del reconocimiento variaba según el tipo de infección.

  3. Encefalitis por anticuerpos contra el receptor de NMDA: experiencia con seis pacientes pediátricos. Potencial eficacia del metotrexato

    Science.gov (United States)

    Bravo-Oro, Antonio; Abud-Mendoza, Carlos; Quezada-Corona, Arturo; Dalmau, Josep; Campos-Guevara, Verónica

    2016-01-01

    Introducción La encefalitis por anticuerpos contra el receptor de N-metil-D-aspartato (NMDA) es una entidad cada vez más diagnosticada en edad pediátrica. A diferencia de los adultos, en muchos casos no se asocia a tumores y las manifestaciones iniciales en niños más frecuentes son crisis convulsivas y trastornos del movimiento, mientras que en los adultos predominan las alteraciones psiquiátricas. Casos clínicos Presentamos seis casos pediátricos confirmados con anticuerpos contra la subunidad NR1 del receptor de NMDA en suero y líquido cefalorraquídeo. Cinco de los casos comenzaron con crisis convulsivas como manifestación clínica inicial antes de desarrollar el cuadro clásico de esta entidad. En todos los casos se utilizaron esteroides como primera línea de tratamiento, con los que sólo se observó control de las manifestaciones en uno, por lo que el resto de los pacientes requirió inmunomoduladores de segunda línea. Todos los pacientes recibieron metotrexato como tratamiento inmunomodulador para evitar recaídas y la evolución fue a la mejoría en todos ellos. Conclusiones En nuestra serie de pacientes con encefalitis por anticuerpos contra el receptor de NMDA, ninguno se asoció a tumores. Todos los casos recibieron metotrexato por lo menos durante un año, no observamos eventos adversos clínicos ni por laboratorio, ni hubo secuelas neurológicas ni recaídas durante el tratamiento. Aunque es una serie pequeña y es deseable incrementar el número y tiempo de evolución, consideramos el metotrexato una excelente alternativa como tratamiento inmunomodulador para esta patología. PMID:24150952

  4. Prevalencia de anticuerpos contra Brucella sp. En donantes del banco de sangre de un hospital de Lima

    OpenAIRE

    Abel Ortega; José Paredes; Alfredo Guillén

    2007-01-01

    El Perú es un país endémico de Brucelosis, por lo que existe el riesgo de transmisión a través de sangre donada por no ser parte del tamizaje regular que realizan los bancos de sangre. Para conocer la prevalencia de anticuerpos contra Brucella en donantes del banco de sangre del Hospital Edgardo Rebagliati Martins, se analizó 1003 muestras de suero. La prueba tamiz fue Rosa de Bengala (RB); las muestras positivas fueron evaluadas por las pruebas de aglutinación en tubo (AT) y 2-Mercaptoetanol...

  5. Prevalencia de anticuerpos contra Trypanosoma cruzi en donadores de sangre del IMSS, Orizaba, Veracruz, México

    OpenAIRE

    Ramos-Ligonio Angel; Ramírez-Sánchez Michaía Elián; González-Hernández Juan Carlos; Rosales-Encina José Luis; López-Monteon Aracely

    2006-01-01

    OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores del Hospital General Regional del Instituto Mexicano del Seguro Social (IMSS) en la ciudad de Orizaba, Veracruz. MATERIAL Y MÉTODOS: Se examinaron muestras de donadores del banco de sangre del Hospital General Regional (HGRO) del IMSS para la búsqueda de antiT. cruzi por ELISA, Western blot e IFI, utilizando una proteína recombinante (MBP::Hsp70) y un extracto crudo de epimastigotes. Las muestras fueron o...

  6. Producción de un anticuerpo IgY específico contra el antígeno CD41 humano

    Directory of Open Access Journals (Sweden)

    Esteban J. Gutiérrez Calzado

    2009-01-01

    Full Text Available Desde hace dos décadas, la comunidad científica muestra un gran interés hacia la generación de anticuerpos en gallinas ponedoras por las ventajas que estas aportan al compararse con otros métodos tradicionales para este fin, sobre todo, en el hecho de lograrse en ellas, mejores respuestas de anticuerpos hacia antígenos de mamíferos muy conservados en la filogenia entre los que se encuentran glicoproteínas de membrana celular. El objetivo de este trabajo fue la generación de anticuerpos específicos contra la glicoproteína de membrana plaquetaria humana gpIIb/IIIa (antígeno CD41 en gallinas ponedoras. Para este propósito, se utilizaron gallinas de 22 semanas de edad, a las que se les aplicaron dosis de 20 ¿g de una preparación inmunopurificada de este antígeno plaquetario, emulsionada con adyuvante completo e incompleto de Freund para una primera y segunda inmunización respectivamente, a intervalos de un mes. Se cosecharon los huevos diariamente de los animales inmunizados a partir de un día antes de esta aplicación hasta 30 d posteriores a la segunda inyección, se procesaron estos para la extracción de los anticuerpos específicos presentes en ellos y se obtuvo la dinámica de producción de anticuerpos por el método clásico de Ouchterlony que se enfrentó a una preparación pura del antígeno. Las respuestas de anticuerpos obtenidas resultaron en títulos adecuados susceptibles de investigar en usos posteriores en la Medicina Transfusional específicamente para el análisis de la calidad de plasmas.

  7. Utilidad de las muestras de sangre total desecada en papel de filtro en la detección de anticuerpos antitoxoplasma

    Directory of Open Access Journals (Sweden)

    Joaquim Gascon

    1989-04-01

    Full Text Available Se compara la técnica de Aglutinación Directa (AD utilizando muestras de sangre total desecada en papel de filtro, con la técnica de ELISA y la misma AD utilizando muestras de suero de los mismos pacientes, para la detección de anticuerpos antitoxoplasma. Los resultados muestran la validez del método de la sangre desecada en papel de filtro para la detección de anticuerpos antitoxoplasma con la técnica de AD, y se considera su utilidad en los estudios epidemiológicos de campo.

  8. Prevalencia de anticuerpos IgG al toxoide tetánico en trabajadores sanitarios

    Directory of Open Access Journals (Sweden)

    B. Pérez Bermúdez

    2014-09-01

    Full Text Available Introducción: En el año 2009 el Ministerio de Sanidad y Consumo de España publica una nueva guía para la vacunación de la Difteria y Tétanos. Existen discrepancias con los tiempos de inoculación de las dosis de recuerdo con otros países y sociedades médicas. Material y métodos: Estudio descriptivo. Las variables analizadas fueron: IgG-Toxoide Tetánico, tiempo última dosis de vacunación, dosis totales, edad, sexo, hospital, habito tabáquico e índice de masa corporal. Se construyó un modelo de Regresión Logística. Con el fin de determinar los puntos de corte más sensibles y específicos para las variables temporales (tiempo desde la última dosis y edad se calcularon las curvas R.O.C Resultados: Las variables, edad O,R= 17,56 (1,840 - 167,760, dosis de vacuna inoculadas al trabajador, O,R= 0,064 (0,006 - 0,908 y tiempo de la última dosis de vacunación, O,R= 1,03 (1,017 - 1,047, son las variables significativas en el análisis multivariante. Los puntos de cortes, para la edad son 54 años (Sensibilidad S= 0,72, Especificidad SP=0,77 y 15 años tras la última dosis años (S= 0,88, SP=0,86, por encima de este corte la probabilidad de no tener anticuerpos al Tétanos es alta. Conclusiones: Ante un trabajador que refiere o documenta que hace más de 15 años de la ultima dosis deberíamos plantearnos la revacunación, si además este trabajador refiere no tener más de 5 dosis inoculadas y tiene más de 54 años la revacunación sería muy recomendable.

  9. Prevalencia de anticuerpos contra Brucella sp. En donantes del banco de sangre de un hospital de Lima

    Directory of Open Access Journals (Sweden)

    Abel Ortega

    2007-10-01

    Full Text Available El Perú es un país endémico de Brucelosis, por lo que existe el riesgo de transmisión a través de sangre donada por no ser parte del tamizaje regular que realizan los bancos de sangre. Para conocer la prevalencia de anticuerpos contra Brucella en donantes del banco de sangre del Hospital Edgardo Rebagliati Martins, se analizó 1003 muestras de suero. La prueba tamiz fue Rosa de Bengala (RB; las muestras positivas fueron evaluadas por las pruebas de aglutinación en tubo (AT y 2-Mercaptoetanol (2-ME. Dos donantes fueron positivos a RB, confirmados por AT y 2-ME, se encontró una prevalencia de 0,20% (IC99%: 0,01-0,92. Se demostró la presencia de donantes portadores de anticuerpos contra Brucella con posible Brucelosis activa, evidenciándose la posibilidad de transmisión de esta infección. Se debe realizar mayores estudios con la finalidad de conocer la realidad de otros bancos de sangre.

  10. Uso de anticuerpos contra proteínas extracelulares de bacterias de la microbiota intestinal como biomarcadores de Enfermedad Inflamatoria Intestinal

    OpenAIRE

    Hevia González, Arancha

    2012-01-01

    En este trabajo se pretende utilizar los niveles de anticuerpos dirigidos contra bacterias ingeridas con los alimentos, representantes de la microbiota intestinal, como posibles biomarcadores para uso en la Enfermedad Inflamatoria Intestinal con el fin de facilitar el desarrollo de mejores métodos de diagnóstico precoz.

  11. Evaluación de anticuerpos contra enfermedades prevenibles por vacunas en el binomio madre–recién nacido en hospitales de Ciudad de La Habana

    Directory of Open Access Journals (Sweden)

    Rolando Felipe Ochoa

    2007-08-01

    Full Text Available El sistema inmune es inmaduro en los recién nacidos, lo que los hace susceptibles a las enfermedades infecciosas, sin embargo, pueden ser parcialmente protegidos por los anticuerpos adquiridos a través de la placenta. Por ello, nos propusimos evaluar la transferencia transplacentaria de anticuerpos contra algunas enfermedades prevenibles por vacunas. Se realizó un ensayo prospectivo, aleatorio, en el binomio madre–recién nacido. Para ello se analizó un total de 96 pares de muestras de suero, tomadas en el salón de preparto y al nacimiento en hospitales de Ciudad de La Habana, durante el año 2004. Se emplearon técnicas inmunoenzimáticas para determinar los niveles de antitoxina tetánica (ATT, antitoxina diftérica (ATD y anticuerpos contra proteínas de membrana externa del meningococo B (PME, contra el polisacárido capsular del meningococo C (PSC y contra el polisacárido Vi de Salmonella Typhi. Se detectó un nivel apropiado de ATT, tanto en las madres como en los recién nacidos, predominando los valores correspondientes a la protección de larga duración (>1 UI/mL, con 88,54% y 92,71%, respectivamente. Se observó niveles de ATD inferiores a 0,1 UI/mL, límite para una protección confiable, en el 54,17% y 45,83% de las madres y los recién nacidos. El 90,63% de las madres y el 96,88% de los recién nacidos presentaron concentraciones de anticuerpos contra PME superiores a 2 µg/mL, así como el 38,54% y el 41,67% para anticuerpos contra PSC. La seroprotección contra la Salmonella Typhi (>1 µg/mL fue de 5,21% y 8,33%, respectivamente. La mayoría de los recién nacidos presentaron títulos superiores de anticuerpos al de sus madres, lo cual demuestra que la transferencia transplacentaria de anticuerpos es un mecanismo eficiente.

  12. Prevalencia de anticuerpos contra Leptospira en personas asintomáticos y en perros de Chancay, Lima 2001

    Directory of Open Access Journals (Sweden)

    Manuel Céspedes

    2007-10-01

    Full Text Available Objetivos. Determinar la prevalencia de anticuerpos contra Leptospiras en personas asintomáticas dedicadas a la agricultura, pesca y comercio y en perros domésticos de localidades de Chancay (Huaral, Lima. Material y métodos. Estudio transversal analítico, se tomó muestras de suero de 268 pobladores de tres localidades, en quienes se evaluó la presencia de anticuerpos totales contra Leptospiras por el método de ELISA IgG y la prueba de microaglutinación (MAT. Se buscaron los factores asociados con la positividad a Leptospiras calculando el OR con su intervalo de confianza al 95%. De la misma manera, se tomó muestras de suero de 241 perros a los que se realizó la prueba de MAT. Resultados. La prevalencia de anticuerpos contra Leptospira en población asintomática fue de 10,1% (IC95%: 6,3-13,9, la cual estuvo asociada con el abastecimiento de agua para consumo en quebrada o pozo (OR: 3,48, IC95%: 1,39-8,74, con el antecedente de nadar en el río o acequia (OR: 4,75, IC95%: 1,51-14,92 y con tener una edad entre 21-40 años (OR: 2,47, IC95%: 1,10-5,52. Los serovares más frecuentes fueron Icterohaemorrhagiae y Canicola según MAT. En canes, 27,8% (67/241 tuvieron serología positiva a leptospiras. Conclusiones. Existe una mediana prevalencia de serología positiva para Leptospiras en la población general asintomática y condiciones favorables para la presencia de Leptospiras en las localidades estudiadas. En estas zonas se recomienda realizar actividades educativas preventivas frecuentes, tomando en cuenta los resultados de este estudio y el personal de salud debe sospechar de la leptospirosis como una causa de enfermedad febril.

  13. DETECCIÓN DE ANTICUERPOS ANTI-Leishmania (Trypanosomatidae EN POBLACIONES CANINAS DEL DEPARTAMENTO DE SUCRE, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Luís Enrique Paternina Tuirán

    2015-11-01

    Full Text Available RESUMENEl objetivo de la investigación fue determinar la prevalencia de anticuerpos anti-Leishmania en perros del departamento de Sucre, Colombia. Se analizaron 122 perros del área rural de los municipios de Ovejas, Sampués y Sincelejo, mediante la técnica de inmunofluorescencia indirecta (IFI. Anticuerpos anti-Leishmania fueron detectados en el 69,6 % (IC95 % = 61,1 – 78,2 de la población canina estudiada. En el municipio de Sincelejo la seropositividad fue del 72 % (IC95 % = 61,1 – 82,8, en el municipio de Sampués del 68,4 % (IC95 % = 52,3 – 84,5 y en el municipio de Ovejas del 55,5 % (IC95 % = 21,2 – 86,3. Los animales seropositivos fueron principalmente caninos jóvenes y adultos. El 17,6 % de los perros seropositivos mostró signos clínicos compatibles con leishmaniasis canina, entre los cuales la onicogrifosis, alopecia y caquexia fueron los más comunes. La alta frecuencia de caninos con anticuerpos a Leishmania detectada en el presente estudio, pone de manifiesto la hiperendemicidad de la leishmaniasis canina en esta zona del país, así como el alto riesgo de brotes epidémicos de la enfermedad.ABSTRACTThe aim of this survey was to determine prevalence of antibodies against Leishmania in dogs from Sucre, Colombia. We analyzed 122 dogs in rural areas from municipalities of Sampués, Ovejas and Sincelejo, by indirect immunofluorescence (IFA. Anti-Leishmania antibodies were detected in 69.6 % (95 % CI = 61.1 to 78.2 of the selected canine population. In the municipality of Sincelejo, Sampues and Ovejas, the seropositivities were 72 % (95 % CI = 61.1 to 82.8, 68.4 % (95 % CI = 52.3 to 84.5 and 55.5 % (95 % CI = 21.2 to 86.3 respectively. Seropositive animals were mainly young and adult dogs. The 17.6 % of seropositive dogs showed clinical signs compatible with canine leishmaniasis; onychogryphosis, alopecia and cachexia were the most common ones. The detected high frequency of canines with antibodies against Leishmania in the

  14. Cinética y capacidad neutralizante de los anticuerpos homólogos y heterólogos contra serotipos de virus dengue en relación con el intervalo entre las infecciones, la secuencia de infección, duración de la viremia y la amplificación dependiente de anticuerpos en infecciones primarias y secundarias

    OpenAIRE

    Alvarez Vera, Mayling

    2008-01-01

    Para sustentar el papel de la infección secundaria en la etiopatogenia del Dengue y Dengue Hemorrágico en epidemias por Dengue 2 y 3 y la influencia de la secuencia de infección e intervalo de tiempo sobre la sensibilización , evaluamos la presencia de anticuerpos específicos contra serotipos, la cinética de anticuerpos neutralizantes en sueros inmunes a Dengue 1 colectados 4 y 20 años después de la primoinfección, la amplificación dependiente de anticuerpos después de 20 años, la capacidad n...

  15. Asociación entre la presencia de anticuerpos anti-Ras y anti-VPH16 E4/E7 y lesiones intraepiteliales del cérvix

    Directory of Open Access Journals (Sweden)

    Vázquez-Corzo Sara

    2003-01-01

    Full Text Available OBJETIVO: Determinar si anticuerpos séricos contra E4, E7 y Ras pueden ser utilizados como marcadores de lesiones tempranas del cérvix uterino asociadas al virus del papiloma humano. MATERIAL Y MÉTODOS: Entre marzo de 1999 y abril de 2000 se realizó un estudio sero-epidemiológico de casos y controles en la clínica de displasias del Hospital General Doctor Gea González, en la Ciudad de México, en 116 muestras de suero para evaluar la presencia de anticuerpos anti-E4, E7 y Ras utilizando un ELISA de captura. Se estimaron razones de momios e intervalos de confianza de 95% RESULTADOS: Anticuerpos anti-E7 se asociaron a mujeres con lesiones NIC III, mientras que anticuerpos anti-E4 y anti-Ras fueron más frecuentes en lesiones NIC I-II. Al evaluar el perfil de anticuerpos que presentaron las mujeres, encontramos que a anticuerpos contra dos proteínas predicen la existencia de una lesión NIC I-II, y b la presencia de tres anticuerpos predicen una lesión NIC III. CONCLUSIONES: La detección de anticuerpos séricos contra E4, E7 y Ras en combinación con otras técnicas de diagnóstico, podrían ser de utilidad para detectar oportunamente a mujeres con lesiones tempranas asociadas al Virus del Papiloma Humano y en riesgo de desarrollar cáncer.

  16. Anticuerpo anticitrulina y manifestaciones extra articulares en artritis reumatoidea Anticitrulin antibody and the extra-articular manifestations in rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    María Jezabel Haye Salinas

    2013-02-01

    Full Text Available Los pacientes con artritis reumatidea (AR pueden desarrollar manifestaciones extra articulares (MExA, relacionadas a su morbi-mortalidad. Los anticuerpos anti-péptidos citrulinados cíclicos (ACCP son específicos para la AR y estan relacionados con el daño articular; y podrían tener rol patogénico en las MExA. Nuestro objetivo fue determinar la relación entre los anticuerpos ACCP y MExA en pacientes con AR. Se incluyeron 74 pacientes con diagnóstico de AR (ACR 1987 mayores de 18 años, de más de 6 meses de evolución, con MExA, y un control apareado por sexo y edad sin MExA por cada paciente. Las variables demográficas, clínicas y de laboratorio se compararon con test t, chi cuadrado o Mann-Whitney. Se realizó análisis multivariado; p ≤ 0.05. Los pacientes con MExA presentaron mayor título de anticuerpo ACCP (116 vs. 34, p A large proportion of rheumatoid arthritis (RA patients develop extra-articular manifestations (EAM, which are associated with morbidity and early mortality. Anti cyclic citrullinated peptide (ACCP antibody has proven to be highly specific for the diagnosis of RA, associated with severe joint damage and may have some role in the pathogenesis of EAM. The aim of this study was to determine the relationship between ACCP antibody and the presence of EAM in RA patients. Seventy four RA patients (ACR 1987 with EAM, > 18 years, more than 6 months duration were included, and an EAM free control, matched by sex and age, for each patient. Demographic, clinical and laboratory variables were compared using t-test, chi-square or Mann-Whitney test. Multivariate analysis was performed: p ≤ 0.05. Patients with EAM presented a greater value of ACCP antibody (116 vs. 34, p < 0.01 and rheumatoid factor (108 vs. 34.5, p < 0.01. Independent association with current smoking habit (p = 0.02, OR = 3.78, 95%: 1.17-12.2, RF positive (p = 0.04, OR 3.23, CI 95%: 1.04 to 11.8 and ACCP antibody positive (p = 0.04, OR 3.23, 95% CI: 1

  17. Anticuerpos frente a virus West nile y otros virus transmitidos por artropodos en la poblacion del Delta del Ebro

    Directory of Open Access Journals (Sweden)

    Lozano Alvaro

    1998-01-01

    Full Text Available FUNDAMENTOS: El virus West Nile (VWN es un Flavivirus que se transmite al hombre a través de distintas especies de mosquitos y produce brotes y casos esporádicos de enfermedad en distintas regiones del Viejo Mundo, incluída la Cuenca Mediterránea. Las zonas húmedas europeas que acogen aves migratorias procedentes de África constituyen áreas de alto riesgo para esta infección, así como para otras infecciones víricas transmitidas por artrópodos. MÉTODOS: Con objeto de investigar la prevalencia de la infección por el VWN y otros virus de transmisión similar en la población humana del Delta del Ebro, se estudiaron 1037 muestras de suero, obtenidas en 10 localidades de la zona, para presencia de anticuerpos frente a VWN y otros 12 virus transmitidos por artrópodos (3 Alfavirus, 8 Flaviviridae y 1 Bunyaviridae mediante titulación por inhibición de la hemaglutinación (IHA. En algunos casos se estudió la presencia de IgM específica por IHA tras fraccionar el suero por centrifugación en gradientes de sacarosa. RESULTADOS: En total, se encontró reactividad significativa frente a alguno de los virus probados en 130 casos (12.5%; 4.1% frente a Alfavirus, 8.0% frente a Flaviviridae y 0.4% frente a Bunyaviridae. El análisis de los títulos de anticuerpos reveló porcentajes significativos de muestras con títulos elevados frente a antígenos de VWN y otros. La distribución de la seroprevalencia fue muy desigual, concentrándose fundamentalmente en 3 localidades del interior del Delta (Ampolla, San Jaime y Montells, donde la prevalencia de anticuerpos frente a Flaviviridae llegó a alcanzar el 30% y se observaron niveles residuales de IgM frente a VWN en algunos sueros. CONCLUSIONES: Estos resultados y los obtenidos previamente en otras regiones de la Península Ibérica sugieren que el VWN circula en la población humana de las zonas de riesgo y produce brotes epidémicos periódicos. Habida cuenta del alto porcentaje de

  18. Prevalencia de anticuerpos para Trypanosoma cruzi en caninos de dos municipios endémicos de Boyacá

    Directory of Open Access Journals (Sweden)

    Diego Manrique Abril

    2012-04-01

    Full Text Available Objetivo. evaluar la prevalencia de anticuerpos anti Trypanosoma cruzi (T. cruzi en una muestra de caninos domésticos residentes en dos municipios endémicos. Materiales y métodos. Se tomaron muestras séricas de 20 caninos procedentes de hogares donde residen mujeres gestantes seropositivas y 40 perros habitantes de hogares de mujeres gestantes seronegativas en Miraflores y Moniquira, Boyacá. El análisis se realizó mediante prueba diagnóstica rápida dipstick de InBios. Resultados. Se encontró prevalencia del 16.7% en Moniquirá y del 13.3% Miraflores respectivamente con una prevalencia general del 15% en los dos municipios. Se halló riesgo 3 veces mayor de que ocurra la infección en caninos, en los hogares donde residen gestantes seropositivas; además la infestación por pulgas y garrapatas en el animal, hábitat cercano a la vivienda, se relacionan con mayor seropositividad en el canino. Conclusiones. La raza, el sexo, la presencia de aves en la casa y al examen clínico general son considerados factores pronósticos en en la infección por Trypanosoma cruzi en caninos. Como factores protectores se identificó la desparasitación y vacunación de los animales.

  19. Prevalencia de anticuerpos contra Trypanosoma cruzi en donadores de sangre del IMSS, Orizaba, Veracruz, México

    Directory of Open Access Journals (Sweden)

    Ramos-Ligonio Angel

    2006-01-01

    Full Text Available OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores del Hospital General Regional del Instituto Mexicano del Seguro Social (IMSS en la ciudad de Orizaba, Veracruz. MATERIAL Y MÉTODOS: Se examinaron muestras de donadores del banco de sangre del Hospital General Regional (HGRO del IMSS para la búsqueda de antiT. cruzi por ELISA, Western blot e IFI, utilizando una proteína recombinante (MBP::Hsp70 y un extracto crudo de epimastigotes. Las muestras fueron obtenidas entre los meses de octubre de 2001 a enero de 2002. RESULTADOS: Los 420 donadores de sangre analizados fueron seronegativos para HBV, HCV, BrA, VDRL y HIV. Después del tamizaje de los 420 donadores, se identificaron dos individuos seropositivos por las pruebas de ELISA, Western blot e IFI, con una seroprevalencia de 0.48%. CONCLUSIONES: En este estudio se muestran evidencias de seropositividad para T. cruzi en donadores de sangre del HGRO, lo que sugiere la existencia de riesgo de contaminación por transfusión sanguínea. Por tal motivo, es necesario aplicar programas para el tamizaje serológico a través de técnicas inmunológicas con alta sensibilidad y especificidad.

  20. Presencia de anticuerpos sericos contra Neospora caninum en equinos en Chile Sera antibodies to Neospora caninum in Chilean horses

    Directory of Open Access Journals (Sweden)

    A.N. Patitucci

    2004-12-01

    Full Text Available Neospora sp. es un parásito protozoario causante de abortos y/o enfermedad del Sistema Nervioso Central (SNC en caninos, bovinos, ciervos, caprinos, ovinos, equinos y otros. En equinos, se lo ha involucrado como causa de aborto, mortalidad neonatal y enfermedades del SNC y viscerales. La especie que infecta a los equinos es distinta a Neospora caninum y se denomina Neospora hughesi. En Chile no existe evidencia de infección en equinos, sin embargo, la enfermedad ha sido informada en bovinos y caninos, por lo que el objetivo de este trabajo fue buscar anticuerpos contra la enfermedad en sueros equinos . Para ello se tomaron muestras de sangre a 145 equinos (87 de la IX Región y 58 de la VIII Región de Chile. Los sueros fueron analizados mediante Test de Aglutinación para Neospora (NAT. Cada suero se diluyó en 1:40 en solución salina tamponada (PBS pH 7.2 conteniendo 2- mercaptoetanol y fueron analizados en 1:40 y 1:80. Los sueros positivos a 1:80 fueron examinados a 1:160 y 1:320. Anticuerpos contra N.caninum (≥ 1:40 se encontraron en 32% (47/145 de los equinos estudiados. Debido a que N.caninum y N.hughesi dan reacción cruzada, ambos o uno de ellos podrían ser los responsables de la seropositividad. Estos resultados indican que equinos provenientes de la VIII y IX regiones de Chile son reaccionantes a la infección de Neospora, por lo que su diagnóstico presuntivo debería ser considerados ante la presencia de cuadros clínicos con sintomatología nerviosa y/o abortos en esta especie.Neospora caninum is a protozoan parasite that affects cattle and dogs, its infections seem to be widely prevalent in Chile. To date, nothing is known of the presence of N. caninum in horse population of the country. In South America, two seroprevalence studies have failed to find antibodies in Argentina and Brazil. The objective of the study was to investigate the presence of N. caninum exposure in horses of Chile. Sera from 145 asymptomatic horses (87

  1. Vasculitis asociadas a anticuerpos anti-citoplasma de neutrófilos: Clínica y tratamiento

    Directory of Open Access Journals (Sweden)

    María Virginia Paolini

    2013-04-01

    Full Text Available Las vasculitis asociadas a anticuerpos anti-citoplasma de neutrófilos (ANCA comprenden a un grupo de enfermedades caracterizadas por la inflamación de la pared de pequeños vasos. Analizamos las características epidemiológicas y clínicas en una serie de 47 pacientes: 23 (49% granulomatosis de Wegener (GW, 15 (32% poliangeítis microscópica (PAM y nueve (19% vasculitis limitada al riñón (VLR. La edad media al inicio de los síntomas fue de 50.7 ± 14.9 años. La manifestación clínica más frecuente fue el compromiso renal en 41 (87% pacientes, seguido por el pulmonar en 26 (55% y el otorrinolaringológico en 17 (36%. En 26 (55% se asoció compromiso renal y pulmonar. La forma clínica más frecuente fue la generalizada en 23 (49%, seguida por la grave en 18 (38%. El 89% presentaron determinaciones de ANCA positivas. Cuatro (8% no recibieron tratamiento inmunosupresor de inicio. De los 43 que recibieron tratamiento de inicio, 29 (67% tuvieron remisión completa, con un tiempo de remisión promedio de 35.3 meses. Once (26% presentaron recaídas, diez (91% recaídas mayores y uno (9% menor. Doce (28% fallecieron, siete en forma temprana y cinco durante la evolución de la enfermedad. Quince (31% evolucionaron a insuficiencia renal crónica. Los 26 pacientes en seguimiento tuvieron respuesta al tratamiento y 20 (77% de ellos estaban en remisión al finalizar el estudio. Las vasculitis asociadas a ANCA continúan siendo enfermedades de alta morbilidad y mortalidad, a pesar de las mejorías logradas con los tratamientos inmunosupresores.

  2. Anticuerpos antiprotrombina y resistencia adquirida a la proteína C activada en el síndrome antifosfolipídico

    OpenAIRE

    Muñoz Rodríguez, Francisco José

    2003-01-01

    El síndrome antifosfolipídico (SAF) se caracteriza clínicamente por la aparición de fenómenos trombóticos recurrentes, complicaciones obstétricas, tales como abortos o pérdidas fetales recurrentes, y trombocitopenia. Inmunológicamente se define por la presencia de los anticuerpos antifosfolipídicos (AAF), un grupo heterogéneo de autoanticuerpos que reconocen complejos constituidos por fosfolípidos de membrana y proteínas plasmáticas que actúan como cofactores. Los mejor conocidos y que ayudan...

  3. Detección de anticuerpos contra Borrelia burgdorferi e identificación de garrapatas ixodidas en Piura Y Amazonas, Perú

    OpenAIRE

    Martha Glenny A; Leonardo Mendoza U; Eduardo Falconí R

    2004-01-01

    Objetivos: Detectar anticuerpos IgG/IgM contra Borrelia burgdorferi en población general, procedentes de los departamentos de Piura y Amazonas e identificar especies de garrapatas probablemente incriminadas en la transmisión de la enfermedad de Lyme. Material y Métodos: Entre agosto del año 2001 y junio de 2002, se colectaron muestras de sangre de 232 pobladores procedentes de ocho localidades del Departamento de Piura y 12 del Departamento de Amazonas, para evaluar mediante ELISA Captia™ Lym...

  4. Estudio de señales de direccionamiento vacuolar del receptor AtRMR1 y su aplicación en la expresión de un anticuerpo recombinante en plantas

    OpenAIRE

    Scabone, Camila

    2012-01-01

    Existe una creciente necesidad de desarrollo de plataformas de producción, a gran escala y de bajo costo, de anticuerpos completos, de manera de satisfacer sus demandas en los distintos tipos de aplicaciones, terapéuticas o diagnósticas. Las plantas son potencialmente el sistema de producción más económico, sin embargo todavía hay que superar varios obstáculos, entre ellos la degradación proteolítica que impacta sobre la calidad y los niveles de acumulación de los anticuerpos producidos. En e...

  5. Prevalencia de anticuerpos contra dengue y leptospira en la población de Jáltipan, Veracruz Prevalence of dengue and leptospira antibodies in the state of Veracruz, Mexico

    OpenAIRE

    Joel Navarrete-Espinosa; Juan Antonio Acevedo-Vales; Emilia Huerta-Hernández; Jorge Torres-Barranca; Dolores Guadalupe Gavaldón-Rosas

    2006-01-01

    OBJETIVO: Conocer la prevalencia de anticuerpos contra dengue y leptospira en Jáltipan, Veracruz, México MATERIAL Y MÉTODOS: Estudio transversal en 500 habitantes de Jáltipan, Veracruz, mediante un muestreo por hogares, aplicación de cuestionario y toma de muestras sanguíneas. Se buscaron anticuerpos IgG y se evaluaron factores asociados a sus seroprevalencias mediante regresión logística RESULTADOS: La seroprevalencia global para denguevirus fue 79.6% (IC95% 76-81); los principales factores ...

  6. Detección de anticuerpos contra Borrelia burgdorferi e identificación de garrapatas ixodidas en Piura Y Amazonas, Perú

    Directory of Open Access Journals (Sweden)

    Martha Glenny A

    2004-01-01

    Full Text Available Objetivos: Detectar anticuerpos IgG/IgM contra Borrelia burgdorferi en población general, procedentes de los departamentos de Piura y Amazonas e identificar especies de garrapatas probablemente incriminadas en la transmisión de la enfermedad de Lyme. Material y Métodos: Entre agosto del año 2001 y junio de 2002, se colectaron muestras de sangre de 232 pobladores procedentes de ocho localidades del Departamento de Piura y 12 del Departamento de Amazonas, para evaluar mediante ELISA Captia™ Lyme IgG/IgM (Trinity biotech la presencia de anticuerpos contra Borrelia burgdorferi. Además, se colectaron garrapatas en animales domésticos por búsqueda directa. Resultados: Se detectó seropositividad en 9,9 % de los sueros evaluados. Asimismo, de 433 garrapatas colectadas se identificaron los géneros: Ixodes (5,5%, Amblyomma (18,0%, Rhipicephalus (23,5%, Anocentor (31,1% y Boophilus (21,7%. Conclusiones: Existen personas seropositivas por Borrelia en Piura y Amazonas, coincidiendo con los hallazgos realizados en Sapillica en el año 1992, además se detectó la presencia de garrapatas del género Ixodes en Piura.

  7. Estudio del perfil de anticuerpos contra Helicobacter pylori producidos por pacientes con diferentes patologías gastroduodenales

    Directory of Open Access Journals (Sweden)

    Spinel Clara

    2004-12-01

    Full Text Available La colonización de la mucosa gástrica con Helicobacter pylori causa la infección bacteriana más frecuente a nivel mundial que es la mayor causa de enfermedades gastrointestinales en humanos. Con el objetivo de examinar el reconocimiento de antígenos de dos cepas de la bacteria en
    150 pacientes infectados y con inflamación (30 de gastritis crónica no atrófica G, úlcera duodenal (30 UD, patologías preneoplásicas (30 de gastritis atrófica GA y 30 de metaplasia intestinal MI y adenocarcinoma gástrico (30 C, se realizó un sistema de cultivo de Helicobacter pylori
    con células epiteliales gástricas. Los sobrenadantes de estos cocultivos fueron empleados como preparación antigénica en pruebas de inmunotransferencia, en las que se detectaron los anticuerpos
    IgG totales, al igual que sus cuatro subclases (IgG1, IgG2, IgG23, IgG4 en los sueros de los pacientes. Se encontró que los perfiles antigénicos de las dos cepas de Helicobacter pylori, aisladas de un paciente con úlcera duodenal y uno con adenocarcinoma gástrico, eran semejantes, con 23 proteínas comunes que incluían los principales factores de virulencia de la bacteria (CagA, VacA, Ureasa, Flagelina. Aunque los sueros mostraron un reconocimiento variado de cada uno de los antígenos, no se encontraron diferencias entre el número de antígenos reconocidos según la patología ni la cepa, tanto para las IgG totales (p = 0,98, como cada una de las subclases (IgG1:p = 0,97; IgG2: p = 0,72; IgG3: p = 0,61; IgG4: p = 0,84. Con el fin de analizar simultáneamente la respuesta de los pacientes hacia el total de los 23 antígenos, se aplicaron análisis multivariados gracias a los cuales se distinguieron cuatro proteínas, de 70,
    82, 90 kDa y VacA de 86 kDa como los principales antígenos implicados en la respuesta inmune de las personas infectadas. Adicionalmente, se diferenciaron dos grupos de patologías según el reconocimiento del conjunto de antígenos: por

  8. Anticuerpos anti 21 hidroxilasa séricos en pacientes con anticuerpos antifracción microsomal: Síndrome poliendocrino autoinmune Seric 21- hydroxilase antibodies in patients with anti-microsomal fraction antibodies: Autoimmune polyendocrine syndrome

    Directory of Open Access Journals (Sweden)

    Silvia Botta

    2007-04-01

    Full Text Available El síndrome poliendocrino autoinmune (SPA es la asociación de enfermedades endocrinas autoinmunes con otros desórdenes autoinmunes no endocrinos. Los tipos 1, 2 y 4 presentan adrenalitis autoinmune, esto indica la presencia de autoanticuerpos, y su marcador serológico específico es el anti 21 hidroxilasa (a21-OH. El SPA tipo 2 es la asociación de adrenalitis, enfermedad tiroidea y/o diabetes mellitus inducidas por autoanticuerpos. Como componentes menores, pueden estar asociados entre otros, vitiligo, alopecia y miastenia. Nuestros objetivos fueron: establecer la prevalencia de a21-OH séricos en pacientes con anticuerpos anti fracción microsomal (AFM positivos, enfermedad tiroidea autoinmune y/o afecciones endocrinas y no endocrinas autoinmunes; diagnosticar formas incompletas de SPA y estudiar individuos con probable riesgo de progresión a un SPA completo. Estudiamos 72 pacientes AFM positivos y 60 sujetos tomados como grupo control, AFM negativos. Hallamos a21-OH elevados en dos pacientes: A= 47 U/ml, hipotiroidismo autoinmune y miastenia; y B= 8.75 U/ml, hipotiroidismo autoinmune y vitiligo; ambos con ausencia de insuficiencia adrenal. La prevalencia de a21-OH encontrada fue del 2.8%. Las pacientes A y B corresponden a un SPA tipo 2 incompleto y latente en relación al componente adrenal. Considerando a los a21-OH marcadores de enfermedad autoinmune latente, el eventual riesgo de evolución hacia la afección clínica sugiere la necesidad de estrechos controles clínicos y bioquímicos periódicos.Autoimmune polyendocrine syndrome (APS is the association of autoimmune endocrine diseases, with other autoimmune nonendocrine disorders. APS types 1, 2 and 4 include autoimmune adrenalitis; this suggests the presence of autoantibodies. A specific serological marker for these is the anti 21- hydroxilase autoantibody (a21-OH. APS type 2 is the association of autoimmune adrenalitis, to autoimmune thyroid disease and/or diabetes mellitus, all

  9. DETERMINACIÓN DEL CATABOLISMO DE LOS ANTICUERPOS MATERNOS Y SU INTERACCIÓN CON DIFERENTES PLANES VACUNALES PARA LA ENFERMEDAD DE GUMBORO EN POLLOS DE ENGORDE

    Directory of Open Access Journals (Sweden)

    Robin O. J.

    2006-11-01

    Full Text Available Con el in de evaluar el catabolismo de los anticuerpos maternos y su interferencia con tres planes vacunales diferentes contra la enfermedad de Gumboro se realizó un estudio utilizando pollos de la estirpe Ross 308, divididos en cuatro grupos: grupo 1: control (sin vacuna; grupo 2: vacunado los días 1, 7 y 15; grupo 3: vacunados los días 1 y 12; y grupo 4: vacunado el día 12. En el primer experimento el biológico se suministró en el agua de bebida, y en el segundo se hizo en el pico. Se sacriicaron 15 aves de cada grupo a los 1, 12, 21 y 42 días de edad y se evaluó peso corporal, tamaño y peso de la bolsa de Fabricio, relación peso bolsa/peso corporal (PB/PC, grado de depleción linfoide, presencia de cepas estándar y/o variantes del virus y los títulos de anticuerpos para la enfermedad de Gumboro. El catabolismo de los anticuerpos maternos ocurrió entre los 21 y 28 días de edad. En los grupos vacunados no se evidenció una respuesta inmune activa frente a ningún plan vacunal. La relación PB/PC no indicó atroia de la bolsa en el experimento 1, aunque las lesiones histopatológicas en el último muestreo fueron grado 3; en el segundo experimento solamente el grupo 3 presentó una disminución en la relación PB/PC; las lesiones histopatológicas en el tercer y cuarto muestreos, en todos los grupos, fueron clasiicadas como grado 3 y 4. En los dos experimentos se detectó la presencia de cepas tanto clásicas como variantes y una baja respuesta humoral. Ninguno de los tres planes vacunales conirió adecuada protección a las aves.

  10. DETERMINACIÓN DEL CATABOLISMO DE LOS ANTICUERPOS MATERNOS Y SU INTERACCIÓN CON DIFERENTES PLANES VACUNALES PARA LA ENFERMEDAD DE GUMBORO EN POLLOS DE ENGORDE

    Directory of Open Access Journals (Sweden)

    R. Castañeda

    2006-01-01

    Full Text Available Con el in de evaluar el catabolismo de los anticuerpos maternos y su interferencia con tres planes vacunales diferentes contra la enfermedad de Gumboro se realizó un estudio utilizando pollos de la estirpe Ross 308, divididos en cuatro grupos: grupo 1: control (sin vacuna; grupo 2: vacunado los días 1, 7 y 15; grupo 3: vacunados los días 1 y 12; y grupo 4: vacunado el día 12. En el primer experimento el biológico se suministró en el agua de bebida, y en el segundo se hizo en el pico. Se sacriicaron 15 aves de cada grupo a los 1, 12, 21 y 42 días de edad y se evaluó peso corporal, tamaño y peso de la bolsa de Fabricio, relación peso bolsa/peso corporal (PB/PC, grado de depleción linfoide, presencia de cepas estándar y/o variantes del virus y los títulos de anticuerpos para la enfermedad de Gumboro. El catabolismo de los anticuerpos maternos ocurrió entre los 21 y 28 días de edad. En los grupos vacunados no se evidenció una respuesta inmune activa frente a ningún plan vacunal. La relación PB/PC no indicó atroia de la bolsa en el experimento 1, aunque las lesiones histopatológicas en el último muestreo fueron grado 3; en el segundo experimento solamente el grupo 3 presentó una disminución en la relación PB/PC; las lesiones histopatológicas en el tercer y cuarto muestreos, en todos los grupos, fueron clasiicadas como grado 3 y 4. En los dos experimentos se detectó la presencia de cepas tanto clásicas como variantes y una baja respuesta humoral. Ninguno de los tres planes vacunales conirió adecuada protección a las aves.

  11. Desarrollo de superficies modificadas oro - anticuerpo anti-PSPB para su uso como biosensor en la detección de preñez bovina

    OpenAIRE

    Justo Laíz; Karen Keel; Juan Pablo Tosar

    2011-01-01

    En este trabajo se presentan los resultados preliminares para el desarrollo de un biosensor amperométrico destinado a la cuantificación de Proteína B Específica de la Preñez (PSPB) en fluidos biológicos como medio de diagnóstico clínico precoz de la preñez bovina. A la superficie de oro modificada con ácido mercaptoundecanoico (MUA) se fijaron anticuerpos anti-PSPB y peroxidasa de rábano (HRP). Se verificó la inmovilización de las biomoléculas mediante voltamperometría cíclica y medida del án...

  12. Bajo índice de sospecha para deficiencia de anticuerpos en niños sometidos a procedimientos quirúrgicos de Otorrinolaringología

    Directory of Open Access Journals (Sweden)

    AB Ramírez-López

    2016-06-01

    Full Text Available INTRODUCCIÓN: las inmunodeficiencias primarias están subdiagnosticadas en todo el mundo, aun en centros de tercer nivel de atención. Los defectos de anticuerpos constituyen el grupo más prevalente y suelen manifestarse clínicamente después de los 6 meses de edad como infecciones respiratorias recurrentes causadas por bacterias encapsuladas. Algunas cirugías de oído-nariz y garganta se indican en pacientes con infecciones respiratorias recurrentes o complicadas que no han respondido adecuadamente al tratamiento médico. Estos niños sometidos a procedimientos quirúrgicos luego de una historia de infecciones respiratorias recurrentes pueden constituir un grupo de alto riesgo para inmunodeficiencias primarias.   OBJETIVO: indagar qué tan frecuentes son los defectos de anticuerpos en niños sometidos a cualquiera de tres cirugías de otorrinolaringología.   MATERIALES Y MÉTODOS: revisamos los expedientes electrónicos de niños que hubieran sido sometidos a adenoamigdalectomía (ATT, drenaje endoscópico de senos paranasales (ESD y colocación de tubos timpánicos de ventilación (TVT en nuestro instituto durante 2011-2012, en busca de niveles séricos de inmunoglobulinas (IgE, IgG, IgA, IgM.   RESULTADOS: encontramos 112 procedimientos quirúrgicos en 87 pacientes, de los cuales la indicación para cirugía fue infecciosa en 37 (21 varones, 1 muerto, edad media 7.3 años, más frecuentemente rinosinusitis (19/37 y amigdalitis (9/37 crónicas. Los procedimientos incluyeron: 24 adenoamigdalectomías, 13 drenajes endoscópicos de senos paranasales y 6 colocaciones de tubos timpánicos de ventilación, para un total de 43; ocho pacientes (21.6% fueron sometidos a más de una cirugía. La IgE sérica se encontró en el expediente de 27 pacientes (72.9%, y “al menos IgG” en 18 (48.6%. Sólo 70% de las pruebas fueron ordenadas antes de la cirugía. Los resultados anormales incluyeron: IgE elevada en 10/27, Ig

  13. Anticuerpos contra Chlamydophilaen pacientes con infarto agudo del miocardio y riesgo coronario, y su relación con la muerte Antibodies against Chlamydophila in patients with acute myocardial infarction and coronary risk and their association with mortality

    Directory of Open Access Journals (Sweden)

    Guadalupe García-Elorriaga

    2005-06-01

    Full Text Available OBJETIVO: Determinar si los anticuerpos contra Chlamydophila pneumoniae en pacientes con infarto agudo del miocardio y factores de riesgo coronario se asocian con la muerte. MATERIAL Y MÉTODOS: Se hizo un estudio observacional, prospectivo, transversal y comparativo. Se incluyeron en el estudio 100 sujetos que, entre 1999 y 2000, estuvieron hospitalizados en la Unidad Coronaria del Hospital de Especialidades del Centro Médico La Raza, del Instituto Mexicano del Seguro Social. Se trataba de una muestra constituida por pacientes de ambos sexos, mayores de 18 años, con infarto agudo del miocardio y riesgo coronario. Mediante microinmunofluorescencia indirecta se identificaron anticuerpos contra Chlamydophila pneumoniae, Chlamydophila psitacii y Chlamydia trachomatis. De entre los 100 sujetos, se eligieron al azar 33, a quienes se les determinaron anticuerpos contra Chlamydophila, no sólo durante su estancia en el hospital, sino también al salir de éste y a los tres meses de haber sufrido el infarto agudo del miocardio. Se calcularon las medias y las desviaciones geométricas estándares para los títulos de anticuerpos contra Chlamydophila, y se determinó la razón de momios y el intervalo de confianza al 95% entre los factores de riesgo coronario y la muerte. RESULTADOS: Setenta por ciento de los pacientes de la muestra inicial presentaron anticuerpos contra Chlamydophila pneumoniae; no se identificaron anticuerpos contra Chlamydophila psitacii y Chlamydia trachomatis. No se observó una fuerza de asociación estadísticamente significativa con la muerte en pacientes con infarto agudo del miocardio y factores de riesgo coronario. De los 33 individuos de la submuestra, 25 presentaron anticuerpos contra Chlamydophila pneumoniae, y en 83% de estos últimos casos, se registró un descenso de dichos anticuerpos a los tres meses de haberse presentado el infarto agudo del miocardio. CONCLUSIONES: A pesar de que en pacientes con infarto agudo del

  14. UltramicroELISA indirecto para la deteccion de anticuerpos totales a citomegalovirus en suero humano Indirect Ultramicroelisa assay for the detection of human antibodies to cytomegalovirus using human serum samples

    OpenAIRE

    Jose Laferte; Miguel Marrero; Maritza Alvarez; Liliana Jomarron; Serafina Garcia; Susana Vazquez; Luis Morier; Mario Ulacia; Antonio Melchor

    1992-01-01

    Se normalizó un ultramicroELISA indirecto para la detección de anticuerpos a Citomegalovirus (CMV) humano (UMELISA CMV). Se determinó la concentración óptima de antígeno en 30 ug/ml, la dilución de los sueros fue de 1:40 y la dilución de trabajo del conjugado fue de 1:1500. El UMELISA CMV fue comparado con las técnicas de aglutinación de latex para anticuerpos anti-CMV (Dupont de Neumors) y la inmunofluorescencia indirecta (EFT). Los resultados mostraron un alto grado de concordancia y elevad...

  15. Asociación entre anticuerpos antifosfolípidos y complicaciones de la gestación en mujeres de Costa Rica

    Directory of Open Access Journals (Sweden)

    Roubier Rojas-Barahona

    2007-04-01

    Full Text Available Objetivo: Determinar asociación entre los anticuerpos antifosfolípidos y complicaciones de la gestación (aborto de cualquier tipo, preeclampsia, eclampsia, insuficiencia placentaria grave o parto antes de la semana 34 de gestación, tomando como base la población de pacientes del servicio de Obstetricia del Hospital México. Materiales y métodos: Estudio de casos y controles en la población de pacientes atendidas por el servicio de Obstetricia del Hospital México en el período comprendido entre enero de 2002 y diciembre de 2004. Se tomaron los datos del registro de egresos Hospitalarios, se hizo un análisis descriptivo, en análisis univariado y multivariado de las principales variables registradas. Resultados: El promedio de edad de las pacientes en los casos y los controles no mostró diferencia significativa. La provincia de San José reporta el mayor porcentaje de casos con un 39.9%, seguido por Heredia con un 26.8% y Alajuela con un 24.6%. En cuanto al número de gestaciones, se determinó que no influyen significativamente en relación con el aborto y otras complicaciones de la gestación. El análisis univariado y multivariado mantiene asociación entre los antecedentes clínicos de las gestaciones anteriores, además de los anticuerpos antifosfolípidos respecto al aborto y otras complicaciones de la gestación. Conclusión: Los anticuerpos antifosfolípidos deberían ser tomados en cuenta como parte del seguimiento del embarazo en pacientes con historia de abortos y complicaciones de la gestación en embarazos previos.Aim: To determine the association between antiphospholipid antibodies and pregnancy failures (abortion, preclampsia, eclampsia, placental insufficiency or delivery before the 34th week of gestation in Costa Rican women. Materials and Methods: The present is a case-control study, the participants belong to the Obstetrics Department of the Hospital Mexico. The period of the study was from January 2002 to December

  16. Patrón de immunoblotting y niveles de anticuerpos anti-Toxoplasma gondii en suero y humor acuoso de pacientes con lesiones de toxoplasmosis ocular

    Directory of Open Access Journals (Sweden)

    Morella Bouchard Pereira

    2014-07-01

    Full Text Available El objetivo de este estudio fue evaluar en muestras de suero y humor acuoso los niveles de anticuerpos anti-toxoplasma a través del Coeficiente de Goldmann y Witmer (CGW y el patrón de reconocimiento antigénico a través del immunoblotting (IB, en pacientes con serología positiva con y sin lesiones de toxoplasmosis ocular. Se recogieron simultáneamente muestras de suero y humor acuoso de 26 pacientes: un grupo de casos que poseían lesiones retinales de toxoplasmosis ocular en fase activa e inactiva (n=17 y un grupo control que requería cirugía ocular por presencia de cataratas (n=9. Las determinación de IgM e IgG específicas se realizó por ELISA de inmunocaptura e indirecto, respectivamente. Se utilizó la inmunodifusión radial para la cuantificación de la IgG total. El CGW resultó >2, indicativo de producción local de anticuerpos específicos en 12/17 de los casos, mientras que en los controles no se observó, esto evidenció una sensibilidad del 71% y una especificidad de 100%. En IB, la aparición de bandas diferentes en humor acuoso, indicativo de producción local de anticuerpos específicos se observaron en 11/17 de los casos y 1/9 de los controles, reflejando una sensibilidad de 65% y una especificidad de 89%. Al considerar las dos pruebas la sensibilidad se incrementó a un 73%, pero la especificidad disminuyó a 89%. En conclusión el IB es útil como prueba confirmatoria para diagnóstico de toxoplasmosis ocular, pero sólo como un complemento del coeficiente de GW especialmente en pacientes con lesiones atípicas donde el diagnóstico clínico es difícil. Aqueous humor and serum immunoblotting profiles and anti–toxoplasma gondii antibodies in patients with toxoplasmosis-induced retinal lesions Abstract The purpose of this study was to analize the anti-Toxoplasma gondii antibodies levels in serum and aqueous humor samples in patients with ocular toxoplasmosis by using Goldman and Witmer Coefficient (GWC and the

  17. Neosporosis canina: Presencia de anticuerpos sericos en poblaciones caninas rurales y urbanas de Chile Neosporosis canine: detection of sera antibodies in rural and urban canine population of chile

    Directory of Open Access Journals (Sweden)

    A.N. Patitucci

    2001-01-01

    Full Text Available Neospora caninum es un protozoo parásito cuya infección se ha reportado en vacunos, caninos y otras especies en diversas partes del mundo. Los perros actúan como huéspedes definitivos e intermediario a la vez. En esta especie la enfermedad se caracteriza por paresia y/o parálisis de los miembros posteriores y puede ser fatal tanto en cachorros infectados transplacentariamente como en adultos. En Chile, no existe información sobre Neospora en caninos pero se ha demostrado la presencia de anticuerpos contra el protozoo en bovinos, por tal motivo se propuso la identificación de la infección mediante la detección de anticuerpos séricos contra N. caninum en perros. Se estudiaron 201 sueros caninos de diferentes edades, sexo, raza, ambiente ("rural" vs. "urbano" y tipo de alimentación ("carne cruda" vs. "no cruda" en una dilución 1:50 mediante la técnica de Inmuno Fluorescencia Indirecta (IFA. Del total de perros estudiados, el 18% (36/201 presentó anticuerpos contra N. caninum. Además se demostró asociación entre la cantidad de positivos y el ambiente y con el tipo de alimentación; no obstante, no hubo relación con el sexo, raza y edad. Los resultados indican que el pertenecer al ambiente rural y/o consumir carne cruda pueden ser importantes factores de riesgo dentro de la epidemiología de la infección por N.caninum. Complementariamente se procesaron dos sueros de zorros (Pseudolapex fulvipes mediante la técnica del Aglutinación de taquizoitos de Neospora (NAT que resultaron positivos hasta la máxima dilución analizada (1:320, demostrando que los animales estaban infectados al momento de la toma de muestra y abriendo interrogantes en la epidemiología de la enfermedad a nivel local.Neospora caninum is a protozoan parasite whose infection has been detected in canine, bovine and others species around the world. In Chile, the presence of the disease has been already demonstrated in cows of the IX Region of the country. In the

  18. Frecuencia de anticuerpos contra el virus C de la hepatitis en pacientes con cirrosis hepática en Yucatán, México

    Directory of Open Access Journals (Sweden)

    Góngora-Biachi Renán A

    2003-01-01

    Full Text Available OBJETIVO: En este estudio reportamos la prevalencia de anticuerpos contra el virus C de la hepatitis (Ac-VCH en un grupo de pacientes con cirrosis hepática (CH. MATERIAL Y MÉTODOS: Se hizo un estudio prospectivo, transversal y descriptivo, de marzo de 1998 a mayo de 1999. Se estudiaron a 153 pacientes (117 (76% hombres y 36 (24% mujeres con diagnóstico de CH, que eran atendidos en el Hospital General Agustín O' Horan y en el Centro de Investigaciones Regionales Doctor Hideyo Noguchi, en la ciudad de Mérida, Yucatán, México. Se aplicó un cuestionario con datos clínico-epidemiológicos y se determinó la presencia de Ac-VCH (ELISA de 2ª generación y RIBA-2 para confirmar el diagnóstico a cada paciente. Se determinó también el antígeno de superficie de la hepatitis B (AgsHB y anticuerpos contra el antígeno central de la hepatitis B (Anti-HBc mediante el método de ELISA. La presencia de Ac-VCH fue relacionada con las variables epidemiológicas de los sujetos. La prevalencia de anti-HCV y la frecuencia de características se compararon entre los pacientes positivos y negativos con las pruebas de c² y exacta de Fisher. RESULTADOS: El 32% de los pacientes con CH (35/117 (30% hombres y 14/36 (39% mujeres fueron positivos para los Ac-VCH. El alcoholismo estuvo presente en todos los hombres serorreactivos y en ninguna de las mujeres positivas (p< 0.001. Ninguna de las variables epidemiológicas analizadas estuvo asociada con la seropositividad. Los anti-HBc se encontraron en 16% de los pacientes positivos para Ac-VCH y en 12% de los seronegativos (p=0.69. CONCLUSIONES: La prevalencia encontrada fue mayor a los reportes previos realizados en población general de la Península de Yucatán (1.3%. La alta prevalencia de Ac-VCH en este grupo de pacientes sugiere que la CH está más frecuentemente asociada con el VCH en Yucatán, México, que con el virus B de la hepatitis. El alcoholismo probablemente actúa como un cofactor en el

  19. Neuromielitis óptica con alta expresión de acuaporina-4 y anticuerpos anti-acuaporina-4 positivos en suero

    Directory of Open Access Journals (Sweden)

    Alejandra Báez

    2012-04-01

    Full Text Available La presencia de anticuerpos IgG en suero, con blanco en los canales de acuaporina-4, es específica de la neuromielitis óptica (NMO. El 60% de los pacientes con NMO presentan lesiones cerebrales en la resonancia magnética (RM; en un 8% (mayoría niños estas lesiones se consideraron "atípicas". Presentamos dos pacientes con NMO y lesiones en el SNC de alta expresión de acuaporina-4. Caso 1: varón de 50 años, que comenzó con pérdida de visión en ojo derecho (OD. Recibió tratamiento empírico con metilprednisolona 1 g/d x 3 días. Al mes presentó dolor generalizado y hemiparesia derecha; nuevamente recibió metilprednisolona 1 g/d x 5 días e IgG IV 400 mg/kg/d × 5 días. Recuperó la deambulación persistiendo el dolor y fenómenos paroxísticos en los 4 miembros. Potenciales evocados visuales: P100, ojo izquierdo (OI 123 mseg. OD sin respuesta. La RM de cerebro (FLAIR mostró hiperintensidad en nervio óptico derecho, hipotálamo y comisura blanca anterior. RM cervical: lesión medular extensa (5 cuerpos vertebrales. Caso 2: mujer de 53 años, con disminución de la agudeza visual en ambos ojos y parestesias en miembros inferiores que remitieron espontáneamente. Evolucionó al mes con cuadriparesia e incontinencia esfinteriana. Recibió metilprednisolona 1 g/d x 5 días, sin mejoría. Potenciales evocados visuales: P100 OI 124 mseg. OD 128 mseg. RM cerebro: (FLAIR hiperintensidad hipotalámica y periacueductal. RM cervical: lesión medular extensa (7 cuerpos vertebrales. Anticuerpos anti-acuaporina-4 positivos en ambos pacientes (inmunofluorescencia indirecta. Las lesiones consideradas "atípicas", como aquí, en sitios con alta densidad de proteínas canales de agua AQP4 deberán considerarse para el diagnóstico diferencial.

  20. Determinación de Anticuerpos IgM contra Virus dengue partir de sangre absorbida en papel filtro: Un método alternativo y sencillo

    Directory of Open Access Journals (Sweden)

    María García M

    2000-01-01

    Full Text Available Objetivo: Se propone como alternativa la obtención de muestras de sangre total en papel filtro, para la determinación de anticuerpos IgM contra dengue, por ser un método de recolección sencillo y no requerir de muchos cuidados en el envío al laboratorio. Materiales y métodos: De 100 pacientes con diagnóstico clínico de dengue clásico, se obtuvieron en forma simultánea, muestras de suero en tubos al vacío y de sangre total en papel filtro. Ambas muestras fueron evaluadas con el método serológico ELISA Captura de IgM a los 30 días de obtenida la muestra. Resultados: De las 100 muestras 25 fueron positivas y 75 negativas en suero, y 24 positivas y 74 negativas en papel filtro. Se obtuvo una concordancia por índice Kappa de 0,97, sensibilidad y especificidad de 96,0% y 98,0% respectivamente; el valor predictivo positivo fue 96,0%, y valor predictivo negativo fue 98,0%. Conclusión: Se evidencia muy buena sensibilidad, especificidad y concordancia en la determinación de IgM contra dengue, al utilizar papel filtro en la obtención de muestra de sangre.

  1. Seroprevalencia de anticuerpos bactericidas frente al meningococo C en Cantabria 10 meses tras la campaña de vacunación

    Directory of Open Access Journals (Sweden)

    Aledo Linos Alvaro Gonzalez de

    1998-01-01

    Full Text Available FUNDAMENTO: En febrero-marzo de 1997 se realizó en Cantabria (Comunidad Autónoma del Estado Español con 541.885 habitantes, de los cuales 107.787 tienen una edad entre 18 meses y 19 años una campaña de vacunación antimeningocócica dirigida a niños entre 18 meses y 19 años, que abarcó a todos sus municipios y alcanzó una cobertura mayor del 95%. En los 12 meses posteriores la eficacia vacunal fue del 95.68% en todas las edades. Para ayudar a decidir una revacunación se realizó un estudio de seroprevalencia de anticuerpos bactericidas en la población vacunada. MÉTODOS: en diciembre de 1997 se analizaron muestras de sangre de 414 niños vacunados, obtenidas al azar de extracciones oportunistas realizadas en Atención Primaria y en Hospitales Públicos de la Comunidad, y de niños escolarizados en las guarderías públicas dependientes de la Dirección General de Bienestar Social de Cantabria. Se analizó la tasa de anticuerpos bactericidas en el Centro Nacional de Microbiología, estableciéndose el nivel de "efecto vacunal" en la dilución 1/8. RESULTADOS: se obtuvieron los siguientes porcentajes de títulos > o = 1/8 (entre paréntesis, grupos de edad al vacunarse: 0% (18-24 meses, 4% (1.5 a 4 años, 7.1% (1.5 a 6 años, 51.3% (6 a 12 años y 81.2% (12 a 19 años. Debido a que la definición de "efecto vacunal" se cifró en la dilución 1/8 de forma artificial, y a que otros trabajos la cifran en 1/4, en 287 sueros con resultado <1/8 se repitió el ensayo bactericida con la dilución 1/4, resultando que 286 (el 99.6% también dieron negativo. Es decir, que el resultado final no variaría si situásemos el punto de corte en la dilución 1/4 en vez de en 1/8. No se encontraron diferencias significativas según la procedencia de municipios donde hubiera habido casos de meningitis C o no los hubiera habido. CONCLUSIONES: la actividad bactericida es muy baja en los menores de 4-6 años, inferior a lo publicado, y mayor por encima de esa

  2. Prevalencia de anticuerpos contra virus dengue en el cantón de Golfito (2005 y en el Distrito Central de Puntarenas (2005-2006, Costa Rica

    Directory of Open Access Journals (Sweden)

    Margarita Lee-Lui

    2008-09-01

    Full Text Available Justificación y objetivo: La primo infección con el virus dengue varía desde asintomática hasta cuadros muy severos, como el dengue hemorrágico o el síndrome de choque por dengue. El Distrito Primero de Puntarenas ha sido una de las poblaciones más afectadas desde 1993, cuando aparecieron los primeros brotes, hasta hoy, con una disminución de la incidencia en los últimos años. La región Brunca fue la segunda en incidencia en el país en 1998, y si bien la endemicidad se ha mantenido, no existen estudios epidemiológicos sobre la prevalencia de esta enfermedad; los datos que aporta el Ministerio de Salud corresponden a la incidencia de casos clínicos en un período determinado. El objetivo de este estudio fue determinar la seroprevalencia en el Distrito Primero de Puntarenas y en Golfito para conocer la vulnerabilidad de la población de sufrir fiebre hemorrágica por dengue y analizar la situación asociada a los datos epidemiológicos de estas regiones, tales como edad, sexo y ubicación geográfica, ya que una población susceptible es la que presenta una alta seroprevalencia, unida a condiciones de hacinamiento y alta densidad vectorial. Métodos: El muestreo se realizó con el método EPI descrito por la OMS. Se recolectaron 210 muestras de suero en cada distrito, se desarrolló y estandarizó una prueba de ELISA de captura de antígeno para la detección de anticuerpos tipo IgG contra dengue, usando como referencia el método de reducción de placas de Dulbecco considerado estándar de oro. Resultados: La seroprevalencia contra dengue fue del 43.8% (92 y del 90% (189 en los distritos de Golfito y Central de Puntarenas, respectivamente, sin diferencias significativas respecto al sexo, la edad y la localidad. Se obtuvo un 83% y un 95% de correlación en Golfito y Puntarenas, respectivamente, entre los casos sintomáticos y la serología con el método estandarizado. Un 32% y un 42% del total de seropositivos en cada localidad

  3. SISTEMA INMUNE Y GENÉTICA:: UN ABORDAJE DIFERENTE A LA DIVERSIDAD DE ANTICUERPOS Immune System and Genetics:: A Different Approach to the Diversity of Antibodies

    Directory of Open Access Journals (Sweden)

    NUBIA ESTELA MATTA CAMACHO

    Full Text Available Es común encontrar en los libros de inmunología o de genética un capítulo con el título de -sistema inmune y genética-, sin embargo su asociación se centra en cómo la generación de anticuerpos rompió el paradigma -un gen, una proteína-, pues en el caso de la producción de anticuerpos, un gen produce millones de proteínas. El sistema inmune tiene muchos vínculos con la genética y la herencia; esta asociación se da porque cualquier sustancia o compuesto que produzca un organismo, es un antígeno potencial cuando es reconocido como extraño por el sistema inmune de otro organismo, sea este de la misma o de diferente especie. La producción de proteínas que potencialmente pueden ser antigénicas están ligadas al genotipo del individuo. La capacidad de responder y el tipo e intensidad de respuesta a antígenos también ha sido demostrado que están correlacionados con el genotipo del individuo en cuestión, así como deficiencias en las respuestas inmunes pueden estar asociadas con mutaciones o polimorfismos genéticos que resultan en la susceptibilidad a enfermedades infecciosas. Este manuscrito busca presentar ejemplos de la relación sistema inmune - genética, en la misma dirección de la conferencia ofrecida para la cátedra de Sede -Todo lo que usted quiere saber de genética y nunca se atrevió a preguntar-.It is common to find in immunology or genetic books a chapter entitled -immune system and genetics-; this association focuses on how the generation of antibodies broke the paradigm -one gene, one protein-, since in this case one gene generates millions of proteins. However, the immune system has many more links to genetics and heredity. For example, any substance or compound produced by an organism can be a potential antigen, when it is recognized as foreign by the immune system of another organism, belonging to the same or different species. The proteins, which are potentially antigenic are encoded by the individual s

  4. Nivel de corte de los ELISAs para cuantificación de anticuerpos inducidos por la vacuna antimeningocócica VA-MENGOC-BC

    Directory of Open Access Journals (Sweden)

    Rolando Ochoa

    2001-06-01

    Full Text Available Para medir el grado de protección inducido por vacunas antimeningocócicas se ha establecido el Ensayo Bactericida en Suero (EBS y se perfeccionan otros ensayos inmunobiológicos, sin embargo, es necesario contar con pruebas sencillas como el ELISA, capaz de evaluar un gran número de muestras. Se estimó el nivel de corte de los ELISAs para la cuantificación de IgG humana contra los antígenos de VA-MENGOC-BC, vacuna antimeningocócica compuesta por vesículas proteicas de membrana externa de meningococo B y polisacárido capsular de meningococo C, con respecto a un panel de muestras de suero de lactantes, caracterizado por Ensayo Bactericida en Sangre Total (EBST. Los valores correspondientes a la máxima sensibilidad y especificidad fueron respectivamente; 2 μg/mL y 12 μg/mL para antipolisacárido C, y 1000 U/mL y 7000 U/mL para antiproteínas de membrana externa. La mayor coincidencia se obtuvo con 6 μg/mL y 2500 U/mL. Se evaluó otro panel de muestras de suero de adolescentes entre 14 y 18 años, por ELISA y EBS para Neisseria meningitidis serogrupos B y C, alcanzándose una buena concordancia. Doce años después de la inmunización con VA-MENGOC-BC persiste una importante concentración de anticuerpos contra los antígenos vacunales en los sueros estudiados.

  5. Detección de anticuerpos contra Trypanosoma cruzi utilizando discos de 3 mm en muestras de sangre seca sobre papel de filtro

    Directory of Open Access Journals (Sweden)

    Idialis Hernández-Spengler

    2014-01-01

    Full Text Available La utilización de sangre seca sobre papel de filtro ha despertado gran interés en los últimos años en los inmunoensayos debido a las ventajas que ofrece este modo de presentación de las muestras, lo que permite su utilización en países con recursos limitados para realizar estudios epidemiológicos. En este trabajo, se determinaron las condiciones óptimas de elución de muestras de sangre seca sobre papel de filtro para discos de 3 mm, como referencia se tomaron muestras de suero y las condiciones de elución establecidas para discos de 5 mm, en la detección de anticuerpos específicos a Trypanosoma cr uzi mediante el ensayo inmunoenzimático indirecto UMELISA ® CHAGAS ( Tecnosuma Internacional S.A. basado en el Sistema Ultra Micro Analítico (SUMA ® . Se evaluaron 12 muestras de suero positivos a la enfermedad de Chagas procedentes de Colombia confirmados p or inmunofluorescencia indirecta (IFI y ELISA – Chagatek ® y 75 muestras de sangre seca sobre papel de filtro procedentes de Bolivia reactivas por el UMELISA ® CHAGAS. Además, se evaluaron muestras de suero y sangre seca sobre papel de filtro negativas a la enfermedad de Chagas procedente de donantes sanos del banco de sangre provincial de La Habana. Los resultados del estudio de sensibilidad y especificidad para discos de 3 mm y 5 mm fueron similares. La reducción del diámetro del disco permite, a partir d e una misma mancha, realizar una mayor cantidad pruebas de diagnósticos para la detección de otras enfermedades, como el síndrome de inmunodeficiencia humana adquirida, hepatitis B y C entre otras.

  6. Prueba de Elisa indirecta para la detección de anticuerpos IgM para el diagnóstico de Leptospirosis humana

    Directory of Open Access Journals (Sweden)

    Manuel Céspedes Z

    2002-01-01

    Full Text Available Para el diagnóstico temprano de enfermedades con cuadro clínico inespecífico como la leptospirosis, es necesario la confirmación laboratorial mediante pruebas específicas, con la finalidad de que el diagnóstico sea más acertado y rápido. Objetivo: se realizó un estudio comparativo entre la prueba de microaglutinacion (MAT y la prueba de ELISA indirecta estandarizada con un "pool" de antígenos de Leptospira interrogans, para la detección de anticuerpos IgM, en muestras de suero de fase aguda de leptospirosis humana. Materiales y métodos: 40 muestras de pacientes con sospecha clínica y con títulos de 1:100-1:12800 por la prueba de MAT, 80 muestras negativas de pacientes aparentemente sanos con enfermedades como Brucelosis, Sífilis, Tifus murino, Hepatitis B, Fiebre Amarilla, Dengue y Enfermedad de Carrión fueron evaluados por ELISA IgM. Resultados: se obtuvo una sensibilidad de 97,5% y especificidad de 98,75%, no observándose reacción cruzada con otras enfermedades. Conclusión: ELISA IgM validado en el laboratorio es suficiente sensible, específico y de fácil aplicación para el uso como prueba de tamizaje en una infección por Leptospiras con la subsecuente confirmación por MAT.

  7. Generación de anticuerpos policlonales para la detección de la variante genotípica GIII de PVY, en cultivos de tomate de árbol y papa de Colombia

    Directory of Open Access Journals (Sweden)

    Yuliana Gallo García

    2012-04-01

    Full Text Available Normal 0 21 false false false ES-CO X-NONE X-NONE MicrosoftInternetExplorer4 Título en ingles: Generation of policlonal antibodies for detection of the PVY genotypic variant GIII in tamarillo and potato crops from Colombia Resumen: El potyvirus PVY es uno de los agentes causales más frecuentemente asociados a problemas virales en cultivos de papa y tomate de árbol en Colombia. Dada la importancia económica de las enfermedades causadas por PVY y a la necesidad de generar material de siembra certificado por su sanidad viral, es fundamental la generación de herramientas de diagnóstico que permitan la detección temprana de este virus. En este trabajo se reporta la obtención de anticuerpos policlonales específicos, útiles para la detección del genotipo III de PVY (GIII, una de las tres variantes que recientemente han sido reportadas en cultivos de papa y tomate de árbol de la región Andina de Colombia. Como antígeno, se utilizó un péptido sintético diseñado a partir de la región variable del extremo N-terminal del gen de la cápside viral. La sensibilidad de los anticuerpos fue evaluada mediante pruebas de ELISA y dot-blot utilizando péptidos sintéticos. Se realizó una prueba piloto para validar el uso de los anticuerpos a partir de plantas sintomáticas y asintomáticas obtenidas de una región donde confluyen cultivos de ambas solanáceas, encontrándose que los anticuerpos generados ofrecen mayores niveles de detección que los anticuerpos comerciales comúnmente utilizados para detectar los serotipos PVY-O,C y PVY-N de este virus. Palabras clave: anticuerpos policlonales; ELISA; potyvirus; RT-PCR; virus Y de la papa Abstract: PVY is one of the potyvirus more frequently associated with viral infections in tomato and tamarillo crops in Colombia. Due to the economic impact of PVY and the need to certify seeds as virus-free it is important to develop diagnostic tools that allow its premature detection. In this work, the

  8. UltramicroELISA indirecto para la deteccion de anticuerpos totales a citomegalovirus en suero humano Indirect Ultramicroelisa assay for the detection of human antibodies to cytomegalovirus using human serum samples

    Directory of Open Access Journals (Sweden)

    Jose Laferte

    1992-02-01

    Full Text Available Se normalizó un ultramicroELISA indirecto para la detección de anticuerpos a Citomegalovirus (CMV humano (UMELISA CMV. Se determinó la concentración óptima de antígeno en 30 ug/ml, la dilución de los sueros fue de 1:40 y la dilución de trabajo del conjugado fue de 1:1500. El UMELISA CMV fue comparado con las técnicas de aglutinación de latex para anticuerpos anti-CMV (Dupont de Neumors y la inmunofluorescencia indirecta (EFT. Los resultados mostraron un alto grado de concordancia y elevada copositividad y conegatividad del UMELISA con respecto a estos dos ensayos. El método es válido para el pesquisaje de anticuerpos en banco de sangre asi como para el diagnóstico de la infección mediante sueros pareados.We have standardized an indirect ultramicro ELISA assay for detecting antibodies to human Cytomegalovirus (CMV using human serum samples (UMELISA CMV. The optimal concentration of coating antigen (30 ug/ml, serum dilution (1:40 and anti-human conjugate working dilution (1:1500, were determined by a check board titration method. The UMELISA CMV was compared with the latex agglutination test for antibodies to CMV (Dupont de Nemours and with an indiret immunofluorescent method. The results have showed the high coincidence, sensitivity and especificity of the proposed assay regarding the two methods compared with, and supporting its use either for a blood donors screening or in the serological diagnosis of this infection by paired serum samples.

  9. Determinación de las condiciones de ensayo óptimas en un ELISA para la detección de anticuerpos séricos IgG anti-LPS de Pseudomonas aeruginosa O11

    OpenAIRE

    Tania Valmaseda; Lázaro Alba; Rolando Ochoa; Aniel Moya; Yadira Pino; Sara Catalina Esnard

    2004-01-01

    La selección de sueros de donantes sanos para la obtención de una gamma hiperinmune contra la infección por Pseudomona aeruginosa, así como la evaluación de la respuesta inmunológica de cualquier candidato vacunal contra este microorganismo necesita contar en el laboratorio con técnicas estandarizadas. En este trabajo se realizaron los ensayos necesarios para el montaje y la optimización de un ELISA indirecto para la determinación de anticuerpos séricos de clase IgG anti- LPS de P. aeruginosa...

  10. Prevalencia de anticuerpos contra Trypanosoma cruzi en donadores de sangre del IMSS, Orizaba, Veracruz, México Prevalence of antibodies against Trypanossoma cruzi in blood bank donors from the IMSS General Hospital in Onizaba, Veracruz, Mexico

    OpenAIRE

    Angel Ramos-Ligonio; Michaía Elián Ramírez-Sánchez; Juan Carlos González-Hernández; José Luis Rosales-Encina; Aracely López-Monteon

    2006-01-01

    OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores del Hospital General Regional del Instituto Mexicano del Seguro Social (IMSS) en la ciudad de Orizaba, Veracruz. MATERIAL Y MÉTODOS: Se examinaron muestras de donadores del banco de sangre del Hospital General Regional (HGRO) del IMSS para la búsqueda de antiT. cruzi por ELISA, Western blot e IFI, utilizando una proteína recombinante (MBP::Hsp70) y un extracto crudo de epimastigotes. Las muestras fueron o...

  11. Obtención de anticuerpos policlonales IgY antiparvovirus canino y evaluación en un sistema de aglutinación con látex

    Directory of Open Access Journals (Sweden)

    Jannet González-Figueredo

    2015-12-01

    Full Text Available La parvovirosis canina es una de las principales infecciones que provoca gastroenteritis, fundamentalmente en cachorros, con altos índices de morbiletalidad. Los diagnosticadores más utilizados se basan en la detección de partículas virales excretadas durante la fase aguda de la enfermedad. Algunos requieren equipos especializados, lo que aumenta los costos y el tiempo de diagnóstico. Por esto, la simplificación de estos métodos con alta sensibilidad y especificidad es prioritaria. En Cuba solo se logra un diagnóstico presuntivo sin la completa confirmación de la enfermedad, principalmente por la escasez o ausencia de un medio diagnóstico en toda la red de consultorios y clínicas veterinarias, rápido, eficaz y ajustable a nuestras condiciones. Este trabajo tuvo como objetivo obtener anticuerpos policlonales IgY a partir de yema de huevo de gallina y evaluarlos mediante un sistema de látex-aglutinación, para su posible uso como terapia y principalmente en el diagnóstico. Se inmunizaron por vía intramuscular dos gallinas de raza Leghorn con una cepa atenuada de parvovirus canino (PVC tipo 2. Se aplicaron 8 inoculaciones por ave cada 15 días. Se cosecharon los huevos y se purificaron los anticuerpos por el método de sulfato de dextrana/sulfato de sodio. Se determinó el título de IgY anti-PVC por el método de Inhibición de la Hemoaglutinación (IH y con antígeno de PVC acoplado a partículas de látex de poliestireno. Por IH se obtuvo un título de IgY anti-PVC de 1:1024. Las mezclas de anticuerpos con títulos alto y medio de ambas gallinas aglutinaron con los reactivos preparados con 230 y 460 µg/mL de antígeno. La mayor intensidad de la reacción y la mejor detectabilidad correspondieron a los reactivos elaborados con los anticuerpos de mayor título.

  12. Los niveles de anticuerpos anti factor plaquetario 4-heparina y el índice 4T para trombocitopenia inducida por heparina

    Directory of Open Access Journals (Sweden)

    Marta E. Martinuzzo

    2012-02-01

    Full Text Available La trombocitopenia inducida por heparina (HIT es un efecto adverso del tratamiento con heparina, mediada por anticuerpos anti complejo factor plaquetario 4 (PF4-heparina (HPIA. La HIT es frecuentemente moderada pero pueden desarrollarse complicaciones trombóticas. El diagnóstico precoz es importante. La detección de HPIA por ELISA tiene alta sensibilidad pero baja especificidad (títulos bajos sin significación clínica. El índice de las 4T (índice 4T puede detectar pacientes con alto riesgo de HIT. El propósito del estudio fue correlacionar los niveles de HPIA y el índice 4T de un grupo de pacientes derivados a nuestro centro. Evaluamos 84 pacientes, 34 de ellos desarrollaron trombosis. Cada médico completó un cuestionario clínico que fue remitido con la muestra a nuestro centro. Los cuestionarios fueron analizados por un investigador externo y el índice 4T se calculó previamente al ensayo. Los HPIA se determinaron por un ELISA (Asserachrom HPIA que detecta los 3 isotipos, IgG, IgM e IgA, único reactivo disponible en Argentina. Los resultados se expresaron como porcentaje de absorbancia (%ABS. La correlación del índice 4T con los HPIA fue 0.472 (rho spearman, p < 0.001. Los pacientes con índice 4T ≥ 6 presentaban %ABS mayores que los ≤ 5 (67 vs. 39, p < 0.001. Aquéllos con trombosis presentaron títulos mayores que los que no la desarrollaron (%ABS 59 vs. 39, p = 0.017. En conclusión: Los títulos altos de HPIA medidos por ELISA, que detecta los 3 isotipos, correlacionaron claramente con el índice 4T ≥ 6 y fueron más frecuentes en los pacientes con trombosis, coincidiendo con lo ya descripto para ensayos de ELISA específicos para isotipo IgG.

  13. Determinación de anticuerpos anti-β2glicoproteína I en pacientes con síndrome antifosfolípido Anti- β2 glycoprotein antibodies in patients with antiphospholipid syndrome

    Directory of Open Access Journals (Sweden)

    Oscar Uribe Uribe

    2004-09-01

    Full Text Available EL objetivo de este estudio fue comparar la presencia de anticuerpos anti-β2glicoproteína I (anti- β2GPI con las pruebas convencionales de laboratorio de anticuerpos anticardiolipina (aCL y anticoagulante lúpico, y con las manifestaciones clínicas del síndrome antifosfolípido (SAF. Se incluyeron en el estudio 80 mujeres con SAF; 35 de ellas de la consulta de Reumatología y las otras 45 con historia de aborto recurrente espontáneo (ARE; 5 mujeres de la consulta de Reumatología sin SAF, 27 mujeres con ARE, sin SAF y un grupo control de 20 mujeres sanas en edad reproductiva. Se investigaron la presencia de anticuerpos IgG e IgM anticardiolipina (aCL e IgG anti- β2GPI por la técnica de ELISA, y el anticoagulante lúpico por la determinación del tiempo parcial de tromboplastina activado. Adicionalmente, se registraron las manifestaciones clínicas asociadas al SAF. De las pacientes con SAF, 25.7% del grupo de Reumatología (9/35 y 4.4% de las pacientes con ARE (2/45 fueron positivas para anticuerpos anti-β2GPI, mientras que ninguna de las mujeres sin SAF, ni de las mujeres del grupo control, fue positiva. La asociación entre la presencia de anti- β2GPI y los anticuerpos IgG e IgM aCL mostró una diferencia significativa en los títulos de 3+ (altamente positivos en contraste con los individuos negativos para anti- β2GPI. La positividad del anticoagulante lúpico también se correlacionó con la presencia de anticuerpos anti- β2GPI. No hubo diferencia significativa entre las diversas manifestaciones clínicas del SAF y la presencia de dichos anticuerpos. En conclusión, la determinación de anticuerpos anti- β2GPI tiene una alta especificidad en pacientes con SAF pero no se asoció con ninguna manifestación clínica en particular. The objective of this study was to compare the presence of anti-β2glycoprotein (anti- β2GPI antibodies with the conventional laboratory tests of anticardiolipin antibodies (aCL and lupus anticoagulant

  14. Detection of PMTV Using Polyclonal Antibodies Raised Against a Capsid-Specific Peptide Antigen / Detección de PMTV Utilizando Anticuerpos Policlonales Contra un Péptido Antigénico Derivado de la Cápside Viral

    Directory of Open Access Journals (Sweden)

    Yuliana Gallo García

    2013-12-01

    Full Text Available Potato mop-top virus (PMTV; genus Pomovirus;family Virgaviridae is the causing agent of the spraing disease in potato (Solanum tuberosum. PMTV is transmitted by Spongospora subterranea f. sp. subterranea (Sss. This disease has a widespread distribution in potato growing regions around the world. The possibility of obtaining strain specific antibodies at low cost can greatly increase the sensitivity and use of serological tests in seed certification programs, plant breeding and quarantine regulations to avoid dissemination of this injurious virus. This work presents an alternative procedure for the production of PMTV specific antibodies useful in serological test such as ELISAand lateral flow. In contrast to standard methods requiring theisolation of viral particles or expression of recombinant capsid, this method uses peptides mimicking the N-terminal region of PMTV capsid protein as antigen for the production of specific polyclonal antibodies. The antibodies were tested against bait plants grown in soil infested with viruliferous Sss, as well as potato plants obtained from naturally Sss infested fields in Colombia. PMTV was detected in 9/14 and 24/28 foliage samples of N. benthamiana and S. phureja, respectively. In the case of field plants, the virus wasdetected in eight out of 12 root tissues evaluated. The minimumpeptide concentration detected by ELISA was of the order of 0.1 nM. / Potato mop-top virus (PMTV; género Pomovirus; familia Virgaviridae es transmitido por Spongospora subterranea f. sp. subterranea (Sss, agente causal de la sarna polvosa de la papa. Esta enfermedad tiene una amplia distribución en las regiones cultivadoras de papa alrededor del mundo. La posibilidad de obtener anticuerpos específicos contra cepas de este virus, puede incrementar la sensibilidad y la utilización de pruebas serológicas en programas de certificación de semilla, mejoramiento genético y regulaciones cuarentenarias que eviten su diseminaci

  15. Optimización del ensayo vibriocida colorimétrico para la determinación de anticuerpos séricos contra V. cholerae del serogrupo O139

    Directory of Open Access Journals (Sweden)

    Joivier Vichi-Lozada

    2011-01-01

    Full Text Available El título de anticuerpos vibriocidas es reconocido actualmente como el mejor marcador de inmunidad protectora ante la infección con Vibrio cholerae. Su evaluación permite estudiar la efectividad de vacunas durante ensayos preclínicos y clínicos, a través de la determinación de la funcionalidad de anticuerpos séricos, capaces de lisar células en presencia de complemento exógeno. Se han desarrollado distintos ensayos bactericidas con puntos finales y métodos de determinación del título vibriocida diferentes. La presencia de cápsula en el serogrupo O139 de Vibrio cholerae constituye un impedimento para la lisis eficiente de las células bajo condiciones del ensayo vibriocida utilizado en cepas del serogrupo O1. Por tal razón, se hace necesario adaptar los ensayos bactericidas existentes para V. cholerae O1, con la finalidad de utilizarlos con el serogrupo O139. A partir de un ensayo vibriocida colorimétrico, desarrollado para el serogrupo O1, se optimizaron las condiciones necesarias para una eficiente lisis celular del serogrupo O139 por anticuerpos específicos y el complemento. Este método colorimétrico tiene la ventaja que mediante la adición de glucosa y un indicador de pH al medio de cultivo utilizado para el crecimiento de las células sobrevivientes, puede determinarse visualmente el título de forma clara e inequívoca. Los mejores resultados se obtuvieron después del crecimiento de la cepa diana en cuñas de agar LB, al usar una concentración inicial de vibrión diana de 106 UFC/mL, una concentración inicial del complemento de 100 %, disolución salina fisiológica como diluente y tiempo de reacción de vibriolisis de una hora. Estas condiciones de experimentación permitieron obtener resultados exactos y precisos para V. cholerae O139.

  16. Detección de anticuerpos Anti-brucella en focas de Weddell (Leptonychotes weddellii de Cabo Shirref, Antártica Detection of anti-brucella antibodies in Weddell seals (Leptonychotes weddellii from cape Shirref, Antarctica

    Directory of Open Access Journals (Sweden)

    O. BLANK

    2002-01-01

    Full Text Available Posterior al hallazgo de anticuerpos anti-Brucella en muestras de lobo fino antártico (Arctocephalus gazella, el estudio serológico en Pinnipedia Antárticos se continuó con el fin de determinar la presencia de anticuerpos anti-Brucella en otras especies. Se colectaron muestras de sangre y de fluido extravascular de 12 ejemplares de foca de Weddell (Leptonychotes weddellii encontrados en el Sitio de Especial Interés Científico (SEIC Nº 32 y sitio CCAMLR Ecosystem Monitoring Program (CEMP N° 2, "Cabo Shirreff e Islotes San Telmo" (62º 47' S; 60º 27' W, localizado en la costa Noroeste de la isla Livingston (Shetland del Sur, Antártica. Las muestras obtenidas fueron analizadas por la técnica convencional Rosa de Bengala (RB y dos inmunoensayos enzimáticos de competencia: Compelisa®, y c-ELISA. De las muestras estudiadas se identificaron cinco con anticuerpos anti-Brucella, siendo las pruebas inmunoenzimáticas las técnicas más sensibles. Estos resultados muestran una alta probabilidad de presencia de infección por una bacteria del género Brucella en ejemplares L. weddellii y plantean la necesidad de realizar estudios complementarios, que permitan conocer la etiología y entender la epidemiología de Brucella en esta región del mundoAfter the finding of anti-Brucella antibodies in samples of Antarctic fur seal (Arctocephalus gazella, the serological study on Antarctic Pinniped was continued in order to determine the presence of anti-Brucella antibodies in other species. Blood and extra vascular fluid samples were taken from 12 Weddell seals (Leptonychotes weddellii at the Site of Special Scientific Interest (SSSI Nº 32 and CCAMLR* Ecosystem Monitoring Program (CEMP site N° 2 "Cape Shirreff and San Telmo Islets" (62º 47' S; 60º 27' W, located on the Norwest coast Livingston Island (South Shetland Islands, Antarctica. The samples were tested by the conventional Rose Bengal test (RB and two competitive enzymatic immunoassay

  17. Toxocara seroprevalence in children from a subtropical city in Argentina Prevalencia de anticuerpos anti Toxocara en niños de una ciudad subtropical de Argentina

    Directory of Open Access Journals (Sweden)

    José Mario ALONSO

    2000-08-01

    Full Text Available Most studies from Argentina have focused on toxocariasis as an environmental problem of big cities, and there are no available data about children infection from small or middle-sized cities. In order to assess the prevalence of anti-Toxocara antibodies in infantile population, 206 children from Resistencia, of both sexes, aged 1-14 years old were studied by Elisa testing with E/S T. canis L2 antigens. Hematological parameters and immunoglobulin levels were determined; five days' stool samples were studied and epidemiological data were obtained by means of a questionnaire to parents. Results showed that 73% of the children had one or more dogs living at home, 57% reported geophagia and 37.9% were positive for Toxocara serology, but there was no significant difference in prevalence neither for boys and girls, nor concerning age. An increased risk of infection was observed in age groups 5-6 and 7-8 for boys, and in age groups 3-4 and 5-6 for girls.La mayoría de los estudios realizados en Argentina, han enfocado a la Toxocariosis como un problema medioambiental propio de las grandes ciudades y no existen datos acerca de esta infección entre los niños de ciudades medianas o pequeñas. A fin de determinar la prevalencia de anticuerpos anti-Toxocara en la población infantil de la ciudad de Resistencia, se estudiaron 206 niños de ambos sexos, con edades comprendidas entre los 1-14 años, mediante el test de Elisa, empleando antígenos E/S de larva L2 de Toxocara canis. También se evaluaron los niveles de inmunoglobulinas séricas y los parámetros hematológicos; se efectuaron análisis coproparasitológico seriados en heces de 5 días y se recolectó información epidemiológica mediante cuestionario a los padres. Los resultados obtenidos señalan que el 73% de los niños tenían uno o mas perros viviendo en la casa, que el 57% tenían antecedentes de geofagia y que el 37.9% tenían serología positiva para Toxocara, aunque no hubo diferencias

  18. POLYCLONAL ANTIBODIES TO DETECT THE CP-RT PROTEIN OF Potato Mop-Top VIRUS ANTICUERPOS POLICLONALES PARA LA DETECCIÓN DE LA PROTEÍNA CP-RT DEL Potato Mop-Top VIRUS

    Directory of Open Access Journals (Sweden)

    Derly Andrade Molina

    2012-06-01

    últiples submuestras por tejido bajo análisis. Con el fin de ampliar el rango de herramientas para la detección de PMTV, se obtuvieron anticuerpos dirigidos al dominio RT de la proteína CP-RT. Se secuenció dicho dominio en el aislamiento colombiano R25 de PMTV y se realizaron análisis bioinformáticos para ubicar regiones peptídicas con alto potencial inmunogénico. El péptido seleccionado fue inoculado en conejos para obtener anticuerpos, cuya utilidad fue evaluada a partir de pruebas de ELISA indirecto en plantas señuelo de Nicotiana benthamiana inoculadas con quistosoros de Sss y en plantas de papa obtenidas en La Unión (Antioquia. Estas pruebas estuvieron acompañadas con evaluaciones de RT-PCR. Se obtuvo la totalidad del dominio RT, así como 441 nt del gen CP. Los análisis filogenéticos identificaron la cepa R25 como asociada al linaje de PMTV mundialmente distribuido. Se obtuvieron 19,26 mg de anticuerpos, los que resultaron efectivos para detectar PMTV. Ya que CP-RT es responsable de la transmisión del PMTV por Sss, estos anticuerpos permitirán no sólo apoyar los programas de diagnóstico, sino también estudios básicos y epidemiológicos tendientes a evaluar las interacciones del PMTV y Sss.

  19. UltramicroELISA para la detección de anticuerpos IgM anti M. leprae UltramicroELISA assay for the detection of human IgM antibodies to M. leprae

    OpenAIRE

    José Laferte; Elba G. Abreu; René Robaina; Vicente Verez

    1991-01-01

    La disponibilidad del sistema Ultramicroanalítico (SUMA) y de un antígeno especie-específico del M. leprae obtenido mediante síntesis química, permitió la normalización y validación de un ultramicroELISA para la detección de anticuerpos IgM específicos a esta micobacteria. El análisis de 433 sueros de banco de sangre y 265 sueros usados para validar el método y clasificados en un grupo control de donantes de banco de sangre (100), un grupo de pacientes tuberculosos (50), un grupo de enfermos ...

  20. Prevalencia de anticuerpos contra dengue y leptospira en la población de Jáltipan, Veracruz Prevalence of dengue and leptospira antibodies in the state of Veracruz, Mexico

    Directory of Open Access Journals (Sweden)

    Joel Navarrete-Espinosa

    2006-06-01

    Full Text Available OBJETIVO: Conocer la prevalencia de anticuerpos contra dengue y leptospira en Jáltipan, Veracruz, México MATERIAL Y MÉTODOS: Estudio transversal en 500 habitantes de Jáltipan, Veracruz, mediante un muestreo por hogares, aplicación de cuestionario y toma de muestras sanguíneas. Se buscaron anticuerpos IgG y se evaluaron factores asociados a sus seroprevalencias mediante regresión logística RESULTADOS: La seroprevalencia global para denguevirus fue 79.6% (IC95% 76-81; los principales factores vinculados con la infección fueron la edad (pOBJECTIVE: To discover the prevalence of antibodies against denguevirus and leptospira. MATERIAL AND METHODS: A cross-sectional study was carried out in 500 inhabitants of Veracruz, Mexico through household sampling, administration of a questionnaire and collection of blood samples. The presence of IgG antibodies was determined and factors associated with seroprevalence were evaluated using a logistic regression model. RESULTS: Total denguevirus seroprevalence was 79.6% (IC95% 76-81. The main factors associated with infection were age and residence in neighborhoods with higher vectorial indices (RMP=2.94, IC95% 1.46-6.1. Overall seroprevalence against leptospira was 4% (IC95% 2-6. Prevalence was higher in the 25 to 44 years age group (35%, IC95% 15-59. Seroprevalence in individuals who referred to living with dogs, pigs, cows and rats was 25% (IC95% 0.63-80. Eighty-five percent of individuals who were leptospira positive were also dengue positive. CONCLUSIONS: The prevalence of denguevirus antibodies suggests the risk of serious dengue hemorrhagic outbreaks. Although leptospirosis prevalence was low, the coexistence of both agents was confirmed.

  1. Asociación entre la presencia de anticuerpos anti-Ras y anti-VPH16 E4/E7 y lesiones intraepiteliales del cérvix Association between anti-Ras and anti-HPV16 E4/E7 antibodies with cervical intraepithelial lesions

    Directory of Open Access Journals (Sweden)

    Sara Vázquez-Corzo

    2003-10-01

    Full Text Available OBJETIVO: Determinar si anticuerpos séricos contra E4, E7 y Ras pueden ser utilizados como marcadores de lesiones tempranas del cérvix uterino asociadas al virus del papiloma humano. MATERIAL Y MÉTODOS: Entre marzo de 1999 y abril de 2000 se realizó un estudio sero-epidemiológico de casos y controles en la clínica de displasias del Hospital General Doctor Gea González, en la Ciudad de México, en 116 muestras de suero para evaluar la presencia de anticuerpos anti-E4, E7 y Ras utilizando un ELISA de captura. Se estimaron razones de momios e intervalos de confianza de 95% RESULTADOS: Anticuerpos anti-E7 se asociaron a mujeres con lesiones NIC III, mientras que anticuerpos anti-E4 y anti-Ras fueron más frecuentes en lesiones NIC I-II. Al evaluar el perfil de anticuerpos que presentaron las mujeres, encontramos que a anticuerpos contra dos proteínas predicen la existencia de una lesión NIC I-II, y b la presencia de tres anticuerpos predicen una lesión NIC III. CONCLUSIONES: La detección de anticuerpos séricos contra E4, E7 y Ras en combinación con otras técnicas de diagnóstico, podrían ser de utilidad para detectar oportunamente a mujeres con lesiones tempranas asociadas al Virus del Papiloma Humano y en riesgo de desarrollar cáncer.OBJECTIVE: To evaluate whether serum antibodies anti-E4, E7 and Ras could be used as markers for early cervical lesions associated with HPV (human papillomavirus. MATERIAL AND METHODS: A seroepidemiological case-control study was conducted between March 1999 and April 2000 at the dysplasia clinic of Hospital General Doctor Gea Gonzalez, in Mexico City, to evaluate the presence of antibodies anti-E4, E7, and Ras through a sandwich ELISA. Analysis was done using odds ratios and 95% confidence intervals. RESULTS: Anti-E7 antibodies were associated to women with CIN III lesions, while anti-E4 and Ras antibodies were strongly associated with CIN I-II lesions. The antibody profile of women with different

  2. Encuesta sobre la realización de las pruebas de detección de los anticuerpos anti-VIH en los laboratorios de Cataluña Survey of HIV testing in laboratories in Catalonia [Spain

    Directory of Open Access Journals (Sweden)

    María Jesús Casado

    2004-02-01

    Full Text Available Para poder interpretar correctamente la epidemia de infección por el VIH, es indispensable garantizar la calidad en la realización del test anti-VIH. Con el objetivo de describir las características durante el proceso analítico e identificar aspectos susceptibles de mejora, en 1998 se realizó una encuesta sobre la garantía de calidad en los laboratorios de Cataluña que realizaban pruebas de detección de anticuerpos anti-VIH. Los resultados de la encuesta muestran la variabilidad de los procesos analíticos llevados a cabo por los diferentes laboratorios para la determinación diagnóstica de anticuerpos anti-VIH. Hay laboratorios que todavía realizan prácticas incorrectas, como identificar especialmente las muestras biológicas VIH, realizar segundas extracciones para pruebas de confirmación y no garantizar la confidencialidad en la entrega de resultados. Sería aconsejable unificar criterios según sea el objetivo de la prueba y la prevalencia de infección en la población analizada. Ello mejoraría la calidad del resultado analítico, ya que el concepto global de calidad incluye todo el proceso (preanalítico, analítico y postanalítico.Quality assurance of HIV testing is essential to correctly assess the HIV epidemic. To describe the characteristics of HIV testing and identify features that could be improved, a questionnaire on the quality of HIV tests was sent to Catalan laboratories in 1998. The survey revealed variability in the procedures used by the participating laboratories when performing HIV tests. Some of the laboratories were still performing incorrect activities such as identifying HIV specimens with specific labels, extracting new specimens for a second test to confirm diagnosis, or failing to guarantee the confidentiality of the results. The criteria for HIV testing should be standardized according to the purpose of the test and the prevalence of the infection in the population analyzed. This approach would improve

  3. Anticuerpos circulantes contra Influenza Aviar y Newcastle en zanates (Quiscalus mexicanus de la ciudad de Guatemala (Avian flu and Newcastle Antibodies in Great-tailed Grackles (Quiscalus mexicanus in Guatemala city.

    Directory of Open Access Journals (Sweden)

    Escobar, Luis E.

    2011-03-01

    Full Text Available ResumenAunque el zanate (Quiscalus mexicanus está distribuido en todaGuatemala y se encuentra estrechamente ligado a poblaciones humanas,se sabe muy poco acerca de su estado sanitario y su papel comoreservorio de enfermedades aviares de importancia. Esta investigacióngenera información sobre el papel del zanate en la epizootiología de la Influenza Aviar (IA; Orthomyxoviridae y de Newcastle (ENC;Paramixoviridae, midiendo los anticuerpos circulantes en zanates norelacionados a granjas avícolas. Se colectaron 71 muestras de suero dezanates urbanos asintomáticos del la ciudad de Guatemala entre abril yjulio de 2008 y se analizaron con la prueba de Inhibición de laHemoaglutinación.SummaryDespite the Great-tailed Grackle (Quiscalus mexicanus is distributed in all Guatemala and it is so close to human populations, few is knownabout its sanitarian status and role as reservoir of important aviandiseases. This research provides information about the role of the Greattailed Grackle in the epizootiology of Avian Influenza (AI;Orthomyxoviridae and Newcastle Disease (NCD; Paramixoviridae,measuring the antibodies of Grackles non-related to avian farms. Wecollected 71 serum samples from urban Great-tailed Grackles without any symptoms in Guatemala City from April to June of 2008, and analyzed with hemagglutination Inhibition Test.

  4. Eficacia experimental de anticuerpos IgY producidos en huevos, contra el veneno de la serpiente peruana Bothrops atrox Experimental efficacy of IgY antibodies produced in eggs against the venom of the Peruvian snake Bothrops atrox

    Directory of Open Access Journals (Sweden)

    Julio C. Mendoza

    2012-03-01

    Full Text Available Objetivos. Desarrollar un protocolo de inmunización para producir inmunoglobulinas IgY de origen aviar contra el veneno de la serpiente peruana Bothrops atrox y evaluar la capacidad neutralizante. Materiales y métodos. Se inmunizaron seis gallinas de postura de la raza hy line brown con 500 μg/dosis de veneno de B. atrox en un periodo de dos meses. Cada semana, los huevos fueron colectados para el aislamiento de inmunoglobulinas IgY a partir de la yema, usando dos pasos consecutivos con αcido caprνlico y sulfato de amonio. La detecciσn de anticuerpos se realizσ por inmunodifusiσn doble mientras que el tνtulo y reactividad cruzada se determinaron por las técnicas de ELISA y Western blot. El cálculo de DL50 y de la DE50 del antiveneno IgY producido se realizó utilizando el método de Probits. Resultados. La masa de anticuerpos aislados fue de 8,5 ± 1,35 mg de IgY/mL de yema. Asimismo, la DE50 del antiveneno aviar fue calculada en 575 μL de antiveneno/mg de veneno. Adicionalmente, los ensayos de reactividad cruzada mostraron que el veneno de B. atrox comparte mas epνtopes comunes con el veneno de B. brazili (47% que con otros veneno del mismo género, en tanto que los venenos de Lachesis muta (19% y Crotalus durissus (12% mostraron una baja reactividad cruzada. Conclusiones. Se ha obtenido IgY purificada contra el veneno de B. atrox con capacidad neutralizante y se ha demostrado su utilidad como herramienta inmunoanalítica para evaluar la reactividad cruzada con venenos de otras especies.Objectives. To develop an immunization protocol in order to produce avian IgY immunoglobulins against Bothrops atrox Peruvian snake venom and to evaluate its neutralizing capacity. Materials and methods. Six Hy Line Brown hens were immunized each two weeks using 500μg/doses of B. atrox venom in a period of two months. Each week, eggs were collected for IgY isolation from yolk using two consecutive steps with caprilic acid and ammonium sulfate

  5. Prevalencia de anticuerpos anti-Leptospira spp. en personas con exposición laboral en el departamento del Tolima / Prevalence of anti-Leptospira spp. antibodies among people with occupational exposure in Tolima Department

    Directory of Open Access Journals (Sweden)

    Blanca L. Guzmán-Barragán

    2016-05-01

    Full Text Available Resumen Objetivo: estimar la prevalencia de anticuerpos IgM contra Leptospira spp., mediante el Ensayo de Inmunoabsorción Ligado a Enzimas (elisa, en la población de riesgo laboral de 8 municipios del Tolima. Metodología: se obtuvieron muestras de sangre de 261 empleados, las cuales fueron analizadas mediante la técnica de elisa para la detección de anticuerpos IgM anti-Leptospira spp., seguido de mat y serotipificación. Resultado: se estimó una seroprevalencia del 25,29%, con una seroreactividad mayor en trabajadores de plantas de beneficio animal (34,2%, recolección de residuos sólidos (27,1% y trabajadores de acueducto y alcantarillado (14,8%. La actividad en plantas de beneficio animal se identificó como factor de riesgo de Leptospira spp. (OR=1,86. Los serovares identificados fueron L. Bratislava (16, Ballum (5, Tarassovi (3, Hebdomadis (2, Sejroe (2 y Icterhemorragiae (1. El municipio de Libano presento el mayor porcentaje de positividad (36,96%, seguido de Espinal y Guamo con 28,57% cada uno. Discusión: la evaluación del sistema de vigilancia indicó deficiencia en recursos y debilidades de los profesionales de la salud al desconocer los procedimientos, investigación, diagnóstico y notificación de la enfermedad. Conclusiones: la leptospirosis está presente en poblaciones de riesgo laboral en el Tolima y se hace necesario abordar esta problemática en la población de otros municipios y los animales transmisores de la enfermedad. / Abstract Objective: to estimate the prevalence of IgM antibodies against Leptospira spp. Using the enzyme-linked immunosorbent assay (elisa in a population at occupational risk from 8 municipalities of the Tolima department, Colombia. Methodology: blood samples were collected from 261 employees and analyzed with the elisa technique to detect IgM and anti-Leptospira spp. antibodies. This was followed by mat and serotyping. Results: a seroprevalence of 25.29% was estimated, with higher

  6. Neospora caninum antibodies in dairy cattle of Lages Municipality, Santa Catarina State, Brazil Anticuerpos séricos contra Neospora caninum en rebaños lecheros de la ciudad de Lages, Estado de Santa Catarina, Brasil

    Directory of Open Access Journals (Sweden)

    AB Moura

    2012-01-01

    Full Text Available Bovines are the main intermediary host of the protozoan Neospora caninum, which is a major cause of bovine abortions and neonatal mortality worldwide. Sera were collected from 373 dairy cattle and 33 dogs on 19 dairy farms in Lages city, Santa Catarina State, Brazil, to determine the prevalence of N. caninum antibodies and risk factors. Tests for N. caninum antibodies were done using an indirect immunofluorescent antibody test (IFAT. Positive reactions with titers ≥ 1:200 (cattle and ≥ 1:50 (dogs were found in 86 (23.1% and seven (21.2% bovines and dogs, respectively. Of the bovines, four (1.1% were calves, 33 (8.8% were heifers, 314 (84.2% were lactating cows, 19 (5.1% were dry cows and three (0.8% were bulls. Infection was primarily found in animals with low milk production (P = 0.008. The presence of seropositive dogs on the properties did not affect the prevalence of bovine infection. No correlation between bovine reproductive disorders and the prevalence of N. caninum antibodies was observed. Our results showed that N. caninum infection is widespread among dairy cattle of Lages, Santa Catarina.Los bovinos son los principales hospederos intermediarios del coccidio Neospora caninum. En esta especie se concentran la mayoría de los daños reproductivos. A fin de determinar la prevalencia de N. caninum e identificar factores de riesgo para la infección en el ganado lechero de la ciudad de Lages, Estado de Santa Catarina, se tomaron muestras de sangre de bovinos (n = 373 y los perros (n = 33 en 19 propiedades. La detección de anticuerpos contra N. caninum fue realizada por medio de IFA. Fueron consideradas positivas las muestras con títulos ≥ 200 (ganado bovino y ≥ 50 (perros. Informaciones relacionadas con la categoría de los animales, la raza, la frecuencia y tipo de trastornos de la reproducción, la producción de leche y la presencia de los perros fueron obtenidos mediante un cuestionario. Los datos fueron analizados con la

  7. Efecto de la vacunación anti-leptospira en bovinos lecheros sobre la producción de anticuerpos anti-leptospira en trabajadores de lecherías de cuatro zonas de Costa Rica

    Directory of Open Access Journals (Sweden)

    Rafael González

    2007-07-01

    Full Text Available Objetivo: Este estudio experimental midió el efecto indirecto de la vacuna anti-Leptospira Leptoferm-5® (Pfizer® en la producción de anticuerpos anti-Leptospira en trabajadores de lecherías de cuatro zonas lecheras de Costa Rica. Materiales y Métodos: Tomaron parte en el estudio 171 vaqueros, 94 en el grupo tratamiento y 77 en el grupo control. A cada vaquero se le tomó una muestra sanguínea en tres diferentes momentos durante un año: la primera, antes de aplicar la vacuna en los animales, la segunda a los 6 meses y la tercera un año después de la primera vacunación. Se utilizó la técnica de micro aglutinación para la detección de anticuerpos anti-Leptospira interrogans serovares pomona, hardjo, canícola y grippotyphosa en el laboratorio del INCIENSA. Se utilizó la razón de prevalencias y el riesgo relativo para determinar si existió asociación entre la vacunación anti-Leptospira a las vacas y la seropositividad en los vaqueros. Resultados: En los tres muestreos se obtuvo un 10.27% (50/487 de muestras positivas a cualquiera de los serovares de Leptospira interrogans a los que fueron analizados. Tanto en el grupo tratamiento como en el control se observaron cambios en la seropositividad entre los distintos muestreos, con un aumento entre el primer y segundo muestreo (p Objective: This experimental study assessed the indirect effect of the anti-Leptospira vaccine Leptoferm-5® (Pfizer® regarding the production of anti-Leptospira antibodies in dairymen from four dairy areas in Costa Rica. Materials and Methods: 171 dairymen took part in the study; 94 in the treatment group and 77 in the control group. Three blood samples were taken from each worker three times throughout a year period: before the vaccination of the animals, and six and twelve months after the initial vaccination. The microscopic agglutination test (MAT was used to detect anti-Leptospira interrogans antibodies, specifically towards pomona, hardjo, canicola

  8. Estudio del anticuerpo DOG1 en el diagnóstico de tumores del estroma gastrointestinal - GIST The role of the DOG1 antibody in the diagnosis of gastrointestinal stromal tumours - GIST

    Directory of Open Access Journals (Sweden)

    M.R. Mercado

    2011-08-01

    Full Text Available Los tumores del estroma gastrointestinal (GIST poseen mutaciones en los genes del receptor de la tirosín quinasa (RTKs KIT y PDGFRA. La posibilidad de bloquear esta actividad ha significado una nueva esperanza terapéutica. El diagnóstico de GIST recae en la expresión inmunohistoquímica del c-KIT, pero un 4-15% son c-KIT negativos (aún en presencia de mutación, y sin embargo estos pacientes podrían beneficiarse del tratamiento con inhibidores tirosín quinasa (TKIs. El DOG1 es un nuevo anticuerpo cuya sensibilidad y especificidad parece ser superior o igual a la del c-KIT. El objetivo de este trabajo es evaluar la sensibilidad (Se y especificidad (Sp de DOG1 en GIST de tipo usual (c-KIT positivos, de tipo inusual (c-KIT negativos y frente a otros tumores fusocelulares mesenquimales, y comparar la validez diagnóstica del DOG1 frente al c-KIT. Estudiamos 40 GIST, 39 c-KIT positivos y un c-KIT negativo. Se realizó un panel inmunohistoquímico con los anticuerpos: c-KIT, CD34, actina músculo liso, DOG1 y S100, en los GIST como en siete tumores fusocelulares. La Se y Sp de GIST para DOG1 fue del 100 y 97,5% para c-KIT. La inmunoreactividad para DOG1 en todos los tumores fusocelulares fue negativa. La validez diagnóstica de DOG1 y C-KIT fue similar a la hora de detectar GIST y no GIST. DOG1 es un marcador específico y sensible para el diagnóstico y diagnóstico diferencial de GISTs (es capaz de detectar algunos GIST sin mutación en RTK. El DOG1 debería de formar parte del panel inmunohistoquímico para el diagnóstico de GIST.Gatrointestinal stromal tumours (GIST harbour oncogenic mutations in tyrosin kynases receptors (RTKs including KIT and PDGFRA. The inhibition of this activity has been regarded as the primary target for the treatment of these patients. Diagnosis of GIST relies on c-KIT inmunoreactivity; however there is a 4-15% of GISTs that are C-KIT negative which may lead to underdiagnosis of GISTs and possible withholding of

  9. Determinación de las condiciones de ensayo óptimas en un ELISA para la detección de anticuerpos séricos IgG anti-LPS de Pseudomonas aeruginosa O11

    Directory of Open Access Journals (Sweden)

    Tania Valmaseda

    2004-12-01

    Full Text Available La selección de sueros de donantes sanos para la obtención de una gamma hiperinmune contra la infección por Pseudomona aeruginosa, así como la evaluación de la respuesta inmunológica de cualquier candidato vacunal contra este microorganismo necesita contar en el laboratorio con técnicas estandarizadas. En este trabajo se realizaron los ensayos necesarios para el montaje y la optimización de un ELISA indirecto para la determinación de anticuerpos séricos de clase IgG anti- LPS de P. aeruginosa O11. Se evaluaron la concentración de recubrimiento, condiciones de bloqueo, dilución de trabajo de las muestras a evaluar y del conjugado con el fin de seleccionar en cada caso las mejores respuestas para el control positivo, el control negativo y el blanco del ensayo. Una concentración de 1,5 μg/mL de LPS O11 en PBS toda la noche a 4 °C como recubrimiento, la necesidad de no incluir un paso adicional de bloqueo y el conjugado humano anti IgG-HRP diluido 1:3000, 1 h a 37 °C resultaron las variables óptimas para el ensayo. Por otra parte, se estableció el rango lineal de la curva del control positivo y se seleccionó la dilución de trabajo 1:100 para las muestras de sueros a evaluar.

  10. Rabbit IgG antibodies against Phospholipase A2 from Crotalus durissus terrificus neutralize the lethal activity of the venom Los anticuerpos IgG de conejos anti-fosfolipasa A2 de Crotalus durissus terrificus neutralizan la actividad letal del veneno

    Directory of Open Access Journals (Sweden)

    Juan P. Rodríguez

    2006-12-01

    Full Text Available Crotalus durissus terrificus (C.d.t. (South American rattlesnake venom possesses myotoxic and neurotoxic activities, both of which are also expressed by crotoxin, the principal toxin of this venom. Crotoxin contains a basic phospholipase A2 (PLA2 and a non toxic acidic protein, crotapotin. We have produced and investigated the ability of IgG antibodies raised in rabbits against PLA2 to neutralize the lethality of the whole venom. PLA2 was isolated by gel filtration chromatography (Sephadex G-75. Specific antibodies were obtained by subcutaneous and intramuscular inoculation of PLA2 (700 µg with Freund adjuvant. Groups of six mice (20 + 2 g were inoculated with 0.5 ml i.p. of C. d. t. venom (4 µg or a mixture of venom that had been preincubated with the desired volume of IgG antibodies. Mortality, recorded 24 and 48 h after inoculation, showed that IgG anti-PLA2 were more effective than anticrotalic serum in neutralizing the lethal activity. These results demonstrate that it could be possible to obtain an anti-venom made by specific antibodies with a high level of protection against the lethal component of C.d.t. venom, and/or the inclusion of these antibodies as a supplement in heterologous anti-venoms.El veneno de Crotalus durissus terrificus (C.d.t. (Cascabel de Sud América posee actividad miotóxica y neurotóxica, actividades que también exhibe el complejo crotoxina, principal componente tóxico de este veneno. El complejo crotoxina está constituido por una fosfolipasa A2 básica (PLA2 y una proteína acídica no tóxica, el crotapotín. En este trabajo se estudió la capacidad neutralizante de anticuerpos IgG anti-PLA2 sobre la letalidad inducida por el veneno entero. El antígeno PLA2, fue aislado por cromatografía de filtración en gel (Sephadex G-75. Se inocularon conejos machos por vía subcutánea e intramuscular, con 700 µg de PLA2 y adyuvante para la obtención de anticuerpos específicos. La capacidad neutralizante del

  11. Soroprevalência de anticorpos contra vírus herpes simples 1-2 no Brasil Seroprevalencia de anticuerpos contra virus herpes simples 1-2 en Brasil Seroprevalence of herpes simplex 1-2 antibodies in Brazil

    Directory of Open Access Journals (Sweden)

    Sue Ann Costa Clemens

    2010-08-01

    Full Text Available OBJETIVO: Estimar a soroprevalência de anticorpos por vírus herpes simples (HSV-1 e HSV-2 e analisar fatores associados no Brasil. MÉTODOS: Estudo transversal realizado entre 1996 e 1997 em 1.090 indivíduos com idade entre um e 40 anos da população geral, em quatro diferentes regiões geográficas no Brasil. Foram analisadas amostras sangüíneas para detecção de anticorpos para HSV-1 e HSV-2 com teste tipo-específico Elisa. Foram descritas freqüências e proporções, comparadas entre grupos utilizando o teste de Fisher bilateral exato. Foi realizada análise de regressão logística para avaliar influência das variáveis sociodemográficas e histórico de DST, sobre a soroprevalência de HSV-1 e/ou HSV-2. RESULTADOS: As soroprevalências de anticorpos para HSV-1 e HSV-2, ajustadas por idade, foram 67,2% e 11,3% respectivamente, sem diferença quanto ao sexo e maiores na Região Norte. As soroprevalências aumentaram com a idade, e para HSV-2 o maior aumento ocorreu na adolescência e entre adultos jovens. Indivíduos soropositivos para HSV-1 apresentaram maior risco de serem positivos para HSV-2 (15,7% quando comparados com os negativos para HSV-1 (4,7%. Na análise multivariada, o histórico de DST aumentou significativamente (OR=3,2 a probabilidade de soropositividade para HSV-2. CONCLUSÕES: As soroprevalências para HSV-1 e para HSV-2 variam com a idade e entre as regiões do Brasil. História pregressa de DST é importante fator de risco para aquisição de infecção por HSV-2.OBJETIVO: Estimar la seroprevalencia de anticuerpos por virus herpes simples (HSV-1 y HSV-2 en diferentes áreas geográficas en Brasil y analizar factores asociados. MÉTODOS: Estudio transversal realizado entre 1996 y 1997 con individuos de la población en general en cuatro diferentes áreas geográficas en Brasil y estratificados por edad (de uno a 40 años y sexo, de los cuales 1.090 fueron incluidos en el análisis final. Fueron analizadas muestras

  12. Respuesta de anticuerpos inducidos por la vacuna antimeningocócica cubana VA-MENGOC-BC® frente a la cepa de Neisseria meningitidis B:4:P1.19,15 en adolescentes después de 12 años de inmunizados

    Directory of Open Access Journals (Sweden)

    María A. Camaraza

    2006-12-01

    Full Text Available Se estudió la respuesta de anticuerpos inducida por la vacuna antimeningocócica cubana VA-MENGOC-BC® contra la cepa de Neisseria meningitidis B:4:P1.19,15 mediante el Ensayo Bactericida del Suero (EBS y ELISA de tipo indirecto, para medir anticuerpos contra vesículas de membrana externa (VME de N. meningitidis B a 184 adolescentes de un politécnico de Ciego de Ávila que fueron inmunizados en campañas masivas 12 años antes. Se realizaron extracciones de sangre antes de aplicar la primera dosis (T0, 4 semanas después de ésta (T1 y 4 semanas después de la segunda dosis (T2. Transcurridos 12 años de esta vacunación el 42% de los adolescentes presentó títulos bactericidas ≥ 1:4 frente a la cepa homóloga (B:4:P1.19,15 y el 98% mostró anticuerpos detectables contra las VME. En el EBS; el porcentaje de seroconversión T1/T0 fue del 57% y T2/T0 del 60%. Mediante ELISA la seroconversión fue del 59% y 54%, respectivamente, por lo que se demostró que la aplicación de una sola dosis después de 12 años indujo una respuesta inmune importante que puede sugerir una respuesta anamnésica.

  13. UltramicroELISA para la detección de anticuerpos IgM anti M. leprae UltramicroELISA assay for the detection of human IgM antibodies to M. leprae

    Directory of Open Access Journals (Sweden)

    José Laferte

    1991-12-01

    Full Text Available La disponibilidad del sistema Ultramicroanalítico (SUMA y de un antígeno especie-específico del M. leprae obtenido mediante síntesis química, permitió la normalización y validación de un ultramicroELISA para la detección de anticuerpos IgM específicos a esta micobacteria. El análisis de 433 sueros de banco de sangre y 265 sueros usados para validar el método y clasificados en un grupo control de donantes de banco de sangre (100, un grupo de pacientes tuberculosos (50, un grupo de enfermos de lepra (65 y un grupo de contactos de estos enfermos (50, mostró la especificidad del ensayo para evidenciar la infección con el M. leprae. Los resultados obtenidos del estudio adicional de 140 muestras de suero de contactos de enfermos estuvieron estrechamente correlacionados (r = 0,98 con los resultados obtenidos por la técnica de microELISA convencional. La utilización del SUMA no solo permite un notable ahorro de reactivos si no además facilita la lectura, cálculo, validación y almacenamiento automático de los resultados.The availability of an ultramicroanalitic system (SUMA and specie-specific antigen of M. leprae obtained by chemical synthesis, have made possible the standardization and validation of an ultramicroELISA assay for detecting specific human IgM antibodies to this mycobacterium. The specificity of this test to demonstrate the infection with M. leprae was corroborated through a screening of 433 blood bank serum samples and other 265 from diferent groups (100, control group, 50 tuberculosis patients, 65 leprosy patients, 50 from household. The results obtained in the aditional study of 140 household sero showed a high correlation (r = 0.98 with the conventional microELISA method. The use of SUMA allows saving reagents and time since sample handling, plate reading, print out and storing the data are computer assisted.

  14. Prevalencia de anticuerpos contra Trypanosoma cruzi en donadores de sangre del IMSS, Orizaba, Veracruz, México Prevalence of antibodies against Trypanossoma cruzi in blood bank donors from the IMSS General Hospital in Onizaba, Veracruz, Mexico

    Directory of Open Access Journals (Sweden)

    Angel Ramos-Ligonio

    2006-02-01

    Full Text Available OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores del Hospital General Regional del Instituto Mexicano del Seguro Social (IMSS en la ciudad de Orizaba, Veracruz. MATERIAL Y MÉTODOS: Se examinaron muestras de donadores del banco de sangre del Hospital General Regional (HGRO del IMSS para la búsqueda de antiT. cruzi por ELISA, Western blot e IFI, utilizando una proteína recombinante (MBP::Hsp70 y un extracto crudo de epimastigotes. Las muestras fueron obtenidas entre los meses de octubre de 2001 a enero de 2002. RESULTADOS: Los 420 donadores de sangre analizados fueron seronegativos para HBV, HCV, BrA, VDRL y HIV. Después del tamizaje de los 420 donadores, se identificaron dos individuos seropositivos por las pruebas de ELISA, Western blot e IFI, con una seroprevalencia de 0.48%. CONCLUSIONES: En este estudio se muestran evidencias de seropositividad para T. cruzi en donadores de sangre del HGRO, lo que sugiere la existencia de riesgo de contaminación por transfusión sanguínea. Por tal motivo, es necesario aplicar programas para el tamizaje serológico a través de técnicas inmunológicas con alta sensibilidad y especificidad.OBJECTIVE: To estimate the prevalence of antibodies against Trypanosoma cruzi in blood donors from Hospital General Regional (HGRO of the Mexican Institute of Social Security (IMSS per its abbreviation in Spanish. MATERIAL AND METHODS: Between October 2001 and January 2002, blood samples were collected from voluntary donors at the blood bank of the Hospital General Regional of IMSS in Orizaba; Veracruz, Mexico. The samples were assayed for anti-T. cruzi by ELISA, Western blot and IFI, using a recombinant protein (MBP::Hsp70, and crude extract from epimastigotes. RESULTS: A total of 420 blood donors were studied; two of them were seropositive for ELISA, Western blot and IFI, with a seroprevalence of 0.48%. CONCLUSIONS: Some blood donors at the HGRO hospital were seropositive for T

  15. Evaluación de la calidad de los reactivos que se utilizan en la tecnica de contrainmunoelectroforesis para la determinación de anticuerpos antirrábicos Evaluation of the quality of the reagents employed in the counterimmunoelectrophoresis technique for the determination of rabies antibodies

    Directory of Open Access Journals (Sweden)

    A. M. Díaz

    1991-02-01

    Full Text Available En este estudio se comprobó que el Instituto Butantan produce antígenos y sueros indicadores que se pueden utilizar con éxito en la prueba de contrainmunoelectroforesis para titular anticuerpos antirrábicos en personas inmunizadas. No se pudieron demostrar diferencias estadísticamente significativas entre los resultados de las pruebas de estandarización realizadas en el Instituto Butantan y las pruebas de control de referencia llevadas a cabo en el Centro Panamericano de Zoonosis. Se propone que el Instituto Butantan produzca y distribuya a nivel nacional los reactivos para que los laboratorios de diagnóstico apliquen la técnica de contrainmunoelectroforesis para la determinación de anticuerpos antirrábicos.This study demonstrated that the antigens and indicator sera produced by the Butantan Institute may be employed with success in the counterimmunoelectrophoresis technique for the titration of rabies antibodies in sera from immunized individuals. No statistically significant differences were demonstrated between the results obtained in the standardization tests carried out at the Butantan Institute and the reference control tests performed at the Pan American Zoonoses Center. It is proposed that the Butantan Institute be in charge of the production and distribution of these reagents at the national level.

  16. Neuromielitis óptica con alta expresión de acuaporina-4 y anticuerpos anti-acuaporina-4 positivos en suero Neuromyelitis optica with high aquaporin-4 expression and positive serum aquaporin-4 autoantibodies

    Directory of Open Access Journals (Sweden)

    Alejandra Báez

    2012-04-01

    Full Text Available La presencia de anticuerpos IgG en suero, con blanco en los canales de acuaporina-4, es específica de la neuromielitis óptica (NMO. El 60% de los pacientes con NMO presentan lesiones cerebrales en la resonancia magnética (RM; en un 8% (mayoría niños estas lesiones se consideraron "atípicas". Presentamos dos pacientes con NMO y lesiones en el SNC de alta expresión de acuaporina-4. Caso 1: varón de 50 años, que comenzó con pérdida de visión en ojo derecho (OD. Recibió tratamiento empírico con metilprednisolona 1 g/d x 3 días. Al mes presentó dolor generalizado y hemiparesia derecha; nuevamente recibió metilprednisolona 1 g/d x 5 días e IgG IV 400 mg/kg/d × 5 días. Recuperó la deambulación persistiendo el dolor y fenómenos paroxísticos en los 4 miembros. Potenciales evocados visuales: P100, ojo izquierdo (OI 123 mseg. OD sin respuesta. La RM de cerebro (FLAIR mostró hiperintensidad en nervio óptico derecho, hipotálamo y comisura blanca anterior. RM cervical: lesión medular extensa (5 cuerpos vertebrales. Caso 2: mujer de 53 años, con disminución de la agudeza visual en ambos ojos y parestesias en miembros inferiores que remitieron espontáneamente. Evolucionó al mes con cuadriparesia e incontinencia esfinteriana. Recibió metilprednisolona 1 g/d x 5 días, sin mejoría. Potenciales evocados visuales: P100 OI 124 mseg. OD 128 mseg. RM cerebro: (FLAIR hiperintensidad hipotalámica y periacueductal. RM cervical: lesión medular extensa (7 cuerpos vertebrales. Anticuerpos anti-acuaporina-4 positivos en ambos pacientes (inmunofluorescencia indirecta. Las lesiones consideradas "atípicas", como aquí, en sitios con alta densidad de proteínas canales de agua AQP4 deberán considerarse para el diagnóstico diferencial.Disease-specific aquaporin-4 antibodies (NMO-IgG are the main effector of lesions in neuromyelitis optica (NMO patients. Brain MRI lesions are detected in 60% of them, with 8% (almost infants at sites of high

  17. Obtención de un anticuerpo contra la proteína p65 del virus de la tristeza de los cítricos y resultados preliminares de la expresión in vivo Obtaining a citric tristeza virus p65 protein antibody and preliminary results of p65 in vivo expression

    Directory of Open Access Journals (Sweden)

    Acosta Orlando

    2003-12-01

    Full Text Available El virus de la tristeza de los cítricos (CTV pertenece a la familia Closteroviridae que incluye a los únicos virus vegetales que poseen en su genoma genes homólogos a las proteínas de choque térmico celulares HSP70. Recien­temente se ha demostrado que las proteínas virales HSP70h, como la p65 de CTV, realizan funciones para el ensam­blaje del virión, como proteína de unión a microtúbulos y de movimiento célula a célula. De allí la importancia de desarrollar trabajos relacionados con esta proteína en el CTV, considerado el patógeno más deletéreo para los cítricos. En el presente estudio, fueron utilizados cuatro péptidos sintéticos correspondientes a la región carboxi-terminal de la proteína de choque térmico p65 del virus de la tristeza de los cítricos (CTV, para inmunizar conejos con el objetivo de obtener anticuerpos policlonales. Todos los péptidos utilizados fueron inmunogénicos. Ninguno de los anticuerpos obtenidos reaccionó contra el extracto de plantas no infectadas pero sí detectaron las proteínas p65 presentes en los extractos proteicos de cítricos infectados con el CTV. Se demostró un comportamiento inmunológico del anticuerpo anti p65 que parece ser independiente de la severidad sintomática del aislado de CTV utilizado, sobre la base de la exposición del anticuerpo a dos aislados colombianos con características serológicas diferentes. Se demostró que el ORF que codifica en el CTV para el homólogo de la HSP70 se expresa in vivo aunque el anticuerpo anti p65 solamente detectó extractos proteicos concentrados de plantas infectadas, lo que apoya lo informado en otros estudios sobre la baja concentración de esta proteína en plantas infectadas con el CTV. Es la primera vez que se obtiene en Colombia un anticuerpo policlonal anti CTV y, particularmente, contra p65, proteína que interviene en el ensamblaje y movimiento viral. La adaptación de una técnica de obtención de anticuerpos anti p65 a

  18. Hallazgos de anticuerpos contra Leptospira sp., serovariedades Panama, Lai, Australis, Shermani y Patoc, en un grupo de monos rhesus (Macaca mulatta en condiciones de cautiverio Antibodies findings against Leptospira sp., of the serovars Panama, Lai, Australis, Shermani, and Patoc, in a group of rhesus monkeys (Macaca mulatta in conditions of captivity

    Directory of Open Access Journals (Sweden)

    A Ibáñez-Contreras

    2010-01-01

    Full Text Available La leptospirosis ha emergido como una importante enfermedad infecciosa, lo que ha ocurrido en diferentes entornos desde urbanos hasta medios naturales; los portadores son animales salvajes o domésticos. El objetivo fue evaluar la presencia de anticuerpos contra Leptospira en monos rhesus en condiciones de bioterio. Se utilizaron 59 monos de diferentes etapas fisiológicas. Se determinaron anticuerpos contra Leptospira a partir de la prueba de aglutinación microscópica (TAM, utilizando como antígenos 25 serovariedades de Leptospira. Se observó que de los 59 animales, únicamente el 30,50% reaccionaron contra una o más serovariedades de Leptospira. En este trabajo se determinaron anticuerpos contra cuatro serovariedades de Leptospira: Panama, Lai, Australis y Shermani, consideradas como patógenas, y once de las muestras reaccionaron contra la serovariedad Patoc, considerada no patógena y saprófita. Ninguno de los animales que resultaron positivos contra Leptospira presentó signos clínicos compatibles con leptospirosis.During the last decade leptospirosis has emerged as a worldwide and very important infectious disease, affecting different environments from urban to rural, with carriers usually being wild or domestic animals. The objective of this study was to evaluate the presence of antibodies against Leptospira in rhesus monkeys (Macaca mulatta in a Research Center. Fifty nine non-human primates of different physiological stages were studied. The animals were held in groups and in individual cages. Blood samples were obtained from the saphenous vein to determine the presence of antibodies through the microscopic agglutination test (MA, using twenty five serovars of Leptospira as antigens. It was observed that 18 out of the 59 monkeys (30.50% reacted against one or more serovars of Leptospira. In this study, antibodies of 4 serovars of Leptospira, (Panama, Lai, Australis, and Shermani were detected. All 4 serovars were considered

  19. Utilización de un anticuerpo monoclonal en el diagnóstico directo e indirecto del virus IPN en peces infectados experimentalmente Utilization of a monoclonal antibody in the diagnosis of infectious pancreatic necrosis virus in fish

    Directory of Open Access Journals (Sweden)

    F. CIFUENTES

    1999-01-01

    Full Text Available El virus de la necrosis pancreática infecciosa, virus IPN, es el agente causal de una enfermedad altamente contagiosa que afecta a peces salmonídeos jóvenes, éstos cuando sobreviven pueden convertirse en portadores que pueden transmitir la enfermedad. Para contribuir al diagnóstico rápido y efectivo del virus tanto en peces con la infección aguda, como en peces portadores, es que ensayamos la aplicación de un anticuerpo monoclonal en la detección del virus en animales infectados experimentalmente. Utilizamos alevines de truchas arcoiris (Oncorhynchus mykiss y de salmones coho (Oncorhynchus kisutch infectados con virus IPN aislado en Chile. Para detectar a los antígenos virales empleamos ensayos de ELISA inmunodot e inmunofluorescencia. Los resultados muestran que en los peces con la enfermedad aguda el virus se detecta aplicando directamente los inmunoensayos en extractos de peces enteros. En cambio, para detectar al virus en los peces portadores fue necesario incorporar un paso adicional para amplificar al virus en cultivos celulares. A pesar de lo cual, sin embargo, los métodos se optimizaron de manera que el procedimiento completo se realizó en menos de tres días para ELISA e inmunodot y menos de un día y medio para la inmunofluorescencia. Debido a que la técnica de inmunofluorescencia permite la identificación inequívoca de una o pocas células infectadas, es que ensayamos condiciones para diagnosticar al virus IPN desde improntas de peces portadores del virus. Demostramos que los antígenos virales pueden ser facilmente identificados por medio de la tinción directa de improntas de órganos de peces con el tamaño adecuadoThe infectious pancreatic necrosis virus, IPNV, is the etiological agent of a highly contagious disease that affects young salmon. If they survive, they become carriers and can transmit the disease. To contribute to the fast and effective diagnosis in fish with the acute infection, as well as of carrier

  20. PRODUCCIÓN DE LA PROTEÍNA DE CHOQUE TÉRMICO HSC70 RECOMBINANTE EN Escherichia Coli BL21(DE3) PARA GENERAR ANTICUERPOS POLICLONALES PRODUCTION OF RECOMBINANT HEAT SHOCK PROTEIN HSC70 IN Escherinchia coli BL21(DE3) TO OBTAIN POLYCLONAL ANTIBODIES

    OpenAIRE

    Rocio Cely Castro; Julia Díaz Gómez; Diana Pulido; Orlando Acosta L; Carlos A Guerrero F

    2006-01-01

    Antecedentes. Los organismos vivos responden al estrés aumentando la síntesis de proteínas. El estrés por choque térmico ha sido el más estudiado y las proteínas que se inducen, se han denominado genéricamente como proteínas de choque térmico. Objetivo.En este trabajo se establecieron las condiciones óptimas de producción de la proteína HSC70, expresada en E.coli BL21 (DE3) y de los anticuerpos policlonales que permitan identificarla. Material y métodos. Mediante varios ensayos se establecier...

  1. PRODUCCIÓN DE LA PROTEÍNA DE CHOQUE TÉRMICO HSC70 RECOMBINANTE EN Escherichia Coli BL21(DE3 PARA GENERAR ANTICUERPOS POLICLONALES PRODUCTION OF RECOMBINANT HEAT SHOCK PROTEIN HSC70 IN Escherinchia coli BL21(DE3 TO OBTAIN POLYCLONAL ANTIBODIES

    Directory of Open Access Journals (Sweden)

    Rocio Cely Castro

    2006-07-01

    Full Text Available Antecedentes. Los organismos vivos responden al estrés aumentando la síntesis de proteínas. El estrés por choque térmico ha sido el más estudiado y las proteínas que se inducen, se han denominado genéricamente como proteínas de choque térmico. Objetivo.En este trabajo se establecieron las condiciones óptimas de producción de la proteína HSC70, expresada en E.coli BL21 (DE3 y de los anticuerpos policlonales que permitan identificarla. Material y métodos. Mediante varios ensayos se establecieron las concentraciones óptimas del agente inductor isopropil- -D-thiogalacto­piranosido (PTG, del inóculo bacteriano, de empleo de los plásmidos de expresión pET-3a y pET-28a (+; y el método más eficiente para la recuperación de las formas soluble o insoluble de la proteína y de anticuerpos policlonales que la identifiquen. Resultados. Encontramos que el inóculo de cinco colonias con IPTG (2mM en tubos con cinco mililitros de medio modificado e incubadas por 24 horas a 37°C con agitación constante (200 r.p.m y tratamiento de sonicación, produce el mejor rendimiento de HSC70. La calidad de la proteína inducida se estableció mediante “Western blotting”. Conclusión. La proteína recombinante así obtenida permitió, generar anticuerpos policlonales que a su vez permiten detectar la proteína HSC70 natural en la membrana citoplasmática de diferentes células por inmunofluorescencia, en ELISA, en Western Blot y en pruebas de bloqueo de infección de rotavirus.Background. Live organisms respond against stressing conditions raising the production of stress proteins. The heat shock stress is a very well kwon condition that produces heat shock proteins. Objective. In this work we determined the optimum conditions to produce HSC70 protein in E. coli BL12 (DE3 under stress conditions, and the best way to obtain its polyclonal antibodies. Materials and methods. The best concen­trations for isopropyl- ß -D

  2. Detección de anticuerpos contra el virus de la peste porcina clásica mediante la prueba inmunoenzimática (CIV-ELISA y seroneutralización Detection of antibodies against the classical swine fever virus by enzime-linked immunosorbent assay (ELISA

    Directory of Open Access Journals (Sweden)

    A. ISLAS

    1997-01-01

    Full Text Available La peste porcina clásica (PPC es una enfermedad de gran importancia mundial. En Chile está sometida a un programa de control y erradi-cación. El presente ensayo tuvo como objetivo estandarizar y comparar una técnica inmunoenzimática (CIV-ELISA que detecta anticuerpos del tipo IgG dirigidos contra el virus de la PPC, con la seroneutralización (SN, técnica oficial para el diagnóstico serológico. Se utilizaron 20 cerdos híbridos Landrace x Large White de 20 kg de peso vivo, los que fueron inoculados experimentalmente con una dosis de 100.000 DICT50 del aislado virulento Quillota del virus PPC. Un grupo constituido por 4 cerdos fue vacunado 14 días antes de la inoculación. Se tomaron muestras de sangre a los 3, 6, 9, 12 y 14 días post-inoculación. Además, se obtuvieron muestras serológicas de 100 hembras reproduc-toras. Los anticuerpos anti-PPC fueron determinados por un CIV-ELISA policlonal, realizándose comparación con la prueba de SN. La prueba CIV-ELISA no detectó anticuerpos en los cerdos inoculados experimentalmente hasta los 14 días post-inoculación. Sin embargo, los cerdos vacunados previamente fueron seropositivos, situación ratificada por la SN. La sensibilidad y especificidad del CIV-ELISA fue de 90.1% y 76.4%, respectivamente. El CIV-ELISA demostró ser una prueba de fácil aplicación y los resultados son similares a los de la SNClassical swine fever (CSF is an important worldwide disease. In Chile, it is subject to a control and erradication programme. The objective of the present assay was to standardize an immunoenzimatic technique (CIV-ELISA that detects antibodies of the IgG type directed against the CSF virus and to compare it with seroneutralization. Twenty hybrid Landrace x Large White pigs with a live weight of 20 kg were used. They were experimentally inoculated with a dose of 100.000 TCID50 of the Quillota virulent isolate of the CSF virus. A four-pig group was vaccinated 14 days before inoculation

  3. Encefalitis aguda mediada por anticuerpos contra el receptor ionotrópico de glutamato activado por N-metil-D-aspartato (NMDAR: análisis de once casos pediátricos en Argentina (Premio Benito Yelín

    Directory of Open Access Journals (Sweden)

    Elisa Pérez

    2013-09-01

    Full Text Available Las encefalitis son procesos inflamatorios de diverso origen, entre las cuales se incluyen las autoinmunes. La identificación de anticuerpos contra el receptor N-metil-D-aspartato permitió la caracterización clínico-inmunológica de una entidad susceptible a tratamiento inmunomodulador. Descripta originalmente en mujeres jóvenes, asociada a teratoma de ovario, es hoy una entidad reconocida en niños aun en ausencia de tumores detectables. El objetivo del trabajo, realizado a través de la revisión de historias clínicas, fue describir las características clínicas, evolutivas y los hallazgos en estudios complementarios de once niños con diagnóstico confirmado de esta entidad a través de la identificación de los anticuerpos específicos. Todos debutaron con síntomas psiquiátricos, en nueve de ellos asociando a convulsiones, y dos a movimientos extrapiramidales. En su evolución, todos presentaron compromiso del lenguaje, nueve, síntomas autonómicos graves, en uno con hipoventilación y requerimientos de ARM. La RM de cerebro fue anormal en tres. Ocho tuvieron EEG con asimetría del voltaje y/o amplitud, tres de ellos presentaron espigas. En el LCR seis tuvieron pleocitosis y tres de siete bandas oligoclonales positivas. Cinco, serologías IgM para micoplasma. El aumento de CPK en coincidencia con antipsicóticos ocurrió en cinco. Con el tratamiento inmunomodulador, cinco tuvieron recuperación total, tres, alteraciones conductuales/cognitivas y uno déficits severo. Un paciente resolvió su cuadro clínico sin tratamiento. En ninguno se detectó tumor asociado. Concluimos que frente a un niño con encefalopatía aguda y clínica compatible con esta entidad, una vez descartada causa infecciosa, se debe comenzar tratamiento inmunomodulador precozmente, evitar la utilización de fármacos antipsicóticos y realizar la búsqueda de posibles tumores ocultos.

  4. Determinación de subtipos del virus respiratorio sincicial en muestras positivas por el virus, aisladas en el Hospital Nacional de Niños

    OpenAIRE

    Doris Mora; Wilbert Alfaro; Lizeth Taylor; Laya Hun

    2011-01-01

    Objetivo: El virus respiratorio sincicial (VRS) es un pneumovirus de la familia Paramyxovridae, que causa enfermedad severa del tracto respiratorio inferior en neonatos y niños pequeños, especialmente en los primeros años de vida. Es responsable de constantes hospitalizaciones y visitas a los servicios de emergencias. Se han identificado dos subtipos: VRS-A y VRS-B, mediante anticuerpos monoclonales y técnicas moleculares. El objetivo de este estudio fue establecer por primera vez la circulac...

  5. Marcadores inflamatórios e anticorpos anti-chlamydia em pacientes com síndrome metabólica Marcadores inflamatorios y anticuerpos anti-chlamydia en pacientes con síndrome metabólico Inflammatory markers and antichlamydial antibodies in patients with metabolic syndrome

    Directory of Open Access Journals (Sweden)

    Rosecler Riethmuller Franco

    2011-02-01

    ão mostraram diferença significativa em pacientes com SM, com e sem eventos.FUNDAMENTO: El síndrome metabólico está asociado al aumento de riesgo de eventos cardiovasculares. Marcadores inflamatorios y anticuerpos anti-Chlamydia han sido relacionados al desarrollo y a la progresión de la aterosclerosis y de los eventos cardiovasculares. OBJETIVO: Evaluar los marcadores inflamatorios interleucina-6 (IL-6 y factor de necrosis tumoral-alfa (TNF-α y los anticuerpos anti-Chlamydia pneumoniae en pacientes con síndrome metabólico (SM, con y sin eventos cardiovasculares. MÉTODOS: Estudio transversal constituido por 147 individuos. De estos, 100 (68% con SM y sin eventos cardiovasculares; y 47 (32% con SM y con eventos cardiovasculares. De los individuos que habían sufrido eventos cardiovasculares, 13 (6,11% presentan infarto agudo de miocardio (IAM, y diez (4,7%, accidente cerebro vascular (ACV. El diagnóstico del SM fue determinado por los criterios del NCEP-ATPIII. RESULTADOS: La media de edad de los sujetos con eventos cardiovasculares fue de 61,26 ± 8,5 y de 59,32 ± 9,9 en los individuos sin esos eventos (p=0,279, habiendo predominio del sexo femenino. El grupo con SM y sin evento presentó mayor peso, altura, IMC y circunferencia abdominal. Para los individuos con eventos cardiovasculares (p=0,001, los marcadores inflamatorios IL-6 y TNF-α y la enfermedad vascular periférica fueron significativamente mayores. Se obtuvieron niveles elevados de anticuerpos IgG para Chlamydia pneumoniae en el grupo SM, sin eventos y de IgA en el grupo con eventos cuando fueron comparados los dos grupos. Con relación al IAM y al ACV, los anticuerpos anti-Chlamydia pneumoniae no demostraron significación estadística, comparados al grupo sin eventos cardiovasculares. Asociación fue observada con el uso de estatinas, hipoglicemiantes orales, inyectables y antiinflamatorios no esteroides en el grupo con esos eventos. CONCLUSIÓN: Marcadores inflamatorios se encuentran

  6. A-3 steel work completed

    Science.gov (United States)

    2009-01-01

    Stennis Space Center engineers celebrated a key milestone in construction of the A-3 Test Stand on April 9 - completion of structural steel work. Workers with Lafayette (La.) Steel Erector Inc. placed the last structural steel beam atop the stand during a noon ceremony attended by more than 100 workers and guests.

  7. Anticuerpos antinucleares, imágenes y características obtenidas por inmunofluorescencia: Importancia de los isotipos IgA, IgM e IgG Antinuclear antibodies, patterns and characteristics obtained by immunofluorescence: The importance of the IgA, IgM and IgG isotypes

    Directory of Open Access Journals (Sweden)

    Miriam Arcavi

    2009-10-01

    Full Text Available La técnica de elección para el screening de anticuerpos antinucleares (ANA es la inmunofluorescencia indirecta que utiliza como sustrato una línea de células epiteliales de carcinoma de laringe humano (IFI-HEp2, y como antisuero, anti-IgG o anti-Ig totales. Los ANA-IgG son los más importantes para el diagnóstico y monitoreo de las enfermedades del tejido conectivo (ETC, mientras los ANA-IgM son de menor relevancia clínica en estos pacientes. Sin embargo, poco se sabe de los ANA-IgA ya que estos Ac han sido menos investigados. El objetivo de este trabajo fue estudiar la prevalencia de los diferentes isotipos de inmunoglobulinas de anticuerpos antinucleares en los pacientes con ETC y evaluar la conveniencia de utilizar conjugados monovalentes o polivalentes. Se procesaron 100 sueros de pacientes con diversas ETC empleando IFI-HEp2, en los cuales se detectó 38% de ANA-IgA (títulos ≥ 1:80 y 12% de ANA-IgM (títulos ≤ 1:160. En 29 casos se detectó IgA en ausencia de IgM, en 3 casos IgM en ausencia de IgA. En todos los casos los ANA-IgG estuvieron presentes. En 6 sueros se observó un cambio de imagen con conjugado anti-IgA y en 3 con conjugado anti-IgM. Debido a la alta prevalencia de ANA-IgA detectada por IFI-HEp2, se destaca la conveniencia de utilizar conjugado anti-Ig totales en lugar de anti-IgG, mientras se desconozca la relevancia de los ANA-IgA en el diagnóstico, pronóstico y seguimiento de las enfermedades reumáticas sistémicas.The indirect immunofluorescence with epitelial cell line from human laryngeal carcinoma as substrate (IIF-HEp2 and anti-IgG or anti-total Ig as antisera, is the technique currently used for the detection of antinuclear antibodies. The most important antibodies for the diagnosis and follow-up of connective tissue diseases (CTD are the IgG-ANA, while the IgM-ANA have no clinical relevance. However the IgA-ANA have not been thoroughly investigated so far. The aim of this work was to study the prevalence

  8. Frecuencia de anticuerpos contra el virus C de la hepatitis en pacientes con cirrosis hepática en Yucatán, México Frequency of antibodies against the hepatitis C virus in patients with hepatic cirrhosis in Yucatan, Mexico

    Directory of Open Access Journals (Sweden)

    Renán A Góngora-Biachi

    2003-10-01

    Full Text Available OBJETIVO: En este estudio reportamos la prevalencia de anticuerpos contra el virus C de la hepatitis (Ac-VCH en un grupo de pacientes con cirrosis hepática (CH. MATERIAL Y MÉTODOS: Se hizo un estudio prospectivo, transversal y descriptivo, de marzo de 1998 a mayo de 1999. Se estudiaron a 153 pacientes (117 (76% hombres y 36 (24% mujeres con diagnóstico de CH, que eran atendidos en el Hospital General Agustín O' Horan y en el Centro de Investigaciones Regionales Doctor Hideyo Noguchi, en la ciudad de Mérida, Yucatán, México. Se aplicó un cuestionario con datos clínico-epidemiológicos y se determinó la presencia de Ac-VCH (ELISA de 2ª generación y RIBA-2 para confirmar el diagnóstico a cada paciente. Se determinó también el antígeno de superficie de la hepatitis B (AgsHB y anticuerpos contra el antígeno central de la hepatitis B (Anti-HBc mediante el método de ELISA. La presencia de Ac-VCH fue relacionada con las variables epidemiológicas de los sujetos. La prevalencia de anti-HCV y la frecuencia de características se compararon entre los pacientes positivos y negativos con las pruebas de c² y exacta de Fisher. RESULTADOS: El 32% de los pacientes con CH (35/117 (30% hombres y 14/36 (39% mujeres fueron positivos para los Ac-VCH. El alcoholismo estuvo presente en todos los hombres serorreactivos y en ninguna de las mujeres positivas (pOBJECTIVE: To report the prevalence of antibodies against the hepatitis C virus (anti-HCV in a group of patients with hepatic cirrhosis (HC. MATERIAL AND METHODS: A prospective transversal and descriptive study was carried out from March 1998 to May 1999. Study subjects were 153 patients; 117 (76% male and 36 (24% female, diagnosed with HC. They were attended at the General Hospital Agustín O' Horan and at Regional Research Center Doctor Hideyo Noguchi, in Merida, Yucatan, Mexico. A clinical-epidemiologic questionnaire completed by interview was used for data collection. Anti-HCV were detected

  9. Estudio del genoma y del transcriptoma en las fases evolutivas de las gammapatías monoclonales

    OpenAIRE

    López Corral, Lucía

    2012-01-01

    [ES] Los estudios epidemiológicos han demostrado que la práctica totalidad de los mielomas múltiples están precedidos por una fase premaligna. En este sentido, la gammapatía monoclonal de significado incierto (GMSI) y el mieloma múltiple quiescente (MMQ) se consideran entidades premalignas y asintomáticas que difieren de forma significativa en la tasa de progresión a MM sintomático. A pesar de su comportamiento clínico radicalmente distinto, las tres entidades comparten aparentemente la m...

  10. Auto-anticorpos anti-β2-glicoproteína I e síndrome metabólica Anticuerpos anti-β2-glicoproteína I y síndrome metabólico Anti-beta2-glycoprotein I autoantibodies and metabolic syndrome

    Directory of Open Access Journals (Sweden)

    Rodrigo B. Krás Borges

    2011-04-01

    Full Text Available FUNDAMENTO: A síndrome metabólica (SM é uma entidade pró-aterogênica. Autoanticorpos tais como β2-glicoproteína I (β2-gpI podem influenciar o aparecimento de ateromas. Estudos anteriores confirmaram uma associação entre anticorpos IgA anti-β2-gpI e isquemia cerebral, infarto do miocárdio, doença arterial periférica e doença da carótida. OBJETIVO: O objetivo desse estudo de caso-controle foi avaliar uma possível associação entre anticorpos anti-β2-gpI e anticardiolipina (aCL com SM não-complicada. MÉTODOS: Pacientes com SM sem histórico de eventos vasculares e indivíduos-controle, consistindo em pacientes da Enfermaria de Ortopedia admitidos devido a doenças musculoesqueléticas foram incluídos no estudo. Idade, sexo, etnia, histórico de hipertensão, tabagismo, hipercolesterolemia e diabetes mellitus foram avaliados como fatores de risco em ambos os grupos. Anticorpos IgG, IgM, e IgA anti-β2-gpI e aCL foram detectados através de imunoensaios enzimáticos. RESULTADOS: Um total de 68 pacientes com SM e 82 controles foram estudados. Os pacientes com SM tinham média de idade superior à dos controles (P = 0,001, enquanto homens (P = 0,003; OR 0,31; IC95%: 0,15-0,16 e etnia caucasiana (P = 0,004; OR 0,25; IC95%:0,10-0,60 eram predominantes nos controles. Histórico de hipertensão, hipercolesterolemia e diabetes mellitus foi mais prevalente nos pacientes com SM do que nos controles (P FUNDAMENTO: El síndrome metabólico (SM es una entidad pro-aterogénica. Autoanticuerpos tales como β2-glicoproteína I (β2-GPI pueden influir en la aparición de ateromas. Estudios previos han confirmado una asociación entre anticuerpos IgA anti-β2-GPI y la isquemia cerebral, infarto de miocardio, enfermedad arterial periférica y enfermedad carotidea. OBJETIVO: El objetivo de este estudio de caso-control fue evaluar una posible asociación entre los anticuerpos anti-β2-GPI y anticardiolipina (aCL con SM complicada. MÉTODOS: Se

  11. Obtención de un conjugado anti IgG de ratón - FITC mediante la tecnología IgY para uso como anticuerpo secundario en la detección de antígenos de superficie celular

    Directory of Open Access Journals (Sweden)

    Esteban J. Gutiérrez Calzado

    2007-01-01

    Full Text Available Desde el año 1996, el Centro Europeo para la Validación de Métodos Alternativos recomendó el uso de la IgY como sustituto de la IgG de mamíferos con el objetivo de reducir al mínimo las situaciones de daño que se les causa a los animales que se someten a la producción de anticuerpos (Acs. En 1999, la tecnología IgY se aprobó por la Oficina Federal Veterinaria del gobierno suizo como un método alternativo para sustentar el cuidado y bienestar de los animales. Muchas de las publicaciones relacionadas con IgY demuestran las características desde el punto de vista bioquímico de esta inmunoglobulina que la hace tomar ventajas sobre la IgG, entre las que refiere que los complejos inmunes que contienen Acs aviares, no pueden interactuar con los receptores Fc o del complemento sobre las células, por lo que el reemplazamiento de los Acs de mamíferos por sus similares en gallinas pudieran evitar interferencias en muchos ensayos diagnósticos. Este conocimiento ha sido la base objetiva de este trabajo que consistió en la obtención de Acs IgY anti IgG de ratón con elevado grado de pureza, los que fueron conjugados por unión covalente vía grupos amino primarios libres al isotiocianato de fluoresceína (FITC. Estos conjugados mostraron poseer una razón molar FITC/proteína en intervalos reportados para un buen desempeño. La dilución óptima de trabajo obtenida para ellos fue muy adecuada y demostró su utilidad como Acs secundarios en el conteo de antígenos de superficie celular linfocitario humano por sus resultados comparables con los reactivos similares de origen mamífero ensayados en paralelo.

  12. Prevalencia de anticuerpos contra virus dengue en el cantón de Golfito (2005 y en el Distrito Central de Puntarenas (2005-2006, Costa Rica Dengue seroprevalence in Golfito and the central district of Puntarenas, Costa Rica 2005-2006

    Directory of Open Access Journals (Sweden)

    Margarita Lee-Lui

    2008-09-01

    Full Text Available Justificación y objetivo: La primo infección con el virus dengue varía desde asintomática hasta cuadros muy severos, como el dengue hemorrágico o el síndrome de choque por dengue. El Distrito Primero de Puntarenas ha sido una de las poblaciones más afectadas desde 1993, cuando aparecieron los primeros brotes, hasta hoy, con una disminución de la incidencia en los últimos años. La región Brunca fue la segunda en incidencia en el país en 1998, y si bien la endemicidad se ha mantenido, no existen estudios epidemiológicos sobre la prevalencia de esta enfermedad; los datos que aporta el Ministerio de Salud corresponden a la incidencia de casos clínicos en un período determinado. El objetivo de este estudio fue determinar la seroprevalencia en el Distrito Primero de Puntarenas y en Golfito para conocer la vulnerabilidad de la población de sufrir fiebre hemorrágica por dengue y analizar la situación asociada a los datos epidemiológicos de estas regiones, tales como edad, sexo y ubicación geográfica, ya que una población susceptible es la que presenta una alta seroprevalencia, unida a condiciones de hacinamiento y alta densidad vectorial. Métodos: El muestreo se realizó con el método EPI descrito por la OMS. Se recolectaron 210 muestras de suero en cada distrito, se desarrolló y estandarizó una prueba de ELISA de captura de antígeno para la detección de anticuerpos tipo IgG contra dengue, usando como referencia el método de reducción de placas de Dulbecco considerado estándar de oro. Resultados: La seroprevalencia contra dengue fue del 43.8% (92 y del 90% (189 en los distritos de Golfito y Central de Puntarenas, respectivamente, sin diferencias significativas respecto al sexo, la edad y la localidad. Se obtuvo un 83% y un 95% de correlación en Golfito y Puntarenas, respectivamente, entre los casos sintomáticos y la serología con el método estandarizado. Un 32% y un 42% del total de seropositivos en cada localidad

  13. Pesquisa de anticuerpos seroneutralizantes para pestivirus y herpesvirus en ovinos, caprinos y camélidos sudamericanos de Chile Survey for antibodies to pestivirus and herpesvirus in sheep, goats, alpacas (Lama pacos, llamas (Lama glama guanacos (Lama guanicoe and vicuña (Vicugna vicugna from Chile

    Directory of Open Access Journals (Sweden)

    M Celedón

    2001-01-01

    Full Text Available Se investigó la presencia de anticuerpos por dilución punto final seroneutralizante (DPFSN para pestivirus (cepa NADL del virus de la diarrea viral bovina y para herpesvirus (cepa Los Angeles del virus herpes bovino 1, en muestras de sueros de 321 ovinos, 322 caprinos, 74 alpacas (Lama pacos , 43 llamas (Lama glama , 48 guanacos (Lama guanicoe y 34 vicuñas (Vicugna vicugna , procedentes de diferentes regiones del país. Para pestivirus se detectó reacción serológica positiva en 60 (18,7% ovinos, en 21 (6,5% caprinos, en 8 (10,8% alpacas y en 6 (14% llamas. Los guanacos y vicuñas fueron seronegativos para pestivirus. Para herpesvirus, la seropositividad se obtuvo en 8 (2,5% ovinos y 62 (19,3% caprinos. No se detectaron anticuerpos para herpesvirus en las muestras de camélidos. Según la distribución geográfica los mayores porcentajes de positividad resultaron ser: para pestivirus en ovinos de 2/3 predios de la XII Región (con positividad de 66,7% y 82,1%, con rangos de títulos de 16 a 710 y, para herpesvirus en caprinos de 5/6 predios de la IV Región (con positividad de 4,2%, 13,3%, 28,6%, 61,5% y 66,7%, con rango de títulos de 2 a 45. Las alpacas y llamas serorreaccionantes a pestivirus se encontraban ubicadas en la Región Metropolitana, en confinamiento en conjunto con otras especies de rumiantes, en cambio que las especies silvestres, guanacos y vicuñas fueron muestreadas en sus lugares de origen. Se confirma que en Chile existe infección por pestivirus en ovinos, caprinos, llamas y alpacas y por herpesvirus en ovinos y caprinosMicrotitration serum virus-neutralization tests were used to determine antibody titres for pestivirus: bovine viral diarrhea virus (NADL strain and herpesvirus: bovine herpes virus 1 (Los Angeles strain in 321 sheep, 322 goats, 74 alpacas (Lama pacos , 43 llamas (Lama glama , 48 guanacos (Lama guanicoe and 34 vicuñas (Vicugna vicugna , from several Regions of Chile. Antibodies to pestivirus were found

  14. Desarrollo de un Sistema ELISA para cuantificar IgG de ratón tomando como base la tecnología IgY

    Directory of Open Access Journals (Sweden)

    Esteban J. Gutiérrez Calzado

    2007-01-01

    Full Text Available Se conoce que desde 1893, se había descrito un experimento en el que se demostraba que en el proceso de inmunización de gallinas, el resultado consistía en la transferencia de anticuerpos específicos hacia la yema de sus huevos. Tomando como base este conocimiento, este trabajo se enfocó en demostrar que los anticuerpos de yema de huevo obtenidos a partir de gallinas inmunizadas con una preparación comercial de IgG de ratón pueden constituir una alternativa a sus similares en mamíferos al conjugarse con la enzima peroxidasa y utilizarse como reactivos en técnicas ELISA para la determinación de anticuerpos monoclonales murinos del tipo IgG. Para esto, se desarrollaron esquemas de inmunización en paralelo en gallinas y conejos a los que se les aplicaron diversas dosis del antígeno (IgG de ratón demostrándose que las gallinas son capaces de brindar títulos de anticuerpos aunque menores que en el conejo, sí razonables en sus yemas de huevo contra este antígeno, útiles para procesos posteriores. Se demuestra que el método del m-peryodato de sodio es aplicable a los anticuerpos de yema de huevo (IgY para conjugarlos a la enzima peroxidasa para su uso exitoso en inmunoensayos como el ELISA. El Sistema ELISA desarrollado sobre la base de los anticuerpos IgY mostró en su desempeño algunas ventajas a su similar desarrollado con conjugado de anticuerpos de mamíferos. Este trabajo demuestra que la obtención de anticuerpos IgY en este caso, es una fórmula que reduce los costos de producción de conjugados enzimáticos al menos tres veces, lo que conjuntamente con los elementos bioéticos la convierte en una vía atractiva para complementar los procesos tradicionales de producción de anticuerpos.

  15. 15 CFR 4a.3 - Classification levels.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Classification levels. 4a.3 Section 4a.3 Commerce and Foreign Trade Office of the Secretary of Commerce CLASSIFICATION, DECLASSIFICATION, AND PUBLIC AVAILABILITY OF NATIONAL SECURITY INFORMATION § 4a.3 Classification levels. Information...

  16. 42 CFR 2a.3 - Application; coordination.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Application; coordination. 2a.3 Section 2a.3 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS PROTECTION OF IDENTITY-RESEARCH SUBJECTS § 2a.3 Application; coordination. (a) Any person engaged in (or who intends...

  17. 32 CFR 168a.3 - Definition.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 1 2010-07-01 2010-07-01 false Definition. 168a.3 Section 168a.3 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE DEFENSE CONTRACTING NATIONAL DEFENSE SCIENCE AND ENGINEERING GRADUATE FELLOWSHIPS § 168a.3 Definition. Sponsoring Agency. A DoD Component or...

  18. Thyroid autoantibodies in autoimmune diseases Anticuerpos antitiroideos en enfermedades autoinmunes

    OpenAIRE

    Regina M. Innocencio; João H. Romaldini; Ward, Laura S.

    2004-01-01

    Abnormalities in the thyroid function and thyroid autoantibodies have been frequently described in patients with autoimmune diseases but seldom in antiphospholipid syndrome patients. In order to determine the prevalence of thyroid function and autoimmune abnormalities, we compared serum thyrotropin (TSH, serum free thyroxine (T4) levels, thyroid antithyroglobulin (TgAb) and antithyroperoxidase (TPOAb) levels of 25 patients with systemic sclerosis, 25 patients with rheumatoid arthritis and 13 ...

  19. Indicación de la determinación de los anticuerpos para los virus de la hepatitis C y de la hepatitis A en los protocolos de atención a los niños inmigrantes Indication of determination of antibodies against hepatitis C and A viruses in the protocol for the care of young immigrants

    Directory of Open Access Journals (Sweden)

    Rosa M. Masvidal Aliberch

    2010-08-01

    Full Text Available Objetivo: Valorar la determinación sistemática de los anticuerpos para el virus de la hepatitis C (Ac. VHC y para el virus de la hepatitis A (Ac. VHA dentro de los protocolo de atención a niños inmigrantes (PANI. Métodos: Estudio descriptivo, transversal y multicéntrico. Se determinaron los Ac. VHC y Ac.VHA, en niños de 6 meses a 15 años procedentes de países de baja renta que habían inmigrado hacía menos de 12 meses. Se registró la edad, el sexo y el país de origen. Se ha comparado el coste de la vacunación (con vacuna HA y vacuna HA-HB, precio de sanidad pública y precio de venta al público a todos los niños inmigrantes sin cribado, con el coste de la vacunación sólo a los no inmunes. Resultados: Se determinaron los Ac. VHC a 1055 niños/as, un caso resultó positivo: 0,09% (IC95%: 0-0,53%. Se determinaron los Ac. VHA a 992 niños/as, y fueron positivos el 38% (IC 95%: 35,0-41,1; en los de América Central y del Sur (n=352 el 34,9%; del Magreb (n=246 el 44,7%; de Indo-Pakistán (n=162 el 58,6%. Según el país de procedencia, la edad y el precio de la vacuna utilizada, es eficiente la determinación de los Ac. VHA previamente a la vacunación para el VHA. Conclusiones: La baja prevalencia de Ac. VHC en población infantil inmigrada no justifica su determinación sistemática. Valorar la determinación de los Ac. VHA en cada niño inmigrante en particular puede aumentar la eficiencia de los PANI.Objectives: To evaluate systematic determination of antibodies against hepatitis C virus (HCV and hepatitis A virus (HAV within the protocols for the care of young immigrants (PCYI. Methods: We performed a descriptive, cross-sectional, multicenter study. Antibodies against HCV and HAV were determined in children aged from 6 months to 15 years from low-income countries who had immigrated to Spain less than 12 months previously. Age, sex and country of origin were registered. The cost of vaccinating all immigrant children (with the HA

  20. Distribución heterogénea de la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores de sangre en Puebla, México Heterogeneous distribution of the prevalence of anti-Trypanosoma cruzi antibodies among blood donors in the State of Puebla, Mexico

    Directory of Open Access Journals (Sweden)

    Víctor M Monteón

    2005-04-01

    Full Text Available OBJETIVO: Identificar la seroprevalencia de anticuerpos anti Trypanosoma cruzi (Ac anti-T. cruzi en donadores de sangre que habitan en ámbito rural y suburbano, así como las regiones del estado de mayor riesgo y factores asociados. MATERIAL Y MÉTODOS: Estudio transversal realizado de enero a diciembre de 2003. Se analizaron 2 489 donadores de sangre reclutados en 10 puestos de sangrado del Instituto Mexicano del Seguro Social (IMSS distribuidos en las siete regiones económicas del estado de Puebla, México. Se determinó la seroprevalencia mediante las pruebas serológicas obligatorias del panel viral y, además, para T. cruzi, región de reclutamiento y de origen de los donadores. RESULTADOS: La seroprevalencia de Ac anti-T. cruzi fue de 1.24% (31/2 489 comparable con la obtenida para el virus de la hepatitis C (1.5% y por arriba de la del virus de la inmunodeficiencia humana (0.4% y del antígeno de superficie del virus de la hepatitis B (0.3%. Las regiones de Tehuacán-Sierra Negra y Mixteca fueron las de mayor riesgo con seroprevalencias, por el origen del donador, de 2.6% para T. cruzi, mientras que en los originarios de las regiones Sierra nororiental y Angelópolis no se detectaron casos positivos. Se observó asociación entre ser seropositivo y mayor de 40 años y ser originario de las regiones de Tehuacán-Sierra Negra y Mixteca. CONCLUSIONES: La distribución de seroprevalencia a T. cruzi es heterogénea, oscila desde 0% hasta 2.6%, y se reconoce a Tehuacán-Sierra Negra y Mixteca como las regiones de mayor riesgo.OBJECTIVE: To determine the seroprevalence and associated factors, of antibodies against Trypanosoma cruzi (T. cruzi Ab among blood donors living in rural and suburban areas and risk regions. MATERIAL AND METHODS: A cross-sectional study was conducted from January to December 2003, in 2489 blood donors of seven regions of Puebla, who were evaluated for mandatory viral and T. cruzi serological tests using validated

  1. Detección de anticuerpos para BVDV y BoHV-1 en llamas de la región de Tandil - Provincia de Buenos Aires Detection of antibodies to BVDV and BoHV-1 in llamas from Tandil - Province of Buenos Aires

    Directory of Open Access Journals (Sweden)

    P.E. Morán

    2010-12-01

    Full Text Available La llama (Lama glama es la especie predominante de camélidos sudamericanos de la República Argentina, con una población aproximada de 200.000 animales. El aumento de la actividad productiva ha incrementado el transporte y la distribución de animales hacia diferentes regiones del país. Como consecuencia, estas especies interactúan con el ganado doméstico posibilitando la diseminación de agentes infecciosos propios y comunes entre especies. Considerando que los camélidos sudamericanos son susceptibles a la infección con pestivirus y herpesvirus, se planteó realizar un relevamiento serológico de anticuerpos neutralizantes para el virus de la diarrea viral bovina (BVDV y el herpesvirus bovino 1 (BoHV-1. Se analizaron 49 animales de dos rebaños de llamas de la región de Tandil mediante la técnica de seroneutralización sobre cultivos celulares de la línea Madin Darby Bovine Kidney. El 22% (11/49 de los animales expresaron seropositividad a BoHV-1, mientras que el 2% (1/49 fue positivo a BVDV. Estos resultados sugieren circulación viral en la población analizada. Es necesario el monitoreo continuo en las poblaciones de estos rumiantes para identificar factores de riesgo involucrados en la epidemiología de estos agentes virales, considerando los potenciales efectos sobre los programas de control y erradicación.Llama (Lama glama is the predominant species of South American camelids in Argentine Republic, with an estimated population of 200.000 animals. The increasing of productive activity raised the animals transport and distribution to different regions of the country. As a result, the direct contact of these species with cattle increase opportunities for spreading own and common infectious agents among species. Considering that American camelids are susceptible to pestivirus and herpesvirus infections, it was proposed to carry out a serological searching of neutralizing antibodies to bovine viral diarrhea (BVDV and bovine

  2. Steel erected at A-3 Test Stand

    Science.gov (United States)

    2008-01-01

    Workers erect the first fabricated steel girders to arrive at the A-3 Test Stand at Stennis Space Center. Steel work began at the construction site Oct. 29 and is scheduled to continue into next spring.

  3. Inmunofluorescencia con Crithidia luciliae para la detección de anticuerpos anti-ADN: Imágenes atípicas y su relación con enfermedad de Chagas y leishmaniasis Immunofluorescence assay with Crithidia luciliae for the detection of anti-DNA antibodies: Atypical images and their relationship with Chagas’ disease and leishmaniasis

    Directory of Open Access Journals (Sweden)

    Gloria Griemberg

    2006-02-01

    Full Text Available Los anticuerpos anti-ADN nativo pueden detectarse por inmunofluorescencia indirecta con Crithidia luciliae, observándose tinción fluorescente anular del kinetoplasto que contiene ADN de doble cadena. En algunos casos pueden observarse imágenes fluorescentes en flagelo, membrana y corpúsculo basal, consideradas atípicas. Como C. luciliae pertenece a la familia Trypanosomatidae, que incluye patógenos para el hombre como Trypanosoma cruzi y Leishmaniaspp., se consideró que las imágenes atípicas pudieran deberse a reacciones cruzadas. Se realizaron estudios serológicos para Chagas a 105 muestras provenientes de zona endémica (Corrientes y no endémica (Buenos Aires para T. cruzi que presentaban imágenes atípicas con C. luciliae. La serología para Chagas resultó positiva en el 64.7% de las muestras de Buenos Aires y en el 78.3% de las de Corrientes que presentaban frente a C. luciliae imagen conjunta de membrana y flagelo. No presentaron la imagen conjunta ninguna de las muestras de dadores de sangre normales, ni de pacientes con enfermedades del tejido conectivo, excepto dos con lupus que también eran chagásicos. Todas las muestras de pacientes chagásicos analizadas frente a C. luciliae presentaron la imagen conjunta. Se estudiaron también 46 muestras de pacientes con leishmaniasis, 28 de ellos coinfectados con T. cruzi. La imagen conjunta se observó en el 88.0% de las muestras de leishmaniásicos y en el 78.5% de las de coinfectados. Los resultados sugieren que C. luciliae podría ser un sustrato alternativo, económico y de bajo riesgo para el diagnóstico serológico de enfermedad de Chagas, aunque no discrimina la infección por Leishmania. El hallazgo de la imagen conjunta en la detección de anti-ADN nativo señala la conveniencia de realizar en esos pacientes, estudios clínicos y de laboratorio para enfermedad de Chagas y leishmaniasis.Anti-native DNA antibodies can be detected by indirect immunofluorescence assay with

  4. TMS delivered for A-3 Test Stand

    Science.gov (United States)

    2010-01-01

    A state-of-the-art thrust measurement system for the A-3 Test Stand under construction at NASA's John C. Stennis Space Center was delivered March 17. Once completed, the A-3 stand (seen in background) will allow simulated high-altitude testing on the next generation of rocket engines for America's space program. Work on the stand began in 2007, with activation scheduled for 2012. The stand is the first major test structure to be built at Stennis since the 1960s. The recently delivered TMS was fabricated by Thrust Measurement Systems in Illinois. It is an advanced calibration system capable of measuring vertical and horizontal thrust loads with an accuracy within 0.15 percent at 225,000 pounds.

  5. A 3d game in python

    OpenAIRE

    Xu, Minghui

    2014-01-01

    3D game has widely been accepted and loved by many game players. More and more different kinds of 3D games were developed to feed people’s needs. The most common programming language for development of 3D game is C++ nowadays. Python is a high-level scripting language. It is simple and clear. The concise syntax could speed up the development cycle. This project was to develop a 3D game using only Python. The game is about how a cat lives in the street. In order to live, the player need...

  6. Purificación de la hormona Gonadotropina Coriónica humana (HCG por cromatografía de inmunoafinidad.

    Directory of Open Access Journals (Sweden)

    Dayami Dorta Hernández

    2006-06-01

    Full Text Available En el presente trabajo se repota la purificación de la hormona Gonadotropina Coriónica Humana (HCG a escala experimental, a partir de concentrados de orina de mujeres gestales, utilizando el método de inmunopurificación por cromatografía de afinidad. Para ello se acoplaron convalentemente anticuerpos monoclonales específicos por la subunidad ß de la HCG a polímeros de Sefarosa CL 4B activada con Bromuro de Cianógeno (PHARMACIA, Suecia. Se logró aislar la glicoproteína HCG con más de un 95 % de pureza, utilizando KSCN 3M como tampón de elución. La proteína obtenida mantuvo su actividad natural, determinada por Dipstick Cromatográfico y análisis por Western-blot.

  7. 华硕A3N

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ 可以看家的笔记本 是否想过一台平时仅用于工作、娱乐的笔记本电脑还能帮您抓获闯入家中的盗贼呢?如此神奇、超乎想像的笔记本电脑就是记本电脑厂商华硕电脑近日最新推出的一款产品--华硕A3N.这款超级笔记本电脑内置35万象素高品质摄像头和高灵敏麦克风,是全球首款内置Game face功能的笔记本电脑,具有强大的网络视讯能力.同时,只要加载华硕独家的Video security(看门狗)软件,还可摇身一变成为奇特的家庭防盗装置.

  8. Avaliação eosinofílica e soropositividade para anticorpos IgG anti-toxocara em crianças atendidas pelo Sistema Único de Saúde Evaluación eosinófila y suero-positividad para anticuerpos igG anti-toxocara en niños atendidos por el Sistema Único de Salud Eosinophilic count and seropositivity for IgG antibodies to toxocara spp. in children assisted at the public health service

    Directory of Open Access Journals (Sweden)

    Ariella Andrade Marchioro

    2011-03-01

    Full Text Available OBJETIVO: Verificar a associação entre a presença de eosinofilia e a soropositividade para anticorpos IgG anti-Toxocara spp. em crianças atendidas pelo Sistema Único de Saúde no Noroeste do Paraná, Brasil. MÉTODOS: Estudo retrospectivo com crianças de sete meses a 12 anos, atendidas pelo Sistema Único de Saúde do Noroeste do Paraná, com teste ELISA para a pesquisa de anticorpos IgG anti-Toxocara spp. e contagem de eosinófilos (eosinofilia >600 células/mm³. RESULTADOS: Entre as 1.199 crianças, 386 (32,2% apresentaram anticorpos IgG anti-Toxocara spp. A soroprevalência e a eosinofilia foram mais frequentes em crianças de sete meses a cinco anos. A eosinofilia foi observada em 7,8% dos pacientes soro-reagentes ao Toxocara spp.. CONCLUSÕES: Foi observada elevada prevalência de anticorpos anti-Toxocara spp., principalmente nos menores de cinco anos. Com exceção de algumas crianças que apresentaram sintomas respiratórios e presença de eosinofilia, a maioria foi assintomática e não mostrava eosinofilia. A pesquisa de eosinófilos é ferramenta secundária para o diagnóstico de toxocaríase.OBJETIVO: Verificar la asociación entre la presencia de eosinofilia y una suero-positividad para anticuerpos IgG anti-Toxocara spp. en niños atendidos por el Sistema Único de Salud en el noroeste de Paraná, Brasil. MÉTODOS: Estudio retrospectivo en niños de siete meses a 12 años de edad, atendidos por el Sistema Único de Salud en el noroeste de Paraná, con prueba de ELISA para la investigación de anticuerpos IgG anti-Toxocara spp. y recuento de eosinófilos (eosinofilia > 600 células/mm³. RESULTADOS: Entre los 1.199 niños, 386 (32,2% presentaron anticuerpos IgG anti-Toxocara spp. La suero-prevalencia y la eosinofilia fueron más frecuentes en niños de siete meses a cinco años. La eosinofilia fue observada en 7,8% de los pacientes suero-reactivos al Toxocara spp. CONCLUSIÓN: Se observó elevada prevalencia de anticuerpos

  9. Evaluación serológica de una proteína recombinante a partir de una cepa aislada del virus de la fiebre amarilla en el Perú: un estudio piloto

    Directory of Open Access Journals (Sweden)

    Carlos Yábar V

    2003-10-01

    Full Text Available Objetivo: Evaluar serológicamente una proteína recombinante de 66 kDa (Er66 de una cepa del virus de la fiebre amarilla aislada en el Perú usando anticuerpos inmunoreactivos. Material y métodos: La proteína Er66 fue expresada in vitro en la bacteria Escherichia coli y enfrentada a títulos de 1/100, 1/50 y 1/25 de anticuerpos monoclonales, y a sueros con anticuerpos IgM e IgG inmunoreactivos contra el virus de la fiebre amarilla mediante ensayos de Western blot (WB. Asimismo, se evaluaron proteínas totales de las cepas de referencia del virus dengue (DEN y fiebre amarilla como controles de antigenicidad. Resultados: La proteína recombinante Er66 presentó antigenicidad contra títulos de 1/50 y 1/25 de anticuerpo monoclonal (MAB8701; sin embargo, no se observó inmunoreactividad en sueros positivos para fiebre amarilla y dengue. Los ensayos con extractos crudos de la cepa de fiebre amarilla Asibi 17D (PTFA revelaron que la antigenicidad de las proteínas virales comprendidas entre 60 y 80 kDa fue afectada negativamente a temperaturas desnaturalizantes de 100°C. En cambio, tratamientos con ß-mercaptoetanol sin calor generó un aumento de la antigenicidad de dichas proteínas. Siguiendo este mismo principio, la proteína Er66 fue sometida a tratamientos desnaturalizantes con ß-mercaptoetanol sin incluir calor y fue enfrentada nuevamente a los sueros reactivos. El resultado final reveló que la proteína Er66 generó inmunoreactividad frente a sueros con altos títulos de anticuerpos IgM e IgG para fiebre amarilla mientras que en otras muestras se observó una débil señal. Conclusiones: Los datos obtenidos en este trabajo demuestran que la Er66 pudo ser reconocida por anticuerpos IgM e IgG específicos para fiebre amarilla presentes en sueros de pacientes infectados. Los datos presentados en este artículo sugieren el uso de proteínas recombinantes como posibles candidatas de valor diagnóstico para la FA.

  10. 8 CFR 274a.3 - Continuing employment of unauthorized aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Continuing employment of unauthorized aliens. 274a.3 Section 274a.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROL OF EMPLOYMENT OF ALIENS Employer Requirements § 274a.3 Continuing employment...

  11. 26 CFR 48.4061(a)-3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Definitions. 48.4061(a)-3 Section 48.4061(a)-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE... Fuel Automotive and Related Items § 48.4061(a)-3 Definitions. For purposes of the tax imposed...

  12. Interdiffusion of liquid solution components in the A3 - Sb and A3 - Te systems (A3 - Al, Ga, and In)

    International Nuclear Information System (INIS)

    Diagrams of distribution of isoactivity lines of A3 components in the binary systems are constructed on the basis of existing information deduced previously by EMF method on thermodynamic properties of liquid solutions in the A3 - Sb and A3 - Te (A3 - Al, Ga, In) systems. The prognosis on concentration dependence of mutual diffusion coefficients in liquid solutions of the observed systems are made. Limitedness of such predictions because of possible strong dependence of statistic correlation coefficients from concentration is noted. The D.K. Belashchenko equation was rearranged by interaction of fluctuation structural factors Sxx(0). Obtained relationship was used for calculation of isotherms of mutual diffusion coefficients and diffusion of components in the liquid solutions of the researched systems. It is demonstrated that the isotherms of mutual diffusion in the A3 - Sb systems have described by continuous curves, and in the systems A3 - Te they differ by the availability of knee points conforming to composition of A23Te3 formation

  13. 26 CFR 20.2056A-3 - QDOT election.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 14 2010-04-01 2010-04-01 false QDOT election. 20.2056A-3 Section 20.2056A-3... ESTATE TAX; ESTATES OF DECEDENTS DYING AFTER AUGUST 16, 1954 Taxable Estate § 20.2056A-3 QDOT election. (a) General rule. Subject to the time period prescribed in section 2056A(d), the election to treat...

  14. 26 CFR 1.25A-3 - Hope Scholarship Credit.

    Science.gov (United States)

    2010-04-01

    ... established by the Department of Education under the Higher Education Act of 1965 and set forth in 34 CFR 674... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Hope Scholarship Credit. 1.25A-3 Section 1.25A-3... Rates During A Taxable Year § 1.25A-3 Hope Scholarship Credit. (a) Amount of the credit—(1) In...

  15. Pharmacology and therapeutic applications of A3 receptor subtype.

    Science.gov (United States)

    Fishman, Pnina; Bar-Yehuda, Sara

    2003-01-01

    The present study summarizes the biological effects elicit upon A(3) adenosine receptor (A(3)AR) activation in normal and tumor cells. Anti-inflamatory response is mediated upon A(3)AR activation in neutrophils, eosinophils and macrophages via direct effect on cell degranulation or the production of anti-inflamatory cytokines. In basophils, which highly express A(3)AR, degranulation and mediator release upon receptor activation lead to pro-inflammatory effects resulting in bronchospasm and asthma. In other normal cells such as cardiomyocytes, neuronal cells and bone marrow cells A(1)AR activation induces cytoprotective effects in vitro. In vivo, A(3)AR agonists act as cardio- and neuroprotective agents and attenuate ischemic damage. Furthermore, agonists to A(3)AR induce granulocyte colony stimulating factor (G-CSF) production and myeloprotective effect in chemotherapy treated mice. Interestingly, A(3)AR agonists inhibit tumor cell growth both in vitro and in vivo through a cytostatic effect mediated via the de-regulation of the Wnt signaling pathway. The variety of activities elicit by A(3)AR agonists suggest their potential use as therapeutic agents in inflammation, brain/cardiac ischemia and cancer. Antagonists to A(3)AR may be implemented to the therapy of asthma and additional allergic conditions.

  16. El virus sincitial respiratorio humano: una panorámica

    Directory of Open Access Journals (Sweden)

    Mylene Corzo-López

    2013-01-01

    Full Text Available Las infecciones respiratorias agudas, son la principal causa de morbilidad y mortalidad en niños de todo el mundo. Dentro de las principales infecciones virales con características respiratorias, ocupa un lugar preponderante las provocadas por el virus sincitial respiratorio humano. Este virus es uno de los patógenos más importantes que causa infección en el tracto respiratorio en niños pequeños, ancianos y pacientes inmunodeprimidos. Su distribución es mundial. Las epidemias causadas por este virus ocurren anualmente, durante los meses de invierno en los países de clima templado y durante las estaciones de lluvia en los países de clima tropical. Este virus se encuentra dividido en dos subgrupos antigénicos bien definidos, A y B. Los estudios de variabilidad genética, se focalizan en la glicoproteína G, debido al alto grado de variabilidad genética y antigénica que presenta esta entre los diversos aislamientos. En Cuba fue detectado por primera vez en 1964 como el agente causal del brote de bronquiolitis desatado este año. Este virus causa infecciones leves como severas en hospederos susceptibles. Dichas infecciones son prevenidas con el empleo de medicamentos profilácticos como por ejemplo: péptidos sintéticos, anticuerpos policlonales y monoclonales humanizados, antígenos virales recombinantes, sin embargo, el más aplicado es el palivizumab (anticuerpo monoclonal humanizado. Se ha observado, que con el empleo de este anticuerpo se ha logrado disminuir a nivel mundial la tasa de hospitalización de los hospederos más susceptibles. Actualmente se investigan otros medicamentos los cuales presentan un modo de acción diferente al palivizumab.

  17. Simple groups with orders 2a3b5cpd,2a3b7cpd and 2a3b5c7d

    Institute of Scientific and Technical Information of China (English)

    JIANG Youyi; TAN Mingshu; LIU Xuefei

    2004-01-01

    This work deals with the power exponent r1 and r2 respectively of the maximal and second-maximal prime factors of the order of simple K4-group, and the classification for simple {5,7}'- K4-group G (i.e. |G| can not be divided by 5 nor by 7 or |π(G)| = 4 ), simple 5' - K4 -group G (i.e. |G| can not divided by 5 and |π(G)| =4) and simple 7'- K4 -group G (i.e. |G| can not divided by 7 and |π(G)| =4). It is derived that r1 =1, 2 and 4, and r2 is not greater than 4. All the simple K4 -groups with order 2a3b5cpd, 2a3b7cpd and 2a3b5c7d are obtained.

  18. 26 CFR 48.4161(a)-3 - Parts and accessories.

    Science.gov (United States)

    2010-04-01

    ....4161(a)-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods § 48.4161(a)-3 Parts and accessories. (a) In general. The tax attaches with respect to parts and accessories for articles specified...

  19. Using Toyota's A3 Thinking for Analyzing MBA Business Cases

    Science.gov (United States)

    Anderson, Joe S.; Morgan, James N.; Williams, Susan K.

    2011-01-01

    A3 Thinking is fundamental to Toyota's benchmark management philosophy and to their lean production system. It is used to solve problems, gain agreement, mentor team members, and lead organizational improvements. A structured problem-solving approach, A3 Thinking builds improvement opportunities through experience. We used "The Toyota…

  20. 26 CFR 1.6038A-3 - Record maintenance.

    Science.gov (United States)

    2010-04-01

    ... for the group. Revenues from only one VCR model, model number VCRX-10, are sufficiently large to make... 26 Internal Revenue 13 2010-04-01 2010-04-01 false Record maintenance. 1.6038A-3 Section 1.6038A-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX...

  1. Importing a 3D model from an industrial design

    OpenAIRE

    Tran Thi, Thien

    2015-01-01

    In the media industry, sharing and transferring a 3D model to other programs for different stages of design is widely used. The final year project was carried out based on a case study in which a 3D model was imported from an industrial design to Autodesk 3ds Max. The thesis focuses on defining the workflow for importing a third-party 3D model to the 3ds Max program. In general, importing a 3D model made by one program to another one always presents many challenges. The purposes of this s...

  2. A 3D digital medical photography system in paediatric medicine.

    Science.gov (United States)

    Williams, Susanne K; Ellis, Lloyd A; Williams, Gigi

    2008-01-01

    In 2004, traditional clinical photography services at the Educational Resource Centre were extended using new technology. This paper describes the establishment of a 3D digital imaging system in a paediatric setting at the Royal Children's Hospital, Melbourne.

  3. Corrosion Behaviors of Steel A3 Exposed to Thiobacillus Ferrooxidans

    Institute of Scientific and Technical Information of China (English)

    Jianhua LIU; Xin LIANG; Songmei LI

    2008-01-01

    The corrosion behaviors of steel A3 in synergistic action of Thiobacillus ferrooxidans (T.f) and electrochemically accelerated corrosion were studied by electrochemical, microbiology and surface analysis methods. The open circuit potential (Eocp) and electrochemical impedance spectroscopy (EIS) of the steel A3 electrodes were measured in leathen culture medium without and with T.f (simply called T.f solution in the following paper)in immersion electrode way at the time of the 2nd, 5th, 10th, 20th and 30th days, respectively. It was found that Eocp of the electrode for immersion in leathen culture medium shifted negatively with the immersion time while that for immersion in T.f solutions shifted negatively, then positively and finally negatively. On the 20th day, the corrosion of steel A3 for immersion in culture medium was in pitting initiation stage while that for immersion in T.f solutions was in pitting growth stage. It was found that the corrosion of steel A3 was accelerated by T.f. The morphology of corrosion product of steel A3 immersion in T.f solutions observed through scanning electron microscopy (SEM) transformed from solid globules to tabular plates and to spongy globules and plates.

  4. Isopropyl alcohol tank installed at A-3 Test Stand

    Science.gov (United States)

    2009-01-01

    An isopropyl alcohol (IPA) tank is lifted into place at the A-3 Test Stand being built at NASA's John C. Stennis Space Center. Fourteen IPA, water and liquid oxygen (LOX) tanks are being installed to support the chemical steam generators to be used on the A-3 Test Stand. The IPA and LOX tanks will provide fuel for the generators. The water will allow the generators to produce steam that will be used to reduce pressure inside the stand's test cell diffuser, enabling operators to simulate altitudes up to 100,000 feet. In that way, operators can perform the tests needed on rocket engines being built to carry humans back to the moon and possibly beyond. The A-3 Test Stand is set for completion and activation in 2011.

  5. Mutations in ALDH1A3 cause microphthalmia.

    Science.gov (United States)

    Aldahmesh, M A; Khan, A O; Hijazi, H; Alkuraya, F S

    2013-08-01

    Microphthalmia is an important inborn error of eye development that can be associated with multisystem involvement. Anophthalmia is more severe and rarer. Single mutations in an expanding list of genes are known to cause this spectrum of anomaly. In one branch of a multiplex family with microphthalmia and anophthalmia, autozygome analysis excluded all known microphthalmia genes at the time of doing this study. Exome sequencing and autozygome filtration identified a novel homozygous variant in ALDH1A3. Subsequently, we identified another homozygous variant in 2 of the 10 probands with microphthalmia we specifically screened for mutations in ALDH1A3. Interestingly, the other branch of the original family was found to segregate anophthalmia/syndactyly with a novel homozygous SMOC1 variant. Our data support the very recent and independent identification of ALDH1A3 as a disease gene in microphthalmia. Locus heterogeneity should be considered in consanguineous families even for extremely rare phenotypes.

  6. Role of A3 adenosine receptor in diabetic neuropathy.

    Science.gov (United States)

    Yan, Heng; Zhang, Enshui; Feng, Chang; Zhao, Xin

    2016-10-01

    Neuropathy is the most common diabetic complication. Although the A1 and A2A adenosine receptors are important pharmacological targets in alleviating diabetic neuropathy, the role of the A3 adenosine receptor remains unknown. Because the A3 adenosine receptor regulates pain induced by chronic constriction injury or chemotherapy, its stimulation might also attenuate diabetic neuropathy. This study examines the effects of systemic treatment with the A3 adenosine receptor agonist 1-deoxy-1-[6-[[(3-iodophenyl)methyl]amino]-9H-purin-9-yl]-N-methyl-β-d-ribofuranuronamide (IB-MECA) on diabetic neuropathy and explores the putative mechanisms underlying its pharmacological effects. We show that IB-MECA alleviated mechanical hyperalgesia and thermal hypoalgesia in mice 2 weeks but not 4 weeks after streptozocin (STZ) treatment. Furthermore, IB-MECA prevented the reduction in sciatic motor nerve conduction velocity and sensory nerve conduction velocity in diabetic mice 2 weeks but not 4 weeks after STZ treatment. Similarly, IB-MECA inhibited the activation of nuclear factor-κB and decreased the generation of tumor necrosis factor-α in the spinal cord of mice 2 weeks but not 4 weeks after STZ treatment. These phenomena were associated with reduction of A3 adenosine receptor expression in the spinal cord after long-term diabetes. Our results suggest that the A3 adenosine receptor plays a critical role in regulating diabetic neuropathy and that reduction in A3 adenosine receptor expression/function might contribute to the progression of diabetic neuropathy. © 2016 Wiley Periodicals, Inc.

  7. Description and Operation of the A3 Subscale Facility

    Science.gov (United States)

    Saunders, G. P.; Varner, D. G.; Grover, J. B.

    2010-01-01

    The purpose of this paper is to give an overview of the general design and operation of the A3 Subscale test facility. The goal is to provide the reader with a general understanding of what the major facility systems are, where they are located, and how they are used to meet the objectives supporting the design of the A3 altitude rocket test facility. This paper also provides the reader with the background information prior to reading the subsequent papers detailing the design and test results of the various systems described herein.

  8. The A3 adenosine receptor (A3AR): therapeutic target and predictive biological marker in rheumatoid arthritis.

    Science.gov (United States)

    Fishman, Pnina; Cohen, Shira

    2016-09-01

    The Gi protein-associated A3 adenosine receptor (A3AR) is over-expressed in inflammatory cells, and this high expression is also reflected in the peripheral blood mononuclear cells of patients with autoimmune inflammatory diseases such as rheumatoid arthritis, psoriasis, and Crohn's disease. CF101, a selective agonist with high affinity to the A3AR, is known to induce robust anti-inflammatory effect in experimental animal models of adjuvant-, collagen-, and tropomyosin-induced arthritis. The effect is mediated via a definitive molecular mechanism entailing deregulation of the nuclear factor-κB (NF-κB) and the Wnt signal transduction pathways resulting in apoptosis of inflammatory cells. CF101 was found to be safe and well tolerated in all preclinical, phase I, and phase II human clinical studies. In two phase II clinical studies where CF101 was administered to rheumatoid arthritis (RA) patients as a stand-alone drug, a significant anti-rheumatic effect and a direct significant correlation were found between receptor expression at baseline and patients' response to the drug, suggesting that A3AR may be utilized as a predictive biomarker. The A3AR is a promising therapeutic target in rheumatoid arthritis and can be used also as a biological marker to predict patients' response to CF101. This is a unique type of a personalized medicine approach which may pave the way for a safe and efficacious treatment for this patient population. PMID:26886128

  9. A 3D Serious City Building Game on Waste Disposal

    Science.gov (United States)

    Cuccurullo, Stefania; Francese, Rita; Passero, Ignazio; Tortora, Genoveffa

    2013-01-01

    The environmental priority requires structural interventions that will be effective in the long period only if they are accompanied by modifications of behaviors, orientations and beliefs, specially investing in the new generations. This paper presents a 3D Virtual World serious game named Pappi World, designed according to pedagogical theories…

  10. Periodic boundary conditions in a 3D hydro code

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, D L; Neely, J R; Vantine, H C

    1998-09-18

    We have modified a 3D hydrodynamics code so that it has the capability to impose periodic boundary conditions on the problem being considered. This capability allows it to treat only a basic symmetry unit of the problem when translational or rotational periodic symmetries are present. The code has been run successfully for two test problems involving rotational symmetries.

  11. ALDH1A3 mutations cause recessive anophthalmia and microphthalmia.

    Science.gov (United States)

    Fares-Taie, Lucas; Gerber, Sylvie; Chassaing, Nicolas; Clayton-Smith, Jill; Hanein, Sylvain; Silva, Eduardo; Serey, Margaux; Serre, Valérie; Gérard, Xavier; Baumann, Clarisse; Plessis, Ghislaine; Demeer, Bénédicte; Brétillon, Lionel; Bole, Christine; Nitschke, Patrick; Munnich, Arnold; Lyonnet, Stanislas; Calvas, Patrick; Kaplan, Josseline; Ragge, Nicola; Rozet, Jean-Michel

    2013-02-01

    Anophthalmia and microphthalmia (A/M) are early-eye-development anomalies resulting in absent or small ocular globes, respectively. A/M anomalies occur in syndromic or nonsyndromic forms. They are genetically heterogeneous, some mutations in some genes being responsible for both anophthalmia and microphthalmia. Using a combination of homozygosity mapping, exome sequencing, and Sanger sequencing, we identified homozygosity for one splice-site and two missense mutations in the gene encoding the A3 isoform of the aldehyde dehydrogenase 1 (ALDH1A3) in three consanguineous families segregating A/M with occasional orbital cystic, neurological, and cardiac anomalies. ALDH1A3 is a key enzyme in the formation of a retinoic acid gradient along the dorso-ventral axis during early eye development. Transitory expression of mutant ALDH1A3 open reading frames showed that both missense mutations reduce the accumulation of the enzyme, potentially leading to altered retinoic acid synthesis. Although the role of retinoic acid signaling in eye development is well established, our findings provide genetic evidence of a direct link between retinoic-acid-synthesis dysfunction and early-eye-development anomalies in humans.

  12. Embryonic staging using a 3D virtual reality system

    NARCIS (Netherlands)

    C.M. Verwoerd-Dikkeboom (Christine); A.H.J. Koning (Anton); P.J. van der Spek (Peter); N. Exalto (Niek); R.P.M. Steegers-Theunissen (Régine)

    2008-01-01

    textabstractBACKGROUND: The aim of this study was to demonstrate that Carnegie Stages could be assigned to embryos visualized with a 3D virtual reality system. METHODS: We analysed 48 3D ultrasound scans of 19 IVF/ICSI pregnancies at 7-10 weeks' gestation. These datasets were visualized as 3D 'holog

  13. Scurvy in a 3-year-old boy: MRI features

    OpenAIRE

    Cock, J.,; Renard, M; de Smet, M.; Breysem, L

    2012-01-01

    A 3-year-old boy presented with painful knees (especially the right knee) and difficulty in walking for a few weeks. He complained of lower limb weakness. He was irritable and thinly built. At clinical examination movement of the knees and hips was painful. He had previously been diagnosed with autism. The mother reported that he didn’t eat well.

  14. The stringent response in Streptomyces coelicolor A3(2)

    NARCIS (Netherlands)

    Strauch, E.; Takano, E.; Baylis, H.A.; Bibb, M.J.

    1991-01-01

    The stringent response was elicited in the antibiotic producer Streptomyces coelicolor A3(2) either by amino acid depletion (nutritional shiftdown) or by the addition of serine hydroxamate; both led to increased levels of ppGpp and to a reduction in transcription from the four promoters of the rrnD

  15. Uso de una conantokina y anticuerpos policlonales para identificar la subunidad NR2B del receptor

    OpenAIRE

    Leonardo Lareo,†; Edgar Reyes M; Edwin Reyes G

    2010-01-01

    Objetivo. Proponer una metodología de identificación de la subunidad NR2B, mediante el uso de conantokina G, así como una adecuada extracción de la subunidad NR2B. Materiales y métodos. Se ensayaron dos metodologías para la extracción de la subunidad NR2B de cerebro de rata adulta, la primera buscó la extracción de la subunidad a partir de la membrana mediante la utilización del detergente deoxicolato de sodio y la segunda, garantizó primero la solubilización y eliminación de proteínas citopl...

  16. Calidad de vida de los pacientes con inmunodeficiencias primarias de anticuerpos

    Directory of Open Access Journals (Sweden)

    Rodolfo Muriel-Vizcaíno

    2016-02-01

    análisis de covarianza. Se incluyeron 28 pacientes. La mediana de edad fue 5 años y 5 meses. Resultados: el promedio de edad al diagnóstico fue de 6 años con 3 meses. La mediana de retraso diagnóstico fue de 3 años 3 meses. El promedio de calidad de vida en los pacientes fue de 74.1 (DE ± 13.8 y de 83.3 (DE ± 10.1 para los controles (p = 0.005. La relación entre calidad de vida, retraso diagnóstico y presencia de complicaciones se analizó mediante un modelo lineal que fue marginalmente significativo (p = 0.056. Se encontró correlación negativa entre concentraciones de IgG en el último año y la calidad de vida. Se observó que, en los pacientes que presentaban bronquiectasias, conforme aumentan los años de retraso en el diagnóstico la calidad de vida disminuye de forma significativa (p = 0.007. Conclusiones: consideramos necesario evaluar la calidad de vida para conocer el estado de salud de los pacientes con inmunodeficiencias primarias y para su seguimiento durante el tratamiento con el objeto de incidir no sólo en la reducción del número de infecciones, hospitalizaciones y complicaciones, sino también en la mejoría de su calidad de vida. Deberá diseñarse un instrumento específico para evaluar la calidad de vida de los pacientes con inmunodeficiencias primarias.

  17. A 3-D SAR approach to IFSAR processing

    Energy Technology Data Exchange (ETDEWEB)

    DOERRY,ARMIN W.; BICKEL,DOUGLAS L.

    2000-03-01

    Interferometric SAR (IFSAR) can be shown to be a special case of 3-D SAR image formation. In fact, traditional IFSAR processing results in the equivalent of merely a super-resolved, under-sampled, 3-D SAR image. However, when approached as a 3-D SAR problem, a number of IFSAR properties and anomalies are easily explained. For example, IFSAR decorrelation with height is merely ordinary migration in 3-D SAR. Consequently, treating IFSAR as a 3-D SAR problem allows insight and development of proper motion compensation techniques and image formation operations to facilitate optimal height estimation. Furthermore, multiple antenna phase centers and baselines are easily incorporated into this formulation, providing essentially a sparse array in the elevation dimension. This paper shows the Polar Format image formation algorithm extended to 3 dimensions, and then proceeds to apply it to the IFSAR collection geometry. This suggests a more optimal reordering of the traditional IFSAR processing steps.

  18. IONIZATION OF CLUSTERS SPUTTERED FROM A3B5 COMPOUNDS

    OpenAIRE

    Sroubek, Z; Hulek, Z.

    1989-01-01

    The process of formation of charged atomic clusters of a general form A3nB5m (3⩽n, m⩽1) emitted from A3B5 compounds (GaAs, InP, Gap, InSb) under the bombardment of slow rare gas primary ions (< 2 keV) has been studied. The experimental data encompass the measurements of ion emission under the impact of He+ and Kr+ ions with primary energies Ep ranging from 0.2 keV to 2 keV and SNMS data on GaAs. The variation of Ep provides means of controlling the level of substrate electronic excitations. T...

  19. Bacoside A3--a triterpenoid saponin from Bacopa monniera.

    Science.gov (United States)

    Rastogi, S; Pal, R; KulshreshthaDK

    1994-05-01

    A new triterpenoid saponin, bacoside A3, a constituent of bacosides the saponin mixture of Bacopa monniera, was isolated and characterized. Its structure was established as 3-beta-[O-beta-D-glucopyranosyl(1-->3)-O- [alpha-L-arabinofuranosyl(1-->2) ]O-beta-D-glucopyranosyl)oxy]jujubogenin by chemical and spectral analyses. The cis-isomer of ebelin lactone was also obtained as one of the artefacts of the aglycone and its structure revised.

  20. A 3-D Hall Sensor for Precise Angular Position Measurements

    OpenAIRE

    DIMITROV, Konstantin Veselinov

    2007-01-01

    A 3-D silicon Hall effect sensor for precise angular-position measurement over 360° rotation is presented. This vector microtransducer functionally integrates into a common sensor region two parallel-field Hall devices for in-plane components of the magnetic field and one orthogonal Hall version for the perpendicular for the chip magnetic field. The advantages of this magnetometer are its low channel cross-sensitivities, remarkable simplified device design and high spatial resolution.

  1. Design of a 3 DOF displacement stage based on ferrofluids.

    OpenAIRE

    Millet, G.; Hubert, Arnaud

    2006-01-01

    International audience This paper presents the design of a 3 DOF (Degrees Of Freedom) displacement stage. This stage is composed of a mobile platform in suspension on three ferrofluid bubbles as an hydrostatic suspension. Bubbles stay attached to the platform thanks to three permanent magnets fixed on this platform. The actuation is obtained by fixing and controlling three coils on the support near the magnets. The dynamical characteristics of the stage are tuning by choosing appropriate v...

  2. Localizing Gravity on a 3-brane in Higher Dimensions

    CERN Document Server

    Gherghetta, Tony

    2001-01-01

    We present metric solutions in six and higher dimensions with a bulk cosmological constant, where gravity is localized on a 3-brane. The corrections to four-dimensional gravity from the bulk continuum modes are power-law suppressed. Furthermore, the introduction of a bulk ``hedgehog'' magnetic field leads to a regular geometry, and can localize gravity on the 3-brane with either positive, zero or negative bulk cosmological constant.

  3. A 3D GIS for managing building rehabilitation process

    OpenAIRE

    Ramos, Fabien; Siret, Daniel; Musy, Marjorie

    2004-01-01

    International audience Increase in energy efficiency and reduction of greenhouse gas emissions of buildings can be achieved through improvements made in the existing stock of buildings. Therefore, one of the objectives for incentive policies should be to promote environmental issues each time a rehabilitation process is engaged. Specific tools have to be developed for that purpose. In this paper, we present a 3D Geographical Information System (3D GIS) designed to evaluate the environmenta...

  4. Design and Applications of A 3D Precision Probe

    Institute of Scientific and Technical Information of China (English)

    YANG Lian-gen; LIU Xin-biao; XIE Tie-bang

    2005-01-01

    A 3D probe used for NC copying process is proposed in the paper. The construction of parallel springs is adopted in the probe. It has compact structure and little volume. By adjusting spring force and improving sensitivity, the probe can be used in CMM. Errors of the probe are analysed.Performances of the probe are verified by test of measuring force, verification of precision of single axis and plane precision.

  5. Kinematics of A 3-PRP planar parallel robot

    OpenAIRE

    Chablat, Damien; Staicu, Stefan

    2009-01-01

    Recursive modelling for the kinematics of a 3-PRP planar parallel robot is presented in this paper. Three planar chains connecting to the moving platform of the manipulator are located in a vertical plane. Knowing the motion of the platform, we develop the inverse kinematics and determine the positions, velocities and accelerations of the robot. Several matrix equations offer iterative expressions and graphs for the displacements, velocities and accelerations of three prismatic actuators.

  6. Incomplete penetrance of biallelic ALDH1A3 mutations.

    Science.gov (United States)

    Plaisancié, Julie; Brémond-Gignac, Dominique; Demeer, Bénédicte; Gaston, Véronique; Verloes, Alain; Fares-Taie, Lucas; Gerber, Sylvie; Rozet, Jean-Michel; Calvas, Patrick; Chassaing, Nicolas

    2016-04-01

    The formation of a properly shaped eye is a complex developmental event that requires the coordination of many induction processes and differentiation pathways. Microphthalmia and anophthalmia (MA) represent the most severe defects that can affect the ocular globe during embryonic development. When genetic, these ocular disorders exhibit large genetic heterogeneity and extreme variable expressivity. Around 20 monogenic diseases are known to be associated with MA as main phenotype and the penetrance of mutations is usually full in the patients. Some of these genes encode proteins involved in the vitamin A pathway, tightly regulated during eye development. One of those retinoic acid synthesis genes is ALDH1A3 and biallelic mutations in that gene have been recently found to lead to MA phenotype in patients. Interestingly, we report here the lack of ocular defect in a girl carrying the same homozygous mutation in the ALDH1A3 gene than the affected members of her family. Thus, this report brings new information for the phenotype-genotype correlation of ALDH1A3 mutations and raises important questions, especially in terms of genetic counselling given to the patients and their families. Furthermore, these data contribute to the more general understanding that we have for the complex genetic inheritance of these MA phenotypes. PMID:26873617

  7. con el aborto provocado

    Directory of Open Access Journals (Sweden)

    José Luis Redondo Calderón

    2008-01-01

    Full Text Available Las vacunas de células diploides humanas (WI-38, MRC-5 tienen un origen éticamente objetable, dado que dichas células proceden de abortos provocados. Entre ellas destacan vacunas empleadas contra rubéola, sarampión, parotiditis, rabia, poliomielitis, viruela, hepatitis A, varicela y herpes zóster. Actualmente se encuentran en desarrollo otras vacunas cultivadas en células (293, PER.C6 transformadas mediante virus, procedentes de abortos. Entre ellas hay vacunas contra la gripe, virus respiratorio sincitial, parainfl uenza, HIV, virus del Nilo Occidental, virus Ébola, Marburg y Lassa, hepatitis B y C, glosopeda, encefalitis japonesa, dengue, tuberculosis, carbunco, peste, tétanos y paludismo. También con igual origen se trabaja en la elaboración de anticuerpos monoclonales y otras proteínas, terapia génica y genómica. Existe la tecnología necesaria para producir todo lo descrito sin recurrir a abortos provocados. Debe indicarse en los prospectos de vacunas y otros productos el origen de las células empleadas. Debe facilitarse el acceso a las vacunas existentes no cultivadas en células procedentes de abortos provocados. Debe potenciarse la investigación de opciones en aquellos casos en los que no exista una vacuna no originada en células procedentes de abortos provocados. Debe potenciarse la elaboración de anticuerpos monoclonales y de otras proteínas, así como la terapia génica y la genómica sin recurrir a células procedentes de abortos provocados. No sería consecuente rechazar productos obtenidos a partir de células troncales embrionarias y aceptar los originados en células procedentes de abortos provocados. Se debe evitar que la biotecnología basada en el aborto provocado invada todos los terrenos de la medicina.

  8. Multiphysics & Parallel Kinematics Modeling of a 3DOF MEMS Mirror

    OpenAIRE

    Mamat N.; Rabenorosoa K.; Clévy C.; Lutz P.; Xie H.

    2015-01-01

    This paper presents a modeling for a 3DoF electrothermal actuated micro-electro-mechanical (MEMS) mirror used to achieve scanning for optical coherence tomography (OCT) imaging. The device is integrated into an OCT endoscopic probe, it is desired that the optical scanner have small footprint for minimum invasiveness, large and flat optical aperture for large scanning range, low driving voltage and low power consumption for safety reason. With a footprint of 2mm×2mm, the MEMS scanner which is ...

  9. A 3-step therapeutic strategy for severe alveolar proteinosis.

    Science.gov (United States)

    Noirez, Leslie; Koutsokera, Angela; Pantet, Olivier; Duss, François-Régis; Eggimann, Philippe; Tozzi, Piergiorgio; Gonzalez, Michel; Coronado, Marcos; Nicod, Laurent P; Lovis, Alban

    2015-04-01

    Pulmonary alveolar proteinosis (PAP) is characterized by accumulation of lipoproteinaceous material in the terminal airways. Whole lung lavage (WLL) remains the gold standard treatment but may be particularly challenging in cases of severe hypoxemia. We present a 3-step strategy that was used in a patient with PAP-associated refractory hypoxemia and that combined venovenous extracorporeal membrane oxygenation (vvECMO), double-lumen orotracheal intubation, and bilateral multisegmental sequential lavage (MSL). The procedure was well tolerated and permitted weaning from the ventilator. PMID:25841841

  10. A 3D Optical Metamaterial Made by Self-Assembly

    KAUST Repository

    Vignolini, Silvia

    2011-10-24

    Optical metamaterials have unusual optical characteristics that arise from their periodic nanostructure. Their manufacture requires the assembly of 3D architectures with structure control on the 10-nm length scale. Such a 3D optical metamaterial, based on the replication of a self-assembled block copolymer into gold, is demonstrated. The resulting gold replica has a feature size that is two orders of magnitude smaller than the wavelength of visible light. Its optical signature reveals an archetypal Pendry wire metamaterial with linear and circular dichroism. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Design and manufacture of a 3D Printer

    OpenAIRE

    Witkowski, Sebastian Maximilian

    2015-01-01

    The aim of this work is to create and manufacture working prototype of a 3D printer. The task is first addressed by conducting broad study about 3D printing technology and available designs in the industry and consumer market. In the next step, in the redesigning and investigation process, various iterations of improved 3D Printers models are made and evaluated, including commercialized in self-funded company Pyramid 3D Studio: the model MM S P3DS. The final outcome of this wor...

  12. A3设计工作室

    Institute of Scientific and Technical Information of China (English)

    于洋(译)

    2010-01-01

    A3设计工作室位于北卡罗来纳的夏洛特,其建立者是才华横溢的艾伦·奥特曼(Alan Altman)和阿曼达·奥特曼(Amanda Altman)。艾伦说他的艺术灵感可以追溯到他年轻时候为自己的树房设计的标志。阿曼达在高中时代就为罗切斯特·马可比游戏设计标识

  13. Performance Analysis of a 3D Ionosphere Tomographic Model

    Institute of Scientific and Technical Information of China (English)

    Liu Zhi-zhao; Gao Yang

    2003-01-01

    A 3D high precision ionospheric model is developed based on tomography technique. This tomographic model employs GPS data observed by an operational network of dual-frequency GPS receivers. The methodology of developing a 3D ionospheric tomography model is briefly summarized. However emphasis is put on the analysis and evaluation of the accuracy variation of 3D ionosphere modeling with respect to the change of GPS data cutoff angle.Three typical cutoff angle values (15°, 20° and 25°) are tested. For each testing cutoff angle, the performances of the3D ionospheric model constructed using tomography technique are assessed by calibrating the model predicted ionospheric TEC with the GPS measured TEC and by employing the model predicted TEC to a practical GPS positioning application single point positioning (SPP).Test results indicate the 3D model predicted VTEC has about 0.4 TECU improvement in accuracy when cutoff angle rises from 15° to 20°. However, no apparent improvement is found from 20° to 25°. The model's improvement is also validated by the better SPP accuracy of 3D model than its counterpart-dual frequency model in the 20° and 25° cases.

  14. Designing a 3rd generation, authenticatable attribute measurement system

    International Nuclear Information System (INIS)

    Attribute measurement systems (AMS) are designed to measure potentially sensitive items containing Special Nuclear Materials to determine if the items possess attributes which fall within an agreed-upon range. Such systems could be used in a treaty to inspect and verify the identity of items in storage without revealing any sensitive information associated with the item. An AMS needs to satisfy two constraints: the host party needs to be sure that none of their sensitive information is released, while the inspecting party wants to have confidence that the limited amount of information they see accurately reflects the properties of the item being measured. The former involves 'certifying' the system and the latter 'authenticating' it. Previous work into designing and building AMS systems have focused more on the questions of certifiability than on the questions of authentication - although a few approaches have been investigated. The next step is to build a 3rd generation AMS which (1) makes the appropriate measurements, (2) can be certified, and (3) can be authenticated (the three generations). This paper will discuss the ideas, options, and process of producing a design for a 3rd generation AMS.

  15. A 3D Babcock-Leighton Solar Dynamo Model

    CERN Document Server

    Miesch, Mark S

    2014-01-01

    We present a 3D kinematic solar dynamo model in which poloidal field is generated by the emergence and dispersal of tilted sunspot pairs (more generally Bipolar Magnetic Regions, or BMRs). The axisymmetric component of this model functions similarly to previous 2D Babcock-Leighton (BL) dynamo models that employ a double-ring prescription for poloidal field generation but we generalize this prescription into a 3D flux emergence algorithm that places BMRs on the surface in response to the dynamo-generated toroidal field. In this way, the model can be regarded as a unification of BL dynamo models (2D in radius/latitude) and surface flux transport models (2D in latitude/longitude) into a more self-consistent framework that captures the full 3D structure of the evolving magnetic field. The model reproduces some basic features of the solar cycle including an 11-yr periodicity, equatorward migration of toroidal flux in the deep convection zone, and poleward propagation of poloidal flux at the surface. The poleward-p...

  16. A 3-mode, Variable Velocity Jet Model for HH 34

    CERN Document Server

    Raga, A C

    1998-01-01

    Variable ejection velocity jet models can qualitatively explain the appearance of successive working surfaces in Herbig-Haro (HH) jets. This paper presents an attempt to explore which features of the HH-34 jet can indeed be reproduced by such a model. From previously published data on this object, we find evidence for the existence of a 3-mode ejection velocity variability, and then explore the implications of such a variability. From simple, analytic considerations it is possible to show that the longer period modes produce a modulation on the shorter period modes, resulting in the formation of ``trains'' of multiple knots. The knots observed close to the source of HH-34 could correspond to such a structure. Finally, a numerical simulation with the ejection velocity variability deduced from the HH-34 data is computed. This numerical simulation shows a quite remarkable resemblance with the observed properties of the HH-34 jet.

  17. Piebaldism in a 3-month-old infant: Case report

    Directory of Open Access Journals (Sweden)

    Milankov Olgica

    2014-01-01

    Full Text Available Introduction. Piebaldism is an autosomal dominant disorder characterized by the congenital absence of melanocytes in the affected areas of skin and hair due to mutations of the KIT protooncogene, which affects the differentiation and migration of melanoblasts. Case report. A 3 ½ month old male infant was admitted to hospital due to depigmentation of skin in the area of forehead, trunk and extremities. On admission, he had multiple, irregularly shaped areas of leucoderma present at the forehead, abdomen, lower legs and left forearm. Based on the characteristic skin features and family history, we diagnosed the boy’s leucoderma as piebaldism. Conclusion. Vitiligo differs from piebaldism by the presence of unstable hypopigmented lesions that are acquired later in life. Albinism presents with widespread skin involvement and lacks the characteristic hyperpigmented macules within hypopigmented areas.

  18. LOAD CONTROL OF A 3-Ø SELF- EXCITED ASYNCHRONOUS GENERATOR

    Directory of Open Access Journals (Sweden)

    SUBRAMANIAN KULANDHAIVELU

    2011-02-01

    Full Text Available This paper describes the simulation based performance study of a 3-Ø self-excited asynchronous generator (SEASG in constant power operation. A feed back voltage based controller by using a load control technique to control and retain the generator terminal voltage constant. This technique mostly used in uncontrolled hydroturbine driven induction generators in a stand-alone power generator. The results has been validate by the steady state equivalent circuit analysis of a 2.2kW, 415Volts, 4.7A, Star connected, 1440-rpm induction generator. The proposed study system has been simulated using Mat lab/Simulink version-7.0.The simulated results arepresented.

  19. Chapter A3. Cleaning of Equipment for Water Sampling

    Science.gov (United States)

    Wilde, Franceska D., (Edited By); Radtke, Dean B.; Gibs, Jacob; Iwatsubo, Rick T.

    1998-01-01

    The National Field Manual for the Collection of Water-Quality Data (National Field Manual) describes protocols and provides guidelines for U.S. Geological Survey (USGS) personnel who collect data used to assess the quality of the Nation's surface-water and ground-water resources. Chapter A3 describes procedures for cleaning the equipment used to collect and process samples of surface water and ground water and procedures for assessing the efficacy of the equipment-cleaning process. This chapter is designed for use with the other chapters of this field manual. Each chapter of the National Field Manual is published separately and revised periodically. Newly published and revised chapters will be posted on the USGS page 'National Field Manual for the Collection of Water-Quality Data.' The URL for this page is http://pubs.water.usgs.gov/twri9A/ (accessed September 20, 2004).

  20. A 3D Printed Toolbox for Opto-Mechanical Components

    CERN Document Server

    Salazar-Serrano, L J; Torres, J P

    2016-01-01

    Nowadays is very common to find headlines in the media where it is stated that 3D printing is a technology called to change our lives in the near future. For many authors, we are living in times of a third industrial revolution. Howerver, we are currently in a stage of development where the use of 3D printing is advantageous over other manufacturing technologies only in rare scenarios. Fortunately, scientific research is one of them. Here we present the development of a set of opto-mechanical components that can be built easily using a 3D printer based on Fused Filament Fabrication (FFF) and parts that can be found on any hardware store. The components of the set presented here are highly customizable, low-cost, require a short time to be fabricated and offer a performance that compares favorably with respect to low-end commercial alternatives.

  1. A 3D printed electromagnetic nonlinear vibration energy harvester

    Science.gov (United States)

    Constantinou, P.; Roy, S.

    2016-09-01

    A 3D printed electromagnetic vibration energy harvester is presented. The motion of the device is in-plane with the excitation vibrations, and this is enabled through the exploitation of a leaf isosceles trapezoidal flexural pivot topology. This topology is ideally suited for systems requiring restricted out-of-plane motion and benefits from being fabricated monolithically. This is achieved by 3D printing the topology with materials having a low flexural modulus. The presented system has a nonlinear softening spring response, as a result of designed magnetic force interactions. A discussion of fatigue performance is presented and it is suggested that whilst fabricating, the raster of the suspension element is printed perpendicular to the flexural direction and that the experienced stress is as low as possible during operation, to ensure longevity. A demonstrated power of ˜25 μW at 0.1 g is achieved and 2.9 mW is demonstrated at 1 g. The corresponding bandwidths reach up-to 4.5 Hz. The system’s corresponding power density of ˜0.48 mW cm-3 and normalised power integral density of 11.9 kg m-3 (at 1 g) are comparable to other in-plane systems found in the literature.

  2. A Typical Simulation of a 3-KW Stirling Engine

    Directory of Open Access Journals (Sweden)

    Duan Chen

    2012-10-01

    Full Text Available Stirling engine is being received more and more attention with the development of renewable energy utility. The paper described the design and simulation of a 3-KW Stirling engine based on a testing V-type machine while in the process of manufactured at the Huazhong University of Science and Technology. The engine was driven by solar energy. Based on the testing machine, the heater model of variable heat source, regenerator model and complete appliance model were built, and the thermal performance was simulated and shown under a typical sunlight in the area of Wuhan. The results suggested that the output power curve of Stirling engine appeared as the shape of a saddle in consideration that the radiant energy density of solar energy was non-constant, and electrical heating was employed to serve as the auxiliary heat source. There was about 1.83 KW output work of the manufactured engine during the simulation, and the effective efficiency was about 25.4%.

  3. Successive Translocation of the Rings in a [3]Rotaxane.

    Science.gov (United States)

    Jagesar, Dhiredj C; Wiering, Piet G; Kay, Euan R; Leigh, David A; Brouwer, Albert M

    2016-06-17

    A [2]rotaxane, a [3]rotaxane and the corresponding thread containing two succinamide (succ) binding stations and a central redox-active pyromellitimide (pmi) station were studied. Infrared spectroelectrochemical experiments revealed the translocation of the macrocycle between the succinamide station and the electrochemically reduced pmi station (radical anion and dianion). Remarkably, in the [3]rotaxane, the rings can be selectively translocated. One-electron reduction leads to the translocation of one of the two macrocycles from the succinamide to the pyromellitimide station, whereas activation of the shuttle through two-electron reduction results in the translocation of both macrocycles: the dianion, due to its higher electron density and hence greater hydrogen-bond accepting affinity, is hydrogen bonded to both macrocycles. Systems with such an on-command contraction are known as molecular muscles. The relative strengths of the binding between the macrocycle and the imide anions could be estimated from the hydrogen-bond-induced shifts in the C=O stretching frequencies of hydrogen-bond accepting amide groups of the macrocycle. PMID:26918870

  4. Computing Radiative Transfer in a 3D Medium

    Science.gov (United States)

    Von Allmen, Paul; Lee, Seungwon

    2012-01-01

    A package of software computes the time-dependent propagation of a narrow laser beam in an arbitrary three- dimensional (3D) medium with absorption and scattering, using the transient-discrete-ordinates method and a direct integration method. Unlike prior software that utilizes a Monte Carlo method, this software enables simulation at very small signal-to-noise ratios. The ability to simulate propagation of a narrow laser beam in a 3D medium is an improvement over other discrete-ordinate software. Unlike other direct-integration software, this software is not limited to simulation of propagation of thermal radiation with broad angular spread in three dimensions or of a laser pulse with narrow angular spread in two dimensions. Uses for this software include (1) computing scattering of a pulsed laser beam on a material having given elastic scattering and absorption profiles, and (2) evaluating concepts for laser-based instruments for sensing oceanic turbulence and related measurements of oceanic mixed-layer depths. With suitable augmentation, this software could be used to compute radiative transfer in ultrasound imaging in biological tissues, radiative transfer in the upper Earth crust for oil exploration, and propagation of laser pulses in telecommunication applications.

  5. Spectral analysis of the Dirac operator on a 3-sphere

    CERN Document Server

    Fang, Yan-Long; Vassiliev, Dmitri

    2016-01-01

    We study the (massless) Dirac operator on a 3-sphere equipped with Riemannian metric. For the standard metric the spectrum is known. In particular, the eigenvalues closest to zero are the two double eigenvalues +3/2 and -3/2. Our aim is to analyse the behaviour of eigenvalues when the metric is perturbed in an arbitrary smooth fashion from the standard one. We derive explicit asymptotic formulae for the two eigenvalues closest to zero. Note that these eigenvalues remain double eigenvalues under perturbations of the metric: they cannot split because of a particular symmetry of the Dirac operator in dimension three (it commutes with the antilinear operator of charge conjugation). Our asymptotic formulae show that in the first approximation our two eigenvalues maintain symmetry about zero and are completely determined by the increment of Riemannian volume. Spectral asymmetry is observed only in the second approximation of the perturbation process. As an example we consider a special family of metrics, the so-cal...

  6. Ramsey-type microwave spectroscopy on CO ($a^3\\Pi$)

    CERN Document Server

    de Nijs, A J; Bethlem, H L

    2014-01-01

    Using a Ramsey-type setup, the lambda-doublet transition in the $J=1,\\, \\Omega=1$ level of the $a^3\\Pi$ state of CO was measured to be 394 064 870(10) Hz. In our molecular beam apparatus, a beam of metastable CO is prepared in a single quantum level by expanding CO into vacuum and exciting the molecules using a narrow-band UV laser system. After passing two microwave zones that are separated by 50 cm, the molecules are state-selectively deflected and detected 1 meter downstream on a position sensitive detector. In order to keep the molecules in a single $m_J^B$ level, a magnetic bias field is applied. We find the field-free transition frequency by taking the average of the $m_J^B = +1 \\rightarrow m_J^B = +1$ and $m_J^B = -1 \\rightarrow m_J^B = -1$ transitions, which have an almost equal but opposite Zeeman shift. The accuracy of this proof-of-principle experiment is a factor of 100 more accurate than the previous best value obtained for this transition.

  7. Elemental concentration distribution in human fingernails - A 3D study

    Energy Technology Data Exchange (ETDEWEB)

    Pineda-Vargas, C.A., E-mail: pineda@tlabs.ac.za [Faculty of Health and Wellness Sciences, Cape Peninsula University of Technology, P.O. Box 1906, Bellville 7535 (South Africa); Materials Research Department, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Mars, J.A.; Gihwala, D. [Faculty of Health and Wellness Sciences, Cape Peninsula University of Technology, P.O. Box 1906, Bellville 7535 (South Africa)

    2012-02-15

    The verification of pathologies has normally been based on analysis of blood (serum and plasma), and physiological tissue. Recently, nails and in particular human fingernails have become an important medium for pathological studies, especially those of environmental origin. The analytical technique of PIXE has been used extensively in the analysis of industrial samples and human tissue specimens. The application of the analytical technique to nails has been mainly to bulk samples. In this study we use micro-PIXE and -RBS, as both complementary and supplementary, to determine the elemental concentration distribution of human fingernails of individuals. We report on the 3D quantitative elemental concentration distributions (QECDs) of various elements that include C, N and O as major elements (10-20%), P, S, Cl, K and Ca as minor elements (1-10%) and Fe, Mn, Zn, Ti, Na, Mg, Cu, Ni, Cr, Rb, Br, Sr and Se as trace elements (less than 1%). For PIXE and RBS the specimens were bombarded with a 3 MeV proton beam. To ascertain any correlations in the quantitative elemental concentration distributions, a linear traverse analysis was performed across the width of the nail. Elemental distribution correlations were also obtained.

  8. Elemental concentration distribution in human fingernails - A 3D study

    Science.gov (United States)

    Pineda-Vargas, C. A.; Mars, J. A.; Gihwala, D.

    2012-02-01

    The verification of pathologies has normally been based on analysis of blood (serum and plasma), and physiological tissue. Recently, nails and in particular human fingernails have become an important medium for pathological studies, especially those of environmental origin. The analytical technique of PIXE has been used extensively in the analysis of industrial samples and human tissue specimens. The application of the analytical technique to nails has been mainly to bulk samples. In this study we use micro-PIXE and -RBS, as both complementary and supplementary, to determine the elemental concentration distribution of human fingernails of individuals. We report on the 3D quantitative elemental concentration distributions (QECDs) of various elements that include C, N and O as major elements (10-20%), P, S, Cl, K and Ca as minor elements (1-10%) and Fe, Mn, Zn, Ti, Na, Mg, Cu, Ni, Cr, Rb, Br, Sr and Se as trace elements (less than 1%). For PIXE and RBS the specimens were bombarded with a 3 MeV proton beam. To ascertain any correlations in the quantitative elemental concentration distributions, a linear traverse analysis was performed across the width of the nail. Elemental distribution correlations were also obtained.

  9. Cardiometabolic Health in Submariners Returning from a 3-Month Patrol

    Directory of Open Access Journals (Sweden)

    Heath G. Gasier

    2016-02-01

    Full Text Available Confined space, limited exercise equipment, rotating shift work and reduced sleep may affect cardiometabolic health in submariners. To test this hypothesis, 53 male U.S. Submariners (20–39 years were studied before and after a 3-month routine submarine patrol. Measures included anthropometrics, dietary and physical activity, biomarkers of cardiometabolic health, energy and appetite regulation, and inflammation. Before deployment, 62% of submariners had a body fat % (BF% ≥ 25% (obesity, and of this group, 30% met the criteria for metabolic syndrome. In obese volunteers, insulin, the homeostatic model assessment of insulin resistance (HOMA-IR, leptin, the leptin/adiponectin ratio, and pro-inflammatory chemokines growth-related oncogene and macrophage-derived chemokine were significantly higher compared to non-obese submariners. Following the patrol, a significant mean reduction in body mass (5% and fat-mass (11% occurred in the obese group as a result of reduced energy intake (~2000 kJ during the patrol; and, independent of group, modest improvements in serum lipids and a mean reduction in interferon γ-induced protein 10 and monocyte chemotactic protein 1 were observed. Since 43% of the submariners remained obese, and 18% continued to meet the criteria for metabolic syndrome following the patrol, the magnitude of weight loss was insufficient to completely abolish metabolic dysfunction. Submergence up to 3-months, however, does not appear to be the cause of obesity, which is similar to that of the general population.

  10. Design and Modeling of a 3 DOF Machine

    Directory of Open Access Journals (Sweden)

    Marjan Sikandar

    2014-06-01

    Full Text Available This paper proposes an IT solution to implement a 3DOF machine by using several design patterns. A Degree of Freedom machine is a motion platform synchronized with the simulation game visually displayed. Through this research we have tried to find an optimal way to implement such a robotic machine that is supposed to be used in different virtual prototypes by industrialists. Since the development cost of an actual product often, is too high to test the initial design, many industrialists now-a-days, invest in building a prototype before actual product. Also to train the employees/students, the prototypes are very useful. For this purpose, different algorithms were studied and a design based on several patterns is proposed as a solution to implement such a machine which will benefit organizations in many ways. To prove our point we have implemented the design and hence we found out that our proposed solution which has been explained in detail in this paper is an optimal design to put into practice for any DOF machine. Thus, the given solution if approved and applied correctly can provide great benefits to the industrialists because they can save a lot amount of their time and money by using a object oriented design solution for their prototypes. The proposed design provides flexibility to the organization to develop any scenario based simulation game with any DOF machine available.

  11. Multiphysics & Parallel Kinematics Modeling of a 3DOF MEMS Mirror

    Directory of Open Access Journals (Sweden)

    Mamat N.

    2015-01-01

    Full Text Available This paper presents a modeling for a 3DoF electrothermal actuated micro-electro-mechanical (MEMS mirror used to achieve scanning for optical coherence tomography (OCT imaging. The device is integrated into an OCT endoscopic probe, it is desired that the optical scanner have small footprint for minimum invasiveness, large and flat optical aperture for large scanning range, low driving voltage and low power consumption for safety reason. With a footprint of 2mm×2mm, the MEMS scanner which is also called as Tip-Tilt-Piston micro-mirror, can perform two rotations around x and y-axis and a vertical translation along z-axis. This work develops a complete model and experimental characterization. The modeling is divided into two parts: multiphysics characterization of the actuators and parallel kinematics studies of the overall system. With proper experimental procedures, we are able to validate the model via Visual Servoing Platform (ViSP. The results give a detailed overview on the performance of the mirror platform while varying the applied voltage at a stable working frequency. The paper also presents a discussion on the MEMS control system based on several scanning trajectories.

  12. A 3D printed electromagnetic nonlinear vibration energy harvester

    Science.gov (United States)

    Constantinou, P.; Roy, S.

    2016-09-01

    A 3D printed electromagnetic vibration energy harvester is presented. The motion of the device is in-plane with the excitation vibrations, and this is enabled through the exploitation of a leaf isosceles trapezoidal flexural pivot topology. This topology is ideally suited for systems requiring restricted out-of-plane motion and benefits from being fabricated monolithically. This is achieved by 3D printing the topology with materials having a low flexural modulus. The presented system has a nonlinear softening spring response, as a result of designed magnetic force interactions. A discussion of fatigue performance is presented and it is suggested that whilst fabricating, the raster of the suspension element is printed perpendicular to the flexural direction and that the experienced stress is as low as possible during operation, to ensure longevity. A demonstrated power of ∼25 μW at 0.1 g is achieved and 2.9 mW is demonstrated at 1 g. The corresponding bandwidths reach up-to 4.5 Hz. The system’s corresponding power density of ∼0.48 mW cm‑3 and normalised power integral density of 11.9 kg m‑3 (at 1 g) are comparable to other in-plane systems found in the literature.

  13. A 3D measurement of the offset in paleoseismological studies

    Science.gov (United States)

    Ferrater, Marta; Echeverria, Anna; Masana, Eulàlia; Martínez-Díaz, José J.; Sharp, Warren D.

    2016-05-01

    The slip rate of a seismogenic fault is a crucial parameter for establishing the contribution of the fault to the seismic hazard. It is calculated from measurements of the offset of linear landforms, such channels, produced by the fault combined with their age. The three-dimensional measurement of offset in buried paleochannels is subject to uncertainties that need to be quantitatively assessed and propagated into the slip rate. Here, we present a set of adapted scripts to calculate the net, lateral and vertical tectonic offset components caused by faults, together with their associated uncertainties. This technique is applied here to a buried channel identified in the stratigraphic record during a paleoseismological study at the El Saltador site (Alhama de Murcia fault, Iberian Peninsula). After defining and measuring the coordinates of the key points of a buried channel in the walls of eight trenches excavated parallel to the fault, we (a) adjusted a 3D straight line to these points and then extrapolated the tendency of this line onto a simplified fault plane; (b) repeated these two steps for the segment of the channel in the other side of the fault; and (c) measured the distance between the two resulting intersection points with the fault plane. In doing so, we avoided the near fault modification of the channel trace and obtained a three-dimensional measurement of offset and its uncertainty. This methodology is a substantial modification of previous procedures that require excavating progressively towards the fault, leading to possible underestimation of offset due to diffuse deformation near the fault. Combining the offset with numerical dating of the buried channel via U-series on soil carbonate, we calculated a maximum estimate of the net slip rate and its vertical and lateral components for the Alhama de Murcia fault.

  14. Clinical evaluation of a '3-in-1' intravenous nutrient solution.

    Science.gov (United States)

    O'Keefe, S J; Bean, E; Symmonds, K; Smit, R; Delport, I; Dicker, J

    1985-07-20

    Eighty-five consecutive general hospital patients requiring total parenteral nutrition (TPN) were prospectively studied in order to evaluate the safety and efficacy of a '3-in-1' nutrient mixture. All formulas were individualized to estimated requirements (average composition nitrogen 14 g, glucose 350 g, fat 50 g), mixed in the hospital pharmacy, contained within 3-litre EVA plastic bags, and given to the patients as a continuous 24-hour infusion. The average duration of TPN was 19 days per patient (range 8 - 84 days). Judging by nitrogen balance and plasma protein concentrations, the system was effective in maintaining or improving nutritional status in patients in a relatively stable condition but not in those who were critically ill (e.g. those in an intensive care unit). Development of magnesium and iron deficiencies was common during the period of TPN (25% of patients developing magnesium deficiency and 40% developing iron deficiency) despite daily supplementation with commercial trace element mixtures, but these states were easily corrected by high-dose administration. 'Creaming' of less than 5 mm on the surface of the emulsion was common, whereas that of more than 10 mm was rare (12 bags) and invariably associated with excessive addition of polyvalent cation or glucose. Deposition of lipid on the internal surface of the catheter was a common problem after 2 weeks' continuous administration. Temporary problems with faulty bag connections resulted in excessive catheter sepsis (14%) due to Staphylococcus epidermidis. Mild reversible disturbances in liver function occurred in one-third of the patients. The system appears safe and effective for the management of most patients requiring long-term TPN.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:3925569

  15. The Physics and Applications of a 3D Plasmonic Nanostructure

    Science.gov (United States)

    Terranova, Brandon B.

    In this work, the dynamics of electromagnetic field interactions with free electrons in a 3D metallic nanostructure is evaluated theoretically. This dissertation starts by reviewing the relevant fundamentals of plasmonics and modern applications of plasmonic systems. Then, motivated by the need to have a simpler way of understanding the surface charge dynamics on complex plasmonic nanostructures, a new plasmon hybridization tree method is introduced. This method provides the plasmonicist with an intuitive way to determine the response of free electrons to incident light in complex nanostructures within the electrostatic regime. Next, a novel 3D plasmonic nanostructure utilizing reflective plasmonic coupling is designed to perform biosensing and plasmonic tweezing applications. By applying analytical and numerical methods, the effectiveness of this nanostructure at performing these applications is determined from the plasmonic response of the nanostructure to an excitation beam of coherent light. During this analysis, it was discovered that under certain conditions, this 3D nanostructure exhibits a plasmonic Fano resonance resulting from the interference of an in-plane dark mode and an out-of-plane bright mode. In evaluating this nanostructure for sensing changes in the local dielectric environment, a figure of merit of 68 is calculated, which is competitive with current localized surface plasmon resonance refractometric sensors. By evaluating the Maxwell stress tensor on a test particle in the vicinity of the nanostructure, it was found that under the right conditions, this plasmonic nanostructure design is capable of imparting forces greater than 10.5 nN on dielectric objects of nanoscale dimensions. The results obtained in these studies provides new routes to the design and engineering of 3D plasmonic nanostructures and Fano resonances in these systems. In addition, the nanostructure presented in this work and the design principles it utilizes have shown

  16. Plasma environment of Titan: a 3-D hybrid simulation study

    Directory of Open Access Journals (Sweden)

    S. Simon

    2006-05-01

    Full Text Available Titan possesses a dense atmosphere, consisting mainly of molecular nitrogen. Titan's orbit is located within the Saturnian magnetosphere most of the time, where the corotating plasma flow is super-Alfvénic, yet subsonic and submagnetosonic. Since Titan does not possess a significant intrinsic magnetic field, the incident plasma interacts directly with the atmosphere and ionosphere. Due to the characteristic length scales of the interaction region being comparable to the ion gyroradii in the vicinity of Titan, magnetohydrodynamic models can only offer a rough description of Titan's interaction with the corotating magnetospheric plasma flow. For this reason, Titan's plasma environment has been studied by using a 3-D hybrid simulation code, treating the electrons as a massless, charge-neutralizing fluid, whereas a completely kinetic approach is used to cover ion dynamics. The calculations are performed on a curvilinear simulation grid which is adapted to the spherical geometry of the obstacle. In the model, Titan's dayside ionosphere is mainly generated by solar UV radiation; hence, the local ion production rate depends on the solar zenith angle. Because the Titan interaction features the possibility of having the densest ionosphere located on a face not aligned with the ram flow of the magnetospheric plasma, a variety of different scenarios can be studied. The simulations show the formation of a strong magnetic draping pattern and an extended pick-up region, being highly asymmetric with respect to the direction of the convective electric field. In general, the mechanism giving rise to these structures exhibits similarities to the interaction of the ionospheres of Mars and Venus with the supersonic solar wind. The simulation results are in agreement with data from recent Cassini flybys.

  17. Leishmania mexicana: aspectos taxonómicos y rareza de la infección humana en Três Braços, Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    César Augusto Cuba Cuba

    1984-09-01

    Full Text Available Del estúdio de 51 stocks de Leishmania aislados de pacientes humanos de leishmaniasis cutaneomucosa en Três Braços, Bahia, Brasil, los autores describen, en detalle, el análisis de los dos únicos stocks de L. mexicana, identificando uno de ellos como L. mexicana amazonensis. El otro aislado permanece en posición taxonómica no definida pues considerándosele como un miembro de L. mexicana, encuéntranse dificultades para su identificación subespecífica. Evaluan también los parâmetros biológicos e isoenzimáticos y discuten el papel de los anticuerpos monoclonales en la tipificación de éstos stocks. Los autores remarcan la rareza de la transmisión de parásitos del complejo L. mexicana en esta región, aun cuando estudien epidemiológicamente por mais de 8 anos la infección humana.

  18. Actualización en el tratamiento de la osteoporosis: manejo desde una unidad del dolor (1.ª parte

    Directory of Open Access Journals (Sweden)

    R. Álvarez Álvarez

    2014-12-01

    Full Text Available La osteoporosis (OP se define como una enfermedad esquelética caracterizada por una resistencia ósea disminuida que predispone a un aumento en el riesgo de fracturas. En Europa se producen 2,7 millones de fracturas por fragilidad, tanto en hombres como mujeres, con un coste directo de 36 billones de euros. Estas fracturas se asocian con un incremento en la morbilidad y mortalidad. El riesgo de fractura osteoporótica viene determinado por la presencia de uno o más factores de riesgo y el descenso de la densidad mineral ósea (DMO valorado mediante la técnica Dual Energy X-ray absortiometry (DEXA, densitometría. La indicación de tratamiento se realiza en función del riesgo absoluto de fractura por fragilidad. En los pacientes con un bajo riesgo de fractura son suficientes las medidas higiénicas, prevención de caídas y mantener una ingesta adecuada de calcio y vitamina D. En los pacientes con un riesgo moderado se debe individualizar la necesidad de tratamiento farmacológico e iniciar el tratamiento en aquellos con alto riesgo de fractura. Los fármacos más utilizados son los bifosfonatos, inhibidores de la reabsorción ósea, también se utilizan fármacos osteoanabólicos como la hormona teriparatida y anticuerpos monoclonales como el denosumab.

  19. Actualización en el tratamiento de la osteoporosis: algoritmo de decisión: manejo desde una unidad del dolor (2.ª parte

    Directory of Open Access Journals (Sweden)

    F. Mendoza Garcés

    2015-04-01

    Full Text Available La heterogeneidad de los pacientes con osteoporosis hace necesaria una aproximación individualizada para conseguir un equilibrio entre los beneficios y limitaciones de los tratamientos disponibles. La indicación de este se realiza en función del riesgo absoluto de fractura por fragilidad. En los pacientes con un bajo riesgo de fractura son suficientes las medidas higiénicas, prevención de caídas y mantener una ingesta adecuada de calcio y vitamina D. En los pacientes con un riesgo moderado se debe individualizar la necesidad de tratamiento farmacológico e iniciar el tratamiento en aquellos con alto riesgo de fractura. Los fármacos más utilizados son los bifosfonatos, inhibidores de la reabsorción ósea, también se utilizan fármacos osteoanabólicos como la hormona teriparatida, y anticuerpos monoclonales como el denosumab. En los pacientes cuyo dolor no se controla de manera satisfactoria se ha de valorar la indicación de tratamientos mínimamente invasivos como bloqueos espinales, vertebroplastia o cifoplastia.

  20. [Illness due the Ebola virus: epidemiology and clinical manifestations within the context of an international public health emergency].

    Science.gov (United States)

    Carod-Artal, Francisco J

    2015-03-16

    Introduccion. La epidemia causada por el virus del Ebola en Africa occidental afecta a Guinea, Liberia, Sierra Leona, Nigeria, Mali y Senegal, y es la mas grave desde que se tiene noticia de este filovirus causante de fiebre hemorragica. En este articulo se revisan las caracteristicas epidemiologicas y las manifestaciones clinicas asociadas a la enfermedad por el virus del Ebola. Desarrollo. Hasta el 23 de febrero de 2015 se habian contabilizado 23.729 casos de ebola, con un 40,1% de mortalidad. En la actual epidemia, el virus se transmite al ser humano por tres vias: contacto con fluidos y secreciones de sujetos enfermos ya diagnosticados, contacto con cadaveres durante las ceremonias de enterramiento, y contagio a familiares y personal sanitario por enfermos sin diagnosticar. El Ebola causa una enfermedad grave en humanos. Tras un periodo de incubacion variable (2-21 dias), se inicia un sindrome febril, cefalea, mialgias, artralgias, vomitos y diarrea. La fase avanzada cursa con hemorragias, fracaso de multiples organos, hipotension y choque. Se desconoce la incidencia de manifestaciones neurologicas, aunque se han descrito hemorragias cerebrales y sindromes postinfecciosos en otras fiebres he­morragicas virales. Los cuidados de soporte son vitales. No existe un tratamiento efectivo demostrado, aunque varios pacientes han sido tratados con un coctel de anticuerpos monoclonales (ZMapp). Conclusiones. La identificacion y diagnostico precoz de casos sospechosos, el aislamiento de sujetos enfermos y las medidas de proteccion en el personal sanitario son fundamentales para contener esta epidemia.

  1. Deteccion de citomegalovirus mediante la tecnica de inmunoperoxidasa y aislamiento viral Cytomegalovirus detection by Immunoperoxidase assay and viral isolation

    Directory of Open Access Journals (Sweden)

    Maritza Alvarez

    1991-06-01

    Full Text Available En el presente estudio se comparó la técnica de inmunoperoxidasa para la detección de citomegalovirus (IPCMV utilizando anticuerpos monoclonales que reconocen proteínas precoces virales con el método convencional de aislamiento viral en fibroblastos humanos. Un total de 150 muestras de orina fueron examinadas encontrando una sensibilidad de un 89.8% y una especificidad de 91.3% de la técnica de IPCMV comparada con el aislamiento viral. Una de las ventajas que presentó la IPCMV fue la rapidez con que fueron obtenidos los resultados (48 horas mientras que el aislamiento viral fue como promedio 14 días.An Immunoperoxidase assay was applied to detect early antigens of Cytomegalovirus (CMV in 150 urine samples from immunocompromised patients, using the commercial available monoclonal antibody against CMV El3. The detection of early antigen by IP (IPCMV is compared to the conventional cell culture isolation regarding specificity and sensitivity in order to evaluate is usefulness in the diagnostic of CMV infections. The IPCMV showed a sensitivity of 89.8% and a specificity of 91.3% when compared to the isolation method. The great advantage of the IPCMV is based on the shorter time results are achieved, since 48-72 Hs can be enough to provide evidence of CMV infection, while in the isolation technique cytopatho-genic effect was present around 14 days after sample inoculation.

  2. Androgen regulation of aldehyde dehydrogenase 1A3 (ALDH1A3) in androgen responsive human prostate cancer cell LNCaP.

    Science.gov (United States)

    Previous gene array data from our laboratory identified the retinoic acid (RA) biosynthesis enzyme aldehyde dehydrogenase 1A3 (ALDH1A3) as a putative androgen-responsive gene in prostate cancer epithelial cells (LNCaP). In the present study we attempted to identify if any of the three ALDH1A/RA synt...

  3. Lack of Association between a 3'UTR VNTR Polymorphism of Dopamine Transporter Gene (SLC6A3) and ADHD in a Brazilian Sample of Adult Patients

    Science.gov (United States)

    Aperecida da Silva, Maria; Cordeiro, Quirino; Louza, Mario; Vallada, Homero

    2011-01-01

    Objective: To investigate a possible association between a 3'UTR VNTR polymorphism of the dopamine transporter gene (SLC6A3) and ADHD in a Brazilian sample of adult patients. Method: Study Case-control with 102 ADHD adult outpatients ("DSM-IV" criteria) and 479 healthy controls. The primers' sequence used were: 3'UTR-Forward: 5' TGT GGT GAT GGG…

  4. Data of evolutionary structure change: 1M40A-3BLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1M40A-3BLMA 1M40 3BLM A A HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEE...612 SER CA 833 ARG CA 954 GLY CA 1118 3BLM... A 3BLMA SGQAITYASR...confEVID> 1 3BLM A 3BLMA 2.768623113632202 2 3BLM

  5. 17 CFR 240.14a-3 - Information to be furnished to security holders.

    Science.gov (United States)

    2010-04-01

    ... Register citations affecting § 240.14a-3, see the List of CFR Sections Affected, which appears in the... security holders. 240.14a-3 Section 240.14a-3 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Information to be furnished to security holders. (a) No solicitation subject to this regulation shall be...

  6. Data of evolutionary structure change: 1CE7A-3CTKA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available K A 3CTKA LFPGVTNRVTL ...bChain>A 3CTKA HGKTINGQEIA ...dbChain> 3CTKA HKSSPQCTTINP ure>HH ...1CE7A-3CTKA 1CE7 3CTK A A YERGDLDVTAQTTGAGYFSFITLLRDYVSSGSFSNAIPL...IETEVVDRGLY-GSFKPNFKVLNLENNWGDISDAIHKSSPQCTTINPALQLISPSNDPWVVNKVSQISPDMGILKFKS EEEEEEE HHHHHHH

  7. Towards a 3D geo-information standard in the Netherlands

    NARCIS (Netherlands)

    Stoter, J.E.; Reuvers, M.; Vosselman, G.; Goos, J.; Van Berlo, L.; Zlatanova, S.; Verbree, E.; Klooster, R.

    2010-01-01

    This paper presents the ongoing research project in The Netherlands in which a large number of stakeholders are realising a 3D testbed based on selected use cases and test areas. The findings of the project will result in a Proof of Concept for a 3D Geoinformation standard and a 3D data infrastructu

  8. Data of evolutionary structure change: 1CH1A-3MBAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CH1A-3MBAA 1CH1 3MBA A A MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPE...4 ALA CA 195 GLU CA 242 LEU CA 314 3MBA... A 3MBAA NNAANAGKMSAML...12298584 2.589318037033081 1 3MBA... A 3MBAA

  9. Data of evolutionary structure change: 1CH2A-3MBAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CH2A-3MBAA 1CH2 3MBA A A MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPE...0 ALA CA 205 GLU CA 261 LEU CA 324 3MBA... A 3MBAA NNAANAGKMSAML...494857788 2.5804030895233154 1 3MBA... A 3MBAA

  10. Nightglow vibrational distributions in the A3Σu+ and A'3Δu states of O2 derived from astronomical sky spectra

    Directory of Open Access Journals (Sweden)

    A. M. Widhalm

    2004-09-01

    Full Text Available Astronomical sky spectra from the Keck I telescope on Mauna Kea have been used to obtain vibrational distributions in the O2A3Σu+ and O2(A'3Δu states from rotationally-resolved Herzberg I and Chamberlain band emissions in the terrestrial nightglow. The A3Σu+ distribution is similar to that presented in earlier publications, with the exception that there is significant population in the previously undiscerned v=0 level. The vibrational distributions of the A'3Δu and A3Σu+ states are essentially the same when comparison is made in terms of the level energies. The intensity of Chamberlain band emission at the peak of the distribution is about one-fourth that of the Herzberg I emission, as previously shown, and may be related primarily to radiative efficiency. The peaks in both population distributions are about 0.25eV below the O(3P+O(3P dissociation limit. We compare these Herzberg state distributions with that of the O2(b1Σg+ state, concurring with others that the intense nightglow emission associated with b1Σg+(v=0 is a reflection of direct transfer from the Herzberg states. This process takes place following O2 collisions, with simultaneous production of very high a1Δg and b1Σg+ vibrational levels.

  11. Los complejos Chaperonina(MSP63inducen anticuerpos de reacciones cruzadas, bactericidas y opsonofagocítica.

    Directory of Open Access Journals (Sweden)

    Juan Marzoa

    2009-08-01

    Full Text Available Alteration of the native structure of antigens can lead to the loss of protective epitopes. Our previous results showed that separation of the meningococcal outer membrane proteins in native conditions revealed the existence of protein complexes that could be relevant for the development of new vaccine formulations. The aim of this work was to analyse the immunogenic characteristics of a highly conserved 700 kDa chaperonin complex (CxChap detected and purified by using high resolution clear native electrophoresis. Analysis of the anti-CxChap serum by Western-blotting revealed the presence of antibodies against the MSP63 but also against the macrophage infectivity potentiator-like protein (MIP, which is coopurified with the chaperonin complex. Antibodies raised by immunisation with CxChap chaperonin complex show bactericidal and opsonophagocytic activity.

  12. Ingeniería de anticuerpos aplicada al desarrollo y caracterización de biosensores enzimáticos

    OpenAIRE

    Alcalá Morales, Pilar Lucía

    2003-01-01

    Una de las aplicaciones de la ingeniería de proteínas es el desarrollo de biosensores moleculares como herramientas para la detección de sustancias mediante la interacción de una macromolécula y su ligando. De acuerdo a este principio se han generado una serie de prototipos de biosensores enzimáticos que han surgido a partir de la ingeniería de proteínas tales como la fosfatasa alcalina, b-galactosidasa, b-lactamasa y la proteína TSP del bacteriófago P22. En todas estas enzimas modificadas se...

  13. A role of autophagy in PTP4A3-driven cancer progression.

    Science.gov (United States)

    Huang, Yu-Han; Al-Aidaroos, Abdul Qader O; Yuen, Hiu-Fung; Zhang, Shu-Dong; Shen, Han-Ming; Rozycka, Ewelina; McCrudden, Cian M; Tergaonkar, Vinay; Gupta, Abhishek; Lin, You Bin; Thiery, Jean Paul; Murray, James T; Zeng, Qi

    2014-10-01

    Autophagy, a "self-eating" cellular process, has dual roles in promoting and suppressing tumor growth, depending on cellular context. PTP4A3/PRL-3, a plasma membrane and endosomal phosphatase, promotes multiple oncogenic processes including cell proliferation, invasion, and cancer metastasis. In this study, we demonstrate that PTP4A3 accumulates in autophagosomes upon inhibition of autophagic degradation. Expression of PTP4A3 enhances PIK3C3-BECN1-dependent autophagosome formation and accelerates LC3-I to LC3-II conversion in an ATG5-dependent manner. PTP4A3 overexpression also enhances the degradation of SQSTM1, a key autophagy substrate. These functions of PTP4A3 are dependent on its catalytic activity and prenylation-dependent membrane association. These results suggest that PTP4A3 functions to promote canonical autophagy flux. Unexpectedly, following autophagy activation, PTP4A3 serves as a novel autophagic substrate, thereby establishing a negative feedback-loop that may be required to fine-tune autophagy activity. Functionally, PTP4A3 utilizes the autophagy pathway to promote cell growth, concomitant with the activation of AKT. Clinically, from the largest ovarian cancer data set (GSE 9899, n = 285) available in GEO, high levels of expression of both PTP4A3 and autophagy genes significantly predict poor prognosis of ovarian cancer patients. These studies reveal a critical role of autophagy in PTP4A3-driven cancer progression, suggesting that autophagy could be a potential Achilles heel to block PTP4A3-mediated tumor progression in stratified patients with high expression of both PTP4A3 and autophagy genes.

  14. Pharmacology of the Adenosine A3 Receptor in the Vasculature and Essential Hypertension

    Science.gov (United States)

    Ho, Ming-Fen; Low, Leanne M.; Rose’Meyer, Roselyn B.

    2016-01-01

    Background Essential hypertension is considered to be a multifactorial disorder and its aetiology has yet to be clearly identified. As the adenosine receptors have a significant role in mediating vasodilation, alterations in their structures or signalling pathways may be involved in the development of hypertension. This study aimed to measure the expression of adenosine A3 receptors in a range of cardiovascular tissues and determine whether they could be altered with essential hypertension, and to functionally test responses to adenosine A3 receptor agonists in coronary blood vessels using the isolated perfused heart preparation. Methods mRNA samples from cardiovascular tissues and a range of blood vessels were collected from 10 week old male spontaneously hypertensive rats and age-gender matched Wistar rats (n = 8). The Langendorff heart perfusion preparation was used to characterise adenosine A3 receptor mediated coronary vasodilation in the rat heart. Results Adenosine A3 receptor agonists induced coronary vasodilation. The expression of adenosine A3 receptors in cardiovascular tissues was altered in a tissue-specific pattern. Specifically, down-regulation of adenosine A3 receptor expression occurred in hypertensive hearts, which might be associated with attenuated vasodilator responses observed in coronary vessels to adenosine A3 receptor agonists. Conclusions This study demonstrated alterations in the expression of adenosine A3 receptors occurred in a tissue specific mode, and reduced adenosine A3 receptor mediated coronary vasodilation in hearts from spontaneously hypertensive rats. Our findings with regard to changes in the adenosine A3 receptor in hypertensive hearts suggest that adenosine A3 receptor might play a role in the physiopathology of essential hypertension and potentially open the way to pharmacologic manipulation of vasomotor activity by the use of adenosine A3 receptor agonists. PMID:26907173

  15. SLC9A3R1 stimulates autophagy via BECN1 stabilization in breast cancer cells.

    Science.gov (United States)

    Liu, Hong; Ma, Yan; He, Hong-Wei; Wang, Jia-Ping; Jiang, Jian-Dong; Shao, Rong-Guang

    2015-01-01

    Autophagy, a self-catabolic process, has been found to be involved in abrogating the proliferation and metastasis of breast cancer. SLC9A3R1 (solute carrier family 9, subfamily A [NHE3, cation proton antiporter 3], member 3 regulator 1), a multifunctional scaffold protein, is involved in suppressing breast cancer cells proliferation and the SLC9A3R1-related signaling pathway regulates the activation of autophagy processes. However, the precise regulatory mechanism and signaling pathway of SLC9A3R1 in the regulation of autophagy processes in breast cancer cells remains unknown. Here, we report that the stability of BECN1, the major component of the autophagic core lipid kinase complex, is augmented in SLC9A3R1-overexpressing breast cancer MDA-MB-231 cells, subsequently stimulating autophagy by attenuating the interaction between BECN1 and BCL2. Initially, we found that SLC9A3R1 partially stimulated autophagy through the PTEN-PI3K-AKT1 signaling cascade in MDA-MB-231 cells. SLC9A3R1 then attenuated the interaction between BECN1 and BCL2 to stimulate the autophagic core lipid kinase complex. Further findings revealed that SLC9A3R1 bound to BECN1 and subsequently blocked ubiquitin-dependent BECN1 degradation. And the deletion of the C-terminal domain of SLC9A3R1 resulted in significantly reduced binding to BECN1. Moreover, the lack of C-terminal of SLC9A3R1 neither reduced the ubiquitination of BECN1 nor induced autophagy in breast cancer cells. The decrease in BECN1 degradation induced by SLC9A3R1 resulted in the activity of autophagy stimulation in breast cancer cells. These findings indicate that the SLC9A3R1-BECN1 signaling pathway participates in the activation of autophagy processes in breast cancer cells.

  16. Data of evolutionary structure change: 1AT1A-3GD5A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AT1A-3GD5A 1AT1 3GD5 A A ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELL...KHKVIASCFFEASTRTRLSFQTSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQQTEGRLDNLHVAMVGD...EEYAHYAG-IPVINALTD-HEHPCQVVADLLTIRENFGRLAGLKLAYVGDGN--NVAHSLLLGCAKVG-MSIAVATPEGFTPDPAVSARASEIAGRTGAEVQIL--RD...ndex> 3GD5 A 3GD5A A... 1 3GD

  17. A method for generating information of a 3-dimensional molecular structure of a molecule

    NARCIS (Netherlands)

    Flohil, J.A.; Wolf, M.G.; De Leeuw, S.W.

    2009-01-01

    The present invention relates to a method for generating information of a 3 -dimensional molecular structure of a molecule, said method being executable by a computer under the control of a program stored in the computer, said method comprising the steps of : (a) receiving a 3 -dimensional represent

  18. Changes in Strength Abilities of Adolescent Girls: The Effect of a 3-Year Physical Education Curriculum

    Science.gov (United States)

    Czarniecka, Renata; Milde, Katarzyna; Tomaszewski, Pawel

    2012-01-01

    Study aim: To evaluate changes in strength abilities of adolescent girls that underwent a 3-year physical education curriculum. Material and methods: The research participants comprised 141 girls aged 13.3 plus or minus 0.35 years who participated in a 3-year physical education curriculum (PEC). Evaluation was based on the following EUROFIT…

  19. Planning and Implementing a 3D Printing Service in an Academic Library

    Science.gov (United States)

    Gonzalez, Sara Russell; Bennett, Denise Beaubien

    2014-01-01

    Initiating a 3D printing service in an academic library goes beyond justification of its value and gaining the necessary library and administrative support. Additional aspects such as policies, environmental safety, training, publicizing, maintenance, and scope of service must be considered. This article provides a guide to developing a 3D print…

  20. A 3D visible evaluation of landslide risk degree under integration of GIS and artificial intelligence

    Institute of Scientific and Technical Information of China (English)

    QIAO; Jianping; ZHU; Axing; CHEN; Yongbo; WANG; Rongxun

    2003-01-01

    Artificial intelligence has been used to obtain background factors (basic environmental factors) from landslide specialists. A 3D visible evaluation map may be charted by fuzzy evaluation, and the traditional plane map may be decoded into a 3D map by using factor weight from specialists system and technology of RS and GIS for quantitative sampling of these factors.

  1. COL4A3 expression correlates with pathogenesis, pathologic behaviors, and prognosis of gastric carcinomas.

    Science.gov (United States)

    Nie, Xiao-cui; Wang, Jian-Ping; Zhu, Wan; Xu, Xiao-yan; Xing, Ya-nan; Yu, Miao; Liu, Yun-peng; Takano, Yasuo; Zheng, Hua-chuan

    2013-01-01

    COL4A3 protein belongs to type IV collagen family and is closely linked to kidney diseases and cancer. To clarify the roles of COL4A3 in gastric carcinogenesis and subsequent progression, its expression was examined by immunohistochemistry on tissue microarrays containing gastric carcinomas, adjacent intestinal metaplasia, pure intestinal metaplasia, and gastritis. Gastric carcinoma tissue and cell lines were studied for COL4A3 expression by Western blotting and reverse transcription-polymerase chain reaction. We found that COL4A3 was differentially expressed in GES-1, AGS, BGC-823, GT-3 TKB, HGC-27, KATO-III, MGC-803, MKN28, MKN45, SCH, SGC-7901, and STKM-2 at both messenger RNA and protein levels. Carcinomas showed statistically lower COL4A3 expression than matched nonneoplastic mucosa (P carcinoma (P carcinoma than gastritis (P carcinomas regardless of invasion into the muscularis propria (P carcinomas showed COL4A3 expression. Kaplan-Meier analysis indicated that COL4A3 expression was negatively associated with a favorable prognosis of overall, advanced, and intestinal-type gastric carcinomas (P carcinoma. COL4A3 overexpression might be used as a marker of gastric intestinal metaplasia and mucinous and signet ring cell carcinoma.

  2. 26 CFR 1.50A-3 - Recomputation of credit allowed by section 40.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Recomputation of credit allowed by section 40. 1.50A-3 Section 1.50A-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY INCOME TAX... installation of new equipment or by the retooling of existing equipment (such as for a model changeover in...

  3. 26 CFR 48.6416(a)-3 - Credit or refund of manufacturers tax under chapter 32.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Credit or refund of manufacturers tax under chapter 32. 48.6416(a)-3 Section 48.6416(a)-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE... total inventory, by model number and quantity, of all such articles purchased tax-paid and held for...

  4. De novo mutations in ATP1A3 cause alternating hemiplegia of childhood

    DEFF Research Database (Denmark)

    Heinzen, Erin L; Swoboda, Kathryn J; Hitomi, Yuki;

    2012-01-01

    Alternating hemiplegia of childhood (AHC) is a rare, severe neurodevelopmental syndrome characterized by recurrent hemiplegic episodes and distinct neurological manifestations. AHC is usually a sporadic disorder and has unknown etiology. We used exome sequencing of seven patients with AHC...... and their unaffected parents to identify de novo nonsynonymous mutations in ATP1A3 in all seven individuals. In a subsequent sequence analysis of ATP1A3 in 98 other patients with AHC, we found that ATP1A3 mutations were likely to be responsible for at least 74% of the cases; we also identified one inherited mutation...... in a case of familial AHC. Notably, most AHC cases are caused by one of seven recurrent ATP1A3 mutations, one of which was observed in 36 patients. Unlike ATP1A3 mutations that cause rapid-onset dystonia-parkinsonism, AHC-causing mutations in this gene caused consistent reductions in ATPase activity without...

  5. A cytosolic juxtamembrane interface modulates plexin A3 oligomerization and signal transduction.

    Directory of Open Access Journals (Sweden)

    Rachael Barton

    Full Text Available Plexins (plxns are transmembrane (TM receptors involved in the guidance of vascular, lymphatic vessel, and neuron growth as well as cancer metastasis. Plxn signaling results in cytosolic GTPase-activating protein activity, and previous research implicates dimerization as important for activation of plxn signaling. Purified, soluble plxn extracellular and cytosolic domains exhibit only weak homomeric interactions, suggesting a role for the plxn TM and juxtamembrane regions in homooligomerization. In this study, we consider a heptad repeat in the Danio rerio PlxnA3 cytosolic juxtamembrane domain (JM for its ability to influence PlxnA3 homooligomerization in TM-domain containing constructs. Site-directed mutagenesis in conjunction with the AraTM assay and bioluminescent energy transfer (BRET² suggest an interface involving a JM heptad repeat, in particular residue M1281, regulates PlxnA3 homomeric interactions when examined in constructs containing an ectodomain, TM and JM domain. In the presence of a neuropilin-2a co-receptor and semaphorin 3F ligand, disruption to PlxnA3 homodimerization caused by an M1281F mutation is eliminated, suggesting destabilization of the PlxnA3 homodimer in the JM is not sufficient to disrupt co-receptor complex formation. In contrast, enhanced homodimerization of PlxnA3 caused by mutation M1281L remains even in the presence of ligand semaphorin 3F and co-receptor neuropilin-2a. Consistent with this pattern of PlxnA3 dimerization in the presence of ligand and co-receptor, destabilizing mutations to PlxnA3 homodimerization (M1281F are able to rescue motor patterning defects in sidetracked zebrafish embryos, whereas mutations that enhance PlxnA3 homodimerization (M1281L are not. Collectively, our results indicate the JM heptad repeat, in particular residue M1281, forms a switchable interface that modulates both PlxnA3 homomeric interactions and signal transduction.

  6. Heterologous expression of active human uridine diphosphate glucuronosyltransferase 1A3 in Chinese hamster lung cells

    Institute of Scientific and Technical Information of China (English)

    Ya-Kun Chen; Xin Li; Shu-Qing Chen; Su Zeng

    2005-01-01

    AIM: To obtain the active human recombinant uridine diphosphate glucuronosyltransferase 1A3 (UGT1A3) enzyme from Chinese hamster lung (CHL) cells.METHODS: The full-length UGT1A3 gene was amplified by reverse transcription-polymerase chain reaction (RT-PCR)using total RNA from human liver as template. The correct fragment confirmed by sequencing was subcloned into the mammalian expression vector pcDNA3.1 (+), and the recombinant vector was transfected into CHL cells using a calcium phosphate method. Expressed UGT1A3 protein was prepared from CHL cells resistant to neomycin (G418). Then the protein was added into a reaction mixture for glucuronidation of quercetin. The glucuronidation activity of UGT1A3 was determined by reverse phase-high performance liquid chromatography (RP-HPLC) coupled with a diode array detector (DAD). The quercetin glucuronide was confirmed by hydrolysis with β-glucuronidase. Control experiments were performed in parallel. The transcriptions of recombinants were also determined by RT-PCR.RESULTS: The gene was confirmed to be an allele (UGT1A3-3) of UGT1A3 by DNA sequencing. The fragment was introduced into pcDNA3.1 (+) successfully. Several colonies were obtained under the selection pressure of G418.The result of RT-PCR showed transcription of recombinants in mRNA level. Glucuronidation assay and HPLC analysis indicated UGT1A3 expressed heterologously in CHL cells was in an active form, and one of the gulcuronides corresponding to quercetin was also detected.CONCLUSION: Correct sequence of UGT1A3 gene can be obtained, and active UGT1A3 enzyme is expressed heterologously in CHL cells.

  7. Disruption of Slc52a3 gene causes neonatal lethality with riboflavin deficiency in mice.

    Science.gov (United States)

    Yoshimatsu, Hiroki; Yonezawa, Atsushi; Yamanishi, Kaori; Yao, Yoshiaki; Sugano, Kumiko; Nakagawa, Shunsaku; Imai, Satoshi; Omura, Tomohiro; Nakagawa, Takayuki; Yano, Ikuko; Masuda, Satohiro; Inui, Ken-Ichi; Matsubara, Kazuo

    2016-01-01

    Homeostasis of riboflavin should be maintained by transporters. Previous in vitro studies have elucidated basic information about riboflavin transporter RFVT3 encoded by SLC52A3 gene. However, the contribution of RFVT3 to the maintenance of riboflavin homeostasis and the significance in vivo remain unclear. Here, we investigated the physiological role of RFVT3 using Slc52a3 knockout (Slc52a3-/-) mice. Most Slc52a3-/- mice died with hyperlipidemia and hypoglycemia within 48 hr after birth. The plasma and tissue riboflavin concentrations in Slc52a3-/- mice at postnatal day 0 were dramatically lower than those in wild-type (WT) littermates. Slc52a3-/- fetuses showed a lower capacity of placental riboflavin transport compared with WT fetuses. Riboflavin supplement during pregnancy and after birth reduced neonatal death and metabolic disorders. To our knowledge, this is the first report to indicate that Rfvt3 contributes to placental riboflavin transport, and that disruption of Slc52a3 gene caused neonatal mortality with hyperlipidemia and hypoglycemia owing to riboflavin deficiency. PMID:27272163

  8. Identification of a signature motif for the eIF4a3-SECIS interaction.

    Science.gov (United States)

    Budiman, Michael E; Bubenik, Jodi L; Driscoll, Donna M

    2011-09-01

    eIF4a3, a DEAD-box protein family member, is a component of the exon junction complex which assembles on spliced mRNAs. The protein also acts as a transcript-selective translational repressor of selenoprotein synthesis during selenium deficiency. Selenocysteine (Sec) incorporation into selenoproteins requires a Sec Insertion Sequence (SECIS) element in the 3' untranslated region. During selenium deficiency, eIF4a3 binds SECIS elements from non-essential selenoproteins, preventing Sec insertion. We identified a molecular signature for the eIF4a3-SECIS interaction using RNA gel shifts, surface plasmon resonance and enzymatic foot printing. Our results support a two-site interaction model, where eIF4a3 binds the internal and apical loops of the SECIS. Additionally, the stability of the complex requires uridine in the SECIS core. In terms of protein requirements, the two globular domains of eIF4a3, which are connected by a linker, are both critical for SECIS binding. Compared to full-length eIF4a3, the two domains in trans bind with a lower association rate but notably, the uridine is no longer important for complex stability. These results provide insight into how eIF4a3 discriminates among SECIS elements and represses translation.

  9. Blockade of S100A3 activity inhibits murine hair growth.

    Science.gov (United States)

    Guan, W; Deng, Q; Yu, X L; Yuan, Y S; Gao, J; Li, J J; Zhou, L; Xia, P; Han, G Y Q; Han, W; Yu, Y

    2015-10-28

    Using mouse gene expression microarray analysis, we obtained dynamic expression profiles of the whole genome in a depilation-induced hair growth mouse model. S100A3 expression increased during the anagen phase and returned to normal during the telogen phase. The effects of S100A3 blockade on the hair growth cycle were examined in mice after subcutaneous injection of an anti-mouse S100A3 antibody. Protein localization of S100A3 was confined to the hair shafts during the anagen phase and the sebaceous glands during the telogen phase. S100A3 blockade delayed hair follicle entry into the anagen phase, decreased hair elongation, and reduced the number of hair follicles in the subcutis, which correlated with the downregulated expression of hair growth induction-related genes in vivo. The present study demonstrates that anti-S100A3 antibody inhibits mouse hair growth, suggesting that S100A3 can be used as a target for hair loss treatment.

  10. Hide and seek: a comparative autoradiographic in vitro investigation of the adenosine A3 receptor

    Energy Technology Data Exchange (ETDEWEB)

    Haeusler, D.; Fuchshuber, F.; Girschele, F.; Hacker, M.; Wadsak, W.; Mitterhauser, Markus [Medical University of Vienna, Department of Biomedical Imaging and Image-guided Therapy, Vienna (Austria); Grassinger, L. [University of Applied Sciences Wiener Neustadt, Department of Biomedical Analytics, Wiener Neustadt (Austria); Hoerleinsberger, W.J. [Medical University of Vienna, Department of Biomedical Imaging and Image-guided Therapy, Vienna (Austria); University of Vienna, Cognitive Science Research Platform, Vienna (Austria); Hoeftberger, R.; Leisser, I. [Medical University of Vienna, Institute of Neurology, Vienna (Austria); Shanab, K.; Spreitzer, H. [University of Vienna, Department of Drug and Natural Product Synthesis, Vienna (Austria); Gerdenitsch, W. [Medical University of Vienna, Institute of Biomedicinal Research, Vienna (Austria)

    2015-05-01

    Since the adenosine A3 receptor (A3R) is considered to be of high clinical importance in the diagnosis and treatment of ischaemic conditions (heart and brain), glaucoma, asthma, arthritis, cancer and inflammation, a suitable and selective A3R PET tracer such as [{sup 18}F]FE rate at SUPPY would be of high clinical value for clinicians as well as patients. A3R was discovered in the late 1990s, but there is still little known regarding its distribution in the CNS and periphery. Hence, in autoradiographic experiments the distribution of A3R in human brain and rat tissues was investigated and the specific binding of the A3R antagonist FE rate at SUPPY and MRS1523 compared. Immunohistochemical staining (IHC) experiments were also performed to validate the autoradiographic findings. For autoradiographic competition experiments human post-mortem brain and rat tissues were incubated with [{sup 125}I]AB-MECA and highly selective compounds to block the other adenosine receptor subtypes. Additionally, IHC was performed with an A3 antibody. Specific A3R binding of MRS1523 and FE rate at SUPPY was found in all rat peripheral tissues examined with the highest amounts in the spleen (44.0 % and 46.4 %), lung (44.5 % and 45.0 %), heart (39.9 % and 42.9 %) and testes (27.4 % and 29.5 %, respectively). Low amounts of A3R were found in rat brain tissues (5.9 % and 5.6 %, respectively) and human brain tissues (thalamus 8.0 % and 9.1 %, putamen 7.8 % and 8.2 %, cerebellum 6.0 % and 7.8 %, hippocampus 5.7 % and 5.6 %, caudate nucleus 4.9 % and 6.4 %, cortex 4.9 % and 6.3 %, respectively). The outcome of the A3 antibody staining experiments complemented the results of the autoradiographic experiments. The presence of A3R protein was verified in central and peripheral tissues by autoradiography and IHC. The specificity and selectivity of FE rate at SUPPY was confirmed by direct comparison with MRS1523, providing further evidence that [{sup 18}F]FE rate at SUPPY may be a suitable A3 PET

  11. Alpha-defensin DEFA1A3 gene copy number elevation in Danish Crohn's disease patients

    DEFF Research Database (Denmark)

    Jespersgaard, Cathrine; Fode, Peder; Dybdahl, Marianne;

    2011-01-01

    BACKGROUND AND PURPOSE OF STUDY: Extensive copy number variation is observed for the DEFA1A3 gene encoding alpha-defensins 1-3. The objective of this study was to determine the involvement of alpha-defensins in colonic tissue from Crohn's disease (CD) patients and the possible genetic association...... number of DEFA1A3 and individual alleles, DEFA1 and DEFA3, were compared with those for controls, by use of combined real-time quantitative PCR and pyrosequencing, and correlated with disease location. RESULTS: Inflammatory-dependent mRNA expression of DEFA1A3 (P

  12. Hide and seek: a comparative autoradiographic in vitro investigation of the adenosine A3 receptor

    International Nuclear Information System (INIS)

    Since the adenosine A3 receptor (A3R) is considered to be of high clinical importance in the diagnosis and treatment of ischaemic conditions (heart and brain), glaucoma, asthma, arthritis, cancer and inflammation, a suitable and selective A3R PET tracer such as [18F]FE rate at SUPPY would be of high clinical value for clinicians as well as patients. A3R was discovered in the late 1990s, but there is still little known regarding its distribution in the CNS and periphery. Hence, in autoradiographic experiments the distribution of A3R in human brain and rat tissues was investigated and the specific binding of the A3R antagonist FE rate at SUPPY and MRS1523 compared. Immunohistochemical staining (IHC) experiments were also performed to validate the autoradiographic findings. For autoradiographic competition experiments human post-mortem brain and rat tissues were incubated with [125I]AB-MECA and highly selective compounds to block the other adenosine receptor subtypes. Additionally, IHC was performed with an A3 antibody. Specific A3R binding of MRS1523 and FE rate at SUPPY was found in all rat peripheral tissues examined with the highest amounts in the spleen (44.0 % and 46.4 %), lung (44.5 % and 45.0 %), heart (39.9 % and 42.9 %) and testes (27.4 % and 29.5 %, respectively). Low amounts of A3R were found in rat brain tissues (5.9 % and 5.6 %, respectively) and human brain tissues (thalamus 8.0 % and 9.1 %, putamen 7.8 % and 8.2 %, cerebellum 6.0 % and 7.8 %, hippocampus 5.7 % and 5.6 %, caudate nucleus 4.9 % and 6.4 %, cortex 4.9 % and 6.3 %, respectively). The outcome of the A3 antibody staining experiments complemented the results of the autoradiographic experiments. The presence of A3R protein was verified in central and peripheral tissues by autoradiography and IHC. The specificity and selectivity of FE rate at SUPPY was confirmed by direct comparison with MRS1523, providing further evidence that [18F]FE rate at SUPPY may be a suitable A3 PET tracer for use in

  13. Physical properties of ferroelectric superlattice A3/B3 system in electric field

    Institute of Scientific and Technical Information of China (English)

    Jiang Wei; Lo Veng-Cheong; Bai Bao-Dong

    2005-01-01

    Based on the differential operator technique, a transverse Ising model (TIM) in the effective-field theory is developed to study the physical properties of a ferroelectric superlattice A3/B3 system. The effects of an external electric field on the polarization, susceptibility and pyroelectric coefficient of the ferroelectric superlattice A3/B3 system are discussed in detail. The susceptibility of the ferroelectric superlattice A3/B3 system decreases with the increase of the electric field, implying that the polarization is weak.

  14. Constructing and Analyzing Fusion Promoter of Partial Sericin 1 and Bombyx A3 Cytoplasmic Actin

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Previous report showed that the 209 bp DNA sequence upstream of the sericin 1 transcriptional start site (-586 to -378 bp) is involved in promoting transcription and responsible for the tissue specificity of sericin 1 promoter in silkworm Bombyx mori. In the present study, this 209 bp sequence exhibited enhancive effect by assembling in two different locations of ubiquitous Bombyx A3 cytoplasmic actin promoter. Sf-9 cells were transfected with recombinant plasmids using Cellfectin reagent. Firefly luciferase gene located downstream of fusion promoter was considered as a reporter, whereas the activity of the co-transfected Renilla luciferase gene (pGL2-SV40) provides an internal control. This 209 bp region up-regulates the strength of A3 promoter significantly (P < 0.01) when it enters into A3 promoter with respect to the position in sericin 1 gene promoter. This 209-bp fragment was almost functionless when being located upstream of A3 promoter.

  15. A Hierarchy of New Nonlinear Evolution Equations Associated with a 3 × 3 Matrix Spectral Problem

    Institute of Scientific and Technical Information of China (English)

    GENG Xian-Guo; LI Fang

    2009-01-01

    A 3 × 3 matrix spectral problem with three potentials and the corresponding hierarchy of new nonlinear evolution equations are proposed. Generalized Hamiltonian structures for the hierarchy of nonlinear evolution equations are derived with the aid of trace identity.

  16. ALDH1A3, a metabolic target for cancer diagnosis and therapy.

    Science.gov (United States)

    Duan, Jiang-Jie; Cai, Jiao; Guo, Yu-Feng; Bian, Xiu-Wu; Yu, Shi-Cang

    2016-09-01

    Metabolism reprogramming has been linked with the initiation, metastasis, and recurrence of cancer. The aldehyde dehydrogenase (ALDH) family is the most important enzyme system for aldehyde metabolism. The human ALDH family is composed of 19 members. ALDH1A3 participates in various physiological processes in human cells by oxidizing all-trans-retinal to retinoic acid. ALDH1A3 expression is regulated by many factors, and it is associated with the development, progression, and prognosis of cancers. In addition, ALDH1A3 influences a diverse range of biological characteristics within cancer stem cells and can act as a marker for these cells. Thus, growing evidence indicates that ALDH1A3 has the potential to be used as a target for cancer diagnosis and therapy. PMID:26991532

  17. On an asymptotic distribution of dependent random variables on a 3-dimensional lattice.

    Science.gov (United States)

    Harvey, Danielle J; Weng, Qian; Beckett, Laurel A

    2010-06-15

    We define conditions under which sums of dependent spatial data will be approximately normally distributed. A theorem on the asymptotic distribution of a sum of dependent random variables defined on a 3-dimensional lattice is presented. Examples are also presented.

  18. Kinematic Analysis of a 3-Axis Parallel Manipulator: The P3

    OpenAIRE

    Qinchuan Li; Zhi Chen; Xinxue Chai; Qiaohong Chen

    2013-01-01

    This paper presents kinematic analysis of a 3-axis parallel manipulator, called P3. The P3 parallel manipulator is developed based on a 3-PRRU parallel mechanism, where P denotes prismatic pair, R revolute pair, and U universal joint. The P3 parallel manipulator can undergo two rotations and one translation without parasitic motion. First, a brief description of the P3 is presented. Then, forward and inverse kinematic solutions of the P3 are derived. Parasitic motion is discussed. The Jacobia...

  19. TAF4 inactivation reveals the 3 dimensional growth promoting activities of collagen 6A3.

    Directory of Open Access Journals (Sweden)

    Igor Martianov

    Full Text Available Collagen 6A3 (Col6a3, a component of extracellular matrix, is often up-regulated in tumours and is believed to play a pro-oncogenic role. However the mechanisms of its tumorigenic activity are poorly understood. We show here that Col6a3 is highly expressed in densely growing mouse embryonic fibroblasts (MEFs. In MEFs where the TAF4 subunit of general transcription factor IID (TFIID has been inactivated, elevated Col6a3 expression prevents contact inhibition promoting their 3 dimensional growth as foci and fibrospheres. Analyses of gene expression in densely growing Taf4(-/- MEFs revealed repression of the Hippo pathway and activation of Wnt signalling. The Hippo activator Kibra/Wwc1 is repressed under dense conditions in Taf4(-/- MEFs, leading to nuclear accumulation of the proliferation factor YAP1 in the cells forming 3D foci. At the same time, Wnt9a is activated and the Sfrp2 antagonist of Wnt signalling is repressed. Surprisingly, treatment of Taf4(-/- MEFs with all-trans retinoic acid (ATRA restores contact inhibition suppressing 3D growth. ATRA represses Col6a3 expression independently of TAF4 expression and Col6a3 silencing is sufficient to restore contact inhibition in Taf4(-/- MEFs and to suppress 3D growth by reactivating Kibra expression to induce Hippo signalling and by inducing Sfrp2 expression to antagonize Wnt signalling. All together, these results reveal a critical role for Col6a3 in regulating both Hippo and Wnt signalling to promote 3D growth, and show that the TFIID subunit TAF4 is essential to restrain the growth promoting properties of Col6a3. Our data provide new insight into the role of extra cellular matrix components in regulating cell growth.

  20. Decomposing a planar graph into an independent set and a 3-degenerate graph

    DEFF Research Database (Denmark)

    Thomassen, Carsten

    2001-01-01

    We prove the conjecture made by O. V. Borodin in 1976 that the vertex set of every planar graph can be decomposed into an independent set and a set inducing a 3-degenerate graph. (C) 2001 Academic Press.......We prove the conjecture made by O. V. Borodin in 1976 that the vertex set of every planar graph can be decomposed into an independent set and a set inducing a 3-degenerate graph. (C) 2001 Academic Press....

  1. De novo mutations in ATP1A3 cause alternating hemiplegia of childhood

    Science.gov (United States)

    Heinzen, Erin L.; Swoboda, Kathryn J.; Hitomi, Yuki; Gurrieri, Fiorella; Nicole, Sophie; de Vries, Boukje; Tiziano, F. Danilo; Fontaine, Bertrand; Walley, Nicole M.; Heavin, Sinéad; Panagiotakaki, Eleni; Fiori, Stefania; Abiusi, Emanuela; Di Pietro, Lorena; Sweney, Matthew T.; Newcomb, Tara M.; Viollet, Louis; Huff, Chad; Jorde, Lynn B.; Reyna, Sandra P.; Murphy, Kelley J.; Shianna, Kevin V.; Gumbs, Curtis E.; Little, Latasha; Silver, Kenneth; Ptác̆ek, Louis J.; Haan, Joost; Ferrari, Michel D.; Bye, Ann M.; Herkes, Geoffrey K.; Whitelaw, Charlotte M.; Webb, David; Lynch, Bryan J.; Uldall, Peter; King, Mary D.; Scheffer, Ingrid E.; Neri, Giovanni; Arzimanoglou, Alexis; van den Maagdenberg, Arn M.J.M.; Sisodiya, Sanjay M.; Mikati, Mohamad A.; Goldstein, David B.; Nicole, Sophie; Gurrieri, Fiorella; Neri, Giovanni; de Vries, Boukje; Koelewijn, Stephany; Kamphorst, Jessica; Geilenkirchen, Marije; Pelzer, Nadine; Laan, Laura; Haan, Joost; Ferrari, Michel; van den Maagdenberg, Arn; Zucca, Claudio; Bassi, Maria Teresa; Franchini, Filippo; Vavassori, Rosaria; Giannotta, Melania; Gobbi, Giuseppe; Granata, Tiziana; Nardocci, Nardo; De Grandis, Elisa; Veneselli, Edvige; Stagnaro, Michela; Gurrieri, Fiorella; Neri, Giovanni; Vigevano, Federico; Panagiotakaki, Eleni; Oechsler, Claudia; Arzimanoglou, Alexis; Nicole, Sophie; Giannotta, Melania; Gobbi, Giuseppe; Ninan, Miriam; Neville, Brian; Ebinger, Friedrich; Fons, Carmen; Campistol, Jaume; Kemlink, David; Nevsimalova, Sona; Laan, Laura; Peeters-Scholte, Cacha; van den Maagdenberg, Arn; Casaer, Paul; Casari, Giorgio; Sange, Guenter; Spiel, Georg; Boneschi, Filippo Martinelli; Zucca, Claudio; Bassi, Maria Teresa; Schyns, Tsveta; Crawley, Francis; Poncelin, Dominique; Vavassori, Rosaria

    2012-01-01

    Alternating hemiplegia of childhood (AHC) is a rare, severe neurodevelopmental syndrome characterized by recurrent hemiplegic episodes and distinct neurologic manifestations. AHC is usually a sporadic disorder with unknown etiology. Using exome sequencing of seven patients with AHC, and their unaffected parents, we identified de novo nonsynonymous mutations in ATP1A3 in all seven AHC patients. Subsequent sequence analysis of ATP1A3 in 98 additional patients revealed that 78% of AHC cases have a likely causal ATP1A3 mutation, including one inherited mutation in a familial case of AHC. Remarkably, six ATP1A3 mutations explain the majority of patients, including one observed in 36 patients. Unlike ATP1A3 mutations that cause rapid-onset-dystonia-parkinsonism, AHC-causing mutations revealed consistent reductions in ATPase activity without effects on protein expression. This work identifies de novo ATP1A3 mutations as the primary cause of AHC, and offers insight into disease pathophysiology by expanding the spectrum of phenotypes associated with mutations in this gene. PMID:22842232

  2. Cloning, expression and pharmacological characterization of rabbit adenosine A1 and A3 receptors.

    Science.gov (United States)

    Hill, R J; Oleynek, J J; Hoth, C F; Kiron, M A; Weng, W; Wester, R T; Tracey, W R; Knight, D R; Buchholz, R A; Kennedy, S P

    1997-01-01

    The role of adenosine A1 and A3 receptors in mediating cardioprotection has been studied predominantly in rabbits, yet the pharmacological characteristics of rabbit adenosine A1 and A3 receptor subtypes are unknown. Thus, the rabbit adenosine A3 receptor was cloned and expressed, and its pharmacology was compared with that of cloned adenosine A1 receptors. Stable transfection of rabbit A1 or A3 cDNAs in Chinese hamster ovary-K1 cells resulted in high levels of expression of each of the receptors, as demonstrated by high-affinity binding of the A1/A3 adenosine receptor agonist N6-(4-amino-3-[125I]iodobenzyl)adenosine (125I-ABA). For both receptors, binding of 125I-ABA was inhibited by the GTP analog 5'-guanylimidodiphosphate, and forskolin-stimulated cyclic AMP accumulation was inhibited by the adenosine receptor agonist (R)-phenylisopropyladenosine. The rank orders of potency of adenosine receptor agonists for inhibition of 125I-ABA binding were as follows: rabbit A1, N6-cyclopentyladenosine = (R)-phenylisopropyladenosine > N-ethylcarboxamidoadenosine > or = I-ABA > or = N6-2-(4-aminophenyl) ethyladenosine > > N6-(3-iodobenzyl)adenosine-5'-N-methyluronamide > N6-(4-amino-3-benzyl)adenosine; rabbit A3, N6-(3-iodobenzyl)adenosine-5'-N-methyluronamide > or = I-ABA > > N-ethylcarboxamidoadenosine > N6-2-(4-aminophenyl) ethyladenosine = N6-cyclopentyladenosine = (R)-phenylisopropyladenosine > N6-(4-amino-3-benzyl)adenosine. The adenosine receptor antagonist rank orders were as follow: rabbit A1, 8-cyclopentyl-1,3-dipropylxanthine > 1,3- dipropyl-8-(4-acrylate)phenylxanthine > or = xanthine amine congener > > 8-(p-sulfophenyl)theophylline; rabbit A3, xanthine amine congener > 1,3-dipropyl-8-(4-acrylate)phenylxanthine > or = 8-cyclopentyl-1,3-dipropylxanthine > > 8-(p-sulfophenyl)theophylline. These observations confirm the identity of the expressed proteins as A1 and A3 receptors. The results will facilitate further in-depth studies of the roles of A1 and A3 receptors in

  3. Mast cell adenosine receptors function: a focus on the A3 adenosine receptor and inflammation

    Directory of Open Access Journals (Sweden)

    Noam eRudich

    2012-06-01

    Full Text Available Adenosine is a metabolite, which has long been implicated in a variety of inflammatory processes. Inhaled adenosine provokes bronchoconstriction in asthmatics or chronic obstructive pulmonary disease (COPD patients, but not in non-asthmatics. This hyper responsiveness to adenosine appears to be mediated by mast cell activation. These observations have marked the receptor that mediates the bronchoconstrictor effect of adenosine on mast cells, as an attractive drug candidate. Four subtypes (A1, A2a, A2b and A3 of adenosine receptors have been cloned and shown to display distinct tissue distributions and functions. Animal models have firmly established the ultimate role of the A3 adenosine receptor (A3R in mediating hyper responsiveness to adenosine in mast cells, although the influence of the A2b adenosine receptor was confirmed as well. In contrast, studies of the A3R in humans have been controversial. In this review, we summarize data on the role of different adenosine receptors in mast cell regulation of inflammation and pathology, with a focus on the common and distinct functions of the A3R in rodent and human mast cells. The relevance of mouse studies to the human is discussed.

  4. von Willebrand factor A1 domain can adequately substitute for A3 domain in recruitment of flowing platelets to collagen

    NARCIS (Netherlands)

    Bonnefoy, A.; Romijn, R. A.; Vandervoort, P. A. H.; Van Rompaey, I.; Vermylen, J.; Hoylaerts, M. F.

    2006-01-01

    Background: Binding of von Willebrand factor (VWF) to platelet GPIb alpha and to collagen is attributed to VWF A1 and A3 domains, respectively. Objectives: Using VWF, VWF lacking A1 (Delta A1-VWF) or A3 (Delta A3-VWF) and VWF with defective A3 (H1786A-VWF), in combination with recombinant A1 (residu

  5. Influence of Nucleating Agent on the Formation of C4A3S

    Institute of Scientific and Technical Information of China (English)

    GUO Huiling; XIE Junlin; ZHANG Shu; XU Qi

    2012-01-01

    The reference test methods are carried out parallelly,by means of chemical analysis,X-ray diffraction,differential scanning calorimetry-thermogravimetry,scanning electron microscopy and polarized optical microscope to study the formation of C4A3S in the presence and absence of nucleating agent.The results show that nucleating agent with high calcium and low heat consumption as tricalcium silicate (C3S) promotes the formation of C4A3S and increases desulfurization degree obviously.During calcining raw meals doped with C3S,the grain sizes of C4A3S are larger compared with that without C3S.And at the same calcining level,the mass loss and the heat consumption belonged to CaCO3 decomposition is reduced.

  6. A 3-D model of superfluid helium suitable for numerical analysis

    CERN Document Server

    Darve, C; Van Sciver, S W

    2009-01-01

    The two-fluid description is a very successful phenomenological representation of the properties of Helium II. A 3-D model suitable for numerical analysis based on the Landau-Khalatnikov description of Helium II is proposed. In this paper we introduce a system of partial differential equations that is both complete and consistent as well as practical, to be used for a 3-D solution of the flow of Helium II. The development of a 3-D numerical model for Helium II is motivated by the need to validate experimental results obtained by observing the normal component velocity distribution in a Helium II thermal counter-flow using the Particle Image Velocimetry (PIV) technique.

  7. Atmospheric nonequilibrium mini-plasma jet created by a 3D printer

    Directory of Open Access Journals (Sweden)

    Toshihiro Takamatsu

    2015-07-01

    Full Text Available In this study, a small-sized plasma jet source with a 3.7 mm head diameter was created via a 3D printer. The jet’s emission properties and OH radical concentrations (generated by argon, helium, and nitrogen plasmas were investigated using optical emission spectrometry (OES and electron spin resonance (ESR. As such, for OES, each individual gas plasma propagates emission lines that derive from gases and ambient air inserted into the measurement system. For the case of ESR, a spin adduct of the OH radical is typically observed for all gas plasma treatment scenarios with a 10 s treatment by helium plasma generating the largest amount of OH radicals at 110 μM. Therefore, it was confirmed that a plasma jet source made by a 3D printer can generate stable plasmas using each of the aforementioned three gases.

  8. Atmospheric nonequilibrium mini-plasma jet created by a 3D printer

    Energy Technology Data Exchange (ETDEWEB)

    Takamatsu, Toshihiro, E-mail: toshihiro@plasma.es.titech.ac.jp [Kobe University Graduate School of Medicine, Department of Gastroenterology, 7-5-1 Kusunoki-cho, Chuo-ku, Kobe, 650-0017 (Japan); Tokyo Institute of Technology, Department of Energy Sciences, J2-32, 4259 Nagatsuta, Midori-ku, Yokohama, 226-8502 (Japan); Kawano, Hiroaki; Miyahara, Hidekazu; Okino, Akitoshi [Tokyo Institute of Technology, Department of Energy Sciences, J2-32, 4259 Nagatsuta, Midori-ku, Yokohama, 226-8502 (Japan); Azuma, Takeshi [Kobe University Graduate School of Medicine, Department of Gastroenterology, 7-5-1 Kusunoki-cho, Chuo-ku, Kobe, 650-0017 (Japan)

    2015-07-15

    In this study, a small-sized plasma jet source with a 3.7 mm head diameter was created via a 3D printer. The jet’s emission properties and OH radical concentrations (generated by argon, helium, and nitrogen plasmas) were investigated using optical emission spectrometry (OES) and electron spin resonance (ESR). As such, for OES, each individual gas plasma propagates emission lines that derive from gases and ambient air inserted into the measurement system. For the case of ESR, a spin adduct of the OH radical is typically observed for all gas plasma treatment scenarios with a 10 s treatment by helium plasma generating the largest amount of OH radicals at 110 μM. Therefore, it was confirmed that a plasma jet source made by a 3D printer can generate stable plasmas using each of the aforementioned three gases.

  9. Atmospheric nonequilibrium mini-plasma jet created by a 3D printer

    International Nuclear Information System (INIS)

    In this study, a small-sized plasma jet source with a 3.7 mm head diameter was created via a 3D printer. The jet’s emission properties and OH radical concentrations (generated by argon, helium, and nitrogen plasmas) were investigated using optical emission spectrometry (OES) and electron spin resonance (ESR). As such, for OES, each individual gas plasma propagates emission lines that derive from gases and ambient air inserted into the measurement system. For the case of ESR, a spin adduct of the OH radical is typically observed for all gas plasma treatment scenarios with a 10 s treatment by helium plasma generating the largest amount of OH radicals at 110 μM. Therefore, it was confirmed that a plasma jet source made by a 3D printer can generate stable plasmas using each of the aforementioned three gases

  10. Investigating the role of CheA-3 in Dusulfovibrio Vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Ray, Jayashee; Keller, Kimberley; Krierim, Bernhard; Auer, Manfred; Keasling, Jay; Wall, Judy; Mukhopadhyay, Aindrila

    2010-05-22

    Multiple sets of chemotaxis genes including three cheA homologs were identified in the genome sequence of the anaerobic bacterium Desulfovibrio vulgaris Hildenborough. Each CheA is a histidine kinase (HK) and part of a two component signal transduction system. Knock out mutants in the three cheA genes were created using single cross-over homologous recombination insertion. We studied the phenotypes of the cheA mutants in detail and discovered that ?cheA-3 has a non swarming/swimming phenotype both in the soft agar plates and Palleroni chamber assays. CheA-3 shows similarity to the Shewanella oneidensis CheA-3 and the Vibrio cholerae CheA-2 that are responsible for chemotaxis in the respective organisms. We did not find any morphological or structural differences between the three Delta cheA mutants and the wild type cells in electron microscopy. Our results from these studies are presented.

  11. Tratamiento quirúrgico en las fracturas del radio distal tipo A3

    OpenAIRE

    Arenas Planelles, Antonio; Ortega Arruti, J.A.; Ortega Sáez, M. (Marta); Arenas Miquélez, A.

    2009-01-01

    Se presentan 44 casos de fractura de radio distal tipo A3 tratadas en nuestro Servicio entre los años 1992 y 2004. Se utilizó como método de osteosíntesis una placa palmar en 7 casos, agujas de Kirschner percutáneas en 14 casos, fijadores externos en 20 y fijador externo + agujas en 3 casos. Los mejores resultados se obtuvieron en el grupo de casos tratados con placa palmar (100 % de resultados satisfactorios). 44 cases of A3 type fracture of the distal radius treated in our Depar...

  12. Regenerative material for aneurysm embolization A 3-dimensional culture system of fibroblasts and calcium alginate gel

    Institute of Scientific and Technical Information of China (English)

    Jingdong Zhang; Kan Xu; Jinlu Yu; Jun Wang; Qi Luo

    2011-01-01

    Calcium alginate gel (CAG) has been shown to successfully model aneurysm embolization within a short period of time. However, gradually degrading CAG potentially results in aneurysm recanalization.In the present study, a regenerative embolic material was designed by seeding rat fibroblasts in a CAG. The study investigated the feasibility of constructing a 3-dimensional culture system. The fibroblasts grew well and firmly attached to the CAG. CAG was conducive for fibroblast growth, and resulted in a 3-dimensional culture system. Results show that CAG can be used theoretically as a vascular, regenerative, embolic material.

  13. A feasibility study of a 3-D finite element solution scheme for aeroengine duct acoustics

    Science.gov (United States)

    Abrahamson, A. L.

    1980-01-01

    The advantage from development of a 3-D model of aeroengine duct acoustics is the ability to analyze axial and circumferential liner segmentation simultaneously. The feasibility of a 3-D duct acoustics model was investigated using Galerkin or least squares element formulations combined with Gaussian elimination, successive over-relaxation, or conjugate gradient solution algorithms on conventional scalar computers and on a vector machine. A least squares element formulation combined with a conjugate gradient solver on a CDC Star vector computer initially appeared to have great promise, but severe difficulties were encountered with matrix ill-conditioning. These difficulties in conditioning rendered this technique impractical for realistic problems.

  14. “3D Turtle Graphics” by using a 3D Printer

    OpenAIRE

    Yasusi Kanada

    2015-01-01

    When creating shapes by using a 3D printer, usually, a static (declarative) model designed by using a 3D CAD system is translated to a CAM program and it is sent to the printer. However, widely-used FDM-type 3D printers input a dynamical (procedural) program that describes control of motions of the print head and extrusion of the filament. If the program is expressed by using a programming language or a library in a straight manner, solids can be created by a method similar to tur...

  15. 26 CFR 1.168A-3 - Election to discontinue amortization.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Election to discontinue amortization. 1.168A-3...-3 Election to discontinue amortization. (a) If a taxpayer has elected to take amortization deductions with respect to an emergency facility, it may, after such election and prior to the expiration...

  16. Development of a 3D CZT detector prototype for Laue Lens telescope

    DEFF Research Database (Denmark)

    Caroli, Ezio; Auricchio, Natalia; Del Sordo, Stefano;

    2010-01-01

    We report on the development of a 3D position sensitive prototype suitable as focal plane detector for Laue lens telescope. The basic sensitive unit is a drift strip detector based on a CZT crystal, (~19×8 mm2 area, 2.4 mm thick), irradiated transversally to the electric field direction. The anode...

  17. Influence of NaCl Deposition on Atmospheric Corrosion of A3 Steel

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Regularity of the initial atmospheric corrosion of A3 steel in the presence of NaCl was investigated. The results showed that NaCl can accelerate the corrosion of A3 steel. Dry mass gain of A3 steel in the presence of NaCl deposition increases with the exposure time, which can be correlated by using exponential decay function. The relationship between dry mass gain and amount of NaCl deposition at a certain exposure time follows a quadratic function. More amount of NaCl deposition will slow down the corrosion rate to some extent after exposure for a certain time. SEM/EDAX was used to characterize the corrosion surface and products. The surfaces of the NaCl treated A3 steel were obviously uneven, and some tiny crevices appear in the corrosion products that could help O2 transmit to the inner layer. The amount of oxygen in atomic percentage in the corrosion products increases with the amount of NaCl deposition.

  18. Rotation symmetry axes and the quality index in a 3D octahedral parallel robot manipulator system

    OpenAIRE

    Tanev, T. K.; Rooney, J.

    2002-01-01

    The geometry of a 3D octahedral parallel robot manipulator system is specified in terms of two rigid octahedral structures (the fixed and moving platforms) and six actuation legs. The symmetry of the system is exploited to determine the behaviour of (a new version of) the quality index for various motions. The main results are presented graphically.

  19. Interplay of Specific Trans- and Juxtamembrane Interfaces in Plexin A3 Dimerization and Signal Transduction.

    Science.gov (United States)

    Barton, Rachael; Khakbaz, Pouyan; Bera, Indrani; Klauda, Jeffery B; Iovine, M Kathryn; Berger, Bryan W

    2016-09-01

    Plexins are transmembrane proteins that serve as guidance receptors during angiogenesis, lymphangiogenesis, neuronal development, and zebrafish fin regeneration, with a putative role in cancer metastasis. Receptor dimerization or clustering, induced by extracellular ligand binding but modulated in part by the plexin transmembrane (TM) and juxtamembrane (JM) domains, is thought to drive plexin activity. Previous studies indicate that isolated plexin TM domains interact through a conserved, small-x3-small packing motif, and the cytosolic JM region interacts through a hydrophobic heptad repeat; however, the roles and interplay of these regions in plexin signal transduction remain unclear. Using an integrated experimental and simulation approach, we find disruption of the small-x3-small motifs in the Danio rerio Plexin A3 TM domain enhances dimerization of the TM-JM domain by enhancing JM-mediated dimerization. Furthermore, mutations of the cytosolic JM heptad repeat that disrupt dimerization do so even in the presence of TM domain mutations. However, mutations to the small-x3-small TM interfaces also disrupt Plexin A3 signaling in a zebrafish axonal guidance assay, indicating the importance of this TM interface in signal transduction. Collectively, our experimental and simulation results demonstrate that multiple TM and JM interfaces exist in the Plexin A3 homodimer, and these interfaces independently regulate dimerization that is important in Plexin A3 signal transduction.

  20. Presence Pedagogy: Teaching and Learning in a 3D Virtual Immersive World

    Science.gov (United States)

    Bronack, Stephen; Sanders, Robert; Cheney, Amelia; Riedl, Richard; Tashner, John; Matzen, Nita

    2008-01-01

    As the use of 3D immersive virtual worlds in higher education expands, it is important to examine which pedagogical approaches are most likely to bring about success. AET Zone, a 3D immersive virtual world in use for more than seven years, is one embodiment of pedagogical innovation that capitalizes on what virtual worlds have to offer to social…

  1. 26 CFR 31.6402(a)-3 - Refund of Federal unemployment tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Refund of Federal unemployment tax. 31.6402(a... Provisions of Subtitle F, Internal Revenue Code of 1954) § 31.6402(a)-3 Refund of Federal unemployment tax... 3301 of the Federal Unemployment Tax Act or a corresponding provision of prior law, or (b)...

  2. 26 CFR 31.6011(a)-3 - Returns under Federal Unemployment Tax Act.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Returns under Federal Unemployment Tax Act. 31... Provisions of Subtitle F, Internal Revenue Code of 1954) § 31.6011(a)-3 Returns under Federal Unemployment Tax Act. (a) Requirement. Every person shall make a return of tax under the Federal Unemployment...

  3. Predictors of Reading Development in Deaf Children: A 3-Year Longitudinal Study

    Science.gov (United States)

    Kyle, Fiona E.; Harris, Margaret

    2010-01-01

    The development of reading ability in a group of deaf children was followed over a 3-year period. A total of 29 deaf children (7-8 years of age at the first assessment) participated in the study, and every 12 months they were given a battery of literacy, cognitive, and language tasks. Earlier vocabulary and speechreading skills predicted…

  4. Synthesis of Calystegine A(3) from Glucose by the Use of Ring-Closing Metathesis

    DEFF Research Database (Denmark)

    Monrad, Rune Nygaard; Pipper, Charlotte Bressen; Madsen, Robert

    2009-01-01

    and allylated in the same pot. The functionalized nona-1,8-diene, thus obtained, is converted into the seven-membered carbon skeleton in calystegine A(3) by ring-closing olefin metathesis. Subsequent deoxygenation by the Barton-McCombie protocol, hydroboration and oxidative workup followed by hydrogenolysis...

  5. Leadership Coaching in an Induction Program for Novice Principals: A 3-Year Study

    Science.gov (United States)

    Lochmiller, Chad R.

    2014-01-01

    This article presents results from a study of leadership coaches who worked with novice principals in a university-based induction program for a 3-year period. The qualitative case study describes how the support the coaches provided to the novice principals changed over time. The study reveals that coaches adapted their leadership coaching…

  6. Reproducibility of a 3-dimensional gyroscope in measuring shoulder anteflexion and abduction

    NARCIS (Netherlands)

    Penning, L.I.F.; Guldemond, N.A.; De Bie, R.A.; Walenkamp, G.H.I.M.

    2012-01-01

    Background: Few studies have investigated the use of a 3-dimensional gyroscope for measuring the range of motion (ROM) in the impaired shoulder. Reproducibility of digital inclinometer and visual estimation is poor. This study aims to investigate the reproducibility of a tri axial gyroscope in measu

  7. 8 CFR 245a.3 - Application for adjustment from temporary to permanent resident status.

    Science.gov (United States)

    2010-01-01

    ...) Evidence of recognition under 8 CFR 245a.3(b)(5)(i)(A), (B), or (C) (e.g., certification from a qualified... grams or less of marijuana; (iv) Paragraphs (27) (prejudicial to the public interest), (28) (communists... Processing Facility may issue a new decision that will grant the benefit which has been requested....

  8. A 3D City Model Used as User-interface for an Energy-system

    DEFF Research Database (Denmark)

    Kjems, Erik

    2011-01-01

    and the overall results after the system has been used at the Bright Green Exhibition connected to the COP15 conference in Copenhagen. This paper presents the empirical findings of the attempt to use a 3D city model as user-interface. The system gave the user the possibility to try out different scenarios...

  9. 26 CFR 1.651(a)-3 - Distribution of amounts other than income.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Distribution of amounts other than income. 1.651... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Trusts Which Distribute Current Income Only § 1.651(a)-3 Distribution of amounts other than income. (a) A trust does not qualify for treatment under section 651 for...

  10. Alpha-defensin DEFA1A3 gene copy number elevation in Danish Crohn's disease patients

    DEFF Research Database (Denmark)

    Jespersgaard, Cathrine; Fode, Peder; Dybdahl, Marianne;

    2011-01-01

    BACKGROUND AND PURPOSE OF STUDY: Extensive copy number variation is observed for the DEFA1A3 gene encoding alpha-defensins 1-3. The objective of this study was to determine the involvement of alpha-defensins in colonic tissue from Crohn's disease (CD) patients and the possible genetic association...

  11. Digital Geological Model (DGM): a 3D raster model of the subsurface of the Netherlands

    NARCIS (Netherlands)

    Gunnink, J.L.; Maljers, D.; Gessel, S.F. van; Menkovic, A.; Hummelman, H.J.

    2013-01-01

    A 3D geological raster model has been constructed of the onshore of the Netherlands. The model displays geological units for the upper 500 m in 3D in an internally consistent way. The units are based on the lithostratigraphical classification of the Netherlands. This classification is used to interp

  12. From Gene to Protein: A 3-Week Intensive Course in Molecular Biology for Physical Scientists

    Science.gov (United States)

    Nadeau, Jay L.

    2009-01-01

    This article describes a 3-week intensive molecular biology methods course based upon fluorescent proteins, which is successfully taught at the McGill University to advanced undergraduates and graduates in physics, chemical engineering, biomedical engineering, and medicine. No previous knowledge of biological terminology or methods is expected, so…

  13. Practitioner Perceptions of the A3 Method for Process Improvement in Health Care

    Science.gov (United States)

    Visich, John K.; Wicks, Angela M.; Zalila, Faiza

    2010-01-01

    The focus of this article is to present students' perceptions of the recently developed A3 method, a structured problem-solving approach based on lean concepts and tools that have been adapted to the health care environment. The students were all employees of a large health care provider and were enrolled in a customized health care executive MBA…

  14. 12 CFR 708a.3 - Board of directors' approval and members' opportunity to comment.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Board of directors' approval and members... REGULATIONS AFFECTING CREDIT UNIONS CONVERSION OF INSURED CREDIT UNIONS TO MUTUAL SAVINGS BANKS § 708a.3 Board of directors' approval and members' opportunity to comment. (a) A credit union's board of...

  15. 26 CFR 301.6231(a)(3)-1 - Partnership items.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Partnership items. 301.6231(a)(3)-1 Section 301... Partnership items. (a) In general. For purposes of subtitle F of the Internal Revenue Code of 1954, the following items which are required to be taken into account for the taxable year of a partnership...

  16. Does Attention Constrain Developmental Trajectories in Fragile X Syndrome? A 3-Year Prospective Longitudinal Study

    Science.gov (United States)

    Cornish, Kim; Cole, Victoria; Longhi, Elena; Karmiloff-Smith, Annette; Scerif, Gaia

    2012-01-01

    Basic attentional processes and their impact on developmental trajectories in fragile X syndrome were assessed in a 3-year prospective study. Although fragile X syndrome is a monogenic X-linked disorder, there is striking variability in outcomes even in young boys with the condition. Attention is a key factor constraining interactions with the…

  17. Regularity of transition semigroups associated to a 3D stochastic Navier-Stokes equation

    OpenAIRE

    Flandoli, F.; Romito, M.

    2006-01-01

    A 3D stochastic Navier-Stokes equation with a suitable non degenerate additive noise is considered. The regularity in the initial conditions of every Markov transition kernel associated to the equation is studied by a simple direct approach. A by-product of the technique is the equivalence of all transition probabilities associated to every Markov transition kernel.

  18. A 3-year longitudinal analysis of changes in fitness, physical activity, fatness and screen time

    DEFF Research Database (Denmark)

    Aires, L; Andersen, Lars Bo; Mendonça, D;

    2010-01-01

    in fitness. METHODS: This is a 3-year longitudinal study of 345 high school students aged 11-19 years. Students performed curl-ups, push-ups and 20-m shuttle run tests from Fitnessgram. PA and ST were evaluated using a standard questionnaire. Standardized scores of fitness tests were summed. Changes over...

  19. miR-200a-3p regulates TLR1 expression in bacterial challenged miiuy croaker.

    Science.gov (United States)

    Wang, Yanjin; Xu, Guoliang; Han, Jingjing; Xu, Tianjun

    2016-10-01

    MicroRNAs (miRNAs) are highly conserved, small non-coding RNAs which post-transcriptionally regulate various biological processes by repressing mRNA translation or degradating mRNA. It has been demonstrated that miRNAs play crucial roles in regulating the immune system. In this study, we explored the potential roles of miR-200a-3p in regulating TLR signaling pathway in miiuy croaker. Bioinformatics analysis showed that miiuy croaker TLR1 (mmiTLR1) was a putative target of miR-200a-3p. Negative expression profiles in spleen of Vibrio anguillarum challenged miiuy croaker and in lipopolysaccharide (LPS) stimulated miiuy croaker leukocytes further validated the prediction. Luciferase reporter assays showed that the dual-luciferase reporter fused to the 3'UTR of wild type mmiTLR1 cotransfected with miR-200a-3p mimics exhibited a reduction in luciferase activity compared with the controls. All of the present data provide direct evidence that miR-200a-3p is involved in TLR1 expression modulation in miiuy croaker, which will offer a basis for better understanding of miRNA regulation in fish TLR signaling pathways. PMID:27288848

  20. Talk to the Hand: Generating a 3D Print from Photographs

    OpenAIRE

    Aboufadel, Edward; Krawczyk, Sylvanna V.; Sherman-Bennett, Melissa

    2015-01-01

    This manuscript presents a linear algebra-based technique that only requires two unique photographs from a digital camera to mathematically construct a 3D surface representation which can then be 3D printed. Basic computer vision theory and manufacturing principles are also briefly discussed.

  1. Synthetic Promoter Library for Modulation of Actinorhodin Production in Streptomyces coelicolor A3(2)

    DEFF Research Database (Denmark)

    Sohoni, Sujata Vijay; Fazio, Alessandro; Workman, Christopher;

    2014-01-01

    The objective of this study was the application of the synthetic promoter library (SPL) technology for modulation of actinorhodin production in Streptomyces coelicolor A3(2). The SPL technology was used to optimize the expression of a pathway specific positive transcriptional regulator Actll orf4...

  2. Striatal Dopamine Transporter Availability Associated with Polymorphisms in the Dopamine Transporter Gene SLC6A3

    NARCIS (Netherlands)

    E.M. van de Giessen; M.M.L. de Win; M.W.T. Tanck; W. van den Brink; F. Baas; J. Booij

    2009-01-01

    Polymorphisms in the dopamine transporter (DAT) gene SLC6A3 are associated with human striatal DAT expression, but the exact effects on DAT expression are not clear. A variable number of tandem repeats (VNTR) in the 3' untranslated region of the DAT gene was previously investigated in relation to st

  3. A 3D virtual plant-modelling study : Tillering in spring wheat

    NARCIS (Netherlands)

    Evers, J.B.; Vos, J.

    2007-01-01

    Tillering in wheat (Triticum aestivum L.) is influenced by both light intensity and the ratio between the intensities of red and far-red light. The relationships between canopy architecture, light properties within the canopy, and tillering in spring-wheat plants were studied using a 3D virtual plan

  4. On an asymptotic distribution of dependent random variables on a 3-dimensional lattice✩

    Science.gov (United States)

    Harvey, Danielle J.; Weng, Qian; Beckett, Laurel A.

    2010-01-01

    We define conditions under which sums of dependent spatial data will be approximately normally distributed. A theorem on the asymptotic distribution of a sum of dependent random variables defined on a 3-dimensional lattice is presented. Examples are also presented. PMID:20436940

  5. Study of the pure annihilation Bc→A2A3 decays

    International Nuclear Information System (INIS)

    In this work, we calculate the CP-averaged branching ratios and the polarization fractions of the charmless hadronic Bc→A2A3 decays within the framework of perturbative QCD (pQCD) approach, where A is either a light 3P1 or 1P1 axial-vector meson. These 32 decay modes can occur through the annihilation topology only. Based on the perturbative calculations and phenomenological analysis, we find the following results: (a) the branching ratios of the considered 32 Bc→A2A3 decays are in the range of 10-5 to 10-8; (b) Bc→a1b1, K10K1+ and some other decays have sizable branching ratios and can be measured at the LHC experiments; (c) the branching ratios of Bc→A2(1P1)A3(1P1) decays are generally much larger than those of Bc→A2(3P1)A3(3P1) decays with a factor around (10∼100); (d) the branching ratios of Bc→K10K1+ decays are sensitive to the value of θK, which will be tested by the running LHC and forthcoming SuperB experiments; (e) the large longitudinal polarization contributions govern most considered decays and play the dominant role.

  6. Plasmidic qnrA3 enhances Escherichia coli fitness in absence of antibiotic exposure.

    Directory of Open Access Journals (Sweden)

    Adrien Michon

    Full Text Available The widespread presence of plasmid-mediated quinolone resistance determinants, particularly qnr genes, has become a current issue. By protecting DNA-gyrase from quinolones, Qnr proteins confer a low level quinolone resistance that is not sufficient to explain their emergence. Since Qnr proteins were hypothesized to act as DNA-binding protein regulators, qnr genes could have emerged by providing a selective advantage other than antibiotic resistance. We investigated host fitness of Escherichia coli isogenic strains after acquisition of the qnrA3 gene, inserted either alone onto a small plasmid (pBR322, or harbored on a large conjugative native plasmid, pHe96(qnrA3 found in a clinical isolate. The isogenic strains were derived from the susceptible E. coli CFT073, a virulent B2 group strain known to infect bladder and kidneys in a mouse model of pyelonephritis. In vitro experiments included growth analysis by automatic spectrophotometry and flow cytometry, and competitions with CFU enumeration. In vivo experiments included infection with each strain and pairwise competitions in absence of antimicrobial exposure. As controls for our experiments we used mutations known to reduce fitness (rpsL K42N mutation or to enhance fitness (tetA deletion in pBR322. E. coli CFT073 transformed with pBRAM(PBR322-qnrA3 had significantly higher maximal OD than E. coli CFT073 transformed with pBR322 or pBR322ΔtetA, and in vivo competitions were more often won by the qnrA3 carrying strain (24 victories vs. 9 loss among 42 competitions, p = 0.001. In contrast, when pHe96(qnrA3 was introduced by conjugation in E. coli CFT073, it exerted a fitness cost shown by an impaired growth observed in vitro and in vivo and a majority of lost competitions (33/35, p<0.0001. In conclusion, qnrA3 acquisition enhanced bacterial fitness, which may explain qnr emergence and suggests a regulation role of qnr. However, fitness was reduced when qnrA3 was inserted onto multidrug

  7. Avances biotecnológicos en el diagnóstico de enfermedades infecciosas Biotechnological advances in infectious diseases diagnosis

    Directory of Open Access Journals (Sweden)

    Fidel de la Cruz Hernández-Hernández

    2009-01-01

    Full Text Available La detección de moléculas de patógenos (antígenos y material genético y moléculas de respuesta de los hospederos ante la infección (anticuerpos es el principio básico de las pruebas diagnósticas moleculares. Estas pruebas han hecho innecesaria la detección directa del microorganismo patógeno agresor. Los nuevos avances en biología molecular y el desarrollo de tecnología robótica y secuenciación genómica y proteica han permitido el desarrollo de nuevas pruebas diagnósticas altamente específicas y de gran rendimiento. La genómica y proteómica contribuyen a la identificación de biomarcadores y la biotecnología aporta métodos para producir reactivos de alta pureza. La identificación de genes codificantes de antígenos específicos, su clonación y producción recombinante y la producción de anticuerpos monoclonales, fragmentos de éstos y anticuerpos de una sola cadena han hecho posible el desarrollo de nuevas técnicas inmunológicas más seguras y de sensibilidad y especificidad elevadas. Nuevas moléculas de reconocimiento, incluidos los aptámeros, podrán pronto superar la necesidad de producir anticuerpos mediante inmunización. Para la detección de material genético se han desarrollado nuevas medidas metodológicas basadas en la hibridación y amplificación (PCR, de punto final y en tiempo real en formatos multiplex y en microarreglos y para su detección se han diseñado moléculas reporteras que permiten su cuantificación. Aunque estos métodos requieren instrumentación compleja, puede ya anticiparse que pronto serán accesibles para su aplicación en salud pública.The detection of molecules of pathogens (antigens and genetic material and host molecules in response to infections (antibodies is the basic principle involved in molecular diagnostic tests. These tests have avoided the need to detect the attacking pathogen. New advances in molecular biology and the development of robotic technology and genomic and

  8. Descripción inmunohistoquímica de la encefalitis en bovinos brasileños naturalmente infectados con el herpesvirus bovino tipo 5 (HVB-5 Immunohistochemical description of encephalitis in Brazilian cattle naturally infected with bovine herpes virus type 5 (BoHV-5

    Directory of Open Access Journals (Sweden)

    FJ Pedraza

    2008-01-01

    Full Text Available Doce casos de meningoencefalitis viral en ganado bovino brasilero fueron sometidos a un análisis inmunohistoquímico para describir la respuesta inflamatoria. Todos los casos mostraron severos signos neurológicos seguidos por la muerte. Histológicamente los cambios inflamatorios en el cerebro y el cerebelo que caracterizaron la infección neurológica muestran meningitis, manguitos perivasculares mononucleares, gliosis, hemorragias y macrófagos (células gitter acompañando grandes áreas de malacia. Ninguno de los casos mostró cuerpos de inclusión intranucleares; sin embargo, en cinco de ellos fue posible el aislamiento del HVB-5. Con el fin de recolectar datos que permitan describir la respuesta inflamatoria en estos casos, muestras de cerebro de todos los casos se analizaron por inmunohistoquímica usando anticuerpos policlonales contra CD3 para detectar linfocitos T y contra GFAP para detectar astrocitos. Por otro lado, se usaron anticuerpos monoclonales contra BLA para detectar células B y MAC 387 para detectar macrófagos. Los resultados indican que la respuesta inflamatoria se caracterizó por linfocitos T en los infiltrados perivasculares y por los astrocitos en otras partes del órgano. Los macrófagos (células gitter estuvieron siempre asociados a grandes áreas de malacia y los linfocitos B tuvieron una discreta participación sobre todo en los infiltrados celulares perivasculares. Estos hallazgos facilitarán futuras investigaciones tendientes al entendimiento de la patogénesis de este tipo de encefalitisTwelve cases of viral meningoencephalitis in Brazilian cattle were submitted to immunohistochemical analysis for inflammatory response description. All the cases showed severe neurological signs followed by death. Mild to moderate histological inflammatory changes in the brain and cerebellum characterized the neurological infection showing meningitis, mononuclear perivascular cuffing, gliosis, haemorrhage, and macrophages

  9. Patogénesis de la enfermedad pélvica inflamatoria. Modelo animal con la biovariedad murina de Chlamydia trachomatis

    Directory of Open Access Journals (Sweden)

    Fabio Carmona Velásquez

    2009-10-01

    Full Text Available Se inocularon hembras de ratones blancos suizo (Balb/c, entre 4 y 6 semanas con la serovariedad MoPn de Chlamydia trachomatis para producirles una salpingitis clamidial experimental. Directamente en la rama uterina izquierda se inyectaron 30 µl equivalente a 6 x 104 UFI. La misma cantidad se inyectó en la bursa del ovario del mismo lado, a través del tejido graso que se encuentra en este sitio. Se sacrificaron grupos de hembras a los 7 y 14 días después de la inoculación para buscar inflamación, hidrosálpinx y respuesta de anticuerpos tipo IgG e IgM. Otras hembras inoculadas se aparearon para observar la tasa de infertilidad bilateral que ocasionaba la infección. Un tercer grupo de animales se trató con tetraciclina, ibuprofén y prostaglandina E1. El tratamiento temprano, hacia el segundo día después de la inoculación, impidió la inflamación, la formación de hidrosálpinx y la infertilidad normal bilateral. Los agentes antiinflamatorios, usados solos, no tuvieron ningún efecto para prevenir la inflamación, ni aun en combinación con tetraciclina. Un cuarto grupo se trató con anticuerpos monoclonales dirigidos contra la subpoblación linfocítica L3T4 (equivalente en seres humanos a CD4. En los ratones con L3T4 se observó un agotamiento (depleción total de la población linfocítica L3T4 hacia el segundo día después de la inoculación. El agotamiento persistió por lo menos hasta el día 20, pero no alteró significativamente los porcentajes de células expresadas por Thy 1.2 (célula de antígeno T o Lyt2 (célula de antígeno T supresor/citotóxico, que equivale a los CD8 en el hombre. Se concluye que los continuos inóculos con Chlamydia, generan una respuesta inmune que termina con daño del tejido y conduce a la infertilidad.

  10. Status of the EBIT in the ReA3 reaccelerator at NSCL

    Energy Technology Data Exchange (ETDEWEB)

    Schwarz, S., E-mail: schwarz@nscl.msu.edu; Bollen, G.; Doleans, M.; Kester, O.; Kittimanapun, K.; Kostin, M.; Lapierre, A.; Portillo, M.; Wilson, C. [Michigan State University, National Superconducting Cyclotron Laboratory, NSCL (United States); Lopez-Urrutia, J. R. Crespo [Max-Planck Institute for Nuclear Physics (Germany); Dilling, J. [TRIUMF (Canada)

    2011-07-15

    At the NSCL a reaccelerator with design end energy of 3 MeV/u for {sup 238}U, called ReA3, is approaching the end of construction. ReA3 will be coupled to a gas stopper at the NSCL fragmentation facility to provide rare-isotope beams of nuclides not available at ISOL facilities in this energy range. An Electron Beam Ion Trap (EBIT) will be used to provide highly charged ions at an energy of about 12 keV/u. The charge breeder is followed by a room-temperature radiofrequency quadrupole (RFQ) and a series of superconducting linear accelerator structures. Initial commissioning results from the EBIT and its charge-over-mass separator are presented.

  11. A 3-D visualization method for image-guided brain surgery.

    Science.gov (United States)

    Bourbakis, N G; Awad, M

    2003-01-01

    This paper deals with a 3D methodology for brain tumor image-guided surgery. The methodology is based on development of a visualization process that mimics the human surgeon behavior and decision-making. In particular, it originally constructs a 3D representation of a tumor by using the segmented version of the 2D MRI images. Then it develops an optimal path for the tumor extraction based on minimizing the surgical effort and penetration area. A cost function, incorporated in this process, minimizes the damage surrounding healthy tissues taking into consideration the constraints of a new snake-like surgical tool proposed here. The tumor extraction method presented in this paper is compared with the ordinary method used on brain surgery, which is based on a straight-line based surgical tool. Illustrative examples based on real simulations present the advantages of the 3D methodology proposed here.

  12. Numerical simulation of the filling stage in injection molding based on a 3D model

    Institute of Scientific and Technical Information of China (English)

    GENG Tie; LI De-qun; ZHOU Hua-min

    2005-01-01

    Most injection molded parts are three-dimensional, with complex geometrical configurations and thick/thin wall sections. The change of the thickness of parts has significant influence on flow during injection molding. This paper presents a 3D finite element model to deal with the three-dimensional flow, which can more accurately predict the filling process than a 2. 5D model. In this model, equal-order velocity-pressure interpolation method is successfully employed and the relation between velocity and pressure is obtained from the discretized momentum equation in order to derive the pressure equation. A 3D control volume scheme is employed to track the flow front. The validity of the model has been tested through the analysis of the flow in a cavity.

  13. A 3/2-Approximation Algorithm for Multiple Depot Multiple Traveling Salesman Problem

    Science.gov (United States)

    Xu, Zhou; Rodrigues, Brian

    As an important extension of the classical traveling salesman problem (TSP), the multiple depot multiple traveling salesman problem (MDMTSP) is to minimize the total length of a collection of tours for multiple vehicles to serve all the customers, where each vehicle must start or stay at its distinct depot. Due to the gap between the existing best approximation ratios for the TSP and for the MDMTSP in literature, which are 3/2 and 2, respectively, it is an open question whether or not a 3/2-approximation algorithm exists for the MDMTSP. We have partially addressed this question by developing a 3/2-approximation algorithm, which runs in polynomial time when the number of depots is a constant.

  14. Supporting Product Family Design in a 3D CAD/PDM Integrated System

    Institute of Scientific and Technical Information of China (English)

    ZHANG Fen; CHEN Zhuo-ning; YAN Xiao-guang; BIN Hong-zan

    2006-01-01

    This paper addresses some key issues in supporting product family design in a 3D CAD/PDM integrated system and introduces the techniques developed or adopted in building the integrated system. The general architecture of a 3D CAD/PDM integrated system is organized as five tiers. Multi-agent technology is applied with a collaborative design environment. The rule-based product family architecture (PFA) and tabular layouts of article characteristics (TLAC) technique are applied to represent the knowledge for product families. They make the knowledge understandable, simplified and can be exchanged among heterogeneous information systems. A transparently concentric integrated mode is put forward to enable the heterogeneous processes to interact and communicate regardless of the language used to construct each process. With the mode, function calling and information exchanging among different processes are carried out via message translation/parse approach. Currently, the integrated system is implemented in the platform of Windows NT and 2000.

  15. Long-lived dipolar molecules and Feshbach molecules in a 3D optical lattice

    CERN Document Server

    Chotia, Amodsen; Moses, Steven A; Yan, Bo; Covey, Jacob P; Foss-Feig, Michael; Rey, Ana Maria; Jin, Deborah S; Ye, Jun

    2011-01-01

    We have realized long-lived ground-state polar molecules in a 3D optical lattice, with a lifetime of up to 25 s, which is limited only by off-resonant scattering of the trapping light. Starting from a 2D optical lattice, we observe that the lifetime increases dramatically as a small lattice potential is added along the tube-shaped lattice traps. The 3D optical lattice also dramatically increases the lifetime for weakly bound Feshbach molecules. For a pure gas of Feshbach molecules, we observe a lifetime of >20 s in a 3D optical lattice; this represents a 100-fold improvement over previous results. This lifetime is also limited by off-resonant scattering, the rate of which is related to the size of the Feshbach molecule. Individually trapped Feshbach molecules in the 3D lattice can be converted to pairs of K and Rb atoms and back with nearly 100% efficiency.

  16. Neural Network Based Reconstruction of a 3D Object from a 2D Wireframe

    CERN Document Server

    Johnson, Kyle; Lipson, Hod

    2010-01-01

    We propose a new approach for constructing a 3D representation from a 2D wireframe drawing. A drawing is simply a parallel projection of a 3D object onto a 2D surface; humans are able to recreate mental 3D models from 2D representations very easily, yet the process is very difficult to emulate computationally. We hypothesize that our ability to perform this construction relies on the angles in the 2D scene, among other geometric properties. Being able to reproduce this reconstruction process automatically would allow for efficient and robust 3D sketch interfaces. Our research focuses on the relationship between 2D geometry observable in the sketch and 3D geometry derived from a potential 3D construction. We present a fully automated system that constructs 3D representations from 2D wireframes using a neural network in conjunction with a genetic search algorithm.

  17. “3D Turtle Graphics” by using a 3D Printer

    Directory of Open Access Journals (Sweden)

    Yasusi Kanada

    2015-04-01

    Full Text Available When creating shapes by using a 3D printer, usually, a static (declarative model designed by using a 3D CAD system is translated to a CAM program and it is sent to the printer. However, widely-used FDM-type 3D printers input a dynamical (procedural program that describes control of motions of the print head and extrusion of the filament. If the program is expressed by using a programming language or a library in a straight manner, solids can be created by a method similar to turtle graphics. An open-source library that enables “turtle 3D printing” method was described by Python and tested. Although this method currently has a problem that it cannot print in the air; however, if this problem is solved by an appropriate method, shapes drawn by 3D turtle graphics freely can be embodied by this method.

  18. Evaluación de la inmunogenicidad de un péptido sintético de la hemoglobina S en ratones BALB/c

    Directory of Open Access Journals (Sweden)

    Isis Amores Sánchez

    2004-01-01

    Full Text Available La anemia de células falciformes es la enfermedad sanguínea hereditaria más frecuente y es provocada por un tipo anormal de hemoglobina, la S. Su incidencia es elevada en la población mundial, siendo de 1 : 40 en África, de 1 : 400 en la población negra americana y de forma general de 8 en 100 000 personas. Persiste durante toda la vida y el tratamiento está dirigido a prevenir los síntomas y a proteger de infecciones al paciente. Debido a la gran similitud entre la hemoglobina A y la S se dificulta la obtención de anticuerpos monoclonales específicos, por eso se sintetizó un péptido correspondiente a una zona de diferenciación entre la hemoglobina A y la S. En este trabajo se evaluó la respuesta inmunológica en ratones BALB/c, del péptido sintético, como control se empleó un péptido sintético de la hemoglobina A. La conjugación se realizó mediante el método del glutaraldehído y se emplearon dos proteínas portadoras (seroalbúmina bovina o tiroglobulina bovina. Para la inmunización se emplearon dosis de 50, 60 y 80 µg/mL en los peptidos conjugados con seroalbúmina bovina y 60 µg/mL en los péptidos conjugados con tiroglobulina bovina. Los títulos más elevados se obtuvieron cuando se empleó el péptido conjugado con seroalbúmina bovina y se inmunizó con 50 µg/mL .

  19. Leishmania mexicana: aspectos taxonómicos y rareza de la infección humana en Três Braços, Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    César Augusto Cuba Cuba

    1984-09-01

    Full Text Available Del estúdio de 51 stocks de Leishmania aislados de pacientes humanos de leishmaniasis cutaneomucosa en Três Braços, Bahia, Brasil, los autores describen, en detalle, el análisis de los dos únicos stocks de L. mexicana, identificando uno de ellos como L. mexicana amazonensis. El otro aislado permanece en posición taxonómica no definida pues considerándosele como un miembro de L. mexicana, encuéntranse dificultades para su identificación subespecífica. Evaluan también los parâmetros biológicos e isoenzimáticos y discuten el papel de los anticuerpos monoclonales en la tipificación de éstos stocks. Los autores remarcan la rareza de la transmisión de parásitos del complejo L. mexicana en esta región, aun cuando estudien epidemiológicamente por mais de 8 anos la infección humana.In a study of 51 stocks of Leishmania isolated from patients with cutaneous leishmaniasis in Três Braços, Bahia, Brazil 49 were characterized as L. braziliensis braziliensis. Only two L. mexicana stocks were identified. One was subspeciated as L. mexicana amazonensis. The other differed from this species and to date remains unspeciated. The biological parameters, isoenzyme analysis and monoclonal antibody findings relating to these two strains are discussed. Transmission of parasites of the mexicana complex to man have been rare in this region during the 8 years of study of the human infection.

  20. Procedimientos para la obtención de reactivos biológicos de los estuches DAVIH Ag P24 y DAVIH Ac P24

    Directory of Open Access Journals (Sweden)

    Nancy M. Ruiz

    2003-09-01

    Full Text Available La pandemia de SIDA es uno de los problemas actuales más graves que afectan a la humanidad. Como todavía no se cuenta con una vacuna efectiva a pesar de los esfuerzos realizados por científicos en todo el mundo, la utilización de drogas antirretrovirales para mejorar la calidad de vida de los pacientes es lo que ha resultado más exitoso, de ahí la importancia de poseer medios para realizar un diagnóstico temprano de la infección y para monitorear su progresión con el objetivo de poder actuar sobre ella. El presente trabajo describe la obtención de los componentes biológicos que se requieren para la producción de dos estuches que se utilizan en nuestro país en todos los estudios que tienen relación con la infección VIH-SIDA. Para ello se realizó un protocolo que incluyó varias etapas de purificación e inmovilización de diferentes moléculas. Como resultado se obtuvieron la proteína de 24 Kd del VIH-1 y anticuerpos monoclonales y policlonales humanos contra esta proteína, con adecuados grados de pureza y actividad biológica. La combinación de etapas en este protocolo, permitió ir obteniendo productos que además de utilizarse en la etapa siguiente también por sí mismos, algunos de ellos, constituyeron reactivos de los estuches.

  1. Definición de una estrategia de transición de la arquitectura empresarial en un entorno industrial-biotecnológico

    Directory of Open Access Journals (Sweden)

    Raimundo Llerena Ferrer

    2015-07-01

    Full Text Available El cambio es una condición no solo presente, sino necesaria a niveles estratégicos y operacionales. Sin embargo, transformar una organización es una tarea compleja. Tomar decisiones que garanticen una satisfactoria evolución tecnológica y organizacional sin una estrategia que guíe el desarrollo de la arquitectura empresarial, resulta una tarea ardua y con pocas probabilidades de éxito. El sector industrial-biotecnológico cubano no escapa a esta realidad y se enfrenta a grandes retos en su empeño de aumentar la productividad y la eficiencia a partir del descubrimiento de conocimiento proveniente del análisis de la data de sus procesos. Este trabajo propone un modelo que guía la ejecución de proyectos para la definición de una estrategia de transición de la arquitectura empresarial y muestra los resultados de su validación mediante un método de expertos, así como los de su aplicación con altos niveles de satisfacción en una planta de producción de anticuerpos monoclonales. Hecho que posibilitó la obtención de una estrategia concreta y bien detallada para la implementación de una plataforma organizacional y tecnológica capaz de registrar, integrar y analizar con un alto nivel de detalle la información de sus procesos productivos medulares.

  2. Ultrarapid Detection of Pathogenic Bacteria Using a 3D Immunomagnetic Flow Assay

    OpenAIRE

    Lee, Wonjae; Kwon, Donghoon; Chung, Boram; Jung, Gyoo Yeol; Au, Anthony; Folch, Albert; Jeon, Sangmin

    2014-01-01

    We developed a novel 3D immunomagnetic flow assay for the rapid detection of pathogenic bacteria in a large-volume food sample. Antibody-functionalized magnetic nanoparticle clusters (AbMNCs) were magnetically immobilized on the surfaces of a 3D-printed cylindrical microchannel. The injection of a Salmonella-spiked sample solution into the microchannel produced instant binding between the AbMNCs and the Salmonella bacteria due to their efficient collisions. Nearly perfect capture of the AbMNC...

  3. Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.

    Science.gov (United States)

    Huether, Robert; Liu, Zhi-Jie; Xu, Hao; Wang, Bi-Cheng; Pletnev, Vladimir Z; Mao, Qilong; Duax, William L; Umland, Timothy C

    2010-02-15

    We have identified a highly conserved fingerprint of 40 residues in the TGYK subfamily of the short-chain oxidoreductase enzymes. The TGYK subfamily is defined by the presence of an N-terminal TGxxxGxG motif and a catalytic YxxxK motif. This subfamily contains more than 12,000 members, with individual members displaying unique substrate specificities. The 40 fingerprint residues are critical to catalysis, cofactor binding, protein folding, and oligomerization but are substrate independent. Their conservation provides critical insight into evolution of the folding and function of TGYK enzymes. Substrate specificity is determined by distinct combinations of residues in three flexible loops that make up the substrate-binding pocket. Here, we report the structure determinations of the TGYK enzyme A3DFK9 from Clostridium thermocellum in its apo form and with bound NAD(+) cofactor. The function of this protein is unknown, but our analysis of the substrate-binding loops putatively identifies A3DFK9 as a carbohydrate or polyalcohol metabolizing enzyme. C. thermocellum has potential commercial applications because of its ability to convert biomaterial into ethanol. A3DFK9 contains 31 of the 40 TGYK subfamily fingerprint residues. The most significant variations are the substitution of a cysteine (Cys84) for a highly conserved glycine within a characteristic VNNAG motif, and the substitution of a glycine (Gly106) for a highly conserved asparagine residue at a helical kink. Both of these variations occur at positions typically participating in the formation of a catalytically important proton transfer network. An alternate means of stabilizing this proton wire was observed in the A3DFK9 crystal structures.

  4. A 250 GHz Gyrotron with a 3 GHz Tuning Bandwidth for Dynamic Nuclear Polarization

    OpenAIRE

    Barnes, Alexander B.; Nanni, Emilio A.; Herzfeld, Judith; Griffin, Robert G.; Temkin, Richard J.

    2012-01-01

    We describe the design and implementation of a novel tunable 250 GHz gyrotron oscillator with >10 W output power over most of a 3 GHz band and >35 W peak power. The tuning bandwidth and power are sufficient to generate a >1 MHz nutation frequency across the entire nitroxide EPR lineshape for cross effect DNP, as well as to excite solid effect transitions utilizing other radicals, without the need for sweeping the NMR magnetic field. Substantially improved tunability is achieved by implementin...

  5. Minor and Minimum Cycle Bases of a 3-connected Planar Graph

    Institute of Scientific and Technical Information of China (English)

    Deng Ju MA; Han REN

    2009-01-01

    In this paper, we prove that if any set of |E(G)| - |V(G)| + 1 facial cycles of a 3-connected planar graph G embedded in the plane doesn't form a minimum cycle base of G, then any minimum cycle base of G contains a separating cycle, and G has a minor isomorphic to T6, where T6 is the graph obtained from the complete graph Kg by deleting a path with four edges.

  6. Dystonia as acute adverse reaction to cough suppressant in a 3-year-old girl.

    Science.gov (United States)

    Polizzi, A; Incorpora, G; Ruggieri, M

    2001-01-01

    Cough suppressant preparations containing mixtures of dextromethorphan or codeine with antihistamines, decongestants (sympathomimetic), expectorants and antipyretics with either sedative or anticholinergic activity have been associated with dystonic reactions in children. We report on a 3-year-old girl who presented with episodic stiffness and abnormal posturing with rigidity after arbitrary maternal administration of a mixture of methylcodeine and extract from Hedera plant. PMID:11587381

  7. Bulk density estimation using a 3-dimensional image acquisition and analysis system

    Directory of Open Access Journals (Sweden)

    Heyduk Adam

    2016-01-01

    Full Text Available The paper presents a concept of dynamic bulk density estimation of a particulate matter stream using a 3-d image analysis system and a conveyor belt scale. A method of image acquisition should be adjusted to the type of scale. The paper presents some laboratory results of static bulk density measurements using the MS Kinect time-of-flight camera and OpenCV/Matlab software. Measurements were made for several different size classes.

  8. Stiffness Model of a 3-DOF Parallel Manipulator with Two Additional Legs

    OpenAIRE

    Yu, Guang; Wu, Jun; Wang, Liping

    2014-01-01

    This paper investigates the stiffness modelling of a 3-DOF parallel manipulator with two additional legs. The stiffness model in six directions of the 3-DOF parallel manipulator with two additional legs is derived by performing condensation of DOFs for the joint connection and treatment of the fixed-end connections. Moreover, this modelling method is used to derive the stiffness model of the manipulator with zero/one additional legs. Two performance indices are given to compare the stiffness ...

  9. Analysis of the Kinematic Accuracy Reliability of a 3-DOF Parallel Robot Manipulator

    OpenAIRE

    Cui, Guohua; Zhang, Haiqiang; Zhang, Dan; Xu, Feng

    2015-01-01

    Kinematic accuracy reliability is an important performance index in the evaluation of mechanism quality. By using a 3- DOF 3-PUU parallel robot manipulator as the research object, the position and orientation error model was derived by mapping the relation between the input and output of the mechanism. Three error sensitivity indexes that evaluate the kinematic accuracy of the parallel robot manipulator were obtained by adapting the singular value decomposition of the error translation matrix...

  10. Multiobjective Optimum Design of a 3-RRR Spherical Parallel Manipulator with Kinematic and Dynamic Dexterities

    OpenAIRE

    Guanglei Wu

    2012-01-01

    This paper deals with the kinematic synthesis problem of a 3-underlineRRR spherical parallel manipulator, based on the evaluation criteria of the kinematic, kinetostatic and dynamic performances of the manipulator. A multiobjective optimization problem is formulated to optimize the structural and geometric parameters of the spherical parallel manipulator. The proposed approach is illustrated with the optimum design of a special spherical parallel manipulator with unlimited rolling motion. The...

  11. A 3-D Model of Signaling and Transport Pathways in Epithelial Cells

    Energy Technology Data Exchange (ETDEWEB)

    Quong, A A; Westbrook, C K

    2005-04-01

    A 3-dimensional computer model was developed to simulate the spatial and chemical evolution of calcium ions inside an array of human epithelial kidney cells. This is a prototype model, intended to develop a methodology to incorporate much more complex interactions of metabolic and other processes within many types of cells and lead to increased ability to predict cellular responses to disease as well as to chemical and biological warfare situations. Preliminary tests of the model are described.

  12. A customized bolus produced using a 3-dimensional printer for radiotherapy.

    Directory of Open Access Journals (Sweden)

    Shin-Wook Kim

    Full Text Available OBJECTIVE: Boluses are used in high-energy radiotherapy in order to overcome the skin sparing effect. In practice though, commonly used flat boluses fail to make a perfect contact with the irregular surface of the patient's skin, resulting in air gaps. Hence, we fabricated a customized bolus using a 3-dimensional (3D printer and evaluated its feasibility for radiotherapy. METHODS: We designed two kinds of bolus for production on a 3D printer, one of which was the 3D printed flat bolus for the Blue water phantom and the other was a 3D printed customized bolus for the RANDO phantom. The 3D printed flat bolus was fabricated to verify its physical quality. The resulting 3D printed flat bolus was evaluated by assessing dosimetric parameters such as D1.5 cm, D5 cm, and D10 cm. The 3D printed customized bolus was then fabricated, and its quality and clinical feasibility were evaluated by visual inspection and by assessing dosimetric parameters such as Dmax, Dmin, Dmean, D90%, and V90%. RESULTS: The dosimetric parameters of the resulting 3D printed flat bolus showed that it was a useful dose escalating material, equivalent to a commercially available flat bolus. Analysis of the dosimetric parameters of the 3D printed customized bolus demonstrated that it is provided good dose escalation and good contact with the irregular surface of the RANDO phantom. CONCLUSIONS: A customized bolus produced using a 3D printer could potentially replace commercially available flat boluses.

  13. Using graphical attributes to influence the perception of safety in a 3D environment

    OpenAIRE

    Karlsson, Julia

    2016-01-01

    Context. Most games make use of graphics to create an environment that fits the mood they wish to convey. To use a game's graphical attributes such as colour, shape and texture to their utmost ability, knowing how these are perceived could help. Objective. This paper tries to determine how graphical attributes such as colour, texture, and shapes affect the perceived safety of a path inside a 3d environment. Method. To reach the objective, an experiment was conducted with 20 participants. The ...

  14. A 3D multilevel model of damage and strength of wood: Analysis of microstructural effects

    DEFF Research Database (Denmark)

    Qing, Hai; Mishnaevsky, Leon

    2011-01-01

    A 3D hierarchical computational model of damage and strength of wood is developed. The model takes into account the four scale microstructures of wood, including the microfibril reinforced structure at nanoscale, multilayered cell walls at microscale, hexagon-shape-tube cellular structure...... arrangements and cellulose strength distributions on the tensile strength of wood is studied numerically. Good agreement of the theoretical results with experimental data has been obtained....

  15. Solution regions in the parameter space of a 3-RRR decoupled robot for a prescribed workspace

    CERN Document Server

    Chablat, Damien; Arakelian, Vigen; Briot, Sébastien; Wenger, Philippe

    2012-01-01

    This paper proposes a new design method to determine the feasible set of parameters of translational or position/orientation decoupled parallel robots for a prescribed singularity-free workspace of regular shape. The suggested method uses Groebner bases to define the singularities and the cylindrical algebraic decomposition to characterize the set of parameters. It makes it possible to generate all the robot designs. A 3-RRR decoupled robot is used to validate the proposed design method.

  16. Predictors of reading development in deaf children: A 3-year longitudinal study

    OpenAIRE

    Kyle, F. E.; Harris, M

    2010-01-01

    The development of reading ability in a group of deaf children was followed over a 3-year period. A total of 29 deaf children (7–8 years of age at the first assessment) participated in the study, and every 12 months they were given a battery of literacy, cognitive, and language tasks. Earlier vocabulary and speechreading skills predicted longitudinal growth in reading achievement. The relations between reading and the predictor variables showed developmental change. Earlier reading ability wa...

  17. Air-structured optical fibre drawn from a 3D-printed preform

    CERN Document Server

    Cook, Kevin; Leon-Saval, Sergio; Reid, Zane; Hossain, Md Arafat; Comatti, Jade-Edouard; Luo, Yanhua; Peng, Gang-Ding

    2016-01-01

    A structured optical fibre is drawn from a 3D-printed structured preform. Preforms containing a single ring of holes around the core are fabricated using filament made from a modified butadiene polymer. More broadly, 3D printers capable of processing soft glasses, silica and other materials are likely to come on line in the not-so distant future. 3D printing of optical preforms signals a new milestone in optical fibre manufacture.

  18. A 3D DISCRETE DUALITY FINITE VOLUME METHOD FOR NONLINEAR ELLIPTIC EQUATIONS

    OpenAIRE

    Coudière, Yves; Hubert, Florence

    2009-01-01

    Discrete Duality Finite Volume (DDFV) schemes have recently been developed in 2D to approximate nonlinear diffusion problems on general meshes. In this paper, a 3D extension of these schemes is proposed. The construction of this extension is detailed and its main properties are proved: a priori bounds, well-posedness and error estimates. The practical implementation of this scheme is easy. Numerical experiments are presented to illustrate its good behavior.

  19. A 3D Model as a Tool for Increasing the Effectiveness of E-Learning

    OpenAIRE

    Valcheva, Donika; Todorova, Margarita; Asenov, Oleg

    2010-01-01

    The paper proposes a 3D model which could be used as a tool for increasing the effectiveness of e-learning. It also offers an approach for applying this 3D model for increasing the effectiveness of e-learning. This approach has methodical value in line with the idea for dynamic adjustment of the individual learning profile of each student in order to increase the personalization level in the e-learning process.

  20. Perfect fluid space-times admitting a 3-dimensional conformal group acting on null orbits

    CERN Document Server

    Sintes, A M

    1997-01-01

    Space-times admitting a 3-dimensional Lie group of conformal motions $C_3$ acting on null orbits are studied. Coordinate expressions for the metric and the conformal Killing vectors (CKV) are then provided (irrespectively of the matter content) and all possible perfect fluid solutions are found, although none of them verifies the weak and dominant energy conditions over the whole space-time manifold.

  1. Building and Evaluating a 3D Scanning System for Measurementsand Estimation of Antennas and Propagation Channels

    OpenAIRE

    Aagaard Fransson, Erik Johannes; Wall-Horgen, Tobias

    2012-01-01

    Wireless communications rely, among other things, on theunderstanding of the properties of the radio propagationchannel, the antennas and their interplay. Adequate measurementsare required to verify theoretical models and togain knowledge of the channel behavior and antenna performance.As a result of this master thesis we built a 3D fieldscanner measurement system to predict multipath propagationand to measure antenna characteristics. The 3Dscanner allows measuring a signal at the point of in...

  2. Cytotoxic purine nucleoside analogues bind to A1, A2A and A3 adenosine receptors

    OpenAIRE

    Jensen, Kyle; Johnson, L’Aurelle A.; Jacobson, Pamala A.; Kachler, Sonja; Kirstein, Mark N.; Lamba, Jatinder; Klotz, Karl-Norbert

    2012-01-01

    Fludarabine, clofarabine and cladribine are anti-cancer agents which are analogues of the purine nucleoside adenosine. These agents have been associated with cardiac and neurological toxicities. Because these agents are analogues of adenosine, they may act through adenosine receptors to elicit their toxic effects. The objective of this study was to evaluate the ability of cytotoxic nucleoside analogues to bind and activate adenosine receptor subtypes (A1, A2A, A2B, and A3). Radioligand bindin...

  3. A 3D Virtual Space for the E-Commerce Strategy Model

    OpenAIRE

    Gong Cheng; Changrui Yu; Kecheng Liu

    2014-01-01

    In recent years, innovative applications of electronic commerce (e-commerce) are facing the challenges of mobile commerce (m-commerce) and ubiquitous commerce (u-commerce). To address these challenges and improve the competitiveness of e-commerce, the three-dimensional e-commerce (3DEC) theory is proposed and a 3DEC business strategy model is built up in this study. The new conceptual 3DEC model incorporates the industrial environment analysis, SWOT analysis, and business model canvas (BMC). ...

  4. Baclofen intoxication after accidental ingestion in a 3-year-old child

    OpenAIRE

    Dasarwar Nagesh; Shanbag Preeti; Kumbhare Nilesh

    2009-01-01

    Baclofen is a skeletal muscle relaxant, used to control spasticity in both adults and children with neuromuscular disorders. Several cases of baclofen overdose have been reported, but only a small number have involved children. We report a 3-year-old girl with accidental ingestion of baclofen, who presented with coma, bradycardia and hypotension. She recovered within 24 hours with supportive treatment. The case emphasizes the importance of warning parents about the potential toxicity of baclo...

  5. Motion Field Estimation for a Dynamic Scene Using a 3D LiDAR

    OpenAIRE

    Qingquan Li; Liang Zhang; Qingzhou Mao; Qin Zou; Pin Zhang; Shaojun Feng; Washington Ochieng

    2014-01-01

    This paper proposes a novel motion field estimation method based on a 3D light detection and ranging (LiDAR) sensor for motion sensing for intelligent driverless vehicles and active collision avoidance systems. Unlike multiple target tracking methods, which estimate the motion state of detected targets, such as cars and pedestrians, motion field estimation regards the whole scene as a motion field in which each little element has its own motion state. Compared to multiple target tracking, seg...

  6. Compliance Modeling and Error Compensation of a 3-Parallelogram Lightweight Robotic Arm

    DEFF Research Database (Denmark)

    Wu, Guanglei; Guo, Sheng; Bai, Shaoping

    2015-01-01

    This paper presents compliance modeling and error compensation for lightweight robotic arms built with parallelogram linkages, i.e., Π joints. The Cartesian stiffness matrix is derived using the virtual joint method. Based on the developed stiffness model, a method to compensate the compliance...... error is introduced, being illustrated with a 3-parallelogram robot in the application of pick-and-place operation. The results show that this compensation method can effectively improve the operation accuracy....

  7. Development of a 3-electrode system for gas phase dynamic electrochemistry

    OpenAIRE

    Fowowe, T.

    2011-01-01

    The principles of potentiometry from liquid phase electrochemistry have already been applied to the gas phase by considering a flame as an ionised gaseous environment which can behave as a dilute electrolyte. This study focused on the design, construction and optimisation of a 3-electrode electrochemical cell for direct electron transfer in the gas phase. Three electrochemical cells were developed with the final design deemed satisfactory to conduct electrochemical measureme...

  8. A 3D Osteoblast In Vitro Model for the Evaluation of Biomedical Materials

    OpenAIRE

    Luciana Restle; Daniela Costa-Silva; Emanuelle Stellet Lourenço; Rober Freitas Bachinski; Ana Carolina Batista; Adriana Brandão Ribeiro Linhares; Gutemberg Gomes Alves

    2015-01-01

    Biomedical materials for bone therapy are usually assessed for their biocompatibility and safety employing animal models or in vitro monolayer cell culture assays. However, alternative in vitro models may offer controlled conditions closer to physiological responses and reduce animal testing. In this work, we developed a 3D spheroidal cell culture with potential to evaluate simultaneously material-cell and cell-cell interactions. Different cell densities of murine MC3T3-E1 preosteoblasts or h...

  9. Update on SLC26A3 Mutations in Congenital Chloride Diarrhea

    OpenAIRE

    Wedenoja, Satu; Pekansaari, Elina; Hoglund, Pia; Mäkelä, Siru; Holmberg, Christer; Kere, Juha

    2011-01-01

    Abstract Congenital chloride diarrhea (CLD) is an autosomal recessive disorder with around 250 cases reported so far. Life-long secretory diarrhea is caused by mutations in the solute carrier family 26 member 3 (SLC26A3) gene disrupting the epithelial Cl-/HCO3- transport in the ileum and colon. Although salt substitution allows favorable outcome, possible manifestations include renal impairment, intestinal inflammation, and male infertility. At least 55 mutations, of which 21 (38%)...

  10. Traumatic posterior dislocation of the hip in a 3-year-old child.

    LENUS (Irish Health Repository)

    Forde, James C

    2012-02-01

    We report the case of a traumatic posterior dislocation of the hip in a 3-year-old boy. After a fall in the garden, the boy was brought to our emergency department where an x-ray confirmed a posterior dislocation of his right hip. A successful prompt reduction was performed in the operating room under general anesthesia. This uncommon injury represents an orthopedic emergency and requires prompt reduction to lessen the risk of complications including avascular necrosis of the femoral head.

  11. Understanding Persistence: A 3D Trap Map of an H2RG Imaging Sensor

    CERN Document Server

    Anderson, Rachel E; Valenti, Jeff; Bergeron, Eddie

    2014-01-01

    Several theories exist to explain persistence, most of which revolve around the distribution of traps. We aim to simulate persistence and illustrate this complex issue with a 3D trap map. For this experiment, we vary the detector voltage bias to simulate the change in the depletion region that occurs when the detector is exposed to light. This allows us to measure the distribution of traps in the depletion region. This paper will explore the results from this experiment and discuss the implications.

  12. Caries risk assessment in young adults: a 3 year validation of the Cariogram model

    OpenAIRE

    Petersson, Gunnel Hänsel; Twetman, Svante

    2015-01-01

    Background To validate baseline caries risk classifications according to the Cariogram model with the actual caries development over a 3-year period in a group of young adults living in Sweden. Methods The study group consisted of 1,295 19-year-old patients that completed a comprehensive clinical baseline examination, including radiographs and salivary tests. An individual caries risk profile was computed and the patient was placed in one of five risk categories. After 3 years, 982 patients (...

  13. Nephrotic Syndrome Following H1N1 Influenza in a 3-Year-Old Boy

    OpenAIRE

    Pio Liberatore; Francesca del Bufalo; Giorgia Bottaro; Pietro Ferrara; Antonio Gatto; Ottavio Vitelli

    2012-01-01

    Background: The pandemic influenza A/H1N1, spread through the world in 2009, producing a serious epidemic in Italy. Complications are generally limited to patients at the extremes of age (65 years) and those with comorbid medical illness. The most frequent complications of influenza involve the respiratory system.Case Presentation: A 3-year-old boy with a recent history of upper respiratory tract infection developed a nephrotic syndrome. Together with prednisone, furosemide and albumin bolus,...

  14. Internal joint forces in dynamics of a 3-PRP planar parallel robot

    OpenAIRE

    Staicu, Stefan; Chablat, Damien

    2012-01-01

    Recursive matrix relations for the complete dynamics of a 3-PRP planar parallel robot are established in this paper. Three identical planar legs connecting to the moving platform are located in the same vertical plane. Knowing the motion of the platform, we develop first the inverse kinematical problem and determine the positions, velocities and accelerations of the robot. Further, the inverse dynamic problem is solved using an approach based on the principle of virtual work. Finally, some gr...

  15. Anisotropic thermal expansion of a 3D metal–organic framework with hydrophilic and hydrophobic pores

    International Nuclear Information System (INIS)

    A 3D flexible metal–organic framework (MOF) with 1D hydrophilic and hydrophobic pores shows anisotropic thermal expansion with relatively large thermal expansion coefficient (αa=−21×10−6 K−1 and αc=79×10−6 K−1) between 133 K and 383 K. Temperature change gives deformation of both pores, which expand in diameter and elongate in length on cooling and vice versa. The thermally induced structural change should be derived from a unique framework topology like “lattice fence”. Silica accommodation changes not only the nature of the MOF but also thermal responsiveness of the MOF. Since the hydrophobic pores in the material are selectively blocked by the silica, the MOF with the silica is considered as a hydrophilic microporous material. Furthermore, inclusion of silica resulted in a drastic pore contraction in diameter and anisotropically changed the thermal responsiveness of the MOF. - Graphical abstract: A 3D metal–organic framework with hydrophilic and hydrophobic pores shows anisotropic thermal expansion behavior. The influence of silica filler in the hydrophobic pore was investigated. - Highlights: • Thermally induced structural change of a 3D MOF with a lattice fence topology was investigated. • The structural change was analyzed by synchrotron X-ray diffraction patterns. • Temperature change induces anisotropic thermal expansion/contraction of the MOF. • Silica inclusion anisotropically changes the thermal responsiveness of the MOF

  16. DRD2 and SLC6A3 moderate impact of maternal depressive symptoms on infant cortisol.

    Science.gov (United States)

    Ludmer, Jaclyn A; Levitan, Robert; Gonzalez, Andrea; Kennedy, James; Villani, Vanessa; Masellis, Mario; Basile, Vincenzo S; Atkinson, Leslie

    2015-12-01

    Both maternal depressive symptoms and infants' dopamine-related genetic characteristics have been linked to infants' hypothalamic-pituitary-adrenal (HPA) functioning. This study investigated the interactive influence of maternal depressive symptoms and infant DRD2 and SLC6A3 genotypes on infant cortisol reactivity; whether this interaction reflects diathesis-stress or differential susceptibility; and whether this interaction influences the flexibility of the infant cortisol response across challenges known to exert differential effects on infant cortisol reactivity. A community sample of 314 mother-infant dyads participated in toy frustration (age 16 months) and maternal separation (age 17 months) challenges, and salivary cortisol was collected at baseline, +20, and +40min. Maternal depressive symptoms were assessed with the Beck Depression Inventory-II at infant age 16 months. Infant buccal cells were collected at both time points for genotyping. DRD2 and SLC6A3 genotypes moderated the relation between maternal depressive symptomatology and infant cortisol reactivity in a diathesis-stress manner in the context of toy frustration, and in a differential susceptibility manner in the context of maternal separation. Higher levels of maternal depressive symptoms predicted reduced cortisol flexibility across challenges for infants with at least one A1 allele of DRD2 and infants with the 10/10 genotype of SLC6A3. Results suggest that maternal depressive symptomatology is related to infants' cortisol reactivity and to the flexibility of that reactivity across psychosocial challenges, but this relation is dependent on the infant's genetic characteristics.

  17. A novel de novo mutation in ATP1A3 and childhood-onset schizophrenia.

    Science.gov (United States)

    Smedemark-Margulies, Niklas; Brownstein, Catherine A; Vargas, Sigella; Tembulkar, Sahil K; Towne, Meghan C; Shi, Jiahai; Gonzalez-Cuevas, Elisa; Liu, Kevin X; Bilguvar, Kaya; Kleiman, Robin J; Han, Min-Joon; Torres, Alcy; Berry, Gerard T; Yu, Timothy W; Beggs, Alan H; Agrawal, Pankaj B; Gonzalez-Heydrich, Joseph

    2016-09-01

    We describe a child with onset of command auditory hallucinations and behavioral regression at 6 yr of age in the context of longer standing selective mutism, aggression, and mild motor delays. His genetic evaluation included chromosomal microarray analysis and whole-exome sequencing. Sequencing revealed a previously unreported heterozygous de novo mutation c.385G>A in ATP1A3, predicted to result in a p.V129M amino acid change. This gene codes for a neuron-specific isoform of the catalytic α-subunit of the ATP-dependent transmembrane sodium-potassium pump. Heterozygous mutations in this gene have been reported as causing both sporadic and inherited forms of alternating hemiplegia of childhood and rapid-onset dystonia parkinsonism. We discuss the literature on phenotypes associated with known variants in ATP1A3, examine past functional studies of the role of ATP1A3 in neuronal function, and describe a novel clinical presentation associated with mutation of this gene. PMID:27626066

  18. Optically Forbidden Transition of A'3△u←X3Σ-g in Oxygen

    Institute of Scientific and Technical Information of China (English)

    ZHU Lin-Fan; XU Wei-Qing; SUN Jian-Min; ZHANG Wen-Yao

    2010-01-01

    @@ The electron energy loss spectra for the valence-shell excitations of oxygen are measured at an incident electron energy of 2500 eV and at scattering angles from 4°to 8.5°.The dipole-forbidden and octupole-allowed transition of the A'3△u←X3Σ-g is observed from the measured spectra,and it is found that the peak profile of the A'3△u←X3Σ-g excitation can be well represented by a Gaussin function.The energy position of 6.007±0.008 eV and Franck-Condon linewidth of 1.312±0.020 eV of the A△u←X3Σ-g,which are independent of the scattering condition,have been determined for the first time.The peak profiles of the A'3△u←X3Σ-g determined in this work provide a possibility to realize the spectral decomposition method of unfolding the Herzberg pseudocontinuum proposed by Campbell et al.[Phys.Rev.A 61 (2000) 022706

  19. Radiative lifetime and quenching constants of the PF(A3II) state

    Science.gov (United States)

    Xu, Jie; Raybone, D.; Setser, Donald W.

    1993-06-01

    The radiative lifetime and the quenching rate constants of the PF(A3PI0,1,2) state have been measured using a microwave discharge to generate PF(X3(Sigma) -) in a flow reactor incorporating laser-induced fluorescence. A radiative lifetime of 4.2 +/- 0.2 microsecond(s) has been determined for a 300 K Boltzmann distribution of rotational and spin- orbit states of PF(A,v' equals 0). The two-body quenching rate constants for PF(A3PI) by diatomic and polyatomic molecules and rare gases were determined at 300 K from the pressure dependence of the first-order decay constants. Electronic quenching by He, Ar, CF4 and SF6 is inefficient and upper limits to these deactivation rate constants are 2 - 4 X 10-14 cm3 molecule-1 s-1. Except for highly fluorinated molecules, the quenching constants for most molecules are in the range of 0.05 - 4.0 X 10-10 cm3 molecule-1 s-1. The available data suggest that the PF(A3$PI0,1,2) state has some promise as a potential UV laser candidate, providing that an efficient excitation method can be discovered.

  20. Anisotropic thermal expansion of a 3D metal–organic framework with hydrophilic and hydrophobic pores

    Energy Technology Data Exchange (ETDEWEB)

    Kondo, Atsushi, E-mail: kondoa@cc.tuat.ac.jp; Maeda, Kazuyuki

    2015-01-15

    A 3D flexible metal–organic framework (MOF) with 1D hydrophilic and hydrophobic pores shows anisotropic thermal expansion with relatively large thermal expansion coefficient (α{sub a}=−21×10{sup −6} K{sup −1} and α{sub c}=79×10{sup −6} K{sup −1}) between 133 K and 383 K. Temperature change gives deformation of both pores, which expand in diameter and elongate in length on cooling and vice versa. The thermally induced structural change should be derived from a unique framework topology like “lattice fence”. Silica accommodation changes not only the nature of the MOF but also thermal responsiveness of the MOF. Since the hydrophobic pores in the material are selectively blocked by the silica, the MOF with the silica is considered as a hydrophilic microporous material. Furthermore, inclusion of silica resulted in a drastic pore contraction in diameter and anisotropically changed the thermal responsiveness of the MOF. - Graphical abstract: A 3D metal–organic framework with hydrophilic and hydrophobic pores shows anisotropic thermal expansion behavior. The influence of silica filler in the hydrophobic pore was investigated. - Highlights: • Thermally induced structural change of a 3D MOF with a lattice fence topology was investigated. • The structural change was analyzed by synchrotron X-ray diffraction patterns. • Temperature change induces anisotropic thermal expansion/contraction of the MOF. • Silica inclusion anisotropically changes the thermal responsiveness of the MOF.

  1. Mapping the Vif-A3G interaction using peptide arrays: a basis for anti-HIV lead peptides.

    Science.gov (United States)

    Reingewertz, Tali H; Britan-Rosich, Elena; Rotem-Bamberger, Shahar; Viard, Mathias; Jacobs, Amy; Miller, Abigail; Lee, Ji Youn; Hwang, Jeeseong; Blumenthal, Robert; Kotler, Moshe; Friedler, Assaf

    2013-06-15

    Human apolipoprotein-B mRNA-editing catalytic polypeptide-like 3G (A3G) is a cytidine deaminase that restricts retroviruses, endogenous retro-elements and DNA viruses. A3G plays a key role in the anti-HIV-1 innate cellular immunity. The HIV-1 Vif protein counteracts A3G mainly by leading A3G towards the proteosomal machinery and by direct inhibition of its enzymatic activity. Both activities involve direct interaction between Vif and A3G. Disrupting the interaction between A3G and Vif may rescue A3G antiviral activity and inhibit HIV-1 propagation. Here, mapping the interaction sites between A3G and Vif by peptide array screening revealed distinct regions in Vif important for A3G binding, including the N-terminal domain (NTD), C-terminal domain (CTD) and residues 83-99. The Vif-binding sites in A3G included 12 different peptides that showed strong binding to either full-length Vif, Vif CTD or both. Sequence similarity was found between Vif-binding peptides from the A3G CTD and NTD. A3G peptides were synthesized and tested for their ability to counteract Vif action. A3G 211-225 inhibited HIV-1 replication in cell culture and impaired Vif dependent A3G degradation. In vivo co-localization of full-length Vif with A3G 211-225 was demonstrated by use of FRET. This peptide has the potential to serve as an anti-HIV-1 lead compound. Our results suggest a complex interaction between Vif and A3G that is mediated by discontinuous binding regions with different affinities.

  2. Down syndrome related muscle hypotonia: association with COL6A3 functional SNP rs2270669

    Directory of Open Access Journals (Sweden)

    Arpita eDey

    2013-04-01

    Full Text Available Down syndrome (DS, the principal cause for intellectual disability, is also associated with hormonal, immunological, and gastrointestinal abnormalities. Muscle hypotonia (MH and congenital heart diseases (CHD are also frequently observed. Collagen molecules are essential components for maintaining muscle integrity and are formed by the assembly of three chains, alpha 1-3. The type VI collagen is crucial for cardiac as well as skeletal muscles. The COL 1 (VI and 2 (VI chains are encoded by genes located at the 21st chromosome and are expected to have higher dosage in individuals with DS. The  3 (VI chain is encoded by the COL6A3 located at the chromosome 2. We hypothesized that apart from COL6A1 and COL6A2, COL6A3 may also have some role in the MH of subjects with DS. To find out the relevance of COL6A3 in DS associated MH and CHD, we genotyped two SNPs in COL6A3, rs2270669 and rs2270668, in individuals with DS. Subjects with DS were recruited based on the Diagnostic and Statistical Manual for Mental Disorders-IV and having trisomy of the 21st chromosome. Parents of individuals with DS and ethnically matched controls were enrolled for comparison. Informed written consent was obtained for participation. Peripheral blood was used for isolation of genomic DNA. Target genetic loci were studied by DNA sequence analysis. Data obtained was subjected to population- as well as family-based statistical analysis. rs2270668 was found to be nonpolymorphic in the studied population. rs2270669 showed significant association of the ‘C’ allele and ‘CC’ genotype with DS probands having MH (P=0.02. Computational analysis showed that rs2270669 may induce structural and functional alterations in the COL 3 (VI. Interaction of COL3 (VI with different proteins, crucial for muscle integrity, was also noticed by computational methods. This pioneering study on COL6A3 with DS related MH thus indicates that rs2270669 ‘C’ could be considered as a

  3. File list: Oth.ALL.20.C16A3PERIOD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.C16A3PERIOD4.AllCell ce10 TFs and others C16A3.4 All cell types SRX22263...9,SRX222638 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.20.C16A3PERIOD4.AllCell.bed ...

  4. File list: Oth.ALL.10.C16A3PERIOD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.10.C16A3PERIOD4.AllCell ce10 TFs and others C16A3.4 All cell types SRX22263...8,SRX222639 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.10.C16A3PERIOD4.AllCell.bed ...

  5. File list: Oth.ALL.05.C16A3PERIOD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.05.C16A3PERIOD4.AllCell ce10 TFs and others C16A3.4 All cell types SRX22263...8,SRX222639 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.05.C16A3PERIOD4.AllCell.bed ...

  6. File list: Oth.ALL.50.C16A3PERIOD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.C16A3PERIOD4.AllCell ce10 TFs and others C16A3.4 All cell types SRX22263...9,SRX222638 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.50.C16A3PERIOD4.AllCell.bed ...

  7. 一例A3血型样本的分子机制%Study of molecular mechanism for a blood sample with A3 phenotype

    Institute of Scientific and Technical Information of China (English)

    梁伟; 杨亮; 梅传亮; 许德义; 邓刚; 贺芸蕾; 刘奕宇; 张哲

    2015-01-01

    Objective To explore the molecular mechanism for a blood sample with mixed-field hemagglutination upon determination of ABO blood group.Methods Serological techniques were employed to identify the erythrocyte phenotype.The A and B antigens were detected by flow cytometry.The preliminary genotype of ABO gene was assayed with sequence-specific primer-polymerase chain reaction (PCR-SSP).Exons 6 and 7 of the ABO gene were amplified with PCR and analyzed by direct sequencing.Haplotypes of the ABO gene were analyzed by cloning sequencing as well.Results The serological reaction pattern has supported an O phenotype when all the tubes were centrifuged for the first time.However, a mixed-field hemagglutination of red blood cells (RBCs) with anti-A antibodies was present after the tube was centrifuged five times later.A antigens were detected on the surface of partial red blood cells of the sample by flow cytometry.PCR-SSP results have shown that the preliminary ABO genotype was A/O.Analysis of the fragments of exons 6 and 7 of the ABO gene has indicated that heterozygosis lied as follows:261G/A, 425T/T, 467C/T, 646A/T, 681A/G, 745C/T, 771C/T, 829A/G, conjecturing the genotype to be A307/O02, which was confirmed by haplotype sequence analysis.Compared with A101 allele, A307 allele has two missense mutations, 467C> T and 745C> T, which have resulted in substitutions Pro156Leu and Arg249Trp in the A glycosyltransferase polypeptide chain.Conclusion A variant allele (A307) has been identified for the first time in mainland China, which is responsible for the formation of A3 phenotype.%目的 研究1例ABO定型时出现混合外观凝集特征个体的分子遗传机制.方法 应用血清学方法和流式细胞术鉴定其ABO红细胞表型,序列特异性引物聚合酶链反应(sequence-specific primerpolymerase chain reaction,PCR-SSP)方法进行ABO基因型的初步检测,对ABO基因第6、7外显子进行聚合酶链反应和DNA序列分析,并进一步通过克隆

  8. Design Evolution and Verification of the A-3 Chemical Steam Generator

    Science.gov (United States)

    Kirchner, Casey K.

    2009-01-01

    Following is an overview of the Chemical Steam Generator system selected to provide vacuum conditions for a new altitude test facility, the A-3 Test Stand at Stennis Space Center (SSC) in Bay St. Louis, MS. A-3 will serve as NASA s primary facility for altitude testing of the J-2X rocket engine, to be used as the primary propulsion device for the upper stages of the Ares launch vehicles. The Chemical Steam Generators (CSGs) will produce vacuum conditions in the test cell through the production and subsequent supersonic ejection of steam into a diffuser downstream of the J-2X engine nozzle exit. The Chemical Steam Generators chosen have a rich heritage of operation at rocket engine altitude test facilities since the days of the Apollo program and are still in use at NASA White Sands Test Facility (WSTF) in New Mexico. The generators at WSTF have been modified to a degree, but are still very close to the heritage design. The intent for the A-3 implementation is to maintain this heritage design as much as possible, making minimal updates only where necessary to substitute for obsolete parts and to increase reliability. Reliability improvements are especially desired because the proposed system will require 27 generators, which is nine times the largest system installed in the 1960s. Improvements were suggested by the original design firm, Reaction Motors, by NASA SSC and NASA WSTF engineers, and by the A-3 test stand design contractor, Jacobs Technology, Inc. (JTI). This paper describes the range of improvements made to the design to date, starting with the heritage generator and the minor modifications made over time at WSTF, to the modernized configuration which will be used at A-3. The paper will discuss NASA s investment in modifications to SSC s E-2 test facility fire a full-scale Chemical Steam Generator in advance of the larger steam system installation at A-3. Risk mitigation testing will be performed in early 2009 at this test facility to verify that the CSGs

  9. Generation of a tumor spheroid in a microgravity environment as a 3D model of melanoma.

    Science.gov (United States)

    Marrero, Bernadette; Messina, Jane L; Heller, Richard

    2009-10-01

    An in vitro 3D model was developed utilizing a synthetic microgravity environment to facilitate studying the cell interactions. 2D monolayer cell culture models have been successfully used to understand various cellular reactions that occur in vivo. There are some limitations to the 2D model that are apparent when compared to cells grown in a 3D matrix. For example, some proteins that are not expressed in a 2D model are found up-regulated in the 3D matrix. In this paper, we discuss techniques used to develop the first known large, free-floating 3D tissue model used to establish tumor spheroids. The bioreactor system known as the High Aspect Ratio Vessel (HARVs) was used to provide a microgravity environment. The HARVs promoted aggregation of keratinocytes (HaCaT) that formed a construct that served as scaffolding for the growth of mouse melanoma. Although there is an emphasis on building a 3D model with the proper extracellular matrix and stroma, we were able to develop a model that excluded the use of matrigel. Immunohistochemistry and apoptosis assays provided evidence that this 3D model supports B16.F10 cell growth, proliferation, and synthesis of extracellular matrix. Immunofluorescence showed that melanoma cells interact with one another displaying observable cellular morphological changes. The goal of engineering a 3D tissue model is to collect new information about cancer development and develop new potential treatment regimens that can be translated to in vivo models while reducing the use of laboratory animals. PMID:19533253

  10. Optimizing illumination in the greenhouse using a 3D model of tomato and a ray tracer.

    Science.gov (United States)

    de Visser, Pieter H B; Buck-Sorlin, Gerhard H; van der Heijden, Gerie W A M

    2014-01-01

    Reduction of energy use for assimilation lighting is one of the most urgent goals of current greenhouse horticulture in the Netherlands. In recent years numerous lighting systems have been tested in greenhouses, yet their efficiency has been very difficult to measure in practice. This simulation study evaluated a number of lighting strategies using a 3D light model for natural and artificial light in combination with a 3D model of tomato. The modeling platform GroIMP was used for the simulation study. The crop was represented by 3D virtual plants of tomato with fixed architecture. Detailed data on greenhouse architecture and lamp emission patterns of different light sources were incorporated in the model. A number of illumination strategies were modeled with the calibrated model. Results were compared to the standard configuration. Moreover, adaptation of leaf angles was incorporated for testing their effect on light use efficiency (LUE). A Farquhar photosynthesis model was used to translate the absorbed light for each leaf into a produced amount of carbohydrates. The carbohydrates produced by the crop per unit emitted light from sun or high pressure sodium lamps was the highest for horizontal leaf angles or slightly downward pointing leaves, and was less for more upward leaf orientations. The simulated leaf angles did not affect light absorption from inter-lighting LED modules, but the scenario with LEDs shining slightly upward (20(°)) increased light absorption and LUE relative to default horizontal beaming LEDs. Furthermore, the model showed that leaf orientation more perpendicular to the string of LEDs increased LED light interception. The combination of a ray tracer and a 3D crop model could compute optimal lighting of leaves by quantification of light fluxes and illustration by rendered lighting patterns. Results indicate that illumination efficiency increases when the lamp light is directed at most to leaves that have a high photosynthetic potential. PMID

  11. Identification of two metallothioneins as novel inhalative coffee allergens cof a 2 and cof a 3.

    Directory of Open Access Journals (Sweden)

    Ulrike Peters

    Full Text Available Dust of green coffee beans is known to be a relevant cause for occupational allergic disorders in coffee industry workers. Recently, we described the first coffee allergen (Cof a 1 establishing an allergenic potential of green coffee dust.Our aim was to identify allergenic components of green coffee in order to enhance inhalative coffee allergy diagnosis.A Coffea arabica pJuFo cDNA phage display library was created and screened for IgE binding with sera from allergic coffee workers. Two further coffee allergens were identified by sequence analysis, expressed in E. coli, and evaluated by Western blots. The prevalence of sensitization to recombinant Cof a 1, Cof a 2, and Cof a 3 and to commercially available extract was investigated by ELISA (enzyme-linked immunosorbent assay respectively CAP (capacity test screening in 18 sera of symptomatic coffee workers.In addition to the previously described chitinase Cof a 1, two Coffea arabica cysteine-rich metallothioneins of 9 and 7 kDa were identified and included in the IUIS Allergen Nomenclature as Cof a 2 and Cof a 3. Serum IgE antibodies to at least one of the recombinant allergens were found in 8 out of 18 symptomatic coffee workers (44%. Only 2 of the analysed sera (11% had reacted previously to the commercial allergy test.In addition to the previously described Cof a 1 we have identified two further coffee proteins to be type I coffee allergens (Cof a 2 and Cof a 3 which may have a relevant potential for the specific diagnosis and/or therapy of coffee allergy.

  12. Going Virtual… or Not: Development and Testing of a 3D Virtual Astronomy Environment

    Science.gov (United States)

    Ruzhitskaya, L.; Speck, A.; Ding, N.; Baldridge, S.; Witzig, S.; Laffey, J.

    2013-04-01

    We present our preliminary results of a pilot study of students' knowledge transfer of an astronomy concept into a new environment. We also share our discoveries on what aspects of a 3D environment students consider being motivational and discouraging for their learning. This study was conducted among 64 non-science major students enrolled in an astronomy laboratory course. During the course, students learned the concept and applications of Kepler's laws using a 2D interactive environment. Later in the semester, the students were placed in a 3D environment in which they were asked to conduct observations and to answers a set of questions pertaining to the Kepler's laws of planetary motion. In this study, we were interested in observing scrutinizing and assessing students' behavior: from choices that they made while creating their avatars (virtual representations) to tools they choose to use, to their navigational patterns, to their levels of discourse in the environment. These helped us to identify what features of the 3D environment our participants found to be helpful and interesting and what tools created unnecessary clutter and distraction. The students' social behavior patterns in the virtual environment together with their answers to the questions helped us to determine how well they understood Kepler's laws, how well they could transfer the concepts to a new situation, and at what point a motivational tool such as a 3D environment becomes a disruption to the constructive learning. Our founding confirmed that students construct deeper knowledge of a concept when they are fully immersed in the environment.

  13. Plexin A3 and turnout regulate motor axonal branch morphogenesis in zebrafish.

    Directory of Open Access Journals (Sweden)

    Rajiv Sainath

    Full Text Available During embryogenesis motor axons navigate to their target muscles, where individual motor axons develop complex branch morphologies. The mechanisms that control axonal branching morphogenesis have been studied intensively, yet it still remains unclear when branches begin to form or how branch locations are determined. Live cell imaging of individual zebrafish motor axons reveals that the first axonal branches are generated at the ventral extent of the myotome via bifurcation of the growth cone. Subsequent branches are generated by collateral branching restricted to their synaptic target field along the distal portion of the axon. This precisely timed and spatially restricted branching process is disrupted in turnout mutants we identified in a forward genetic screen. Molecular genetic mapping positioned the turnout mutation within a 300 kb region encompassing eight annotated genes, however sequence analysis of all eight open reading frames failed to unambiguously identify the turnout mutation. Chimeric analysis and single cell labeling reveal that turnout function is required cell non-autonomously for intraspinal motor axon guidance and peripheral branch formation. turnout mutant motor axons form the first branch on time via growth cone bifurcation, but unlike wild-type they form collateral branches precociously, when the growth cone is still navigating towards the ventral myotome. These precocious collateral branches emerge along the proximal region of the axon shaft typically devoid of branches, and they develop into stable, permanent branches. Furthermore, we find that null mutants of the guidance receptor plexin A3 display identical motor axon branching defects, and time lapse analysis reveals that precocious branch formation in turnout and plexin A3 mutants is due to increased stability of otherwise short-lived axonal protrusions. Thus, plexin A3 dependent intrinsic and turnout dependent extrinsic mechanisms suppress collateral branch

  14. Optimizing illumination in the greenhouse using a 3D model of tomato and a ray tracer

    Directory of Open Access Journals (Sweden)

    Pieter Huibert Bram De Visser

    2014-02-01

    Full Text Available Reduction of energy use for assimilation lighting is one of the most urgent goals of current greenhouse horticulture in the Netherlands. In recent years numerous lighting systems have been tested in greenhouses, yet their efficiency has been very difficult to measure in practice. This simulation study evaluated a number of lighting strategies using a 3D light model for natural and artificial light in combination with a 3D model of tomato. The modeling platform GroIMP was used for the simulation study. The crop was represented by 3D virtual plants of tomato with fixed architecture. Detailed data on greenhouse architecture and lamp emission patterns of different light sources were incorporated in the model. A number of illumination strategies were modeled with the calibrated model. Results were compared to the standard configuration. Moreover, adaptation of leaf angles was incorporated for testing their effect on light use efficiency. A Farquhar photosynthesis model was used to translate the absorbed light for each leaf into a produced amount of carbohydrates. The carbohydrates produced by the crop per unit emitted light from sun or HPS lamps was the highest for horizontal leaf angles or slightly downward pointing leaves, and was less for more upward leaf orientations. The simulated leaf angles did not affect light absorption from inter-lighting LED modules, but the scenario with LEDs shining slightly upward (20° increased light absorption and light use efficiency relative to default horizontal beaming LEDs. Furthermore, the model showed that leaf orientation more perpendicular to the string of LEDs increased LED light interception.The combination of a ray tracer and a 3D crop model could compute optimal lighting of leaves by quantification of light fluxes and illustration by rendered lighting patterns. Results indicate that illumination efficiency increases when the lamp light is directed at most to leaves that have a high photosynthetic

  15. Treatment of AO/OTA 31-A3 intertrochanteric femoral fractures with a percutaneous compression plate

    Directory of Open Access Journals (Sweden)

    Fei Luo

    2014-01-01

    Full Text Available OBJECTIVE: AO/OTA 31-A3 intertrochanteric femoral fractures have completely different fracture line directions and biomechanical characteristics compared with other types of intertrochanteric fractures. The choice of the fixation method has been a focus of dispute among orthopedic trauma surgeons. The purpose of this study was to review the outcomes of these fractures treated with a percutaneous compression plate at our institute. METHOD: Seventeen patients with AO/OTA 31-A3 intertrochanteric femoral fractures were treated with a percutaneous compression plate at our institute from January 2010 to December 2011. The clinical data and imaging results were retrospectively analyzed. RESULTS: The medical complication of popliteal vein thrombosis occurred in one patient. Sixteen patients were followed up for 12 to 21 months. Two patients had malunion and mild pain. Fracture collapse occurred in two patients, with one having head penetration. These two patients had moderate pain. There were no occurrences of nonunion or reoperation. The mean Harris hip score obtained during the last follow-up was 84.1 (61-97. Patients with a poor quality of reduction were more likely to have pain results (p = 0.001. A trend existed toward the presence of a poor quality of reduction (p = 0.05 in patients with a collapse of fracture. Patients with poor preoperative mobility were more likely to have a lower Harris hip score (p = 0.000. CONCLUSION: The percutaneous compression plate is an alternative device for the treatment of AO/OTA 31-A3 intertrochanteric femoral fractures. Good fracture reduction and an ideal placement position of the neck screw are important in the success of the device.

  16. Phase Structure of a 3D Nonlocal U(1) Gauge Theory: Deconfinement by Gapless Matter Fields

    OpenAIRE

    Arakawa, Gaku; Ichinose, Ikuo; Matsui, Tetsuo; Sakakibara, Kazuhiko; Takashima, Shunsuke

    2005-01-01

    In this paper, we study a 3D compact U(1) lattice gauge theory with a variety of nonlocal interactions that simulates the effects of gapless/gapful matter fields. This theory is quite important to investigate the phase structures of QED$_3$ and strongly-correlated electron systems like the 2D quantum spin models, the fractional quantum Hall effect, the t-J model of high-temperature superconductivity. We restrict the nonlocal interactions among gauge variables only to those along the temporal ...

  17. Fabrication of a 3D electrically small antenna using holographic photolithography

    Science.gov (United States)

    Toriz-Garcia, J. J.; Cowling, J. J.; Williams, G. L.; Bai, Q.; Seed, N. L.; Tennant, A.; McWilliam, R.; Purvis, A.; Soulard, F. B.; Ivey, P. A.

    2013-05-01

    We describe the novel fabrication of a 3D electrical small antenna and its subsequent characterization. The patterning of meander lines conformed onto a hemispherical substrate is achieved by 3D holographic photolithography, which uses time-division multiplexing of a series of iteratively optimized computer-generated holograms. The meander lines have a line width of 100 µm and line separation of 400 µm, with a line pitch of 500 µm and a total meander length of 145 mm. The working frequency is found to be 2.06 GHz, with an efficiency of 46%. This work demonstrates a new method for the fabrication of 3D conformal antennas.

  18. It’s all in the Game: A 3D Learning Model for Business Ethics

    OpenAIRE

    Jagger, Suzy; Siala, Haytham; Sloan, Diane

    2015-01-01

    How can we improve business ethics education for the twenty first century? This study evaluates the effectiveness of a visual case exercise in the form of a 3D immersive game given to undergraduate students at two UK Universities as part of a mandatory business ethics module. We propose that due to evolving learning styles, the immersive nature of interactive games lends itself as a vehicle to make the learning of ethics more ‘concrete’ and ‘personal’ and therefore more engaging. To achieve t...

  19. Characteristics and facilities of a 3MW LEU fuelled TRIGA reactor

    International Nuclear Information System (INIS)

    A 3 MW TRIGA reactor fuelled with low enriched uranium having 19.7 % U-235 and 20 wt% Uranium and Zirconium Hydride, has been installed and recently made critical at a research laboratory of the Bangladesh Atomic Energy Commission. This paper describes the basic design, low and high power test results and the facilities of the reactor. The details of the core configuration of the initial criticality with 50 elements and the final core with 100 elements at 3 MW power are discussed. The available experimental facilities are also described briefly. (author)

  20. Multiobjective Optimum Design of a 3-RRR Spherical Parallel Manipulator with Kinematic and Dynamic Dexterities

    Directory of Open Access Journals (Sweden)

    Guanglei Wu

    2012-07-01

    Full Text Available This paper deals with the kinematic synthesis problem of a 3-underlineRRR spherical parallel manipulator, based on the evaluation criteria of the kinematic, kinetostatic and dynamic performances of the manipulator. A multiobjective optimization problem is formulated to optimize the structural and geometric parameters of the spherical parallel manipulator. The proposed approach is illustrated with the optimum design of a special spherical parallel manipulator with unlimited rolling motion. The corresponding optimization problem aims to maximize the kinematic and dynamic dexterities over its regular shaped workspace.

  1. Face Recognition and Growth Prediction using a 3D Morphable Face Model

    OpenAIRE

    Scherbaum, Kristina

    2007-01-01

    We present two different techniques and applications that are based on the 3D Morphable Face Model. In the first part of this thesis, we develop a new top-down approach to 3D data analysis by fitting a 3D Morphable Face Model to 3D scans of faces. The algorithm is specifically designed for scans which were recorded in a perspective projection. In an analysis-by-synthesis approach, shape, texture, pose and illumination are optimized simultaneously. Starting from raw 3D s...

  2. Incorporating a 3-dimensional printer into the management of early-stage cervical cancer.

    Science.gov (United States)

    Baek, Min-Hyun; Kim, Dae-Yeon; Kim, Namkug; Rhim, Chae Chun; Kim, Jong-Hyeok; Nam, Joo-Hyun

    2016-08-01

    We used a 3-dimensional (3D) printer to create anatomical replicas of real lesions and tested its application in cervical cancer. Our study patient decided to undergo radical hysterectomy after seeing her 3D model which was then used to plan and simulate this surgery. Using 3D printers to create patient-specific 3D tumor models may aid cervical cancer patients make treatment decisions. This technology will lead to better surgical and oncological outcomes for cervical cancer patients. J. Surg. Oncol. 2016;114:150-152. © 2016 Wiley Periodicals, Inc. PMID:27222318

  3. Retrieval and Clustering from a 3D Human Database based on Body and Head Shape

    CERN Document Server

    Godil, Afzal

    2011-01-01

    In this paper, we describe a framework for similarity based retrieval and clustering from a 3D human database. Our technique is based on both body and head shape representation and the retrieval is based on similarity of both of them. The 3D human database used in our study is the CAESAR anthropometric database which contains approximately 5000 bodies. We have developed a web-based interface for specifying the queries to interact with the retrieval system. Our approach performs the similarity based retrieval in a reasonable amount of time and is a practical approach.

  4. Design of a 3rd order micro power switched current ΣΔ-modulator

    DEFF Research Database (Denmark)

    Jørgensen, Ivan Harald Holger; Bogason, Gudmundur

    1996-01-01

    This paper reports the design of a 3rd order switched current-ΣΔ-modulator. The modulator is design to have a SNR of 80 dB with a signal bandwidth of fb=6 kHz. The oversampling ratio is R=90 and the sampling frequency fs=1.08 MHz. Multiple input signals are used to reduce the internal signal swings...... supply voltage is VDD=2.7 V. A new methology is presented that allows for optimization of SI circuits for minimum power consumption with respect to process tolerances...

  5. Effects of a 3-year intervention: The Copenhagen School Child Intervention Study

    DEFF Research Database (Denmark)

    Bugge, Anna; El-Naaman, Bianca; Dencker, Magnus;

    2012-01-01

    INTRODUCTION: This study assessed short and long term effects of a 3-year controlled school-based physical activity (PA) intervention on fatness, cardiorespiratory fitness (VO2peak) and cardiovascular disease (CVD) risk factors in children. METHODS: The study involved 18 schools (10 intervention ...... and HOMA-score in boys, but not in PA, VO2peak, fatness and the other measured CVD risk factors. Our results indicate that a doubling of physical education and providing training and equipment may not be sufficient to induce mayor improvements in CVD risk factors in a normal population....

  6. A 3D DEM-LBM approach for the assessment of the quick condition for sands

    Science.gov (United States)

    Mansouri, M.; Delenne, J.-Y.; El Youssoufi, M. S.; Seridi, A.

    2009-09-01

    We present a 3D numerical model to assess the quick condition (the onset of the boiling phenomenon) in a saturated polydisperse granular material. We use the Discrete Element Method (DEM) to study the evolution of the vertical intergranular stress in a granular sample subjected to an increasing hydraulic gradient. The hydrodynamic forces on the grains of the sample are computed using the Lattice Boltzmann Method (LBM). The principal assumption used is that grains remain at rest until the boiling onset. We show that the obtained critical hydraulic gradient is close to that defined in classical soil mechanics. To cite this article: M. Mansouri et al., C. R. Mecanique 337 (2009).

  7. Suspected disseminated histiocytic sarcoma in a 3-year-old Perro de Presa Canario dog.

    Science.gov (United States)

    Denstedt, Emily

    2014-02-01

    A 3-year-old intact male Perro de Presa Canario dog was presented with acutely inflamed and edematous right hind limb, scrotum, prepuce, and an enlarged left carpus. Two weeks later the dog returned with weight loss, draining tracts in the right hind limb, dermal nodules, a palpable abdominal mass, and uveitis in the left eye. The dog succumbed to his illness 2 days later and a widely disseminated round cell tumor compatible with histiocytic sarcoma was diagnosed following postmortem examination. PMID:24489399

  8. SLC45A3-ELK4 Chimera in Prostate Cancer: Spotlight on Cis-Splicing

    OpenAIRE

    Kumar-Sinha, Chandan; Kalyana-Sundaram, Shanker; Chinnaiyan, Arul M.

    2012-01-01

    Using a series of detailed experiments, Zhang et al establish that the prostate cancer RNA chimera SLC45A3-ELK4 is generated by cis-splicing between the two adjacent genes and does not involve DNA rearrangements or trans-splicing. The chimera expression is induced by androgen treatment likely by overcoming the read-through block imposed by the intergenic CCCTC-insulators bound by CTCF repressor protein. The chimeric transcript, but not wild type ELK4, is shown to augment prostate cancer cell ...

  9. Using a robot head with a 3D face mask as a communication medium for telepresence

    OpenAIRE

    Gudmandsen, Magnus

    2015-01-01

    This thesis investigates the viability of a new communication medium for telepresence, namely a robotic head with a 3D face mask. In order to investigate this, a program was developed for an existing social robot, enabling the robot to be used as a device reflecting the facial movements of the operator. A study is performed with the operator located in front of a computer with a web camera, connected to speak through the robot to two interlocutors located in a room with the robot. This setup ...

  10. New ATP-binding cassette A3 mutation causing surfactant metabolism dysfunction pulmonary type 3.

    Science.gov (United States)

    Piersigilli, Fiammetta; Peca, Donatella; Campi, Francesca; Corsello, Mirta; Landolfo, Francesca; Boldrini, Renata; Danhaive, Olivier; Dotta, Andrea

    2015-10-01

    Respiratory distress syndrome (RDS) may occur in term and near-term infants because of mutations in surfactant-related genes. ATP-binding cassette A3 (ABCA3), a phospholipid carrier specifically expressed in the alveolar epithelium, is the most frequently involved protein. We report the case of a couple of late-preterm fraternal twin infants of opposite sex carrying the same compound heterozygous ABCA3 mutations, one of which has never been previously reported, with different disease severity, suggesting variable penetrance or sex-related differences. ABCA3 deficiency should be considered in term or near-term babies who develop unexplained RDS. PMID:26508177

  11. ROBUST ATTITUDE CONTROL OF A 3DOF HELICOPTER WITH MULTI-OPERATION POINTS

    Institute of Scientific and Technical Information of China (English)

    Yao YU; Yisheng ZHONG

    2009-01-01

    A 3DOF (three degrees of freedom) helicopter attitude control system with multi-operation points is described as a MIMO time-varying uncertain nonlinear system with unknown constant param-eters, bounded disturbance and nonlinear uncertainty, and a robust output feedback control method based on signal compensation is proposed. A controller designed by this method consists of a nominal controller and a robust compensator. The controller is linear time-invariant and can be realized easily. Robust attitude tracking property of closed-loop system is proven and experimental results show that the designed control system can guarantee high precision robust attitude control under multi-operation points.

  12. Hybrid direct carbon fuel cell anode processes investigated using a 3-electrode half-cell setup

    DEFF Research Database (Denmark)

    Deleebeeck, Lisa; Arenillas, A.; Menendez, J.A.;

    2015-01-01

    anthracite and bituminous coals, as well as carbon black, were tested, revealing similar open circuit potential and activation energies in mixed 96-4vol% N2-CO2 and 50-50vol% CO-CO2 environments between 700 and 800°C. Bituminous coal showed the highest activity, likely associated to a high O/C ratio......A 3-electrode half-cell setup consisting of a yttria-stabilized zirconia (YSZ) electrolyte support was employed to investigate the chemical and electrochemical processes occurring in the vicinity of a model hybrid direct carbon fuel cell (HDCFC) anode (Ni-YSZ) in contact with a molten carbon...

  13. Development of a 3D capacitive gyroscope with reduced parasitic capacitance

    International Nuclear Information System (INIS)

    We present the development of a technological platform dedicated to 3D capacitive inertial sensors. The proof of concept will be made on a 3D gyroscope. The mobile structure is made within a 30 µm thick Si top layer of a SOI substrate, while poly-Si deposited on top of a sacrificial PSG layer serves as suspended top electrodes and connection wires. This technology enables us to maintain low parasitic capacitance, which is of paramount significance for capacitive detection. After packaging and association with an analogue electronic board, functionality of the sensor is demonstrated. (paper)

  14. A 3-D discontinuous Galerkin Method for jet engine buzz-saw noise propagation

    International Nuclear Information System (INIS)

    This paper presents a 3-D methodology for solving jet engine aero-acoustics problems in the presence of strong shocks and rarefactions. For example, turbofan engines suffer from Multiple Pure Tone noise, also called Buzz-saw noise, generated by the fan when the blade rotational tip speed is supersonic. These waves are composed of a series of shocks and rarefactions produced by a coalescence of shocks due to non-uniformities in the blade spacing and in the blade stagger angles, arising from manufacturing tolerances

  15. A 3-Component Approach Incorporating Focus Groups in Strategic Planning for Sexual Violence Prevention.

    Science.gov (United States)

    Cruz, Theresa H; Hess, Julia Meredith; Woelk, Leona; Bear, Samantha

    2016-01-01

    Sexual violence is of special concern in New Mexico because of the presence of large priority populations in which its prevalence is high. This article describes a 3-component approach to developing a strategic plan to prevent sexual violence in the state that consisted of an advisory group, subject matter experts, and focus groups from geographically and demographically diverse communities. Both common and community-specific themes emerged from the focus groups and were included in the strategic plan. By incorporating community needs and experiences, this approach fosters increased investment in plan implementation.

  16. 外观像平板电脑的LynxA3D相机

    Institute of Scientific and Technical Information of China (English)

    2013-01-01

    Kickstarter推出的这款LynxA3D相机,有别于传统的相机,但学习过程就像一部普通相机那样简单。该公司很看重这件产品的易用性,并称其为世上第一部rpoint—and—shootj的3D相机,其外观毫不像一部相机,反而像一部平板电脑。

  17. 3DTS: A 3D tolerancing system based on mathematical definition

    Institute of Scientific and Technical Information of China (English)

    CAO Yan-long; LIU Yu-sheng; MAO Jian; YANG Jiang-xin

    2006-01-01

    Tolerance is almost ubiquitous during the whole product lift cycle and is imperative for seamless integration of CAD and CAM. Based on the mathematical definition of tolerance, a 3D tolerancing system, 3DTS, is presented with its design principle, system architecture and key functions. The following functional modules, tolerance modeling, semantics interpretation, 3D tolerance analysis, are described in detail. To make the tolerancing system robust and efficient, many techniques such as hierarchical tolerance representation, rule-based evaluation and non-intersection determination of tolerance zone have been devised.Tested by many samples, this system shows good robustness and practicability.

  18. A 3D measurement method based on multi-view fringe projection by using a turntable

    Science.gov (United States)

    Song, Li-mei; Gao, Yan-yan; Zhu, Xin-jun; Guo, Qing-hua; Xi, Jiang-tao

    2016-09-01

    In order to get the entire data in the optical measurement, a multi-view three-dimensional (3D) measurement method based on turntable is proposed. In the method, a turntable is used to rotate the object and obtain multi-view point cloud data, and then multi-view point cloud data are registered and integrated into a 3D model. The measurement results are compared with that of the sticking marked point method. Experimental results show that the measurement process of the proposed method is simpler, and the scanning speed and accuracy are improved.

  19. Global asymptotic stability of positive equilibrium in a 3-species cooperating model with time delay

    Institute of Scientific and Technical Information of China (English)

    WANG Chang-you

    2007-01-01

    The asymptotic behavior of the time-dependent solution for a 3-species cooperating model was investigated with the effects of both diffusion and time delay taken into consideration. We proved the global asymptotic stability of a positive steady-state solution to the model problem by using coupled upper and lower solutions for a more general reaction-diffusion system that gives a common framework for 3-species cooperating model problems. The result of global asymptotic stability implies that the model system coexistence is permanent. Some global asymptotic stability results for 2-species cooperating reaction-diffusion systems are included in the discussion, and some known results are extended.

  20. Design of a 3 Axis Parallel Machine Tool for High Speed Machining: The Orthoglide

    CERN Document Server

    Majou, Félix; Chablat, Damien

    2002-01-01

    The Orthoglide project aims at designing a new 3-axis machine tool for High Speed Machining. Basis kinematics is a 3 degree-of-freedom translational parallel mechanism. This basis was submitted to isotropic and manipulability constraints that allowed the optmization of its kinematic architecture and legs architecture. Thus, several leg morphologies are convenient for the chosen mechanism. We explain the process that led us to the choice we made for the Orthoglide. A static study is presented to show how singular configurations of the legs can cause stiffness problems.

  1. Thermal Calibration of a 3 DOF Ultra High-Precision Robot Operating in Industrial Environment

    OpenAIRE

    Lubrano, Emanuele; Clavel, Reymond

    2010-01-01

    While dealing with sub-micrometer precision robots, thermal expansion is the most significant source of inaccuracy. Thermal variations in the environment, in the robot parts and in the frame change the robot geometry, lowering the robot precision. In this article we propose a strategy to model and compensate such effects. The thermal behavior of a 3 DOF (Degree(s)-of-freedom) parallel robot has been studied using a high-precision measuring system. A model of the robot thermal behavior has bee...

  2. Congenital Chloride Diarrhea - Novel Mutation in SLC26A3 Gene.

    Science.gov (United States)

    Bhardwaj, Swati; Pandit, Deepti; Sinha, Aditi; Hari, Pankaj; Cheong, Hae Il; Bagga, Arvind

    2016-08-01

    The authors report a case of congenital chloride diarrhea with molecular confirmation of diagnosis. A 10-mo-old boy presented with failure to thrive, voluminous diarrhea, dehydration, hyponatremia, hypokalemia, metabolic alkalosis and history of maternal polyhydramnios. The diagnosis of congenital chloride diarrhea was based on high fecal and low urinary chloride excretion, in addition to biochemical abnormalities. Genetic testing revealed a novel homozygous mutation in exon 4 of the SLC26A3 gene that encodes the protein regulating chloride bicarbonate absorption in distal ileum and colon. Therapy with oral fluids and electrolytes led to decrease in stool frequency and improvement in growth parameters. PMID:26637435

  3. 3D Genome Tuner: Compare Multiple Circular Genomes in a 3D Context

    Institute of Scientific and Technical Information of China (English)

    Qi Wang; Qun Liang; Xiuqing Zhang

    2009-01-01

    Circular genomes, being the largest proportion of sequenced genomes, play an important role in genome analysis. However, traditional 2D circular map only provides an overview and annotations of genome but does not offer feature-based comparison. For remedying these shortcomings, we developed 3D Genome Tuner, a hybrid of circular map and comparative map tools. Its capability of viewing comparisons between multiple circular maps in a 3D space offers great benefits to the study of comparative genomics. The program is freely available(under an LGPL licence)at http://sourceforge.net/projects/dgenometuner.

  4. Microrheology and ROCK signaling of human endothelial cells embedded in a 3D matrix.

    Science.gov (United States)

    Panorchan, Porntula; Lee, Jerry S H; Kole, Thomas P; Tseng, Yiider; Wirtz, Denis

    2006-11-01

    Cell function is profoundly affected by the geometry of the extracellular environment confining the cell. Whether and how cells plated on a two-dimensional matrix or embedded in a three-dimensional (3D) matrix mechanically sense the dimensionality of their environment is mostly unknown, partly because individual cells in an extended matrix are inaccessible to conventional cell-mechanics probes. Here we develop a functional assay based on multiple particle tracking microrheology coupled with ballistic injection of nanoparticles to measure the local intracellular micromechanical properties of individual cells embedded inside a matrix. With our novel assay, we probe the mechanical properties of the cytoplasm of individual human umbilical vein endothelial cells (HUVECs) embedded in a 3D peptide hydrogel in the presence or absence of vascular endothelial growth factor (VEGF). We found that VEGF treatment, which enhances endothelial migration, increases the compliance and reduces the elasticity of the cytoplasm of HUVECs in a matrix. This VEGF-induced softening response of the cytoplasm is abrogated by specific Rho-kinase (ROCK) inhibition. These results establish combined particle-tracking microrheology and ballistic injection as the first method able to probe the micromechanical properties and mechanical response to agonists and/or drug treatments of individual cells inside a matrix. These results suggest that ROCK plays an essential role in the regulation of the intracellular mechanical response to VEGF of endothelial cells in a 3D matrix.

  5. Microfabricated Tepui: probing into cancer invasion, metastasis and evolution in a 3D environment

    Science.gov (United States)

    Liu, Liyu

    2011-03-01

    Cancer metastasis and chemotherapeutic resistance are the major reasons why cancer remains recalcitrant to long-term therapy. We are interested to know: 1. How cancer cells invade tissues and metastasize in a 3D spatial environment? 2. How cancer cells evolve resistance to chemotherapeutic therapy? Answering these fundamental questions will require spatially propagating cancer cells in a 3D in vitro micro environment with dynamically controlled chemical stress. Here we attempt to realize this micro environment with a three-dimentional topology on a micro-chip which consist of isolated highlands (Tepui) and deep lower lands. Cancer cells are patterned in the lower lands and their spatial invasion to the mesas of Tepui is observed continuously with a microscope. Experiments have demonstrated that the cell invasion potential is time dependent, which is not only determined by cell motility, but also cell number and spatial stress. Quantitative analysis shows that the invasion rate fits logistic equation. Further more, we have also imbedded collagen based Extracellular Matrix (ECM) inside these structures and established a robust chemical gradient in a vertical space. With merit of real-time confocal imaging, cell propagation, metastasis and evolution in the 3D environment are studied with time as a model for cell behavior inside tissues. NCI grant: U54CA143803.

  6. The application of a 3D PTV algorithm to a mixed convection flow

    Energy Technology Data Exchange (ETDEWEB)

    Kieft, R.N.; Schreel, K.R.A.M.; Van der Plas, G.A.J.; Rindt, C.C.M. [Energy Technology Division, Department of Mechanical Engineering, Eindhoven University of Technology, P.O. Box 513, 5600 MB Eindhoven (Netherlands)

    2002-10-01

    A 3D particle-tracking velocimetry (PTV) algorithm is applied to the wake flow behind a heated cylinder. The method is tested in advance with respect to its accuracy and performance. In the accuracy tests, its capability to locate particles in 3D space is tested. It appears that the algorithm can determine the particle position with an accuracy of less than 0.5 camera pixels, equivalent to 0.3 mm in the present test situation. The performance tests show that for particles located in a 2D plane, the algorithm can track the particles with a vector yield reaching 100%, which means that a velocity vector can be determined for almost all particles detected. The calculated velocity vectors for this situation have a standard deviation of less than 1%. The performance is also tested on a mixed convection flow behind a heated cylinder in which the 2D flow transits into a 3D flow. As there is no exact solution of such a flow available, the 3D PTV results are compared with visualisation results. The results show that the 3D PTV method can capture the main features of the 3D transition of the 2D vortex street. (orig.)

  7. A 3-Step Algorithm Using Region-Based Active Contours for Video Objects Detection

    Directory of Open Access Journals (Sweden)

    Stéphanie Jehan-Besson

    2002-06-01

    Full Text Available We propose a 3-step algorithm for the automatic detection of moving objects in video sequences using region-based active contours. First, we introduce a very full general framework for region-based active contours with a new Eulerian method to compute the evolution equation of the active contour from a criterion including both region-based and boundary-based terms. This framework can be easily adapted to various applications, thanks to the introduction of functions named descriptors of the different regions. With this new Eulerian method based on shape optimization principles, we can easily take into account the case of descriptors depending upon features globally attached to the regions. Second, we propose a 3-step algorithm for detection of moving objects, with a static or a mobile camera, using region-based active contours. The basic idea is to hierarchically associate temporal and spatial information. The active contour evolves with successively three sets of descriptors: a temporal one, and then two spatial ones. The third spatial descriptor takes advantage of the segmentation of the image in intensity homogeneous regions. User interaction is reduced to the choice of a few parameters at the beginning of the process. Some experimental results are supplied.

  8. Fabrication of Dye-Sensitized Solar Cells with a 3D Nanostructured Electrode

    Directory of Open Access Journals (Sweden)

    Guo-Yang Chen

    2010-01-01

    Full Text Available A novel Dye-Sensitized Solar Cell (DSSC scheme for better solar conversion efficiency is proposed. The distinctive characteristic of this novel scheme is that the conventional thin film electrode is replaced by a 3D nanostructured indium tin oxide (ITO electrode, which was fabricated using RF magnetron sputtering with an anodic aluminum oxide (AAO template. The template was prepared by immersing the barrier-layer side of an AAO film into a 30 wt% phosphoric acid solution to produce a contrasting surface. RF magnetron sputtering was then used to deposit a 3D nanostructured ITO thin film on the template. The crystallinity and conductivity of the 3D ITO films were further enhanced by annealing. Titanium dioxide nanoparticles were electrophoretically deposited on the 3D ITO film after which the proposed DSSC was formed by filling vacant spaces in the 3D nanostructured ITO electrode with dye. The measured solar conversion efficiency of the device was 0.125%. It presents a 5-fold improvement over that of conventional spin-coated TiO2 film electrode DSSCs.

  9. Race-track coils for a 3 MW HTS ship motor

    International Nuclear Information System (INIS)

    Highlights: • Sumitomo Electric manufactured the HTS field coils for a 3 MW HTS ship motor. • The motor was developed and successfully passed the loading test by Kawasaki Heavy. • We tested and obtained the basic data to evaluate the 20-year durability of coils. - Abstract: Since the discovery of high-temperature superconductivity (HTS), Sumitomo Electric has been developing silver-sheathed Bi2223 superconducting wire and products. Ship propulsion motors are one of the most promising applications of HTS. Sumitomo Electric Industries, Ltd. (SEI) has recently manufactured 24 large racetrack coils, using 70 km long DI-BSCCO wires, for use in a 3 MW HTS motor developed by Kawasaki Heavy Industries, Ltd. (KHI). The 3 MW HTS motor, using our newly developed racetrack coils, has successfully passed the loading test. It is particularly important that the HTS field coils used in ship propulsion motors can withstand the expansive forces repeatedly applied to them. As racetrack type coils have straight sections, the support mechanism they require to withstand expansive forces is very different from that of circular coils. Therefore, we ran tests and obtained the basic data to evaluate the 20-year durability of racetrack coils against the repeatedly applied expansive forces expected in domestic ship propulsion motors

  10. Contribution to the design of a 3 dimension simulation for quasistatic evolutions

    International Nuclear Information System (INIS)

    A 3-dimensions description based on the 1 1/2 group diffusion theory, has been used to model the core. The cross-section are function of a vector (β-vector) including temperatures, local power Boron and Xenon concentrations and another control vector (α-vector). The reference state cross-section are given by laser, and the cross-section for any vector are computed using a first order interpolation formula for βi and Gordon interpolation for χi. Temperatures variations needed for the above interpolations are calculated using an analytical model with the reference state given by STDY-3. The local flux and the local power for the reference state are determined by a 3-dimensions code Dorning. The Xenon concentration is the value at equilibrium and the Boron concentration is obtained from criticite. The 3-dimensions code being very expensive, cannot be used at each time and Gordon interpolation is used instead for the calculation between two reference states the flux for any state of the control vector is computed using variational interpolation of Pomraning

  11. Reliability Analysis of a 3-Machine Power Station Using State Space Approach

    Directory of Open Access Journals (Sweden)

    WasiuAkande Ahmed

    2014-07-01

    Full Text Available With the advent of high-integrity fault-tolerant systems, the ability to account for repairs of partially failed (but still operational systems become increasingly important. This paper presents a systemic method of determining the reliability of a 3-machine electric power station, taking into consideration the failure rates and repair rates of the individual component (machine that make up the system. A state-space transition process for a 3-machine with 23 states was developed and consequently, steady state equations were generated based on Markov mathematical modeling of the power station. Important reliability components were deduced from this analysis. This research simulation was achieved with codes written in Excel® -VBA programming environment. System reliability using state space approach proofs to be a viable and efficient technique of reliability prediction as it is able to predict the state of the system under consideration. For the purpose of neatness and easy entry of data, Graphic User Interface (GUI was designed.

  12. Neural evidence for a 3-state model of visual short-term memory.

    Science.gov (United States)

    Nee, Derek Evan; Jonides, John

    2013-07-01

    Recent research has suggested that short-term memory (STM) can be partitioned into three distinct states. By this model, a single item is held in the focus of attention making it available for immediate processing (focus of attention), a capacity-limited set of additional items is actively maintained for future processing (direct access region), and other recently presented information is passively active, but can nevertheless influence ongoing cognition (activated portion of long-term memory). While there is both behavioral and neural support for this 3-state model in verbal STM, it is unclear whether the model generalizes to non-verbal STM. Here, we tested a 3-state model of visual STM using fMRI. We found a triple dissociation of regions involved in the access of each hypothesized state. The inferior parietal cortex mediated access to the focus of attention, the medial temporal lobe (MTL) including the hippocampus mediated access to the direct access region, and the left ventrolateral prefrontal cortex (VLPFC) mediated access to the activated portion of long-term memory. Direct comparison with previously collected verbal STM data revealed overlapping neural activations involved in the access of each state across different forms of content suggesting that mechanisms of access are domain general. These data support a 3-state model of STM.

  13. Numerical and Experimental Verification of a 3D Quasi-Optical System

    Directory of Open Access Journals (Sweden)

    Zejian Lu

    2015-01-01

    Full Text Available A modular and efficient Gaussian beam (GB analysis method, incorporating frame-based Gabor transformation, GB reflection, and a 3D GB diffraction technique, was developed to analyze both the reflectors and frequency selective surface (FSS in quasi-optical (QO system. To validate this analysis method, a 3D dual-channel QO system operating at 183 and 325 GHz was designed and tested. The proposed QO system employs two-layer structure with a FSS of perforated hexagonal array transmitting the 325 GHz signal on the top layer while diverting the 183 GHz signal to the bottom layer. Measured results of the system demonstrate that the agreement can be achieved down to −30 dB signal level for both channels in the far field pattern. The discrepancy between the calculation and measurement is within 2 dB in the main beam region (2.5 times −3 dB beamwidth, verifying the effectiveness and accuracy of the proposed method.

  14. Planning and Control of Stable Walking for a 3D Bipedal Robot

    Directory of Open Access Journals (Sweden)

    Ching-Long Shih

    2012-08-01

    Full Text Available This paper presents a time‐invariant feedback controller that simultaneously regulates the ZMP (zero‐moment point position and the joint configuration of a 3D biped in order to achieve an asymptotically, periodic walking gait for a 3D bipedal robot with feet. The cyclic walking gait is composed of a successive single‐support phase and an impulsive impact with full plane‐contact between the feet and the ground. The biped robot has 10 DOFs (degrees of freedom in the single‐support phase and 10 actuators. In order to avoid the unexpected rotation of the supporting foot, the position of the ZMP in the horizontal plane has to be controlled. It is also desired that the feedback controller tracks a parameterized reference trajectory to achieve walking stability. We use the method of virtual constraints previously implemented for controlling point‐feet bipedal robots to create a set of parameterized reference walking trajectories. By creating the hybrid zero dynamics, an orbital stability study with Poincaré map is evaluated in a reduced space. We then design a supplemental event‐based feedback controller to enhance walking stability. The walking gait has an average walking speed of 0.76m/sec (or 0.72 body lengths per second in the simulation study.

  15. Functional chondroitin sulfate from Enteroctopus dofleini containing a 3-O-sulfo glucuronic acid residue.

    Science.gov (United States)

    Higashi, Kyohei; Okamoto, Yusuke; Mukuno, Ann; Wakai, Jun; Hosoyama, Saori; Linhardt, Robert J; Toida, Toshihiko

    2015-12-10

    There are several reports that chondroitin sulfate containing K-type units [GlcA (3S)-GalNAc (4S)] exhibiting similar levels of neurite outgrowth promoting activities as CS having high amounts of B-, D- and E-type disulfated disaccharides. Although CS containing K-type units possess important biological activities, there are only few sources, such as king crab cartilage, squid cartilage or sea cucumber. In this study, CS containing 13.9% of K-type units was found in octopus (Enteroctopus dofleini) cartilage using different substrate specificities of chondroitinases. The 2D NMR spectra showed cross-peaks assigned to protons on sugar ring of GlcA (3S), demonstrating the presence of K-type units in octopus CS. Furthermore, proportion of fucosylated disaccharide units in octopus CS was very low. Octopus CS showed high affinity for growth factors and stimulated neurite outgrowth of hippocampal neurons, similar to the activity of squid CS-E. These results strongly suggest that octopus cartilage is a rich source of CS-K and has important biological activities. PMID:26428158

  16. Race-track coils for a 3 MW HTS ship motor

    Energy Technology Data Exchange (ETDEWEB)

    Ueno, E., E-mail: ueno-eisaku@sei.co.jp; Kato, T.; Hayashi, K.

    2014-09-15

    Highlights: • Sumitomo Electric manufactured the HTS field coils for a 3 MW HTS ship motor. • The motor was developed and successfully passed the loading test by Kawasaki Heavy. • We tested and obtained the basic data to evaluate the 20-year durability of coils. - Abstract: Since the discovery of high-temperature superconductivity (HTS), Sumitomo Electric has been developing silver-sheathed Bi2223 superconducting wire and products. Ship propulsion motors are one of the most promising applications of HTS. Sumitomo Electric Industries, Ltd. (SEI) has recently manufactured 24 large racetrack coils, using 70 km long DI-BSCCO wires, for use in a 3 MW HTS motor developed by Kawasaki Heavy Industries, Ltd. (KHI). The 3 MW HTS motor, using our newly developed racetrack coils, has successfully passed the loading test. It is particularly important that the HTS field coils used in ship propulsion motors can withstand the expansive forces repeatedly applied to them. As racetrack type coils have straight sections, the support mechanism they require to withstand expansive forces is very different from that of circular coils. Therefore, we ran tests and obtained the basic data to evaluate the 20-year durability of racetrack coils against the repeatedly applied expansive forces expected in domestic ship propulsion motors.

  17. Inclusion of high resolution MODIS maps on a 3D tropospheric water vapor GPS tomography model

    Science.gov (United States)

    Benevides, Pedro; Catalao, Joao; Nico, Giovanni; Miranda, Pedro M. A.

    2015-10-01

    Observing the water vapor distribution on the troposphere remains a challenge for the weather forecast. Radiosondes provide precise water vapor profiles of the troposphere, but lack geographical and temporal coverage, while satellite meteorological maps have good spatial resolution but even poorer temporal resolution. GPS has proved its capacity to measure the integrated water vapor in all weather conditions with high temporal sampling frequency. However these measurements lack a vertical water vapor discretization. Reconstruction of the slant path GPS observation to the satellite allows oblique water vapor measurements. Implementation of a 3D grid of voxels along the troposphere over an area where GPS stations are available enables the observation ray tracing. A relation between the water vapor density and the distanced traveled inside the voxels is established, defining GPS tomography. An inverse problem formulation is needed to obtain a water vapor solution. The combination of precipitable water vapor (PWV) maps obtained from MODIS satellite data with the GPS tomography is performed in this work. The MODIS PWV maps can have 1 or 5 km pixel resolution, being obtained 2 times per day in the same location at most. The inclusion of MODIS PWV maps provides an enhanced horizontal resolution for the tomographic solution and benefits the stability of the inversion problem. A 3D tomographic grid was adjusted over a regional area covering Lisbon, Portugal, where a GNSS network of 9 receivers is available. Radiosonde measurements in the area are used to evaluate the 3D water vapor tomography maps.

  18. Triazoloquinazolines as Human A3 Adenosine Receptor Antagonists: A QSAR Study

    Directory of Open Access Journals (Sweden)

    Dae-Sil Lee

    2006-11-01

    Full Text Available Multiple linear regression analysis was performed on the quantitative structure-activity relationships (QSAR of the triazoloquinazoline adenosine antagonists for human A3receptors. The data set used for the QSAR analysis encompassed the activities of 33triazoloquinazoline derivatives and 72 physicochemical descriptors. A template moleculewas derived using the known molecular structure for one of the compounds when bound tothe human A2B receptor, in which the amide bond was in a cis-conformation. All the testcompounds were aligned to the template molecule. In order to identify a reasonable QSARequation to describe the data set, we developed a multiple linear regression program thatexamined every possible combination of descriptors. The QSAR equation derived from thisanalysis indicates that the spatial and electronic effects is greater than that of hydrophobiceffects in binding of the antagonists to the human A3 receptor. It also predicts that a largesterimol length parameter is advantageous to activity, whereas large sterimol widthparameters and fractional positive partial surface areas are nonadvatageous.

  19. Isolation and characterization of an archaebacterial viruslike particle from Methanococcus voltae A3

    Energy Technology Data Exchange (ETDEWEB)

    Wood, A.G.; Konisky, J. (Univ. of Illinois, Urbana (USA)); Whitman, W.B. (Univ. of Georgia, Athens (USA))

    1989-01-01

    Small amounts of 23-kilobase covalently closed circular DNA molecule were isolated from unwashed cells of Methanococcus voltae A3. Further investigation indicated the presence of greater quantities of the circular DNA in the culture supernatant, complexed with protein in a manner rendering the DNA resistant to DNase. Electron-microscopic examination of supernatant material revealed the presence of particles which morphologically resemble virus. Phenol extraction of viruslike particle preparations resulted in the recovery of DNase-sensitive open-circular DNA molecules. As many as 30 viruslike particles per cell were recovered from some cultures. Hybridization data clearly indicated the presence of a chromosomally integrated copy of the viruslike particle DNA. Although M. voltae PS was not observed to produce viruslike particles, DNA homologous to the viruslike particle DNA was detected in its chromosome. A mutant of M. voltae A3 was isolated which produced no particles; its DNA was deleted for 80% of the integrated viruslike particle DNA. Despite any similarities to lysogenic bacteriophages of eubacteria, neither infectivity nor inducibility of the viruslike particles could by demonstrated.

  20. Cancer regression and neurologic toxicity following anti-MAGE-A3 TCR gene therapy

    Science.gov (United States)

    Morgan, Richard A.; Chinnasamy, Nachimuthu; Abate-Daga, Daniel D; Gros, Alena; Robbins, Paul F.; Zheng, Zhili; Feldman, Steven A.; Yang, James C.; Sherry, Richard M.; Phan, Giao Q.; Hughes, Marybeth S.; Kammula, Udai S.; Miller, Akemi D.; Hessman, Crystal J.; Stewart, Ashley A.; Restifo, Nicholas P.; Quezado, Martha M.; Alimchandani, Meghna; Rosenberg, Avi Z.; Nath, Avindra; Wang, Tongguang; Bielekova, Bibiana; Wuest, Simone C.; Nirmala, Akula; McMahon, Francis J.; Wilde, Susanne; Mosetter, Barbara; Schendel, Dolores J.; Laurencot, Carolyn M.; Rosenberg, Steven A

    2013-01-01

    Nine cancer patients were treated with adoptive cell therapy using autologous anti-MAGE-A3 TCR engineered T cells. Five patients experienced clinical regression of their cancers including two on-going responders. Beginning 1–2 days post-infusion, three patients (#’s 5, 7, and 8) experienced mental status changes, and two patients (5 and 8) lapsed into comas and subsequently died. Magnetic resonance imagining analysis of patients 5 and 8 demonstrated periventricular leukomalacia, and examination of their brains at autopsy revealed necrotizing leukoencephalopathy with extensive white matter defects associated with infiltration of CD3+/CD8+ T cells. Patient 7, developed Parkinson-like symptoms, which resolved over 4 weeks and fully recovered. Immunohistochemical staining of patient and normal brain samples demonstrated rare positively staining neurons with an antibody that recognizes multiple MAGE-A family members. The TCR used in this study recognized epitopes in MAGE-A3/A9/A12. Molecular assays of human brain samples using Q-RT-PCR, Nano string quantitation, and deep-sequencing indicated that MAGE -A12 was expressed in human brain (and possibly MAGE-A1, MAGE-A8, and MAGE-A9). This previously unrecognized expression of MAGE-A12 in human brain was possibly the initiating event of a TCR-mediated inflammatory response that resulted in neuronal cell destruction and raises caution for clinical applications targeting MAGE-A family members with highly active immunotherapies. PMID:23377668

  1. A 3' Poly(A) Tract Is Required for LINE-1 Retrotransposition.

    Science.gov (United States)

    Doucet, Aurélien J; Wilusz, Jeremy E; Miyoshi, Tomoichiro; Liu, Ying; Moran, John V

    2015-12-01

    L1 retrotransposons express proteins (ORF1p and ORF2p) that preferentially mobilize their encoding RNA in cis, but they also can mobilize Alu RNA and, more rarely, cellular mRNAs in trans. Although these RNAs differ in sequence, each ends in a 3' polyadenosine (poly(A)) tract. Here, we replace the L1 polyadenylation signal with sequences derived from a non-polyadenylated long non-coding RNA (MALAT1), which can form a stabilizing triple helix at the 3' end of an RNA. L1/MALAT RNAs accumulate in cells, lack poly(A) tails, and are translated; however, they cannot retrotranspose in cis. Remarkably, the addition of a 16 or 40 base poly(A) tract downstream of the L1/MALAT triple helix restores retrotransposition in cis. The presence of a poly(A) tract also allows ORF2p to bind and mobilize RNAs in trans. Thus, a 3' poly(A) tract is critical for the retrotransposition of sequences that comprise approximately one billion base pairs of human DNA.

  2. ADIDAS A~3 Garnett ’05 VS NIKE SHOX VC Ⅳ

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    乍一看,adidas a~3 Garnett ’05和 Nike Shox VC Ⅳ就像是从出生就被迫分开的双胞胎一样。首先,他们都是被设计成签名的全明星常规赛的球鞋,最知名的特点就是他们都是用姓名的首字母签名作标记的产品——KG代表的就是 Keyin Garnett(凯文·加内特),VC 代表的就是 Vince Carter(文斯·卡特)。另一方面,它们都是基于气垫系统原理制作的产品,加内特’05的设计是基于 adidas a~3的结构,而文斯·卡特Ⅳ则是采用最新的技术复制经典的耐克鞋款,它的技术特点与 Shox 系列相似。最后,两款鞋的零售价

  3. βA3/A1-crystallin in astroglial cells regulates retinal vascular remodeling during development

    Science.gov (United States)

    Sinha, Debasish; Klise, Andrew; Sergeev, Yuri; Hose, Stacey; Bhutto, Imran A.; Hackler, Laszlo; Malpic-llanos, Tanya; Samtani, Sonia; Grebe, Rhonda; Goldberg, Morton F.; Hejtmancik, J. Fielding; Nath, Avindra; Zack, Donald J.; Fariss, Robert N.; McLeod, D. Scott; Sundin, Olof; Broman, Karl W.; Lutty, Gerard A.; Zigler, J. Samuel

    2016-01-01

    Vascular remodeling is a complex process critical to development of the mature vascular system. Astrocytes are known to be indispensable for initial formation of the retinal vasculature; our studies with the Nuc1 rat provide novel evidence that these cells are also essential in the retinal vascular remodeling process. Nuc1 is a spontaneous mutation in the Sprague–Dawley rat originally characterized by nuclear cataracts in the heterozygote and microphthalmia in the homozygote. We report here that the Nuc1 allele results from mutation of the βA3/A1-crystallin gene, which in the neural retina is expressed only in astrocytes. We demonstrate striking structural abnormalities in Nuc1 astrocytes with profound effects on the organization of intermediate filaments. While vessels form in the Nuc1 retina, the subsequent remodeling process required to provide a mature vascular network is deficient. Our data implicate βA3/A1-crystallin as an important regulatory factor mediating vascular patterning and remodeling in the retina. PMID:17931883

  4. Developing and Testing a 3d Cadastral Data Model a Case Study in Australia

    Science.gov (United States)

    Aien, A.; Kalantari, M.; Rajabifard, A.; Williamson, I. P.; Shojaei, D.

    2012-07-01

    Population growth, urbanization and industrialization place more pressure on land use with the need for increased space. To extend the use and functionality of the land, complex infrastructures are being built, both vertically and horizontally, layered and stacked. These three-dimensional (3D) developments affect the interests (Rights, Restrictions, and Responsibilities (RRRs)) attached to the underlying land. A 3D cadastre will assist in managing the effects of 3D development on a particular extent of land. There are many elements that contribute to developing a 3D cadastre, such as existing of 3D property legislations, 3D DBMS, 3D visualization. However, data modelling is one of the most important elements of a successful 3D cadastre. As architectural models of houses and high rise buildings help their users visualize the final product, 3D cadastre data model supports 3D cadastre users to understand the structure or behavior of the system and has a template that guides them to construct and implement the 3D cadastre. Many jurisdictions, organizations and software developers have built their own cadastral data model. Land Administration Domain Model (DIS-ISO 19152, The Netherlands) and ePlan (Intergovernmental Committee on Surveying and Mapping, Australia) are examples of existing data models. The variation between these data models is the result of different attitudes towards cadastres. However, there is a basic common thread among them all. Current cadastral data models use a 2D land-parcel concept and extend it to support 3D requirements. These data models cannot adequately manage and represent the spatial extent of 3D RRRs. Most of the current cadastral data models have been influenced by a very broad understanding of 3D cadastral concepts because better clarity in what needs to be represented and analysed in the cadastre needs to be established. This paper presents the first version of a 3D Cadastral Data Model (3DCDM_Version 1.0). 3DCDM models both the legal

  5. Towards Development of a 3-State Self-Paced Brain-Computer Interface

    Directory of Open Access Journals (Sweden)

    Ali Bashashati

    2007-01-01

    the presence of a right- or a left-hand movement and the second classifies the detected movement as a right or a left one. In an offline analysis of the EEG data collected from four able-bodied individuals, the 3-state brain-computer interface shows a comparable performance with a 2-state system and significant performance improvement if used as a 2-state BCI, that is, in detecting the presence of a right- or a left-hand movement (regardless of the type of movement. It has an average true positive rate of 37.5% and 42.8% (at false positives rate of 1% in detecting right- and left-hand extensions, respectively, in the context of a 3-state self-paced BCI and average detection rate of 58.1% (at false positive rate of 1% in the context of a 2-state self-paced BCI.

  6. Construction of a $^3$He magnetic force microscope with a vector magnet

    CERN Document Server

    Yang, Jinho; Kim, Yun Won; Shin, Dongwoo; Jeong, Juyoung; Wulferding, Dirk; Yeom, Han Woong; Kim, Jeehoon

    2016-01-01

    We constructed a $^3$He magnetic force microscope operating at the base temperature of 300 mK under a vector magnetic field of 2-2-9 T in the $x-y-z$ direction. Fiber optic interferometry as a detection scheme is employed in which two home-built fiber walkers are used for the alignment between the cantilever and the optical fiber. The noise level of the laser interferometer is close to its thermodynamic limit. The capabilities of the sub-Kelvin and vector field are demonstrated by imaging the coexistence of magnetism and superconductivity in a ferromagnetic superconductor (ErNi$_2$B$_2$C) at $T$=500 mK and by probing a dipole shape of a single Abrikosov vortex with an in-plane tip magnetization.

  7. Stiffness Model of a 3-DOF Parallel Manipulator with Two Additional Legs

    Directory of Open Access Journals (Sweden)

    Guang Yu

    2014-10-01

    Full Text Available This paper investigates the stiffness modelling of a 3-DOF parallel manipulator with two additional legs. The stiffness model in six directions of the 3-DOF parallel manipulator with two additional legs is derived by performing condensation of DOFs for the joint connection and treatment of the fixed-end connections. Moreover, this modelling method is used to derive the stiffness model of the manipulator with zero/one additional legs. Two performance indices are given to compare the stiffness of the parallel manipulators with two additional legs with those of the manipulators with zero/one additional legs. The method not only can be used to derive the stiffness model of a redundant parallel manipulator, but also to model the stiffness of non-redundant parallel manipulators.

  8. Epidermoid Cyst in the Floor of the Mouth of a 3-Year-Old

    Directory of Open Access Journals (Sweden)

    Rossana Pascual Dabán

    2015-01-01

    Full Text Available Epidermoid cysts are a rare entity in the oral cavity and are even less frequent in the floor of the mouth, representing less than 0.01% of all the cases. We present the case of a 3-year-old girl with a growth in the floor of the mouth with 2 months of evolution and without changes since it was discovered by her parents. The lesion was asymptomatic; it did not cause dysphagia, dyspnea, or any other alteration. A CT scan with contrast was done which revealed the location and exact size of the lesion, allowing an intraoral approach for its excision. The histological examination confirmed the clinical speculation of an epidermoid cyst.

  9. A 3-Day-Old Girl Referred From Her Pediatrician for Oral Ulcerations.

    Science.gov (United States)

    Neel, Mary Lauren; Kern, Jeremy; Ronis, Tova

    2016-09-01

    A 3-day-old girl was referred from her pediatrician for oral ulcerations. The patient was otherwise well appearing and afebrile. Her prenatal and antenatal courses were unremarkable, except for a failed routine hearing screen. The patient's examination was notable for several yellowish ulcers on erythematous bases located on her anterior tonsillar pillars. The patient also had a right coloboma and a II/VI systolic ejection murmur. Laboratory analyses revealed a traumatic lumbar puncture with 182 000 red blood cells and 808 white blood cells, as well as a complete blood count that showed thrombocytopenia and leukocytosis. During the patient's hospitalization, she developed a new facial rash. Her physical examination findings, along with her diagnostic evaluation and hospital course, ultimately led to 2 surprising diagnoses elaborated on in this case discussion. PMID:27507895

  10. A 3mm band SIS receiver for the Sardinia Radio Telescope

    Science.gov (United States)

    Ladu, A.; Pisanu, T.; Navarrini, A.; Marongiu, P.; Valente, G.

    2014-07-01

    We present the optical and mechanical design of a 3mm band SIS receiver for the Gregorian focus of the Sardinia Radio Telescope (SRT). The receiver, was designed and built at IRAM and deployed on the IRAM for the Plateau de Bure Interferometer antennas until 2006. Following its decommissioning the receiver was purchased by the INAFAstronomical Observatory of Cagliari with the aim to adapt its optics for test of the performance of the new 64-m diameter Sardinia Radio Telescope (SRT) in the 3 mm band (84 - 116 GHz). The instrument will be installed in the rotating turret inside of the Gregorian focal room of SRT. The dimensions of the focal room, the horn position in the lower side of the cryostat and the vessel for the liquid helium impose very hard constraints to the optical and mechanical mounting structure of the receiver inside the cabin. We present the receiver configuration and how we plan to install it on SRT.

  11. Dosimetry of a 3-5 MeV linear electron accelerator for radiation processing

    International Nuclear Information System (INIS)

    With the multiple uses of a 3-5 MeV linear electron accelerator of the Institute of Low Energy Nuclear Physics (Beijing Radiation Center) at Beijing Normal University, the dosimetry of the linac for radiation processing has been studied. The graphite and water calorimeters have been used for routine dosimeter calibrations and reference measurements of absorbed dose for 4 MeV electron beam. Under the same irradiation condition, the polymer-alanine/ESR film and RCD dosimeters were calibrated in order to be used for routine process control. The polymer-alanine/ESR film dosimeter was also used as a transfer dosimeter for both 60Co gamma rays and 4 MeV electron beam because of its good dosimetric properties. (author)

  12. A 250 GHz gyrotron with a 3 GHz tuning bandwidth for dynamic nuclear polarization.

    Science.gov (United States)

    Barnes, Alexander B; Nanni, Emilio A; Herzfeld, Judith; Griffin, Robert G; Temkin, Richard J

    2012-08-01

    We describe the design and implementation of a novel tunable 250 GHz gyrotron oscillator with >10 W output power over most of a 3 GHz band and >35 W peak power. The tuning bandwidth and power are sufficient to generate a >1 MHz nutation frequency across the entire nitroxide EPR lineshape for cross effect DNP, as well as to excite solid effect transitions utilizing other radicals, without the need for sweeping the NMR magnetic field. Substantially improved tunability is achieved by implementing a long (23 mm) interaction cavity that can excite higher order axial modes by changing either the magnetic field of the gyrotron or the cathode potential. This interaction cavity excites the rotating TE(₅,₂,q) mode, and an internal mode converter outputs a high-quality microwave beam with >94% Gaussian content. The gyrotron was integrated into a DNP spectrometer, resulting in a measured DNP enhancement of 54 on the membrane protein bacteriorhodopsin. PMID:22743211

  13. A 250 GHz gyrotron with a 3 GHz tuning bandwidth for dynamic nuclear polarization

    Science.gov (United States)

    Barnes, Alexander B.; Nanni, Emilio A.; Herzfeld, Judith; Griffin, Robert G.; Temkin, Richard J.

    2012-08-01

    We describe the design and implementation of a novel tunable 250 GHz gyrotron oscillator with >10 W output power over most of a 3 GHz band and >35 W peak power. The tuning bandwidth and power are sufficient to generate a >1 MHz nutation frequency across the entire nitroxide EPR lineshape for cross effect DNP, as well as to excite solid effect transitions utilizing other radicals, without the need for sweeping the NMR magnetic field. Substantially improved tunability is achieved by implementing a long (23 mm) interaction cavity that can excite higher order axial modes by changing either the magnetic field of the gyrotron or the cathode potential. This interaction cavity excites the rotating TE5,2,q mode, and an internal mode converter outputs a high-quality microwave beam with >94% Gaussian content. The gyrotron was integrated into a DNP spectrometer, resulting in a measured DNP enhancement of 54 on the membrane protein bacteriorhodopsin.

  14. Have you seen an A3 white artists folder containing an original storyboard?

    CERN Multimedia

    Ariane Koek

    2013-01-01

    Last seen in Room C, Main Building 61, first floor on  Tuesday 5 March 2013 at CERN at 12.00 a.m. on the Meyrin site - one A3 sized Artists porfolio - white ribbed transparent plastic. Contents include an original storyboard,  which is laid out like a cartoon series, depicting the adventures of a  dynamic girl wearing a breathing apparatus on the hunt for the Higgs at CERN. Please contact ariane.koek@cern.ch direct line +41 22  76 75246 with any information you might have regarding this portfolio - whether  you have seen it and/or most of all, found it or know where it is. The storyboard is original creative work and means a great deal to the artist.

  15. Phase variation in the phage growth limitation system of Streptomyces coelicolor A3(2).

    Science.gov (United States)

    Sumby, Paul; Smith, Margaret C M

    2003-08-01

    The phase-variable phage growth limitation (Pgl) system of Streptomyces coelicolor A3(2) is an unusual bacteriophage resistance mechanism that confers protection against the temperate phage phiC31 and homoimmune relatives. Pgl is subject to phase variation, and data presented here show that this is at least partially due to expansion and contraction of a polyguanine tract present within the putative adenine-specific DNA methyltransferase gene, pglX. Furthermore, the pglX paralogue SC6G9.02, here renamed pglS, was shown to be able to interfere with the Pgl phenotype, suggesting that PglS could provide an alternative activity to that conferred by PglX.

  16. Nonlinear analysis of chaotic flow in a 3D closed-loop pulsating heat pipe

    CERN Document Server

    Pouryoussefi, S M

    2016-01-01

    Numerical simulation has been conducted for the chaotic flow in a 3D closed-loop pulsating heat pipe (PHP). Heat flux and constant temperature boundary conditions were applied for evaporator and condenser sections, respectively. Water and ethanol were used as working fluids. Volume of Fluid (VOF) method has been employed for two-phase flow simulation. Spectral analysis of temperature time series was carried out using Power Spectrum Density (PSD) method. Existence of dominant peak in PSD diagram indicated periodic or quasi-periodic behavior in temperature oscillations at particular frequencies. Correlation dimension values for ethanol as working fluid was found to be higher than that for water under the same operating conditions. Similar range of Lyapunov exponent values for the PHP with water and ethanol as working fluids indicated strong dependency of Lyapunov exponent to the structure and dimensions of the PHP. An O-ring structure pattern was obtained for reconstructed 3D attractor at periodic or quasi-peri...

  17. Mechano-sensing and cell migration: a 3D model approach

    International Nuclear Information System (INIS)

    Cell migration is essential for tissue development in different physiological and pathological conditions. It is a complex process orchestrated by chemistry, biological factors, microstructure and surrounding mechanical properties. Focusing on the mechanical interactions, cells do not only exert forces on the matrix that surrounds them, but they also sense and react to mechanical cues in a process called mechano-sensing. Here, we hypothesize the involvement of mechano-sensing in the regulation of directional cell migration through a three-dimensional (3D) matrix. For this purpose, we develop a 3D numerical model of individual cell migration, which incorporates the mechano-sensing process of the cell as the main mechanism regulating its movement. Consistent with this hypothesis, we found that factors, such as substrate stiffness, boundary conditions and external forces, regulate specific and distinct cell movements

  18. A 3D dynamical biomechanical tongue model to study speech motor control

    CERN Document Server

    Gérard, J M; Perrier, P; Payan, Y; Gerard, Jean-Michel; Wilhelms-Tricarico, Reiner; Perrier, Pascal; Payan, Yohan

    2003-01-01

    A 3D biomechanical dynamical model of human tongue is presented, that is elaborated in the aim to test hypotheses about speech motor control. Tissue elastic properties are accounted for in Finite Element Modeling (FEM). The FEM mesh was designed in order to facilitate the implementation of muscle arrangement within the tongue. Therefore, its structure was determined on the basis of accurate anatomical data about the tongue. Mechanically, the hypothesis of hyperelasticity was adopted with the Mooney-Rivlin formulation of the strain energy function. Muscles are modeled as general force generators that act on anatomically specified sets of nodes of the FEM structure. The 8 muscles that are known to be largely involved in the production of basic speech movements are modeled. The model and the solving of the Lagrangian equations of movement are implemented using the ANSYSTM software. Simulations of the influence of muscle activations onto the tongue shape are presented and analyzed.

  19. The relation between personality and anxiety: findings from a 3-year prospective study.

    Science.gov (United States)

    Gershuny, B S; Sher, K J

    1998-05-01

    The authors tested the extent to which the personality dimensions of neuroticism, extraversion, and psychoticism (H. J. Eysenck & S. B. G. Eysenck, 1975) prospectively predicted global anxiety (assessed by items from the Brief Symptom Inventory: L. R. Derogatis & M. S. Spencer, 1982). The authors also examined prospective relations among these personality dimensions and depression to evaluate the specificity of findings. Participants were 466 young adults, primarily undergraduate students, assessed twice over a 3-year interval. An interaction between neuroticism and extraversion predicted both global anxiety and depression 3 years later. Findings indicated that personality, in particular the combination of high neuroticism and low extraversion, may play an important predisposing, etiological role in anxiety. Interpretations and implications of the predictive importance of the Neuroticism x Extraversion interaction in anxiety are discussed, and further speculations about the relation between anxiety and depression are put forth.

  20. Spatial Sense and Perspective: A 3-D Model of the Orion Constellation

    Science.gov (United States)

    Heyer, I.; Slater, T. F.; Slater, S. J.

    2012-08-01

    Building a scale model of the Orion constellation provides spatial perspective for students studying astronomy. For this activity, students read a passage from literature that refers to stars being strange when seen from a different point of view. From a data set of the seven major stars of Orion they construct a 3-D distance scale model. This involves the subject areas of astronomy, mathematics, literature and art, as well as the skill areas of perspective, relative distances, line-of-sight, and basic algebra. This model will appear from one side exactly the way we see it from Earth. But when looking at it from any other angle the familiar constellation will look very alien. Students are encouraged to come up with their own names and stories to go with these new constellations. This activity has been used for K-12 teacher professional development classes, and would be most suitable for grades 6-12.

  1. Gastroesophageal Variceal Bleeding as a Complication of Cystic Fibrosis in a 3-Month-Old Patient.

    Science.gov (United States)

    Motamed, Farzaneh; Fallahi, Gholamhossein; Ahmadi, Faezeh; Bazvand, Fatemeh; Ahmadi, Maedeh; Eftekhari, Kambiz; Rezaei, Nima

    2016-03-01

    Cystic fibrosis (CF) is a hereditary disease of mucous and sweat glands, which affects the respiratory and gastrointestinal systems. Herein, we describe a 3-month-old girl with a history of recurrent episodes of urinary tract infections that required hospitalization. She was referred to our center at the age of three months, with massive gastroesophageal variceal bleeding. In physical examination, she had clubbing, hepatosplenomegaly, and mild ascites. Laboratory studies revealed high serum levels of liver enzymes and low level of Albumin. As of suspicious to CF, sweat tests were performed twice which confirmed the diagnosis of CF. Gastrointestinal bleeding due to gastroesophageal varices is a rare complication of CF, which could result as a consequence of hepatobiliary involvement of disease. Early diagnosis of CF could prevent severe complications and even death in this group of patients. PMID:27107529

  2. Epidermoid cyst in the floor of the mouth of a 3-year-old.

    Science.gov (United States)

    Pascual Dabán, Rossana; García Díez, Eloy; González Navarro, Beatriz; López-López, José

    2015-01-01

    Epidermoid cysts are a rare entity in the oral cavity and are even less frequent in the floor of the mouth, representing less than 0.01% of all the cases. We present the case of a 3-year-old girl with a growth in the floor of the mouth with 2 months of evolution and without changes since it was discovered by her parents. The lesion was asymptomatic; it did not cause dysphagia, dyspnea, or any other alteration. A CT scan with contrast was done which revealed the location and exact size of the lesion, allowing an intraoral approach for its excision. The histological examination confirmed the clinical speculation of an epidermoid cyst. PMID:25694831

  3. "Intelligent design" of a 3D reflection survey for the SAFOD drill-hole site

    Science.gov (United States)

    Alvarez, G.; Hole, J. A.; Klemperer, S. L.; Biondi, B.; Imhof, M.

    2003-12-01

    SAFOD seeks to better understand the earthquake process by drilling though the San Andreas fault (SAF) to sample an earthquake in situ. To capitalize fully on the opportunities presented by the 1D drill-hole into a complex fault zone we must characterize the surrounding 3D geology at a scale commensurate with the drilling observations, to provide the structural context to extrapolate 1D drilling results along the fault plane and into the surrounding 3D volume. Excellent active-2D and passive-3D seismic observations completed and underway lack the detailed 3D resolution required. Only an industry-quality 3D reflection survey can provide c. 25 m subsurface sample-spacing horizontally and vertically. A 3D reflection survey will provide subsurface structural and stratigraphic control at the 100-m level, mapping major geologic units, structural boundaries, and subsurface relationships between the many faults that make up the SAF fault system. A principal objective should be a reflection-image (horizon-slice through the 3D volume) of the near-vertical fault plane(s) to show variations in physical properties around the drill-hole. Without a 3D reflection image of the fault zone, we risk interpreting drilled anomalies as ubiquitous properties of the fault, or risk missing important anomalies altogether. Such a survey cannot be properly costed or technically designed without major planning. "Intelligent survey design" can minimize source and receiver effort without compromising data-quality at the fault target. Such optimization can in principal reduce the cost of a 3D seismic survey by a factor of two or three, utilizing the known surface logistic constraints, partially-known sub-surface velocity field, and the suite of scientific targets at SAFOD. Our methodology poses the selection of the survey parameters as an optimization process that allows the parameters to vary spatially in response to changes in the subsurface. The acquisition geometry is locally optimized for

  4. Charge collection characterization of a 3D silicon radiation detector by using 3D simulations

    CERN Document Server

    Kalliopuska, J; Orava, R

    2007-01-01

    In 3D detectors, the electrodes are processed within the bulk of the sensor material. Therefore, the signal charge is collected independently of the wafer thickness and the collection process is faster due to shorter distances between the charge collection electrodes as compared to a planar detector structure. In this paper, 3D simulations are used to assess the performance of a 3D detector structure in terms of charge sharing, efficiency and speed of charge collection, surface charge, location of the primary interaction and the bias voltage. The measured current pulse is proposed to be delayed due to the resistance–capacitance (RC) product induced by the variation of the serial resistance of the pixel electrode depending on the depth of the primary interaction. Extensive simulations are carried out to characterize the 3D detector structures and to verify the proposed explanation for the delay of the current pulse. A method for testing the hypothesis experimentally is suggested.

  5. A 3D-Printed Oxygen Control Insert for a 24-Well Plate.

    Directory of Open Access Journals (Sweden)

    Martin D Brennan

    Full Text Available 3D printing has emerged as a method for directly printing complete microfluidic devices, although printing materials have been limited to oxygen-impermeable materials. We demonstrate the addition of gas permeable PDMS (Polydimethylsiloxane membranes to 3D-printed microfluidic devices as a means to enable oxygen control cell culture studies. The incorporation of a 3D-printed device and gas-permeable membranes was demonstrated on a 24-well oxygen control device for standard multiwell plates. The direct printing allows integrated distribution channels and device geometries not possible with traditional planar lithography. With this device, four different oxygen conditions were able to be controlled, and six wells were maintained under each oxygen condition. We demonstrate enhanced transcription of the gene VEGFA (vascular endothelial growth factor A with decreasing oxygen levels in human lung adenocarcinoma cells. This is the first 3D-printed device incorporating gas permeable membranes to facilitate oxygen control in cell culture.

  6. Investigation of the accuracy of close-range photogrammetry – a 3D printing case study

    Directory of Open Access Journals (Sweden)

    Ognjan Lužanin

    2015-12-01

    Full Text Available 3D scanning of physical objects is one of the frequently used methods for generating input data for 3D printing process. Close-range photogrammetry represents a cost-efficient alternative to conventional 3D scanning. However, one of the basic problems in application of this method is accuracy, especially in the case of small objects with complex geometry. In this case study, a 3D-printed object of small dimensions was used to test the accuracy and precision of close-range photogrammetry. CAD Inspection was used to obtain measurements of the scanned model and compare it with the original CAD model, while the results were statistically analyzed. The results of statistical analysis showed that the scanning accuracy in this experiment did not depend on the particular cross-section of the model, while the precision of 3D scanning depended on the selection of cross-sectional profile curve.

  7. Demonstration of a 3-bit optical digital-to-analog converter based on silicon microring resonators.

    Science.gov (United States)

    Yang, Lin; Ding, Jianfeng; Chen, Qiaoshan; Zhou, Ping; Zhang, Fanfan; Zhang, Lei

    2014-10-01

    We propose an N-bit optical digital-to-analog converter based on silicon microring resonators (MRRs), which can transform an N-bit electrical digital signal to an optical analog signal. A 3-bit optical digital-to-analog convertor is fabricated as proof of concept through a CMOS-compatible process on a silicon-on-insulator platform. The silicon MRRs are modulated through the electric-field-induced carrier injection in forward biased PN junctions embedded in the ring waveguides. The electro-optical 3-dB bandwidths of the silicon MRRs are approximately 800 MHz. The device works well at a speed of 500  MSample/s under driving voltage swings of 0.75 V. PMID:25360972

  8. Caries preventive effects of toothpastes containing monofluorophosphate and trimetaphosphate: a 3-year clinical trial.

    Science.gov (United States)

    Andlaw, R J; Palmer, J D; King, J; Kneebone, S B

    1983-06-01

    The caries-preventive effects of two toothpastes were tested in a 3-year clinical trial involving 1319 children aged 11-13 years. The test toothpastes were: 1) a low abrasion paste containing 0.8% sodium monofluorophosphate (MFP), and 2) a paste containing 3% sodium trimetaphosphate (TMP). The control toothpaste was a conventional, moderately abrasive paste containing 0.8% sodium monofluorophosphate. The children were examined clinically and radiologically each year. Toothpaste was supplied to the children's homes, and its use was unsupervised. Caries increments after 3 years, in terms of DMF teeth and DMF surfaces, showed no significant differences between the MFP test group (444 children) and the MFP control group (450 children). However, the TMP test group (425 children) had significantly higher caries increments than the MFP control group. All three groups of children showed some improvement in oral hygiene and in gingival health, but there were no significant differences between the groups. PMID:6342928

  9. A 3He Cryostat for Scientific Measurements in Pulsed High Magnetic Fields

    Science.gov (United States)

    Wang, Shaoliang; Li, Liang; Liu, Mengyu; Zuo, Huakun; Peng, Tao

    A top loading 3He cryostat has been developed for scientific experiments with a 60 T pulsed magnetic field facility at Wuhan National High Magnetic Field Center. The cryostat consists of a 4He bath cryostat, a 3He insert and a closed circulation system for 3He gas handling. To eliminate the eddy current heating during the pulse, the tail of the 3He insert with a vacuum space at the bottom is made from fiberglass tubing coated with epoxy. The 3He bath is separated from the 4He bath with the vacuum space. The 4He bath cryostat provides cooling power to condense 3He gas by a neck tube on top of the tail. Experimental results have shown that the sample can be cooled down to 385 mK and kept cold for more than 150 second by one-shot cooling, which is sufficiently long for an experiment in a pulsed high magnetic field.

  10. Calculation of residual stresses by means of a 3D numerical weld simulation

    Energy Technology Data Exchange (ETDEWEB)

    Nicak, Tomas; Huemmer, Matthias [AREVA NP GmbH, Postfach 1109 (Germany)

    2008-07-01

    The numerical weld simulation has developed very fast in recent years. The problem complexity has increased from simple 2D models to full 3D models, which can describe the entire welding process more realistically. As recent research projects indicate, a quantitative assessment of the residual stresses by means of a 3D analysis is possible. The structure integrity can be assessed based on the weld simulation results superimposed with the operating load. Moreover, to support the qualification of welded components parametric studies for optimization of the residual stress distribution in the weld region can be performed. In this paper a full 3D numerical weld simulation for a man-hole drainage nozzle in a steam generator will be presented. The residual stresses are calculated by means of an uncoupled transient thermal and mechanical FE analysis. The paper will present a robust procedure allowing reasonable predictions of the residual stresses for complex structures in industrial practice. (authors)

  11. Development of generic key performance indicators for PMBOK® using a 3D project integration model

    Directory of Open Access Journals (Sweden)

    Craig Langston

    2013-12-01

    Full Text Available Since Martin Barnes’ so-called ‘iron triangle’ circa 1969, much debate has occurred over how best to describe the fundamental constraints that underpin project success. This paper develops a 3D project integration model for PMBOK® comprising core constraints of scope, cost, time and risk as a basis to propose six generic key performance indicators (KPIs that articulate successful project delivery. These KPIs are defined as value, efficiency, speed, innovation, complexity and impact and can each be measured objectively as ratios of the core constraints. An overall KPI (denoted as s3/ctr is also derived. The aim in this paper is to set out the case for such a model and to demonstrate how it can be employed to assess the performance of project teams in delivering successful outcomes at various stages in the project life cycle. As part of the model’s development, a new PMBOK® knowledge area concerning environmental management is advanced.

  12. A 3-D Global History from a Glober Identity ina Noncentric and Holistic Perspective

    Institute of Scientific and Technical Information of China (English)

    2014-01-01

    In modern times, global and world history has been understood, writtenand taught from either a national perspective or a regional/cultural/ideological one in the light of centrism such as West/Eurocentrism eversince it was created. The author argues, in a noncentric and holisticperspective, that nationalized global or world histories are nothingbut distorting mirrors full of pride and prejudice. It is argued that bothobjective global history and subjective global history are contingentresultants in a certain special and temporal context. In the early 21stcentury, the author heralds a globalization of global history and "GlobalHistorians of All Countries Unite!" He also suggests that it is necessaryfor a global historian to develop a glober identity beyond her/hisnational identity and that a reasonable and intelligible global historywhich is closer to the objective global history should be a 3-D globalhistory of the glober, by the glober, for the glober.

  13. Concurrent validity of the GMS-AGECAT (A3) package in a Danish nursing home population

    DEFF Research Database (Denmark)

    Sørensen, Lisbeth; Foldspang, Anders; Gulman, N.C.;

    1998-01-01

    Aim. To validate the Danish version of the GMS–AGECAT (A3), the Standardized Mini Mental State Examination (SMMSE) and the Geriatric Depression Scale-15 (GDS-15) by comparing them to clinical ICD-10 criteria in a Danish nursing home population. Methods. With a participation of 91%, the study....... The prevalence of clinical psychiatric ICD-10 main diagnoses was 56%. The non-accessibles had significantly higher psychiatric morbidity and lower ADL scores (modified Barthel ADL index) compared to those who were able to communicate. With the non-accessibles (N=100) included, the optimal screening...... residents were able to complete the SMMSE and 78% were able to complete the GDS-15. Conclusion. The Danish version of the GMS–AGECAT has relevant diagnostic and screening properties for organic disorders in Danish nursing home populations....

  14. Car-borne survey measurements with a 3x3` NaI detector

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, E.; Ugletveit, F.; Floe, L.; Mikkelborg, O. [Norwegian Radiation Protection Authority, Oesteraas (Norway)

    1997-12-31

    The Norwegian Radiation Protection Authority (NRPA) took part in the international survey measurement exercise RESUME95 that was arranged in Finland in August 1995. NRPA performed measurements with a simple car-borne measuring system based on standard equipment, a 3x3` NaI detector, an MCA and a GPS connected to a portable PC. The results show substantial variations in dose rate inside areas of a few square kilometres. Spectrum analysis shows that a major part of these differences are caused by variations in deposition of {sup 137}Cs. Our results show that even standard 3x3` NaI detectors can be used for car based survey measurements in fall out situations and search for sources. The detection limits are higher than for larger detectors, but the main limiting factor seem to be the timing capabilities of the acquisition system. (au).

  15. A 3D City Model Used as User-interface for an Energy-System

    DEFF Research Database (Denmark)

    Kjems, Erik; Wen, Wan

    At CUPUM 2009 the project “Object Oriented Visualization of Urban Energy Consumption” was presented, explaining the technology behind the visualization of an energy-model connected to a 3D city model. This paper presents the subsequent work involving the final design, the user involvement...... of combinations of the energy-consumption and energy-production for an entire city. The interface was supposed to help especially nonprofessionals, among them politicians, to better perceive the numbers and graphs adjoining the 3D model in a combined view. Only very few systems have been developed for this kind...... of interaction, why the design guide lines for this development was a mix of believe and trial and error. To minimize the developing time and induce a steeper learning curve, it was obvious to use similar techniques for the different inputs and controls. Though the energy model, behind the visualization, could...

  16. A 3D City Model as User Interface Connected to an Energy Model

    DEFF Research Database (Denmark)

    Kjems, Erik; Østergaard, Poul Alberg

    2014-01-01

    it a project for the citizens of Frederikshavn. One result of this decision was an interactive Web application developed at Aalborg University. The application uses a 3D city model of the city of Frederikshavn as interface and gives the possibility to alter inputs for the energy consumption and energy......Back in 2007 the municipality of Frederikshavn in Northern Jutland in Denmark decided to use only 100% renewable energy for electricity, heat and transport by the year of 2015. Frederikshavn, the largest city in the municipality, was naturally chosen as case city. To be able to verify whether...... the green energy balance is possible to achieve, it was necessary to create energy scenarios for the whole city and also give the possibility to alter the current energy production and consumption. At the same time the city decided to involve as many people living in the city as possible, making...

  17. Mobilities and dislocation energies of planar faults in an ordered A3B (D019) structure

    Indian Academy of Sciences (India)

    A K Singh; R Sankarasubramanian; T K Nandy

    2013-08-01

    Present work describes the stability of possible planar faults of the A3B (D019) phase with an axial ratio less than the ideal. Mobilities and dislocation energies of various planar faults viz. antiphase boundaries (APBs), superlattice intrinsic stacking faults (SISFs) and complex stacking faults (CSFs) have been computed using complex fourth-order tensor transformations and hard sphere model. Displacements normal to the slip planes for various slip systems (vertical shift) have been used to calculate mobility of dislocations. The energy of the planar faults in Ti3Al intermetallic is calculated using some simplifying assumptions. Based on the mobility and energy, stability of planar faults has been explained. These results are compared with single crystal ordered Ti3Al alloy having D019 structure.

  18. Computational Finite Element Software Assisted Development of a 3D Inductively Coupled Power Transfer System

    Directory of Open Access Journals (Sweden)

    Pratik Raval

    2014-02-01

    Full Text Available To date inductively coupled power transfer (ICPT systems have already found many practical applications including battery charging pads. In fact, current charging platforms tend to largely support only one- or two-dimensional planar movement in load. This paper proposes a new concept of extending the aspect ratios of the operating power transfer volume of ICPT systems to support arbitrary three dimensional load movements with respect to the primary coils. This is done by use of modern finite element method analysis software to propose the primary and secondary magnetic structures of such an ICPT system. Firstly, two primary magnetic structures are proposed based on contrasting modes of operation and different field directions. This includes a single-phase and multi-phase current model. Next, a secondary magnetic structure is customized to be compatible with both primary structures. The resulting system is shown to produce a 3D power transfer volume for battery cell charging applications.

  19. Design and Control of a 3 kW Wireless Power Transfer System for Electric Vehicles

    Directory of Open Access Journals (Sweden)

    Zhenshi Wang

    2015-12-01

    Full Text Available This paper aims to study a 3 kW wireless power transfer system for electric vehicles. First, the LCL-LCL topology and LC-LC series topology are analyzed, and their transfer efficiencies under the same transfer power are compared. The LC-LC series topology is validated to be more efficient than the LCL-LCL topology and thus is more suitable for the system design. Then a novel q-Zsource-based online power regulation method which employs a unique impedance network (two pairs of inductors and capacitors to couple the cascaded H Bridge to the power source is proposed. By controlling the shoot-through state of the H Bridge, the charging current can be adjusted, and hence, transfer power. Finally, a prototype is implemented, which can transfer 3 kW wirelessly with ~95% efficiency over a 20 cm transfer distance.

  20. Ratchet rotation of a 3D dimer on a vibrating plate.

    Science.gov (United States)

    Wang, Jiao; Liu, Caishan; Jia, Yan-Bin; Ma, Daolin

    2014-01-01

    This work studies the dynamics of a 3D dimer bouncing upon a horizontal plate undergoing a vertical harmonic vibration. Despite complex interactions within the system due to impacts and friction, numerical simulation shows that, under certain conditions prescribed for the dynamics, the center of mass of the dimer, when projected onto a horizontal plane, will follow a circular orbit. The phenomenon is like a particle under Coulomb friction performing a ratchet motion that rotates around. Investigations further reveal that the dimer dynamics bear some typical characteristics of a nonlinear system, including sensitivity to the initial conditions and bifurcation behaviors related to the physical parameters of the dynamics. Our results indicate that the coefficient of restitution and the plate's vibration intensity play critical roles in exciting the circular orbit, while the dimer's geometry and the vibration frequency mainly influence the trajectory characteristics. These findings may help understand transport mechanisms underlying systems of granular matter with anisotropic particles. PMID:24458553

  1. Nanoimprint of a 3D structure on an optical fiber for light wavefront manipulation.

    Science.gov (United States)

    Calafiore, Giuseppe; Koshelev, Alexander; Allen, Frances I; Dhuey, Scott; Sassolini, Simone; Wong, Edward; Lum, Paul; Munechika, Keiko; Cabrini, Stefano

    2016-09-16

    Integration of complex photonic structures onto optical fiber facets enables powerful platforms with unprecedented optical functionalities. Conventional nanofabrication technologies, however, do not permit viable integration of complex photonic devices onto optical fibers owing to their low throughput and high cost. In this paper we report the fabrication of a three-dimensional structure achieved by direct nanoimprint lithography on the facet of an optical fiber. Nanoimprint processes and tools were specifically developed to enable a high lithographic accuracy and coaxial alignment of the optical device with respect to the fiber core. To demonstrate the capability of this new approach, a 3D beam splitter has been designed, imprinted and optically characterized. Scanning electron microscopy and optical measurements confirmed the good lithographic capabilities of the proposed approach as well as the desired optical performance of the imprinted structure. The inexpensive solution presented here should enable advancements in areas such as integrated optics and sensing, achieving enhanced portability and versatility of fiber optic components.

  2. Testing of a 3 tesla superconducting magnet for the AMY detector at TRISTAN

    International Nuclear Information System (INIS)

    A 3 tesla magnet was constructed and installed in an experimental hall at TRISTAN. Cooldown and excitation tests of the magnet were carried out with a dedicated cryogenic system. The coil has a 2.39 m inner diameter and is 1.54 m long with a radial thickness of 0.1 m. The rated current is 5 kA and the stored energy is 40 MJ. The refrigerator and 17-ton magnet cold mass were cooled to 4.4 K in seven days. Then the magnet was energized to the design current of 5 kA and the mechanical stress of the coil supports was measured. The stress on the supports was well below the allowed maximum. Measurements of the discharge characteristics of the magnet confirmed that the magnet was stable and reliable

  3. Dynamics and Stability of Blind Grasping of a 3-Dimensional Object under Non-holonomic Constraints

    Institute of Scientific and Technical Information of China (English)

    Suguru Arimoto; Morio Yoshida; Ji-Hun Bae

    2006-01-01

    A mathematical model expressing the motion of a pair of multi-DOF robot fingers with hemi-spherical ends,grasping a 3-D rigid object with parallel flat surfaces, is derived, together with non-holonomic constraints. By referring to the fact that humans grasp an object in the form of precision prehension, dynamically and stably by opposable forces, between the thumb and another finger (index or middle finger), a simple control signal constructed from finger-thumb opposition is proposed, and shown to realize stable grasping in a dynamic sense without using object information or external sensing (this is called "blind grasp" in this paper). The stability of grasping with force/torque balance under non-holonomic constraints is analyzed on the basis of a new concept named "stability on a manifold". Preliminary simulation results are shown to verify the validity of the theoretical results.

  4. Metal-mesh based transparent electrode on a 3-D curved surface by electrohydrodynamic jet printing

    Science.gov (United States)

    Seong, Baekhoon; Yoo, Hyunwoong; Dat Nguyen, Vu; Jang, Yonghee; Ryu, Changkook; Byun, Doyoung

    2014-09-01

    Invisible Ag mesh transparent electrodes (TEs), with a width of 7 μm, were prepared on a curved glass surface by electrohydrodynamic (EHD) jet printing. With a 100 μm pitch, the EHD jet printed the Ag mesh on the convex glass which had a sheet resistance of 1.49 Ω/□. The printing speed was 30 cm s-1 using Ag ink, which had a 10 000 cPs viscosity and a 70 wt% Ag nanoparticle concentration. We further showed the performance of a 3-D transparent heater using the Ag mesh transparent electrode. The EHD jet printed an invisible Ag grid transparent electrode with good electrical and optical properties with promising applications on printed optoelectronic devices.

  5. Thermomechanical effects on permeability for a 3-D model of YM rock

    International Nuclear Information System (INIS)

    The authors estimate how thermomechanical processes affect the spatial variability of fracture permeability for a 3-D model representing Topopah Spring tuff at the nuclear-waste repository horizon in Yucca Mountain, Nevada. Using a finite-difference code, they compute thermal stress changes. They evaluate possible permeability enhancement resulting from shear slip along various mapped fracture sets after 50 years of heating, for rock in the near-field environment of the proposed repository. The results indicate permeability enhancement of a factor of 2 for regions about 10 to 30 m above drifts, for north-south striking vertical fractures. Shear slip and permeability increases of a factor of 4 can occur in regions just above drifts, for east-west striking vertical fractures. Information on how permeability may change over the lifetime of a geologic repository is important to the prediction and evaluation of repository performance

  6. Dimensional synthesis of a 3-DOF parallel manipulator based on dimensionally homogeneous Jacobian matrix

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    A study of dimensional synthesis of a 3-DOF parallel manipulator with coupling of translation and rotation is carried out.The architecture of the manipulator is composed of a moving platform attached to a fixed base through three identical PRS(prismatic-revolute-spherical) serial limbs,whose unique topology leads to the physical unit inconsistency of the conventional Jacobian matrix and the emergence of the parasitic motion.Then this paper introduces a kinetostatic performance index of the manipulator based on the condition of a dimensionally homogeneous Jacobian matrix,later,the workspace of the aforementioned manipulator is searched and the influence of the crucial design variables on the workspace is analyzed.Finally,a dimensional synthesis method of the manipulator is proposed,which may be regarded as a nonlinear programming problem with subject to the parasitic motion and other several engineering constraints.

  7. Large-scale Inference Problems in Astronomy: Building a 3D Galactic Dust Map

    Science.gov (United States)

    Finkbeiner, Douglas

    2016-03-01

    The term ''Big Data'' has become trite, as modern technology has made data sets of terabytes or even petabytes easy to store. Such data sets provide a sandbox in which to develop new statistical inference techniques that can extract interesting results from increasingly rich (and large) databases. I will give an example from my work on mapping the interstellar dust of the Milky Way. 2D emission-based maps have been used for decades to estimate the reddening and emission from interstellar dust, with applications from CMB foregrounds to surveys of large-scale structure. For studies within the Milky Way, however, the third dimension is required. I will present our work on a 3D dust map based on Pan-STARRS1 and 2MASS over 3/4 of the sky (http://arxiv.org/abs/1507.01005), assess its usefulness relative to other dust maps, and discuss future work. Supported by the NSF.

  8. Development of a 3 MJ/750 kVA SMES system

    Energy Technology Data Exchange (ETDEWEB)

    Hae-Jong Kim; Ki-Chul Seong; Jeon-Wook Cho [Korea Electrotechnology Research Institute, Changwon (KR). Applied Superconductivity Group] (and others)

    2006-05-15

    Research and development on superconducting magnetic energy storage (SMES) system have been carried out to realize efficient electric power management for several decades. Korea Electrotechnology Research Institute (KERI) has developed a 3 MJ/750 kVA SMES system to improve power quality in sensitive electric loads. It consists of an IGBT based power converter, NbTi mixed matrix Rutherford cable superconducting magnet and a cryostat with HTS current leads. A computer code was developed to find the parameters of the SMES magnet which used minimum amount of superconductors for the same energy storage capability, and the 3 MJ SMES magnet was designed based upon that. This paper describes the fabrication and experimental results of the 3 MJ/750 kVA SMES system. (author)

  9. Efficient UAV Path Planning with Multiconstraints in a 3D Large Battlefield Environment

    Directory of Open Access Journals (Sweden)

    Weiwei Zhan

    2014-01-01

    Full Text Available This study introduces an improved A* algorithm for the real-time path planning of Unmanned Air Vehicles (UAVs in a 3D large-scale battlefield environment to solve the problem that UAVs require high survival rates and low fuel consumption. The algorithm is able to find the optimal path between two waypoints in the target space and comprehensively takes factors such as altitude, detection probability, and path length into account. It considers the maneuverability constraints of the UAV, including the safety altitude, climb rate, and turning radius, to obtain the final flyable path. Finally, the authors test the algorithm in an approximately 2,500,000 square meter area containing radars, no-fly zones, and extreme weather conditions to measure its feasibility, stability, and efficiency.

  10. Nanoimprint of a 3D structure on an optical fiber for light wavefront manipulation

    Science.gov (United States)

    Calafiore, Giuseppe; Koshelev, Alexander; Allen, Frances I.; Dhuey, Scott; Sassolini, Simone; Wong, Edward; Lum, Paul; Munechika, Keiko; Cabrini, Stefano

    2016-09-01

    Integration of complex photonic structures onto optical fiber facets enables powerful platforms with unprecedented optical functionalities. Conventional nanofabrication technologies, however, do not permit viable integration of complex photonic devices onto optical fibers owing to their low throughput and high cost. In this paper we report the fabrication of a three-dimensional structure achieved by direct nanoimprint lithography on the facet of an optical fiber. Nanoimprint processes and tools were specifically developed to enable a high lithographic accuracy and coaxial alignment of the optical device with respect to the fiber core. To demonstrate the capability of this new approach, a 3D beam splitter has been designed, imprinted and optically characterized. Scanning electron microscopy and optical measurements confirmed the good lithographic capabilities of the proposed approach as well as the desired optical performance of the imprinted structure. The inexpensive solution presented here should enable advancements in areas such as integrated optics and sensing, achieving enhanced portability and versatility of fiber optic components.

  11. Nanoimprint of a 3D structure on an optical fiber for light wavefront manipulation

    CERN Document Server

    Calafiore, Giuseppe; Allen, Frances I; Dhuey, Scott; Sassolini, Simone; Wong, Edward; Lum, Paul; Munechika, Keiko; Cabrini, Stefano

    2016-01-01

    Integration of complex photonic structures onto optical fiber facets enables powerful platforms with unprecedented optical functionalities. Conventional nanofabrication technologies, however, do not permit viable integration of complex photonic devices onto optical fibers owing to their low throughput and high cost. In this paper we report the fabrication of a three dimensional structure achieved by direct Nanoimprint Lithography on the facet of an optical fiber. Nanoimprint processes and tools were specifically developed to enable a high lithographic accuracy and coaxial alignment of the optical device with respect to the fiber core. To demonstrate the capability of this new approach, a 3D beam splitter has been designed, imprinted and optically characterized. Scanning electron microscopy and optical measurements confirmed the excellent lithographic capabilities of the proposed approach as well as the desired optical performance of the imprinted structure. The inexpensive solution presented here should enabl...

  12. Building an Orthonormal Basis from a 3D Unit Vector Without Normalization

    DEFF Research Database (Denmark)

    Frisvad, Jeppe Revall

    2012-01-01

    vector. This is useful in Monte Carlo rendering techniques, such as path tracing, where directions are usually sampled in spherical coordinates and then transformed to a Cartesian unit vector in a local coordinate system where the zenith direction is the z -axis. The second tool is a more general result...... extracted from the first formula, namely a faster way of building an orthonormal basis from a 3D unit vector. These tools require fewer arithmetic operations than other methods I am aware of, and a performance test of the more general tool confirms that it is faster.......I present two tools that save the computation of a dot product and a reciprocal square root in operations that are used frequently in the core of many rendering programs. The first tool is a formula for rotating a direction sampled around the z -axis to a direction sampled around an arbitrary unit...

  13. A 3D discrete model of the diaphragm and human trunk

    CERN Document Server

    Promayon, Emmanuel

    2008-01-01

    In this paper, a 3D discrete model is presented to model the movements of the trunk during breathing. In this model, objects are represented by physical particles on their contours. A simple notion of force generated by a linear actuator allows the model to create forces on each particle by way of a geometrical attractor. Tissue elasticity and contractility are modeled by local shape memory and muscular fibers attractors. A specific dynamic MRI study was used to build a simple trunk model comprised of by three compartments: lungs, diaphragm and abdomen. This model was registered on the real geometry. Simulation results were compared qualitatively as well as quantitatively to the experimental data, in terms of volume and geometry. A good correlation was obtained between the model and the real data. Thanks to this model, pathology such as hemidiaphragm paralysis can also be simulated.

  14. Improving object detection in 2D images using a 3D world model

    Science.gov (United States)

    Viggh, Herbert E. M.; Cho, Peter L.; Armstrong-Crews, Nicholas; Nam, Myra; Shah, Danelle C.; Brown, Geoffrey E.

    2014-05-01

    A mobile robot operating in a netcentric environment can utilize offboard resources on the network to improve its local perception. One such offboard resource is a world model built and maintained by other sensor systems. In this paper we present results from research into improving the performance of Deformable Parts Model object detection algorithms by using an offboard 3D world model. Experiments were run for detecting both people and cars in 2D photographs taken in an urban environment. After generating candidate object detections, a 3D world model built from airborne Light Detection and Ranging (LIDAR) and aerial photographs was used to filter out false alarm using several types of geometric reasoning. Comparison of the baseline detection performance to the performance after false alarm filtering showed a significant decrease in false alarms for a given probability of detection.

  15. Nephrotic Syndrome Following H1N1 Influenza in a 3-Year-Old Boy

    Directory of Open Access Journals (Sweden)

    Pio Liberatore

    2012-06-01

    Full Text Available Background: The pandemic influenza A/H1N1, spread through the world in 2009, producing a serious epidemic in Italy. Complications are generally limited to patients at the extremes of age (65years and those with comorbid medical illness. The most frequent complications of influenza involve the respiratory system.Case Presentation: A 3-year-old boy with a recent history of upper respiratory tract infection developed a nephrotic syndrome. Together with prednisone, furosemide and albumin bolus, a therapy with oseltamivir was started since the nasopharyngeal swab resulted positive for influenza A/H1N1. Clinical conditions andlaboratory findings progressively improved during hospitalization, becoming normal during a 2 month follow up.Conclusion: The possibility of a renal involvement after influenza A/H1N1 infection should be considered.

  16. Pirâmide alimentar para crianças de 2 a 3 anos

    Directory of Open Access Journals (Sweden)

    Philippi Sonia Tucunduva

    2003-01-01

    Full Text Available Com a finalidade de promover orientação nutricional e hábitos alimentares saudáveis para crianças de 2 a 3 anos de idade, fez-se a adaptação da Pirâmide Alimentar. A pirâmide foi baseada em dieta padrão (1300kcal com seis refeições, calculada de acordo com as recomendações para a idade. As porções e os equivalentes foram estabelecidos de acordo com o total de energia de cada alimento utilizando-se o software Virtual Nutri. Foi avaliada a distribuição percentual dos macronutrientes em relação ao valor energético total, obtendo-se 15% para proteínas, 59% para carboidratos e 26% para lipídios. Foram calculados ainda os valores para ferro total e ferro biodisponível. Os alimentos estão organizados em oito grupos: arroz, pão, massa, batata, mandioca (5 porções, verduras e legumes (3 porções, frutas (3 porções, carnes e ovos (2 porções, leite, queijo e iogurte (3 porções, feijões (1 porção, óleos e gorduras (1 porção e açúcares e doces (1 porção. A pirâmide alimentar apresenta-se como um instrumento importante para orientação nutricional, servindo como guia para o planejamento de uma alimentação saudável para crianças de 2 a 3 anos de idade.

  17. Development of a 3-dimensional seismic isolation floor for computer systems

    International Nuclear Information System (INIS)

    In this paper, we investigated the applicability of a seismic isolation floor as a method for protecting computer systems from strong earthquakes, such as computer systems in nuclear power plants. Assuming that the computer system is guaranteed for 250 cm/s2 of input acceleration in the horizontal and vertical directions as the seismic performance, the basic design specification of the seismic isolation floor is considered as follows. Against S1 level earthquakes, the maximum acceleration response of the seismic isolation floor in the horizontal and vertical directions is kept less than 250 cm/s2 to maintain continuous computer operation. Against S2 level earthquakes, the isolation floor allows large horizontal movement and large displacement of the isolation devices to reduce the acceleration response, although it is not guaranteed to be less than 250 cm/s2. By reducing the acceleration response, however, serious damage to the computer systems is reduced, so that they can be restarted after an earthquake. Usually, seismic isolation floor systems permit 2-dimensional (horizontal) isolation. However, in the case of just-under-seated earthquakes, which have large vertical components, the vertical acceleration response of this system is amplified by the lateral vibration of the frame of the isolation floor. Therefore, in this study a 3-dimensional seismic isolation floor, including vertical isolation, was developed. This paper describes 1) the experimental results of the response characteristics of the 3-dimensional seismic isolation floor built as a trial using a 3-dimensional shaking table, and 2) comparison of a 2-dimensional analytical model, for motion in one horizontal direction and the vertical direction, to experimental results. (J.P.N.)

  18. Living with diabetes—Development of learning patterns over a 3-year period

    Directory of Open Access Journals (Sweden)

    Åsa Kneck

    2014-07-01

    Full Text Available Background: Learning involves acquiring new knowledge and skills, and changing our ways of thinking, acting, and feeling. Learning in relation to living with diabetes is a lifelong process where there is limited knowledge of how it is experienced and established over time. It was considered important to explore how learning was developed over time for persons living with diabetes. Aim: The aim of the study was to identify patterns in learning when living with diabetes, from recently being diagnosed, and over a 3-year period. Materials and methods: A longitudinal qualitative descriptive design was used. Thirteen participants, with both type I and type II diabetes, were interviewed at three different occasions during a 3-year period. Qualitative content analysis was used in different steps in order to distinguish patterns. Findings: Five main patterns of learning were identified. Two of the patterns (I and II were characterized by gradually becoming comfortable living with diabetes, whereas for one pattern (IV living with diabetes became gradually more difficult. For pattern V living with diabetes was making only a limited impact on life, whereas for Pattern III there was a constant management of obstacles related to illness. The different patterns in the present study showed common and different ways of learning and using different learning strategies at different timespans. Conclusion: The present study showed that duration of illness is not of importance for how far a person has come in his own learning process. A person-centered care is needed to meet the different and changing needs of persons living with diabetes in relation to learning to live with a lifelong illness.

  19. Treating fibromyalgia with mindfulness-based stress reduction: results from a 3-armed randomized controlled trial.

    Science.gov (United States)

    Schmidt, Stefan; Grossman, Paul; Schwarzer, Barbara; Jena, Susanne; Naumann, Johannes; Walach, Harald

    2011-02-01

    Mindfulness-based stress reduction (MBSR) is a structured 8-week group program teaching mindfulness meditation and mindful yoga exercises. MBSR aims to help participants develop nonjudgmental awareness of moment-to-moment experience. Fibromyalgia is a clinical syndrome with chronic pain, fatigue, and insomnia as major symptoms. Efficacy of MBSR for enhanced well-being of fibromyalgia patients was investigated in a 3-armed trial, which was a follow-up to an earlier quasi-randomized investigation. A total of 177 female patients were randomized to one of the following: (1) MBSR, (2) an active control procedure controlling for nonspecific effects of MBSR, or (3) a wait list. The major outcome was health-related quality of life (HRQoL) 2 months post-treatment. Secondary outcomes were disorder-specific quality of life, depression, pain, anxiety, somatic complaints, and a proposed index of mindfulness. Of the patients, 82% completed the study. There were no significant differences between groups on primary outcome, but patients overall improved in HRQoL at short-term follow-up (P=0.004). Post hoc analyses showed that only MBSR manifested a significant pre-to-post-intervention improvement in HRQoL (P=0.02). Furthermore, multivariate analysis of secondary measures indicated modest benefits for MBSR patients. MBSR yielded significant pre-to-post-intervention improvements in 6 of 8 secondary outcome variables, the active control in 3, and the wait list in 2. In conclusion, primary outcome analyses did not support the efficacy of MBSR in fibromyalgia, although patients in the MBSR arm appeared to benefit most. Effect sizes were small compared to the earlier, quasi-randomized investigation. Several methodological aspects are discussed, e.g., patient burden, treatment preference and motivation, that may provide explanations for differences. In a 3-armed randomized controlled trial in female patients suffering from fibromyalgia, patients benefited modestly from a mindfulness

  20. Targeted deletion of the metastasis-associated phosphatase Ptp4a3 (PRL-3) suppresses murine colon cancer.

    Science.gov (United States)

    Zimmerman, Mark W; Homanics, Gregg E; Lazo, John S

    2013-01-01

    Ptp4a3 (commonly known as PRL-3) is an enigmatic member of the Ptp4a family of prenylated protein tyrosine phosphatases that are highly expressed in many human cancers. Despite strong correlations with tumor metastasis and poor patient prognosis, there is very limited understanding of this gene family's role in malignancy. Therefore, we created a gene-targeted murine knockout model for Ptp4a3, the most widely studied Ptp4a family member. Mice deficient for Ptp4a3 were grossly normal. Fewer homozygous-null males were observed at weaning, however, and they maintained a decreased body mass. Although Ptp4a3 is normally associated with late-stage cancer and metastasis, we observed increased Ptp4a3 expression in the colon of wildtype mice immediately following treatment with the carcinogen azoxymethane. To investigate the role of Ptp4a3 in malignancy, we used the most commonly studied murine colitis-associated colon cancer model. Wildtype mice treated with azoxymethane and dextran sodium sulfate developed approximately 7-10 tumors per mouse in the distal colon. The resulting tumor tissue had 4-fold more Ptp4a3 mRNA relative to normal colon epithelium and increased PTP4A3 protein. Ptp4a3-null mice developed 50% fewer colon tumors than wildtype mice after exposure to azoxymethane and dextran sodium sulfate. Tumors from the Ptp4a3-null mice had elevated levels of both IGF1Rβ and c-MYC compared to tumors replete with Ptp4a3, suggesting an enhanced cell signaling pathway engagement in the absence of the phosphatase. These results provide the first definitive evidence implicating Ptp4a3 in colon tumorigenesis and highlight the potential value of the phosphatase as a therapeutic target for early stage malignant disease.

  1. Evaluation of finger A3 pulley rupture in the crimp grip position - a magnetic resonance imaging cadaver study

    Energy Technology Data Exchange (ETDEWEB)

    Bayer, Thomas; Uder, Michael; Janka, Rolf [University of Erlangen-Nuremberg, Department of Radiology, Erlangen (Germany); Adler, Werner [University of Erlangen-Nuremberg, Department of Biometry and Epidemiology, Erlangen (Germany); Schweizer, Andreas [Balgrist, University of Zurich, Department of Orthopaedics, Zurich (Switzerland); Schoeffl, Isabelle [Klinikum Bamberg, Department of Pediatrics, Bamberg (Germany)

    2015-09-15

    The correct diagnosis of an A3 pulley rupture is challenging for musculoskeletal radiologists. An A3 pulley rupture should in theory influence the shape of the proximal interphalangeal joint volar plate (VP) and the amount of bowstringing at level of the VP during finger flexion. The purpose of this study was to perform MRI with metric analysis of the VP configuration and VP bowstringing in cadaver fingers in the crimp grip position and to determine cut points for A3 pulley rupture. MRI in the crimp grip position was performed in 21 cadaver fingers with artificially created flexor tendon pulley tears (fingers with A3 pulley rupture n = 16, fingers without A3 pulley rupture n = 5). The distances of the translation of the VP relative to the middle phalanx base, the distances between the flexor tendons and the VP body, and the distances between the flexor tendon and bone (TB) were measured. Statistical analysis showed significantly lower VP translation distances and significantly higher VP tendon distances if the A3 pulley was ruptured. A2 TB and A4 TB distances did not differ significantly in specimens with and without A3 pulley rupture. The optimal cut points for A3 pulley rupture were a VP translation distance <2.8 mm and a VP tendon distance >1.4 mm. Reduction of the VP translation distance and augmentation of the VP tendon distance are suitable indirect signs of A3 pulley rupture. (orig.)

  2. Nucleoside-derived antagonists to A3 adenosine receptors lower mouse intraocular pressure and act across species.

    Science.gov (United States)

    Wang, Zhao; Do, Chi Wai; Avila, Marcel Y; Peterson-Yantorno, Kim; Stone, Richard A; Gao, Zhan-Guo; Joshi, Bhalchandra; Besada, Pedro; Jeong, Lak Shin; Jacobson, Kenneth A; Civan, Mortimer M

    2010-01-01

    The purpose of the study was to determine whether novel, selective antagonists of human A3 adenosine receptors (ARs) derived from the A3-selective agonist Cl-IB-MECA lower intraocular pressure (IOP) and act across species. IOP was measured invasively with a micropipette by the Servo-Null Micropipette System (SNMS) and by non-invasive pneumotonometry during topical drug application. Antagonist efficacy was also assayed by measuring inhibition of adenosine-triggered shrinkage of native bovine nonpigmented ciliary epithelial (NPE) cells. Five agonist-based A3AR antagonists lowered mouse IOP measured with SNMS tonometry by 3-5 mm Hg within minutes of topical application. Of the five agonist derivatives, LJ 1251 was the only antagonist to lower IOP measured by pneumotonometry. No effect was detected pneumotonometrically over 30 min following application of the other four compounds, consonant with slower, smaller responses previously measured non-invasively following topical application of A3AR agonists and the dihydropyridine A3AR antagonist MRS 1191. Latanoprost similarly lowered SNMS-measured IOP, but not IOP measured non-invasively over 30 min. Like MRS 1191, agonist-based A3AR antagonists applied to native bovine NPE cells inhibited adenosine-triggered shrinkage. In summary, the results indicate that antagonists of human A3ARs derived from the potent, selective A3 agonist Cl-IB-MECA display efficacy in mouse and bovine cells, as well. When intraocular delivery was enhanced by measuring mouse IOP invasively, five derivatives of the A3AR agonist Cl-IB-MECA lowered IOP but only one rapidly reduced IOP measured non-invasively after topical application. We conclude that derivatives of the highly-selective A3AR agonist Cl-IB-MECA can reduce IOP upon reaching their intraocular target, and that nucleoside-based derivatives are promising A3 antagonists for study in multiple animal models. PMID:19878673

  3. Comparative heart failure profile over a 3-year period in a Romanian general hospital

    Directory of Open Access Journals (Sweden)

    Pop D

    2013-07-01

    Full Text Available Dana Pop,1 Oana Maria Penciu,1 Adela Viviana Sitar-Taut,2 Dumitru Tudor Zdrenghea11Department of Cardiology, Clinical Rehabilitation Hospital, "Iuliu Hatieganu" University of Medicine and Pharmacy, Cluj-Napoca, Romania; 2"Babes-Bolyai" University, Cluj-Napoca, RomaniaBackground: Heart failure (HF has become an increasingly significant public health problem, associated with repeated hospitalizations, high costs, low quality of life, and decreased survival rate. The progress of the disease may be slowed if treatment is administered in accordance with current guidelines.Objectives: To compare the clinical profile of HF patients in a Romanian general hospital over a 3-year period.Methods and results: We studied two cohorts of patients admitted in the cardiology department of a rehabilitation hospital with a diagnosis of chronic HF New York Heart Association class II–IV. The first, in 2006, included 415 patients, 67.08 ± 10.59 years; the second, in 2009, included 500 patients, 67.31 ± 11.27 years. Considering all patients, the left ventricle ejection fraction (LVEF was not statistically different in the two cohorts. Compared to the 2006 cohort, the 2009 female cohort had higher LVEF (60.49% ± 13.41% vs 64.42% ± 13.79%, P < 0.05, while males over 65 years of age had lower LVEF (52.75% ± 15.02% vs 54.37% ± 15.23%, P = NS. For females, the probability of having LVEF ,45% was higher in 2006 (odds ratio = 1.573. HF with preserved LVEF was more common in females, both in 2006 (78.2% vs 54.2% and 2009 (87.2% vs 57.3%. In the 2009 cohort, LVEF was higher both in young patients (59.08% ± 14.22% vs 55.35% ± 14.92% and patients ≥ than 75 years of age (62.28% ± 13.81% vs 56.79% ± 14.81% compared to the 2006 cohort. Ischemic heart disease was the main underlying cause for HF in both cohorts.Conclusion: HF appeared to have the same clinical profile over a 3-year period. Females diagnosed with HF showed higher rates of preserved LVEF.Keywords: heart

  4. Toward A 3-D Picture of Hydraulic Conductivity With Multilevel Slug Tests

    Science.gov (United States)

    McElwee, C. D.; McElwee, C. D.; Ross, H. C.

    2001-12-01

    The GEMS (Geohydrologic Experiment and Monitoring Site) field area has been established (in the Kansas River valley near Lawrence, Kansas) for a variety of reasons relating to research and teaching in hydrogeology at the University of Kansas. Over 70 wells have been installed for various purposes. The site overlies an alluvial aquifer with a total thickness of about 70 feet. The water table is typically about 20 feet below the surface, giving a total saturated thickness of about 50 feet. The upper part of the aquifer is finer material consisting of silt and clay. Typically, the lower 35 feet of the aquifer is sand and gravel. A number of wells through out the site are fully screened through the sand and gravel aquifer. Some of these fully screened wells are larger diameters; however, most wells are constructed of 2 inch PVC casing. Slug tests are widely used in hydrogeology to measure hydraulic conductivity. Over the last several years we have been conducting research to improve the slug test method. We have previously reported the detailed structure of hydraulic conductivity that can be seen in a 5 inch well (McElwee and Zemansky, EOS, v. 80, no. 46, p. F397, 1999) at this site, using multilevel slug tests. The existing 2 inch, fully screened wells are spread out over the site and offer the opportunity for developing a 3-D picture of the hydraulic conductivity distribution. However, it is difficult to develop a system that allows multilevel slug tests to be done accurately and efficiently in a 2 inch well. This is especially true in regions of very high hydraulic conductivity, where the water velocity in the casing will be relatively high. The resistance caused by frictional forces in the equipment must be minimized and a model taking account of these forces must be used. We have developed a system (equipment, software, and technique) for performing multilevel slug tests in 2 inch wells. Some equipment configurations work better than others. The data that we have

  5. Nitrous oxide emissions from Chinese maize-wheat rotation systems: A 3-year field measurement

    Science.gov (United States)

    Cai, Yanjiang; Ding, Weixin; Luo, Jiafa

    2013-02-01

    Nitrous oxide (N2O) fluxes were measured over a 3-year period (2004-2007) in a long-term experimental field. The objectives of the study were to evaluate the interannual variation of N2O emissions from a maize-wheat rotation, under different fertilizer regimes and to determine the key controlling factors. The study involved four treatments: compost (OM), half compost N plus half inorganic fertilizer-N (HOM), inorganic fertilizer-N (NPK), and control (CK) where no N application. The mean annual N2O emission over a 3-year period was 0.30 ± 0.11 kg N2O-N ha-1 in the CK treatment, but increased to 1.61 ± 0.10 kg N2O-N ha-1 in the HOM treatment, 2.13 ± 0.15 kg N2O-N ha-1 in the OM treatment, and 2.76 ± 0.19 kg N2O-N ha-1 in the NPK treatment. Differences were significant among treatments. The N2O emission factors of the applied OM, NPK and HOM were 0.61 ± 0.02, 0.82 ± 0.10 and 0.44 ± 0.04%, respectively, at a rate of 300 kg N ha-1 year-1, indicating that the combined application of compost with inorganic fertilizer significantly reduced N2O emission. Over a maize-wheat rotation year, more than 65% of the annual N2O emission occurred during the maize growing season. There was a large interannual variation in N2O emission in all treatments, albeit not significant either during the maize growing season or at an inter-year scale. This interannual variation was mainly attributable to differences in soil moisture after basal fertilizer application, and irrigation and/or heavy rainfall events immediately following basal fertilization could induce more N2O production than pre-irrigation before plowing. The HOM treatment had higher N fertilizer use efficiency and lowest yield-scaled N2O emissions compared with the OM and NPK treatments. We therefore argue that the combined application of half compost N plus half fertilizer-N will mitigate N2O emissions from soils in the North China plain.

  6. New Technique for Developing a Proton Range Compensator With Use of a 3-Dimensional Printer

    Energy Technology Data Exchange (ETDEWEB)

    Ju, Sang Gyu, E-mail: sg.ju@samsung.com [Department of Radiation Oncology, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Kim, Min Kyu; Hong, Chae-Seon; Kim, Jin Sung; Han, Youngyih; Choi, Doo Ho [Department of Radiation Oncology, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Shin, Dongho; Lee, Se Byeong [Proton Therapy Center, National Cancer Center, Gyeonggi-do (Korea, Republic of)

    2014-02-01

    Purpose: A new system for manufacturing a proton range compensator (RC) was developed by using a 3-dimensional printer (3DP). The physical accuracy and dosimetric characteristics of the new RC manufactured by 3DP (RC{sub 3}DP) were compared with those of a conventional RC (RC{sub C}MM) manufactured by a computerized milling machine (CMM). Methods and Materials: An RC for brain tumor treatment with a scattered proton beam was calculated with a treatment planning system, and the resulting data were converted into a new format for 3DP using in-house software. The RC{sub 3}DP was printed with ultraviolet curable acrylic plastic, and an RC{sub C}MM was milled into polymethylmethacrylate using a CMM. The inner shape of both RCs was scanned by using a 3D scanner and compared with TPS data by applying composite analysis (CA; with 1-mm depth difference and 1 mm distance-to-agreement criteria) to verify their geometric accuracy. The position and distal penumbra of distal dose falloff at the central axis and field width of the dose profile at the midline depth of spread-out Bragg peak were measured for the 2 RCs to evaluate their dosimetric characteristics. Both RCs were imaged on a computed tomography scanner to evaluate uniformity of internal density. The manufacturing times for both RCs were compared to evaluate the production efficiency. Results: The pass rates for the CA test were 99.5% and 92.5% for RC{sub 3}DP and RC{sub C}MM, respectively. There was no significant difference in dosimetric characteristics and uniformity of internal density between the 2 RCs. The net fabrication times of RC{sub 3}DP and RC{sub C}MM were about 18 and 3 hours, respectively. Conclusions: The physical accuracy and dosimetric characteristics of RC{sub 3}DP were comparable with those of the conventional RC{sub C}MM, and significant system minimization was provided.

  7. Centroid Moment Tensor Inversion in a 3D heterogeneous Earth: Application to the Australasian region

    Science.gov (United States)

    Hejrani, B.; Tkalcic, H.; Fichtner, A.

    2015-12-01

    Australia is surrounded by active complex tectonic belts causing significant seismicity. The recent expansion of permanent seismic networks in the Australasian region provides great opportunity to study Earth structure and a great variety of physical mechanisms responsible for earthquakes.On one hand, a better understanding of the Australasian lithosphere, which is now available through tomographic images from full waveform modelling (Fichtner et al. 2010), provides a powerful tool to scrutinize the determination of earthquake source parameters. Even at relatively long periods (40-200s), the 3D effects of regional structure were shown to significantly alter the global centroid moment tensor solutions (Hingee et al. 2012). Thus, we can now explore other types of uncertainties and test the accuracy of global centroid moment tensor (GCMT) solution for the earthquakes in the Australasian region while checking for the systematic inconsistencies in the solutions. This has a significant bearing on tectonic interpretations. For example, azimuth and plunge of fault planes can be investigated in search for systematic biases.On the other hand, the time has come to take a full advantage of the 3D Earth structural model and embrace ongoing advances in computational power and storage. We develop a semi-automated procedure to calculate the Centroid Moment Tensors in a 3D heterogeneous Earth. We utilize the reciprocity theorem to create Green's functions for point sources covering seismogenic zones of Australasia. We focus on improving the capacity of the method to fully complement the existing monitoring tools at Geosciences Australia. Furthermore, we investigate the effects of detailed velocity structure on Centroid location and double-couple percentages. Moreover Azimuth and Plunge of focal mechanisms in GCMT (Global CMT), were investigated in search for any systematic bias.References: Fichtner, A., Kennett, B.L.N., Igel, H., Bunge, H.-P., 2010. Full waveform tomography for

  8. Rice CYP703A3, a cytochrome P450 hydroxylase, is essential for development of anther cuticle and pollen exine

    Institute of Scientific and Technical Information of China (English)

    Xijia Yang; Zhijing Luo; Wanqi Liang; Dabing Zhang; Di Wu; Jianxin Shi; Yi He; Franck Pinot; Bernard Grausem; Changsong Yin; Lu Zhu; Mingjiao Chen

    2014-01-01

    Anther cuticle and pol en exine act as protective envelopes for the male gametophyte or pol en grain, but the mechanism underlying the synthesis of these lipidic polymers remains unclear. Previously, a tapetum-expressed CYP703A3, a putative cytochrome P450 fatty acid hydroxylase, was shown to be essential for male fertility in rice (Oryza sativa L.). However, the biochemical and biological roles of CYP703A3 has not been characterized. Here, we observed that cyp703a3-2 caused by one base insertion in CYP703A3 displays defective pol en exine and anther epicuticular layer, which differs from Arabidopsis cyp703a2 in which only defective pol en exine occurs. Consis-tently, chemical composition assay showed that levels of cutin monomers and wax components were dramatical y reduced in cyp703a3-2 anthers. Unlike the wide range of substrates of Arabidopsis CYP703A2, CYP703A3 functions as an in-chain hydroxylase only for a specific substrate, lauric acid, preferably generating 7-hydroxylated lauric acid. Moreover, chromatin immunoprecipitation and expression analyses revealed that the expression of CYP703A3 is directly regulated by Tapetum Degeneration Retardation, a known regulator of tapetum PCD and pol en exine formation. Col ectively, our results suggest that CYP703A3 represents a conserved and diversified biochemical pathway for in-chain hydroxylation of lauric acid required for the development of male organ in higher plants.

  9. 17 CFR 270.3a-3 - Certain investment companies owned by companies which are not investment companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain investment companies owned by companies which are not investment companies. 270.3a-3 Section 270.3a-3 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT...

  10. Production of CO /a 3Pi/ and other metastable fragments by electron impact dissociation of CO2.

    Science.gov (United States)

    Wells, W. C.; Borst, W. L.; Zipf, E. C.

    1972-01-01

    The dissociative excitation of CO (a 3Pi) and other metastable fragments produced by electron impact on CO2 has been investigated from threshold to 50 eV. The observed threshold for CO (a 3Pi) production at 11.9 (plus or minus 0.5) eV was near the minimum required energy of 11.5 eV.

  11. Ultrarapid detection of pathogenic bacteria using a 3D immunomagnetic flow assay.

    Science.gov (United States)

    Lee, Wonjae; Kwon, Donghoon; Chung, Boram; Jung, Gyoo Yeol; Au, Anthony; Folch, Albert; Jeon, Sangmin

    2014-07-01

    We developed a novel 3D immunomagnetic flow assay for the rapid detection of pathogenic bacteria in a large-volume food sample. Antibody-functionalized magnetic nanoparticle clusters (AbMNCs) were magnetically immobilized on the surfaces of a 3D-printed cylindrical microchannel. The injection of a Salmonella-spiked sample solution into the microchannel produced instant binding between the AbMNCs and the Salmonella bacteria due to their efficient collisions. Nearly perfect capture of the AbMNCs and AbMNCs-Salmonella complexes was achieved under a high flow rate by stacking permanent magnets with spacers inside the cylindrical separator to maximize the magnetic force. The concentration of the bacteria in solution was determined using ATP luminescence measurements. The detection limit was better than 10 cfu/mL, and the overall assay time, including the binding, rinsing, and detection steps for a 10 mL sample took less than 3 min. To our knowledge, the 3D immunomagnetic flow assay described here provides the fastest high-sensitivity, high-capacity method for the detection of pathogenic bacteria. PMID:24856003

  12. A 3D social platform for the Paths of Via Regina

    Science.gov (United States)

    Brovelli, M. A.; Zamboni, G.

    2015-06-01

    GeoWeb 2.0, the geographic extension of Web 2.0, has opened new possibilities in terms of online dissemination and sharing of geospatial contents, thus laying the foundations for a fruitful development of Volunteered Geographic Information (VGI) systems. At the same time the technological evolution and the availability of ever more efficient devices has allowed the usability of the third dimension even for the cartographic viewers, changing the way people approach to geographic information on the Web. Unlike the traditional 2D-visualization typical of the classic Web Geographic Information Systems (Web-GISs), the multi-dimensional viewers, of which virtual globes are the main examples, offer fully-realistic content visualization which allows for a much richer user experience. In this paper a 3D Web application based on the NASA World Wind virtual globe which aims at the enhancement of the foot paths on the hilly cross-border area between Italy and Switzerland is presented.

  13. A 3D optical head motion measurement system and its primary application in stereotactic radiosurgery

    International Nuclear Information System (INIS)

    Head motion is a significant source of therapy-effect degradation in stereotactic radiosurgery (SRS). In this study, a 3D optical head motion measurement system with a precision less than 0.1 mm has been developed by our group. During the clinical SRS treatment experiments, three dimensional (3D) positions of infrared light emission diode (ILED) markers on the head-chin, nose tip, forehead and ear were measured with a data sampling rate of once per second for 30 minutes, in frame and frameless sessions, respectively, by this system. The t-test and linear correlation analysis have been used, and the results indicate that the difference of head motion with moldable thermoplastic frame on and without frame was highly statistically significant (p<0.01), and the fixation of the moldable thermoplastic frame in X axial direction (defined in local treatment-couch coordinate system) needs to be reinforced to realize better fixation effect for high degree of treatment precision. It is also shown that the head motion was mainly due to the rotation about the occiput-couch contact point, however, the chin is the most easily movable area on the head. The result implies that in the newly developing frameless SRS treatment, the landmarkers should be attached to the relatively static areas such as forehead and ear. (author)

  14. A 3D theoretical model for green management: a case study of Chinese enterprises

    Institute of Scientific and Technical Information of China (English)

    Zhang Ying; Wen Xingzi

    2007-01-01

    Companies that not only abide by environmental regulations, but also discover new techniques and adopt new management methods to reduce negative environmental impacts often have positive effects on corporate profitability. In order to meet the needs of sustainability of enterprises and protect environment, the concept of green management is developed and regarded as an important direction of management theory of the 21st century. Though there are many theories and practices about green management in western countries, they are built based on the developed market economy, which are not suitable for Chinese enterprises absolutely. By analyzing the viewpoints and models of the overseas and domestic experts and scholars, combining characteristic of China's market economy, this paper points out the real connotation of enterprise green management - the combination of ecological harmony (harmony between human and nature) with human harmony (harmony among people), establishes a 3D theoretical model, points out the defects of enterprise's green management in China, reanalyzes and redesigned enterprise green management, which paves the way for the deeper and broader development of green management.

  15. Developing a 3D Road Cadastral System: Comparing Legal Requirements and User Needs

    Science.gov (United States)

    Gristina, S.; Ellul, C.; Scianna, A.

    2016-10-01

    Road transport has always played an important role in a country's growth and, in order to manage road networks and ensure a high standard of road performance (e.g. durability, efficiency and safety), both public and private road inventories have been implemented using databases and Geographical Information Systems. They enable registering and managing significant amounts of different road information, but to date do not focus on 3D road information, data integration and interoperability. In an increasingly complex 3D urban environment, and in the age of smart cities, however, applications including intelligent transport systems, mobility and traffic management, road maintenance and safety require digital data infrastructures to manage road data: thus new inventories based on integrated 3D road models (queryable, updateable and shareable on line) are required. This paper outlines the first step towards the implementation of 3D GIS-based road inventories. Focusing on the case study of the "Road Cadastre" (the Italian road inventory as established by law), it investigates current limitations and required improvements, and also compares the required data structure imposed by cadastral legislation with real road users' needs. The study aims to: a) determine whether 3D GIS would improve road cadastre (for better management of data through the complete life-cycle infrastructure projects); b) define a conceptual model for a 3D road cadastre for Italy (whose general principles may be extended also to other countries).

  16. Population and Evolutionary Dynamics based on Predator-Prey Relationships in a 3D Physical Simulation.

    Science.gov (United States)

    Ito, Takashi; Pilat, Marcin L; Suzuki, Reiji; Arita, Takaya

    2016-01-01

    Recent studies have reported that population dynamics and evolutionary dynamics, occurring at different time scales, can be affected by each other. Our purpose is to explore the interaction between population and evolutionary dynamics using an artificial life approach based on a 3D physically simulated environment in the context of predator-prey and morphology-behavior coevolution. The morphologies and behaviors of virtual prey creatures are evolved using a genetic algorithm based on the predation interactions between predators and prey. Both population sizes are also changed, depending on the fitness. We observe two types of cyclic behaviors, corresponding to short-term and long-term dynamics. The former can be interpreted as a simple population dynamics of Lotka-Volterra type. It is shown that the latter cycle is based on the interaction between the changes in the prey strategy against predators and the long-term change in both population sizes, resulting partly from a tradeoff between their defensive success and the cost of defense. PMID:26934093

  17. Behavior of Caulobacter Crescentus Diagnosed Using a 3-Channel Microfluidic Device

    Science.gov (United States)

    Tang, Jay; Morse, Michael; Colin, Remy; Wilson, Laurence

    2015-03-01

    Many motile microorganisms are able to detect chemical gradients in their surroundings in order to bias their motion towards more favorable conditions. We study the biased motility of Caulobacter crescentus, a singly flagellated bacteria, which alternate between forward and backward swimming, driven by its flagella motor, which switches in rotation direction. We observe the swimming patterns of C. crescents in an oxygen gradient, which is established by flowing atmospheric air and pure nitrogen through a 3 parallel channel microfluidic device. In this setup, oxygen diffuses through the PDMS device and the bacterial medium, creating a linear gradient. Using low magnification, dark field microscopy, individual cells are tracked over a large field of view, with particular interest in the cells' motion relative to the oxygen gradient. Utilizing observable differences between backward and forward swimming motion, motor switching events can be identified. By analyzing these run time intervals between motor switches as a function of a cell's local oxygen level, we demonstrate that C. crescentus displays aerotacitc behavior by extending forward swimming run times while moving up an oxygen gradient, resulting in directed motility towards oxygen sources. Additionally, motor switching response is sensitive to both the steepness of the gradient experienced and background oxygen levels with cells exhibiting a logarithmic response to oxygen levels. Work funded by the United States National Science Foundation and by the Rowland Institute at Harvard University.

  18. A new ion beam facility based on a 3 MV Tandetron™ at IFIN-HH, Romania

    Energy Technology Data Exchange (ETDEWEB)

    Burducea, I.; Straticiuc, M. [Horia Hulubei National Institute of Physics and Nuclear Engineering, IFIN-HH, Măgurele 077125 (Romania); Ghiță, D.G., E-mail: dan.ghita@nipne.ro [Horia Hulubei National Institute of Physics and Nuclear Engineering, IFIN-HH, Măgurele 077125 (Romania); Moșu, D.V.; Călinescu, C.I. [Horia Hulubei National Institute of Physics and Nuclear Engineering, IFIN-HH, Măgurele 077125 (Romania); Podaru, N.C.; Mous, D.J.W. [High Voltage Engineering Europa B.V., P.O. Box 99, 3800AB Amersfoort (Netherlands); Ursu, I.; Zamfir, N.V. [Horia Hulubei National Institute of Physics and Nuclear Engineering, IFIN-HH, Măgurele 077125 (Romania)

    2015-09-15

    A 3 MV Tandetron™ accelerator system has been installed and commissioned at the “Horia Hulubei” National Institute for Physics and Nuclear Engineering – IFIN-HH, Măgurele, Romania. The main purpose of this machine is to strengthen applied nuclear physics research ongoing in our institute for more than four decades. The accelerator system was developed by High Voltage Engineering Europa B.V. (HVE) and comprises three high energy beam lines. The first beam line is dedicated to ion beam analysis (IBA) techniques: Rutherford Backscattering Spectrometry – RBS, Nuclear Reaction Analysis – NRA, Particle Induced X-ray and γ-ray Emission – PIXE and PIGE and micro-beam experiments – μ-PIXE. The second beam line is dedicated to high energy ion implantation experiments and the third beam line was designed mainly for nuclear cross-sections measurements used in nuclear astrophysics. A unique feature, the first time in operation at an accelerator facility is the Na charge exchange canal (CEC), which is used to obtain high intensity beams of He{sup −} of at least 3 μA. The results of the acceptance tests demonstrate the huge potential of this new facility in various fields, from IBA to radiation hardness studies and from medical or environmental applications to astrophysics. The main features of the accelerator are presented in this paper.

  19. Scaling laws of coronal loops compared to a 3D MHD model of an Active Region

    CERN Document Server

    Bourdin, Philippe-A; Peter, Hardi

    2016-01-01

    Context. The structure and heating of coronal loops are investigated since decades. Established scaling laws relate fundamental quantities like the loop apex temperature, pressure, length, and the coronal heating. Aims. We test such scaling laws against a large-scale 3D MHD model of the Solar corona, which became feasible with nowadays high-performance computing. Methods. We drive an active region simulation a with photospheric observations and found strong similarities to the observed coronal loops in X-rays and EUV wavelength. A 3D reconstruction of stereoscopic observations showed that our model loops have a realistic spatial structure. We compare scaling laws to our model data extracted along an ensemble of field lines. Finally, we fit a new scaling law that represents well hot loops and also cooler structures, which was not possible before only based on observations. Results. Our model data gives some support for scaling laws that were established for hot and EUV-emissive coronal loops. For the RTV scali...

  20. Analysis of the Kinematic Accuracy Reliability of a 3-DOF Parallel Robot Manipulator

    Directory of Open Access Journals (Sweden)

    Guohua Cui

    2015-02-01

    Full Text Available Kinematic accuracy reliability is an important performance index in the evaluation of mechanism quality. By using a 3- DOF 3-PUU parallel robot manipulator as the research object, the position and orientation error model was derived by mapping the relation between the input and output of the mechanism. Three error sensitivity indexes that evaluate the kinematic accuracy of the parallel robot manipulator were obtained by adapting the singular value decomposition of the error translation matrix. Considering the influence of controllable and uncontrollable factors on the kinematic accuracy, the mathematical model of reliability based on random probability was employed. The measurement and calculation method for the evaluation of the mechanism’s kinematic reliability level was also provided. By analysing the mechanism’s errors and reliability, the law of surface error sensitivity for the location and structure parameters was obtained. The kinematic reliability of the parallel robot manipulator was statistically computed on the basis of the Monte Carlo simulation method. The reliability analysis of kinematic accuracy provides a theoretical basis for design optimization and error compensation.

  1. Singularity analysis of a 3-RPS parallel manipulator using geometric algebra

    Science.gov (United States)

    Li, Qinchuan; Xiang, Ji'nan; Chai, Xinxue; Wu, Chuanyu

    2015-11-01

    Singular configurations must be avoided in path planning and control of a parallel manipulator. However, most studies rarely focus on an overall singularity loci distribution of lower-mobility parallel mechanisms. Geometric algebra is employed in analysis of singularity of a 3-RPS parallel manipulator. Twist and wrench in screw theory are represented in geometric algebra. Linear dependency of twists and wrenches are described by outer product in geometric algebra. Reciprocity between twists and constraint wrenches are reflected by duality. To compute the positions of the three spherical joints of the 3-RPS parallel manipulator, Tilt-and-Torsion angles are used to describe the orientation of the moving platform. The outer product of twists and constraint wrenches is used as an index for closeness to singularity(ICS) of the 3-RPS parallel manipulator. An overall and thorough perspective of the singularity loci distribution of the 3-RPS parallel manipulator is disclosed, which is helpful to design, trajectory planning and control of this kind of parallel manipulator.

  2. Numerical investigation of wave attenuation by vegetation using a 3D RANS model

    Science.gov (United States)

    Marsooli, Reza; Wu, Weiming

    2014-12-01

    Vegetation has been recognized as an important natural shoreline protection against storm surges and waves. Understanding of wave-vegetation interaction is essential for assessing the ability of vegetation patches, such as wetlands, to mitigate storm damages. In this study the wave attenuation by vegetation is investigated numerically using a 3-D model which solves the Reynolds-Averaged Navier-Stokes equations (RANS) by means of a finite-volume method based on collocated hexahedron mesh. A mixing length model is used for turbulence closure of the RANS equations. The water surface boundary is tracked using the Volume-of-Fluid (VOF) method with the Compressive Interface Capturing Scheme for Arbitrary Meshes (CICSAM) to solve the VOF advection equation. The presence of vegetation is taken into account by adding the vegetation drag and inertia forces to the momentum equations. The model is validated by several laboratory experiments of short wave propagation through vegetation over flat and sloping beds. The comparisons show good agreement between the measured data and calculated results, but the swaying motion of flexible vegetation which is neglected in this study can influence the accuracy of the wave height predictions. The model is then applied to one of the validation tests with different vegetation properties, revealing that the wave height attenuation by vegetation depends not only on the wave conditions, but also the vegetation characteristics such as vegetation height and density.

  3. Mechanisms driving estuarine water quality: A 3D biogeochemical model for informed management

    Science.gov (United States)

    Wild-Allen, Karen; Skerratt, Jenny; Whitehead, Jason; Rizwi, Farhan; Parslow, John

    2013-12-01

    Estuaries are amongst the most productive marine ecosystems of the world but are also some of the most degraded due to coastal urban development. Sparse sampling of complex interactions between estuarine physics, sediment transport, chemistry, and biology limits understanding of the processes controlling estuarine water quality and confounds active management. We use a 3D coupled hydrodynamic, sediment and biogeochemical model to identify the key mechanisms driving fine-scale fluctuations in water quality in a temperate micro-tidal salt wedge estuary [Derwent Estuary, Tasmania]. Model results are dynamically consistent with relatively sparse monitoring data collected over a seasonal cycle and are considered to be a plausible hypothesis of sub-monitoring scale processes occurring in the estuary. The model shows enhanced mixing of nutrients across the pycnocline downstream of the salt wedge front that supports a persistent phytoplankton bloom. The length and flow regime of the estuary results in nutrient recycling and retention in the estuarine circulation driving a decline in bottom water dissolved oxygen in the mid- and upper-reaches. A budget analysis of modelled nitrogen suggests high levels of denitrification are critical to the maintenance of existing water quality. Active estuarine management focused on the improvement of bottom water dissolved oxygen for ecological health reasons must either concurrently reduce anthropogenic nitrogen loads or be sure to maintain high levels of microbial denitrification for net water quality improvement.

  4. ENTRYSAT: A 3U Cubesat to Study the Re-Entry Atmospheric Environment

    Science.gov (United States)

    Garcia, R. F.; Chaix, J.; Mimoun, D.; EntrySat student Team

    2014-04-01

    The EntrySat is a 3U CubeSat designed to study the uncontrolled atmospheric re-entry. The project, developed by ISAE in collaboration with ONERA, is funded by CNES and is intended to be launched in January 2016, in the context of the QB50 network. The scientific goal is to relate the kinematics of the satellite with the aerothermodynamic environment during re-entry. In particular, data will be compared with the computations of MUSIC/FAST, a new 6-degree of freedom code developed by ONERA to predict the trajectory of space debris. According to these requirements, the satellite will measure the temperature, pressure, heat flux, and drag force during re-entry, as well as the trajectory and attitude of the satellite. One of the major technological challenges is the retrieval of data during the re-entry phase, which will be based on the Iridium satellite network. The system design is based on the use of commercial COTS components, and is mostly developed by students from ISAE. As such, the EntrySat has an important educational value in the formation of young engineers.

  5. Analyses and forecasts of a tornadic supercell outbreak using a 3DVAR system ensemble

    Science.gov (United States)

    Zhuang, Zhaorong; Yussouf, Nusrat; Gao, Jidong

    2016-05-01

    As part of NOAA's "Warn-On-Forecast" initiative, a convective-scale data assimilation and prediction system was developed using the WRF-ARW model and ARPS 3DVAR data assimilation technique. The system was then evaluated using retrospective short-range ensemble analyses and probabilistic forecasts of the tornadic supercell outbreak event that occurred on 24 May 2011 in Oklahoma, USA. A 36-member multi-physics ensemble system provided the initial and boundary conditions for a 3-km convective-scale ensemble system. Radial velocity and reflectivity observations from four WSR-88Ds were assimilated into the ensemble using the ARPS 3DVAR technique. Five data assimilation and forecast experiments were conducted to evaluate the sensitivity of the system to data assimilation frequencies, in-cloud temperature adjustment schemes, and fixed- and mixed-microphysics ensembles. The results indicated that the experiment with 5-min assimilation frequency quickly built up the storm and produced a more accurate analysis compared with the 10-min assimilation frequency experiment. The predicted vertical vorticity from the moist-adiabatic in-cloud temperature adjustment scheme was larger in magnitude than that from the latent heat scheme. Cycled data assimilation yielded good forecasts, where the ensemble probability of high vertical vorticity matched reasonably well with the observed tornado damage path. Overall, the results of the study suggest that the 3DVAR analysis and forecast system can provide reasonable forecasts of tornadic supercell storms.

  6. First measurement of unpolarized SIDIS cross section and cross section ratios from a $^3$He target

    CERN Document Server

    Yan, X; Aniol, K; Annand, J R M; Averett, T; Benmokhtar, F; Bertozzi, W; Bradshaw, P C; Bosted, P; Camsonne, A; Canan, M; Cates, G D; Chen, C; Chen, J -P; Chen, W; Chirapatpimol, K; Chudakov, E; Cisbani, E; Cornejo, J C; Cusanno, F; Dalton, M M; Deconinck, W; de Jager, C W; De Leo, R; Deng, X; Deur, A; Ding, H; Dolph, P A M; Dutta, C; Dutta, D; Fassi, L El; Frullani, S; Gao, H; Garibaldi, F; Gaskell, D; Gilad, S; Gilman, R; Glamazdin, O; Golge, S; Guo, L; Hamilton, D; Hansen, O; Higinbotham, D W; Holmstrom, T; Huang, J; Huang, M; Ibrahim, H F; Iodice, M; Jiang, X; Jin, G; Jones, M K; Katich, J; Kelleher, A; Kim, W; Kolarkar, A; Korsch, W; LeRose, J J; Li, X; Li, Y; Lindgren, R; Liu, T; Liyanage, N; Long, E; Lu, H -J; Margaziotis, D J; Markowitz, P; Marrone, S; McNulty, D; Meziani, Z -E; Michaels, R; Moffit, B; Camacho, C Munoz; Nanda, S; Narayan, A; Nelyubin, V; Norum, B; Oh, Y; Osipenko, M; Parno, D; Peng, J -C; Phillips, S K; Posik, M; Puckett, A J R; Qian, X; Qiang, Y; Rakhman, A; Ransome, R; Riordan, S; Saha, A; Sawatzky, B; Schulte, E; Shahinyan, A; Shabestari, M H; Sirca, S; Stepanyan, S; Subedi, R; Sulkosky, V; Tang, L -G; Tobias, W A; Urciuoli, G M; Vilardi, I; Wang, K; Wojtsekhowski, B; Wang, Y; Yan, X; Yao, H; Ye, Y; Ye, Z; Yuan, L; Zhan, X; Zhang, Y; Zhang, Y -W; Zhao, B; Zhao, Y X; Zheng, X; Zhu, L; Zhu, X; Zong, X

    2016-01-01

    The unpolarized semi-inclusive deep-inelastic scattering (SIDIS) differential cross sections in $^3$He($e,e^{\\prime}\\pi^{\\pm}$)$X$ have been measured for the first time in Jefferson Lab experiment E06-010 performed with a $5.9\\,$GeV $e^-$ beam on a $^3$He target. The experiment focuses on the valence quark region, covering a kinematic range $0.12 < x_{bj} < 0.45$, $1 < Q^2 < 4 \\, \\textrm{(GeV/c)}^2$, $0.45 < z_{h} < 0.65$, and $0.05 < P_t < 0.55 \\, \\textrm{GeV/c}$. The extracted SIDIS differential cross sections of $\\pi^{\\pm}$ production are compared with existing phenomenological models while the $^3$He nucleus approximated as two protons and one neutron in a plane wave picture, in multi-dimensional bins. Within the experimental uncertainties, the azimuthal modulations of the cross sections are found to be consistent with zero.

  7. A 3D unstructured non-hydrostatic ocean model for internal waves

    Science.gov (United States)

    Ai, Congfang; Ding, Weiye

    2016-08-01

    A 3D non-hydrostatic model is developed to compute internal waves. A novel grid arrangement is incorporated in the model. This not only ensures the homogenous Dirichlet boundary condition for the non-hydrostatic pressure can be precisely and easily imposed but also renders the model relatively simple in its discretized form. The Perot scheme is employed to discretize horizontal advection terms in the horizontal momentum equations, which is based on staggered grids and has the conservative property. Based on previous water wave models, the main works of the present paper are to (1) utilize a semi-implicit, fractional step algorithm to solve the Navier-Stokes equations (NSE); (2) develop a second-order flux-limiter method satisfying the max-min property; (3) incorporate a density equation, which is solved by a high-resolution finite volume method ensuring mass conservation and max-min property based on a vertical boundary-fitted coordinate system; and (4) validate the developed model by using four tests including two internal seiche waves, lock-exchange flow, and internal solitary wave breaking. Comparisons of numerical results with analytical solutions or experimental data or other model results show reasonably good agreement, demonstrating the model's capability to resolve internal waves relating to complex non-hydrostatic phenomena.

  8. Singularity Analysis of a 3-RPS Parallel Manipulator Using Geometric Algebra

    Institute of Scientific and Technical Information of China (English)

    LI Qinchuan; XIANG Ji’nan; CHAI Xinxue; WU Chuanyu

    2015-01-01

    Singular configurations must be avoided in path planning and control of a parallel manipulator. However, most studies rarely focus on an overall singularity loci distribution of lower-mobility parallel mechanisms. Geometric algebra is employed in analysis of singularity of a 3-RPS parallel manipulator. Twist and wrench in screw theory are represented in geometric algebra. Linear dependency of twists and wrenches are described by outer product in geometric algebra. Reciprocity between twists and constraint wrenches are reflected by duality. To compute the positions of the three spherical joints of the 3-RPS parallel manipulator, Tilt-and-Torsion angles are used to describe the orientation of the moving platform. The outer product of twists and constraint wrenches is used as an index for closeness to singularity(ICS) of the 3-RPS parallel manipulator. An overall and thorough perspective of the singularity loci distribution of the 3-RPS parallel manipulator is disclosed, which is helpful to design, trajectory planning and control of this kind of parallel manipulator.

  9. Simulation on a photocathode-based microtron using a 3D PIC code

    Science.gov (United States)

    Park, Sunjeong; Jeong, Young Uk; Park, Seong Hee; Jang, Kyu-Ha; Vinokurov, Nikolay A.; Kim, Eun-San

    2015-02-01

    The Korea Atomic Energy Research Institute (KAERI) has used a microtron accelerator based on a thermionic cathode for operating a compact terahertz (THz) FEL, where the electrons are emitted and accelerated automatically during the radio-frequency (RF) macro-pulse over threshold power for their emission. Usually a thermionic cathode is embedded inside the microtron cavity for electron-beam emission, and at the same time acceleration is due to the input RF source. In this case, the accelerator scheme is simple, but just a fraction of the emitted electrons are accelerated, and the electron bunch length is uncontrollable due to the RF phase condition for acceleration. In this paper, a photocathode-based microtron which is able to produce high peak (˜100 A) and ultrashort (˜1 ps) electron bunch is studied to adapt it for an electron injector of a THz generator. Especially, we analyzed the electron beam dynamics along the accelerating trajectory with a 3D PIC-code to find the optimized RF phase and laser input time.

  10. A novel electroporation system for efficient molecular delivery into Chlamydomonas reinhardtii with a 3-dimensional microelectrode

    Science.gov (United States)

    Kang, Seongsu; Kim, Kwon-Ho; Kim, Yeu-Chun

    2015-11-01

    Electroporation is one of the most widely used transfection methods because of its high efficiency and convenience among the various transfection methods. Previous micro-electroporation systems have some drawbacks such as limitations in height and design, time-consuming and an expensive fabrication process due to technical constraints. This study fabricates a three dimensional microelectrode using the 3D printing technique. The interdigitated microstructure consisting of poly lactic acid was injected by a 3D printer and coated with silver and aluminum with a series of dip-coatings. With the same strength of electric field (V cm-1), a higher efficiency for molecular delivery and a higher cellular viability are achieved with the microelectrode than with a standard cuvette. In addition, this study investigates chemicophysical changes such as Joule heating and dissolved metal during electroporation and showed the micro-electroporation system had less chemicophysical changes. It was concluded that the proposed micro-electroporation system will contribute to genetic engineering as a promising delivery tool, and this combination of 3D printing and electroporation has many potential applications for diverse designs or systems.

  11. Design and Implementation of a 3D Ocean Virtual Reality and Visualization Engine

    Institute of Scientific and Technical Information of China (English)

    CHEN Ge; LI Bo; TIAN Fenglin; JI Pengbo; LI Wenqing

    2012-01-01

    In this study,a 3D virtual reality and visualization engine for rendering the ocean,named VV-Ocean,is designed for marine applications.The design goals of VV-Ocean aim at high fidelity simulation of ocean environment,visualization of massive and multidimensional marine data,and imitation of marine lives.VV-Ocean is composed of five modules,i.e.memory management module,resources management module,scene management module,rendering process management module and interaction management module.There are three core functions in VV-Ocean:reconstructing vivid virtual ocean scenes,visualizing real data dynamically in real time,imitating and simulating marine lives intuitively.Based on VV-Ocean,we establish a sea-land integration platform which can reproduce drifting and diffusion processes of oil spilling from sea bottom to surface.Environment factors such as ocean current and wind field have been considered in this simulation.On this platform oil spilling process can be abstracted as movements of abundant oil particles.The result shows that oil particles blend with water well and the platform meets the requirement for real-time and interactive rendering.VV-Ocean can be widely used in ocean applications such as demonstrating marine operations,facilitating maritime communications,developing ocean games,reducing marine hazards,forecasting the weather over oceans,serving marine tourism,and so on.Finally,further technological improvements of VV-Ocean are discussed.

  12. Design and implementation of a 3D ocean virtual reality and visualization engine

    Science.gov (United States)

    Chen, Ge; Li, Bo; Tian, Fenglin; Ji, Pengbo; Li, Wenqing

    2012-12-01

    In this study, a 3D virtual reality and visualization engine for rendering the ocean, named VV-Ocean, is designed for marine applications. The design goals of VV-Ocean aim at high fidelity simulation of ocean environment, visualization of massive and multidimensional marine data, and imitation of marine lives. VV-Ocean is composed of five modules, i.e. memory management module, resources management module, scene management module, rendering process management module and interaction management module. There are three core functions in VV-Ocean: reconstructing vivid virtual ocean scenes, visualizing real data dynamically in real time, imitating and simulating marine lives intuitively. Based on VV-Ocean, we establish a sea-land integration platform which can reproduce drifting and diffusion processes of oil spilling from sea bottom to surface. Environment factors such as ocean current and wind field have been considered in this simulation. On this platform oil spilling process can be abstracted as movements of abundant oil particles. The result shows that oil particles blend with water well and the platform meets the requirement for real-time and interactive rendering. VV-Ocean can be widely used in ocean applications such as demonstrating marine operations, facilitating maritime communications, developing ocean games, reducing marine hazards, forecasting the weather over oceans, serving marine tourism, and so on. Finally, further technological improvements of VV-Ocean are discussed.

  13. Intraosseous rotation of the scaphoid: assessment by using a 3D CT model - an anatomic study

    Energy Technology Data Exchange (ETDEWEB)

    Schmidle, Gernot; Gabl, Markus [Medical University Innsbruck, Department of Trauma Surgery, Innsbruck (Austria); Rieger, Michael [Regional Hospital Hall, Department of Radiology, Hall in Tirol (Austria); Klauser, Andrea Sabine; Thauerer, Michael [Medical University Innsbruck, Department of Radiology, Innsbruck (Austria); Hoermann, Romed [Medical University Innsbruck, Department of Anatomy, Histology and Embryology-Division of Clinical and Functional Anatomy, Innsbruck (Austria)

    2014-06-15

    The purpose of this study was to assess intraosseous rotation as the third dimension of scaphoid anatomy on a 3D CT model using common volume rendering software to impact anatomical reconstruction of scaphoid fractures. CT images of 13 cadaver wrist pairs were acquired. Reference axes for the alignment of distal and proximal scaphoid poles were defined three-dimensionally. Two methods for rotation measurement - the reference axis method (RAM) and the scapho-trapezio-trapezoidal joint method (STTM) - were developed and compared by three independent observers. Rotation measured by the RAM averaged 66.9 ± 7 for the right and 67.2 ± 5.8 for the left wrists. Using the STTM there was a mean rotation of 68.6 ± 6.6 for the right and 68.6 ± 6.8 for the left wrists. The overall results showed a significant variability of the measured values between different specimens (P < 0.05). There was no significant difference between left and right wrists of the same specimen, neither for the RAM (P = 0.268) nor for the STTM (P = 0.774). Repeatability coefficients between the observers were low, indicating good repeatability. The presented methods are practical tools to quantify intraosseous rotation between distal and proximal scaphoid poles using common volume rendering software. For clinical application the opposite side provides the best reference values to assess malrotation in scaphoid fracture cases. (orig.)

  14. A 3-month age difference profoundly alters the primary rat stromal vascular fraction phenotype.

    Science.gov (United States)

    Quaade, Marlene Louise; Jensen, Charlotte Harken; Andersen, Ditte Caroline; Sheikh, Søren Paludan

    2016-06-01

    The stromal vascular fraction (SVF) is a heterogeneous population obtained from collagenase digestion of adipose tissue. When cultured the population becomes more homogeneous and the cells are then termed adipose stromal/stem cells (ASCs). Both the freshly isolated primary SVF population and the cultured ASC population possess regenerative abilities suggested to be mediated by paracrine mechanisms mainly. The use of ASCs and SVF cells, both in animal studies and human clinical studies, has dramatically increased during recent years. However, more knowledge regarding optimal donor characteristics such as age is demanded. Here we report that even a short age difference has an impact on the phenotype of primary SVF cells. We observed that a 3-month difference in relatively young adult rats affects the expression pattern of several mesenchymal stem cell markers in their primary SVF. The younger animals had significantly more CD90+/CD44+/CD29+/PDGFRα+primary cells, than the aged rats, suggesting an age dependent shift in the relative cell type distribution within the population. Taken together with recent studies of much more pronounced age differences, our data strongly suggest that donor age is a very critical parameter that should be taken into account in future stem cell studies, especially when using primary cells. PMID:27265810

  15. The effect of sodium trimetaphosphate on caries: a 3-year clinical toothpaste trial.

    Science.gov (United States)

    Städtler, P; Müller-Bruckschwaiger, K; Schäfer, F; Huntington, E

    1996-01-01

    The objective of this study was to assess the anticaries efficacy of a toothpaste containing 3% sodium trimetaphosphate (TMP; test) relative to a toothpaste containing no caries-preventive agent (control). The study was designed as a 3-year double-blind caries incidence study involving about 2,500 subjects aged 11 years at baseline. After a clinical examination, subjects were stratified by sex, presence of supragingival calculus and caries status and randomly assigned to either the control or the test group. Clinical examinations then took place at annual intervals. At baseline and at the final examination bite-wing radiographs were taken of subjects not radiographed within the previous 6 months. The change in caries between baseline and the 3-year examination was calculated as DMFS increments. The results showed a statistically significant difference of 8% between the test and control groups (p < 0.05). In subjects brushing twice daily the difference between the test and control group was 11% (p < 0.01). It is concluded that, when used regularly, a toothpaste containing 3% TMP will be effective against caries. PMID:8946103

  16. A 3 He-129 Xe co-magnetometer with 87 Rb magnetometry

    Science.gov (United States)

    Limes, Mark; Sheng, Dong; Romalis, Mike

    2016-05-01

    We report progress on a 3 He-129 Xe co-magnetometer detected with a 87 Rb magnetometer. The noble-gas co-magnetometer is insensitive to any long-term bias field drifts, but the presence of hot Rb can cause instability in the ratio of 3 He-129 Xe precession frequencies. We use a sequence of Rb π pulses to suppress the instability due to Rb-noble gas interactions by a factor of 104 along all three spatial axes. For detection, our 87 Rb magnetometer operates using single-axis 87 Rb π pulses with σ+ /σ- pumping-this technique decouples the 87 Rb magnetometer from bias fields, and allows for SERF operation. We are presently investigating systematic effects due to combinations of several imperfections, such as longitudinal noble gas polarization, imperfect 87 Rb π pulses, and 87 Rb pump light shifts. Thus far, our 87 Rb magnetometer has a sensitivity of 40 fT/√{Hz}, and our 3 He-129 Xe co-magnetometer has achieved a single-shot precession frequency ratio error of 20 nHz and a long-term bias drift of 8 nHz at 7 h. We are developing the co-magnetometer for use as an NMR gyro, and to search for possible spin-gravity interactions. Supported by DARPA and NSF.

  17. Toward a 3D video format for auto-stereoscopic displays

    Science.gov (United States)

    Vetro, Anthony; Yea, Sehoon; Smolic, Aljoscha

    2008-08-01

    There has been increased momentum recently in the production of 3D content for cinema applications; for the most part, this has been limited to stereo content. There are also a variety of display technologies on the market that support 3DTV, each offering a different viewing experience and having different input requirements. More specifically, stereoscopic displays support stereo content and require glasses, while auto-stereoscopic displays avoid the need for glasses by rendering view-dependent stereo pairs for a multitude of viewing angles. To realize high quality auto-stereoscopic displays, multiple views of the video must either be provided as input to the display, or these views must be created locally at the display. The former approach has difficulties in that the production environment is typically limited to stereo, and transmission bandwidth for a large number of views is not likely to be available. This paper discusses an emerging 3D data format that enables the latter approach to be realized. A new framework for efficiently representing a 3D scene and enabling the reconstruction of an arbitrarily large number of views prior to rendering is introduced. Several design challenges are also highlighted through experimental results.

  18. Creating S0s with Major Mergers: A 3D View

    Directory of Open Access Journals (Sweden)

    Miguel Querejeta

    2015-12-01

    Full Text Available A number of simulators have argued that major mergers can sometimes preserve discs, but the possibility that they could explain the emergence of lenticular galaxies (S0s has been generally neglected. In fact, observations of S0s reveal a strong structural coupling between their bulges and discs, which seems difficult to reconcile with the idea that they come from major mergers. However, in our recent papers we have used N-body simulations of binary mergers to show that, under favourable conditions, discs are first destroyed but soon regrow out of the leftover debris, matching observational photometric scaling relations. Additionally, we have shown how the merger scenario agrees with the recent discovery that S0s and most spirals are not compatible in an angular momentum–concentration plane. This important result from CALIFA constitutes a serious objection to the idea that spirals transform into S0s mainly by fading (e.g., via ram-pressure stripping, as that would not explain the observed simultaneous change in λ Re and concentration, but our simulations of major mergers do explain that mismatch. From such a 3D comparison we conclude that mergers must be a relevant process in the build-up of the current population of S0s.

  19. Benign occipital epilepsy of childhood: Panayiotopoulos syndrome in a 3 year old child

    Directory of Open Access Journals (Sweden)

    Menon Narayanankutty Sunilkumar , Vadakut Krishnan Parvathy

    2014-11-01

    Full Text Available Panayiotopoulos syndrome (PS is a relatively frequent and benign epileptic syndrome seen in children in the age group of 3-6 years and is characterised by predominantly autonomic symptoms and/or simple motor focal seizures followed or not by impairment of consciousness. Although multifocal spikes with high amplitude sharp-slow wave complexes at various locations can be present in the EEG, interictal electroencephalogram (EEG in children with this particular type of epilepsy characteristically shows occipital spikes. This syndrome has known to be a masquerader and can imitate gastroenteritis, encephalitis, syncope, migraine, sleep disorders or metabolic diseases. In the absence of thorough knowledge of types of benign epilepsy syndromes and their various clinical presentations, epilepsy such as PS can be easily missed. The peculiar aspects of this type of epilepsy in children should be known not only by paediatricians but also by general doctors because a correct diagnosis would avoid aggressive interventions and concerns on account of its benign outcome. In this case study, we report a case of PS in a 3 year old child.

  20. 3D Virtual Dig: a 3D Application for Teaching Fieldwork in Archaeology

    Directory of Open Access Journals (Sweden)

    Paola Di Giuseppantonio Di Franco

    2012-12-01

    Full Text Available Archaeology is a material, embodied discipline; communicating this experience is critical to student success. In the context of lower-division archaeology courses, the present study examines the efficacy of 3D virtual and 2D archaeological representations of digs. This presentation aims to show a 3D application created to teach the archaeological excavation process to freshmen students. An archaeological environment was virtually re-created in 3D, and inserted in a virtual reality software application that allows users to work with the reconstructed excavation area. The software was tested in class for teaching the basics of archaeological fieldwork. The application interface is user-friendly and especially easy for 21st century students. The study employed a pre-survey, post-test, and post-survey design, used to understand the students' previous familiarity with archaeology, and test their awareness after the use of the application. Their level of knowledge was then compared with that of those students who had accessed written material only. This case-study demonstrates how a digital approach to laboratory work can positively affect student learning. Increased abilities to complete ill-defined problems (characteristic of the high-order thinking in the field, can, in fact, be demonstrated. 3D Virtual reconstruction serves, then, as an important bridge from traditional coursework to fieldwork.