WorldWideScience

Sample records for anticuerpos monoclonales a3

  1. Seguridad post-comercialización de los anticuerpos monoclonales antineoplásicos

    OpenAIRE

    González Iglesias, Verónica

    2016-01-01

    INTRODUCCIÓN: Los primeros anticuerpos monoclonales comercializados en España han sido rituximab, trastuzumab, bevacizumab, cetuximab y panitumumab, en este orden. El estudio de su seguridad en los primeros años postcomercialización es fundamental para definir su relación beneficio/riesgo en las condiciones de uso autorizadas. JUSTIFICACIÓN Y OBJETIVOS: Con el fin de estudiar la seguridad postcomercialización de los anticuerpos monoclonales nos planteamos como objetivos: 1) Analizar las s...

  2. Detección de pepsinógeno mediante el uso de antisueros y anticuerpos monoclonales.

    Directory of Open Access Journals (Sweden)

    Oscar Orozco

    2000-02-01

    Full Text Available

    El pepsinógeno (PGA y PGC es una aspartato proteasa secretada por células principales gástricas que a pH ácido se convierte en pepsina. Los niveles séricos de dicha enzima se han postulado como indicadores del estado de la mucosa gástrica ya que dependiendo de la patología de base estos pueden encontrarse elevados o disminuidos. Así, en la gastritis superficial y úlcera duodenal los niveles de PGA se encuentran aumentados, mientras que en la gastritis atrófica y cáncer gástrico se encuentran disminuidos. Se planteó como objetivo de este trabajo producir anticuerpos policlonales y monoclonales anti-pepsinógeno con el fin de ser empleados en el diseño de sistemas de cuantificación de pepsinógeno sérico, ya que los sistemas de cuantificación comerciales son muy costosos y de difícil acceso. Para la producción de los anticuerpos se empleó pepsina A porcina como inmunógeno teniendo en cuenta que presenta una alta homología en la secuencia de aminoácidos (86% con la pepsina A humana y además tienen una estructura secundaria idéntica. Anticuerpos policlonales fueron obtenidos de conejos Nueva Zelanda inmunizados vía subcutánea con pepsina A porcina y los anticuerpos monoclonales a partir de células de bazo de los ratones BALB/c inmunizados con pepsina A vía intraperitoneal. Los anticuerpos tanto policlonales como monoclonales fueron purificados por precipitación con sulfato de amonio y posteriormente cromatografía de intercambio iónico a partir del suero o líquido ascítico respectivamente. Los anticuerpos purificados, tanto policlonales como monoclonales, son capaces de reconocer pepsina porcina y pepsinógeno humano presente en sonicados de biopsias gástricas en ensayos de ELISA y western blot. En ensayos de inmunohistoquímica realizados sobre cortes de biopsias gástricas los anticuerpos monoclonales detectan el pepsinógeno presente en el

  3. Anticuerpos monoclonales contra la Gonadotropina Corionica Humana (HCG y su empleo en el diagnóstico precoz del embarazo.

    Directory of Open Access Journals (Sweden)

    Torres E

    2006-03-01

    Full Text Available Se describe la obtención y caracterización de anticuerpos monoclonales contra la hormona gonadotropina cariónica humana (HCG, seleccionados de la inmunización subcutánea en ratones BALB/c. Se reporta también el desarrollo del sistema rápido HeberFast Line® Embarazo, para la detección de la hormona en muestras de orina, basado en los anticuerpos obtenidos y la tecnología del flujo lateral desarrollada en membranas de nitrocelulosa como soporte sólido. El nivel de sensibilidad alcanzado con este sistema diagnóstico es de 20 UI/L de HCG en muestra de orina, y no se observó reactividad cruzada en analitos similares conteniendo concentraciones de las glicohormonas relacionadas; 1000 IU de LH, 5000 IU de FSH, y 1000 µIU de TSH respectivamente. Los estudios de estabilidad arrojaron, que el diagnosticador mantine las características de funcionalidad por un tiempo de 15 meses a temperaturas entre 2 y 30 ºC, conformando este el tiempo de vigencia del sistema. De poseer en Farmacias, Consultorios Médicos de la Familia y Hospital Gineco-Obstétricos, un sistema rápido y sencillo como el establecido en este trabajo, se pueden evitar todos los riesgos e inconvenientes que acarrean los procesos de interrupción del embarazo en la mujer.

  4. Obtención de anticuerpos monoclonales de ratón contra proteasa de cisteína 5 recombinante de Entamoeba histolytica

    Directory of Open Access Journals (Sweden)

    Juanita Trejos S.

    2012-08-01

    Full Text Available Objetivo. Obtener anticuerpos monoclonales de ratón contra la proteasas de cisteína 5 (EhCP5 de Entamoeba histolytica. Materiales y métodos. Se inmunizaron ratones BALB/c por vía intraperitoneal con adyuvante de Freund completo e incompleto con la proteína recombinante EhCP5 obtenida a partir del cultivo de E.coli DH5α trasfectada con el vector recombinante pJC45 que expresa dicha proteína. Se seleccionó el animal con mejor respuesta de anticuerpos. Al cual se le extrajo su bazo como fuente de linfocitos B, los cuales se fusionaron utilizando PEG con células de mieloma de ratón SP2-0/Ag14. Se procedió a selección de los hibridomas y a la evaluación de los sobrenadantes de las colonias que crecieron a los 7 días mediante ELISA. Los hibridomas con valores más altos de anticuerpos específicos contra la proteína EhCP5r se seleccionaron, y los clones obtenidos por diluciones limitantes fueron expandidos. Resultados. A partir de un clon secretor estable se purifico el anticuerpo monoclonal anti EhCP5r del isotipo IgG1 por cromatografía de afinidad con proteína G. Los clones fueron expandidos in vivo e in vitro. Con el anticuerpo purificado se diseñaron tres sistemas de captura para evaluar la aplicabilidad del anticuerpo monoclonal anti EhCP5r como método inmunodiagnóstico. Conclusiones. Se logro la producción de un anticuerpo monoclonal específico contra EhCP5r que permite diferenciar Entamoeba histolytica de Entamoeba dispar.

  5. Procedimiento para la obtención de anticuerpos monoclonales a partir de muestras complejas de antígenos

    OpenAIRE

    Fraile de Paz, Sofía; Zafra-Amorós, Olga; Jiménez, José Ignacio; Lorenzo Prieto, Víctor de

    2011-01-01

    La presente invención se refiere a un proceso de selección, en un solo paso, de dominios variables de anticuerpos, preferiblemente de camello, unidos a fagos, de gran afinidad y especificidad para un antígeno concreto o diversas proteínas que comparten epítopos comunes. Además el procedimiento incluye de forma preferente una amplificación de los fagos que comprenden los dominios variables de interés, mediante la infección de bacterias por dichos fagos, lo que permite la obtención de un elevad...

  6. Anticuerpos monoclonales específicos de inmunoglobulina G canina: caracterización y aplicación en inmunoensayos

    OpenAIRE

    2011-01-01

    En este trabajo se ha conseguido aislar la IgG+IgM de perro a partir de sueros de animales sanos y enfermos, considerado de gran interés dada la escasez de este tipo de reactivos en el mercado y de la importancia de los estudios inmunologicos en las especies de interes veterinario. A partir de la IgG comercial se ha producido y posteriormente caracterizado un panel de seis anticuerpos (CA2E9, CA3B8, CA3H1, CA4E7, CA4F1, CA5B2) frente a dicha inmunogloblulina. Dada la reaccion cruzada de los a...

  7. El potencial de la inmunomodulación con anticuerpos monoclonales anti-CD137 (4-1BB para terapia de enfermedades malignas e infecciones virales crónicas The immunotherapy potential of agonistic anti-CD137 (4-1BB monoclonal antibodies for malignancies and chronic viral diseases

    Directory of Open Access Journals (Sweden)

    C. Alfaro

    2006-04-01

    Full Text Available La manipulación farmacológica del sistema inmunitario para conseguir respuestas linfocitarias de mayor intensidad tiene aplicación potencial en inmunoterapia tumoral y en el tratamiento de enfermedades virales crónicas. Los anticuerpos monoclonales inmunoestimuladores se definen como una familia de fármacos que aumentan la respuesta inmunitaria al interaccionar como ligandos artificiales con proteínas funcionales del sistema inmunitario, activando o inhibiendo su función. Hay anticuerpos monoclonales humanizados dirigidos frente al receptor inhibidor linfocitario CD152 (CTLA-4 que se están probando en ensayos clínicos con evidencia de actividad antitumoral, aunque con la contrapartida de producir reacciones autoinmunitarias severas. Los anticuerpos anti-CD137 tienen la capacidad de inducir potentes respuestas inmunitarias, mediadas principalmente por linfocitos T citotóxicos, con el resultado de erradicar tumores transplantables de ratón de forma comparativamente superior a los anticuerpos frente a CD152. CD137 (4-1BB es un antígeno de diferenciación expresado selectivamente en la superficie de linfocitos T y NK activados y sobre células dendríticas. Los anticuerpos monoclonales que actúan como ligandos artificiales estimuladores de este receptor (anticuerpos monoclonales agonistas anti-CD137 potencian la inmunidad celular antitumoral y antiviral en modelos experimentales murinos. Paradójicamente, estos mismos anticuerpos previenen o mejoran el curso de enfermedades autoinmunitarias establecidas en ratones como modelo. A la luz de estos datos experimentales, varios grupos de investigación han procedido a la humanización de anticuerpos dirigidos frente a CD137 humano y se plantea la inminente realización de los primeros ensayos clínicos.Pharmacological intervention on the immune system to achieve more intense lymphocyte responses has potential application in tumour immunology and in the treatment of chronic viral diseases

  8. Diagnóstico rápido de citomegalovirus (CMV en pacientes inmunocomprometidos mediante anticuerpos monoclonales que reconocen proteinas precoces virales Rapid diagnosis of cytomegalovirus infection in immunocompromised patients by using monoclonal antibodies against early viral antigens

    Directory of Open Access Journals (Sweden)

    Maritza Alvarez

    1989-06-01

    Full Text Available Se aplicó la técnica de detección de antigenos precoces fluorescentes (DAPF usando el anticuerpo monoclonal E-13 McAb, mediante el cual se lograron detectar 15 casos positivos a CMV de 75 muestras de orina o sangre ("buffy coat" tomadas de 52 pacientes inmunocomprometidos ingresados en el Instituto de Nefrología de ciudad Habana. Aplicando las técnicas clásicas de aislamiento en fibroblastos humanos diploides (MRC-5, se lograron aislar 12 cepas de CMV de casos previamente positivos por DAPF; lográndose además un aislamiento en una muestra reportada negativa por fluorescencia. Se observó una coincidencia de un 80% entre ambas técnicas. Se detectó la presencia de anticuerpos IgG contra CMV en todos los casos estudiados, utilizando para ello la técnica ELISA.A technique was applied to detect early fluorescent antigens (DEFA of cytomegalovirus (CMV using the E13 monoclonal antibodies in 52 immunocompromised patients hospitalized in the Nephrology Institute of Havana. Of the 75 urine or blood (buffy coat samples taken, 15 were found positive to CMV. Using classical diploide human fibroblast isolation technique, 12 CMV strains were isloation of previously detected positive samples by DEFA. In addition, CMV was isolated from one sample reported to be negative by DEFA. A coincidence of 80% was found between both techniques. With the ELISA test, all the sample studied have IgG antibodies to CMV.

  9. Detección de pepsinógeno mediante el uso de antisueros y anticuerpos monoclonales.

    OpenAIRE

    Oscar Orozco; Giovanni Suárez; Carolina Sierra

    2000-01-01

    El pepsinógeno (PGA y PGC) es una aspartato proteasa secretada por células principales gástricas que a pH ácido se convierte en pepsina. Los niveles séricos de dicha enzima se han postulado como indicadores del estado de la mucosa gástrica ya que dependiendo de la patología de base estos pueden encontrarse elevados o disminuidos. Así, en la gastritis superficial y úlcera duodenal los niveles de PGA se encuentr...

  10. Aplicación de una biblioteca de anticuerpos lineales humanos frente al polisacárido capsular de Neisseria meningitidis serogrupo B

    Directory of Open Access Journals (Sweden)

    Emigdio León-Toirac

    2013-12-01

    Full Text Available Neisseria meningitidis serogrupo B produce aún morbimortalidad significativa. Su polisacárido capsular muestra similitud estructural con proteínas humanas y pobre inmunogenicidad, obstaculizando así el desarrollo de vacunas y anticuerpos monoclonales (AcM y policlonales contra esta bacteria. Recientemente se han creado bibliotecas artificiales de anticuerpos humanos expresados en bacteriófagos que reconocen específicamente a moléculas diana existentes, con la ventaja sobre los AcM convencionales por su rápida obtención, sin utilización de animales de laboratorio, lo que emerge como alternativa atractiva para la producción de AcM contra antígenos peculiares o complejos. Se realizó un trabajo de investigación básica, utilizando una biblioteca de fagos filamentosos que expresan constitutivamente regiones variables de anticuerpos humanos, que se enfrentó al polisacárido capsular de N. meningitidis serogrupo B. Los resultados que se obtuvieron mediante ELISA policlonal sugieren la existencia de anticuerpos humanos expresados en fagos que lo reconocen.

  11. Haptenos, conjugados y anticuerpos para el fungicida pirimetanil

    OpenAIRE

    Mercader Badia, Josep Vicent; Abad Fuentes, Antonio; Abad Somovilla, Antonio; Agulló, Consuelo

    2012-01-01

    [ES] La presente invención se refiere a haptenos, conjugados, derivados marcados y anticuerpos para pirimetanil. Así mismo, la presente invención también se refiere al uso de los derivados marcados de pirimetanil como antígenos de ensayo o inmunógenos para obtener anticuerpos de este fungicida; y al uso de los derivados marcados de pirimetanil como antígenos de ensayo. Además, la presente invención también se refiere a un método de análisis de pirimetanil utilizando los anticuerpos obtenidos,...

  12. Haptenos, conjugados y anticuerpos para el fungicida pirimetanil

    OpenAIRE

    Mercader Badia, Josep Vicent; Abad Fuentes, Antonio; Abad Somovilla, Antonio; Agulló, Consuelo

    2012-01-01

    La presente invención se refiere a haptenos, conjugados, derivados marcados y anticuerpos para pirimetanil. Así mismo, la presente invención también se refiere al uso de conjugados de pirimetanil como antígenos de ensayo o inmunógenos para obtener anticuerpos de este fungicida; y al uso de los derivados marcados de pirimetanil como antígenos de ensayo. Además, la presente invención también se refiere a un método de análisis de pirimetanil utilizando los anticuerpos obtenidos, en ocasiones jun...

  13. Anticuerpo anticitrulina y manifestaciones extra articulares en artritis reumatoidea

    Directory of Open Access Journals (Sweden)

    María Jezabel Haye Salinas

    2013-02-01

    Full Text Available Los pacientes con artritis reumatidea (AR pueden desarrollar manifestaciones extra articulares (MExA, relacionadas a su morbi-mortalidad. Los anticuerpos anti-péptidos citrulinados cíclicos (ACCP son específicos para la AR y estan relacionados con el daño articular; y podrían tener rol patogénico en las MExA. Nuestro objetivo fue determinar la relación entre los anticuerpos ACCP y MExA en pacientes con AR. Se incluyeron 74 pacientes con diagnóstico de AR (ACR 1987 mayores de 18 años, de más de 6 meses de evolución, con MExA, y un control apareado por sexo y edad sin MExA por cada paciente. Las variables demográficas, clínicas y de laboratorio se compararon con test t, chi cuadrado o Mann-Whitney. Se realizó análisis multivariado; p ≤ 0.05. Los pacientes con MExA presentaron mayor título de anticuerpo ACCP (116 vs. 34, p < 0.01 y de factor reumatoideo (FR (108 vs. 34.5, p < 0.01. En el análisis multivariado hubo asociación entre la presencia de MExA y tabaquismo activo (p = 0.02, OR: 3.78, IC 95%: 1.17-12.2, FR positivo (p = 0.04, OR: 3.23, IC95%: 1.04-11.8 y anticuerpo ACCP positivo (p = 0.04, OR: 3.23, IC 95%: 1.04-10. Presentaron mayor título de anticuerpo ACCP que los controles los pacientes con xerostomía (109 vs. 34, p = 0.04, xeroftalmia (150 vs. 34, p < 0.01, nódulos sub-cutáneos (NSC (141 vs. 34, p < 0.01 y fibrosis pulmonar (158 vs. 34, p = 0.04. En conclusión, el anticuerpo ACCP positivo, el FR positivo y el tabaquismo activo fueron factores de riesgo independientes para el desarrollo de MExA.

  14. Trasplante renal en pacientes con anticuerpos dirigidos contra donante

    Directory of Open Access Journals (Sweden)

    Federico Cicora

    2014-10-01

    Full Text Available En trasplante renal, los anticuerpos donante-específicos por ensayos de fase sólida predicen el rechazo temprano mediado por anticuerpos, incluso con resultados negativos de citometría de flujo o citotoxicidad dependiente del complemento. Aquí se describen los protocolos de inmunosupresión y los resultados a diez meses de cuatro pacientes en los que se detectó anticuerpos donante-específicos anti-antígenos leucocitarios humanos (HLA por Luminex®, pero no detectados por el método de citotoxicidad dependiente de complemento (CDC ni por citometría de flujo. Los cuatro pacientes recibieron tratamiento de inducción con 5 dosis de timoglobulina de 1.25 mg/kg y 5 dosis de inmunoglobulina intravenosa (IVIG de 400 mg/kg. Además, uno recibió 20 mg de basiliximab el mismo día del trasplante y el día 4 postrasplante; otro recibió 3 sesiones de plasmaféresis en los días -5, -3, y -1 y eculizumab en dosis de 1200 mg antes del trasplante, 900 mg el día 1, and 600 mg por semana durante un mes. En todos los casos, la inmunosupresión de mantenimiento consistió en tacrolimus, micofenolato y deltisona. Todos presentaron buenos resultados en el corto plazo. Nuestra experiencia sugiere que los pacientes con anticuerpos donante-específicos anti-HLA detectados solo por Luminex® deben recibir un seguimiento estricto y que en esta población se pueden obtener buenos resultados a partir del uso de terapia de inducción con timoglobulina e IVIG.

  15. Antisperm autoantibodies and infertility Anticuerpos antiespermatozoides e infertilidad

    Directory of Open Access Journals (Sweden)

    Jorge Eliécer Ossa Londoño

    1997-02-01

    Full Text Available Fourteen human infertile couples were studied along with seven fertile control couples in order to determine the presence of antisperm au. toantibodies and to correlate results with their clinical reproductive status, spermogram parameters and the quality of cervical mucus. Immunoglobulins of IgG and IgA isotypes were evaluated on spermatozoa by the direct immunobead technique and in serum and cervical mucus by the indirect method. The following differences were found: Nine of 14 male patients but only 1 of 7 male controls had IgG on spermatozoa (p= 0.042 and OR= 10.8. Seven out of 14 male patiens and 1 of 7 controls were positive for IgA on spermatozoa (p= 0.12. Infertile males had a higher frequency of abnormal spermogram parameters as compared to controls (p= 0.0029 and OR= 3.32. Interestingly, the presence of only IgG in serum appeared to be a "protective factor" against IgG on sperm; only one out of the 16 positive males contradicted this observation. Para determinar la presencia de anticuerpos antiespermatozoides y correlacionarla con la situación reproductiva, el espermograma y la calidad del moco cervical, se estudiaron 7 parejas sanas, con hijos, y 14 infértiles. Se determinaron por las técnicas directa e indirecta de inmunoesferas los anticuerpos de los isotipos IgG e IgA en espermatozoides, suero y moco cervical. En 9 de los 14 hombres infértiles y en 1 de los 7 fértiles se encontraron anticuerpos IgG en la superficie de los espermatozoides (p= 0.042 y una Razón de disparidad [RD] = 10.8 y 8 de éstos también tuvieron IgA en los espermatozoides. El número de pruebas alteradas en el espermograma de los hombres infértiles fue significativamente mayor (p= 0.0029 y RD = 3.32. Tanto en los hombres infértiles como en los fértiles la presencia de sólo IgG en el suero parece ser un "factor de protección" contra IgG en los espermatozoides; de los 16 hombres que presentaron anticuerpos, fuera en el suero o en los espermatozoides, s

  16. Thyroid autoantibodies in autoimmune diseases Anticuerpos antitiroideos en enfermedades autoinmunes

    Directory of Open Access Journals (Sweden)

    Regina M. Innocencio

    2004-06-01

    Full Text Available Abnormalities in the thyroid function and thyroid autoantibodies have been frequently described in patients with autoimmune diseases but seldom in antiphospholipid syndrome patients. In order to determine the prevalence of thyroid function and autoimmune abnormalities, we compared serum thyrotropin (TSH, serum free thyroxine (T4 levels, thyroid antithyroglobulin (TgAb and antithyroperoxidase (TPOAb levels of 25 patients with systemic sclerosis, 25 patients with rheumatoid arthritis and 13 patients with antiphospholipid syndrome to a control group of 113 healthy individuals. Evaluation included a thorough clinical examination with particular attention to thyroid disease and a serologic immune profile including rheumatoid factor, antinuclear and anticardiolipin antibody measurements. Subclinical hypothyroidism (4.2Ciertas anormalidades en la función tiroidea y anticuerpos antitiroideos han sido frecuentemente descriptos en pacientes con enfermedades autoinmunes, y más raramente en pacientes con el síndrome antifosfolipídico. Para determinar la prevalencía de anormalidades en la función tiroidea y de autoinmunidad, comparamos los niveles séricos de tirotropina (TSH tiroxina libre en suero (T4 anticuerpos antitiroglobulina (TgAb y antitiroperoxidasa (TPOAb en 25 pacientes con esclerosis sistémica, 25 pacientes con artritis reumatoidea y 13 pacientes con el síndrome antifosfolipídico con un grupo control de 113 individuos aparentemente sanos. La evaluación incluyó un completo examen clínico con particular atención para las enfermedades de la tiroides y una evaluación inmunológica incluyendo dosaje del factor reumatoideo, anticuerpos antinucleares y anticardiolipina. Hipotiroidismo subclínico (4.2anticuerpos anti-tiroglobulina (TgAb y/o anti-peroxidasa (TPOAb estaban presentes en 21/63 (33% de los

  17. Efecto de un anticuerpo monoclonal anti CD20 (Rituximab) en trombocitopenia inmune.

    OpenAIRE

    Untama, José; Médico, Departamento de Hematología, Hospital Nacional Edgardo Rebagliati Martins – EsSalud. Lima.; Del Carpio, Daniel; Médico, Departamento de Hematología, Hospital Nacional Edgardo Rebagliati Martins – EsSalud. Lima.

    2012-01-01

    Objetivo: Describir la respuesta terapéutica con un anticuerpo monoclonal anti CD20 (Rituximab), en pacientes con Trombocitopenia Inmune (PTI). Material y métodos: Estudio retrospectivo, descriptivo y observacional tipo serie de casos. Se revisaron las historias clínicas de pacientes adultos con PTI que recibieron el anticuerpo monoclonal anti CD20 (Rituximab), desde diciembre 2005 hasta diciembre 2010. Se definió respuesta: conteo plaquetario >30 mil, por lo menos duplicar el conteo plaqu...

  18. Manejo de la embarazada con isoinmunización por anticuerpos irregulares

    OpenAIRE

    Fuenzalida C,Javiera; Carvajal C,Jorge A

    2014-01-01

    La isoinmunización eritrocitaria feto-materna se define como la presencia de anticuerpos maternos dirigidos contra antígenos presentes en los glóbulos rojos fetales. Los anticuerpos maternos pueden atravesar la barrera placentaria y provocar hemólisis de los glóbulos rojos fetales produciendo anemia hemolítica e hiperbilirrubinemia, características de la enfermedad hemolítica perinatal (EHP). La principal causa de EHP es la incompatibilidad ABO, seguida de la isoinmunización por RhD; esta últ...

  19. Rearreglos de genes de cadenas pesadas de las inmunoglobulinas en las gammapatías monoclonales Immunoglobulin heavy chain gene rearrangements in the monoclonal gammopathies

    Directory of Open Access Journals (Sweden)

    Andrea Bosaleh

    2005-06-01

    Full Text Available Las neoplasias de células plasmáticas resultan de la expansión de un clon de células B que secreta inmunoglobulinas, conocido como componente monoclonal o componente M. Las neoplasias malignas incluyen al mieloma múltiple y la macroglobulinemia de Waldenström, y la condición premaligna comprende las gammapatías monoclonales de significado incierto (MGUS. El MGUS presenta un componente monoclonal sin evidencia de mieloma múltiple, macroglobulinemia de Waldenström, amiloidosis primaria u otros desórdenes. El diagnóstico se basa en la combinación de características patológicas, radiológicas y clínicas. Aproximadamente el 25% de las gammapatías monoclonales de significado incierto desarrollarán mieloma múltiple, amiloidosis sistémica, macroglobulinemia o enfermedades linfoproliferativas malignas, indicando que sería una condición premielomatosa. El objetivo del presente trabajo es establecer la utilidad clínica de la inmunofenotipificación por citometría de flujo (CF y la detección de clonalidad por biología molecular. Se estudiaron 32 pacientes, siete con diagnóstico de mieloma múltiple y veinticinco con gammapatía monoclonal en estudio, los cuales fueron divididos en cuatro grupos basados en los datos clínicos y los resultados de CF. En el grupo de pacientes con CF no diagnóstica, se realizó la detección de los rearreglos de los genes de las cadenas pesadas de las inmunoglobulinas mediante reacción en cadena de la polimerasa (PCR, detectándose monoclonalidad en el 59% de los casos. El estudio de los rearreglos de los genes de las cadenas pesadas de las IgH mediante PCR incrementa la sensibilidad de detección de monoclonalidad.Plasma cell neoplasia occurs as a result of the expansion of an immunoglobulin-secreting B-cells clones, known as monoclonal component or M component. Malignant neoplasias include multiple myeloma and Waldenström macroglobulinemia, while premalignant conditions comprise monoclonal

  20. Frecuencia de anticuerpos anti Toxoplasma gondii en gestantes de Cúcuta, Colombia

    OpenAIRE

    Cárdenas, Denny; Lozano, Claudia; Castillo, Zaida; Cedeño, Jessenia; Galvis, Viannis; Rios, Jessica; Tórres, Madalhene

    2016-01-01

    La toxoplasmosis es una infección ocasionada por Toxoplasma gondii, peligrosa durante la gestación. La presencia de anticuerpos IgG específicos implica contacto previo individuo-parásito, mientras que la detección de IgM anti-T. gondii, es considerada marcador de infección aguda, fase en la que se incrementa además el título IgG. Objetivo: Determinar la frecuencia y título de anticuerpos contra Toxoplasma gondii en gestantes. Material y métodos: Estudio transversal, se determinó el título de ...

  1. Papel de los anticuerpos en la protección contra micobacterium tuberculosis

    Directory of Open Access Journals (Sweden)

    Nesty Olivares

    2006-12-01

    Full Text Available Convencionalmente se asume que la defensa del hospedero contra Mycobacterium tuberculosis se basa en los mecanismos de inmunidad celular exclusivamente y se descarta el papel de los anticuerpos en la protección. En este trabajo se analizan evidencias recientes que retan este dogma y sugieren la importancia de considerar la manipulación de la respuesta inmune humoral como una alternativa en la investigación de vacunas contra la tuberculosis.

  2. Anticuerpos anticardiolipina en pacientes con hipertensión arterial esencial

    OpenAIRE

    Diumenjo, M. S.; Testasecca, E.; Testasecca, A.; Maneschi, E.

    2014-01-01

    Los anticuerpos antifosfolípidos pueden activar el endotelio, modificar su función, alterar la regulación del tono vascular, producir daño renal, y así participar en la patogenia de la hipertensión arterial esencial. Antiphospholipid antibodies can activate the endothelium, alter their function, alter the regulation of vascular tone, cause kidney damage, and thus participate in the pathogenesis of essential hypertension. Fil: Diumenjo, M. S.. Universidad Nacional de Cuyo...

  3. Diagnóstico diferencial en la encefalitis por anticuerpos contra el receptor NMDA

    Science.gov (United States)

    González-Valcárcel, J.; Rosenfeld, M.R.; Dalmau, J.

    2011-01-01

    Resumen Introducción La encefalitis por anticuerpos contra el receptor de NMDA (NMDAR) suele desarrollarse como un síndrome característico de evolución multifásica y diagnóstico diferencial amplio. Pacientes Presentamos a 2 pacientes diagnosticadas de encefalitis por anticuerpos NMDAR con un cuadro clínico típico, pero que inicialmente señaló otras etiologías. Discusión La afectación frecuente de pacientes jóvenes con manifestaciones psiquiátricas prominentes indica frecuentemente otras consideraciones diagnósticas; las más frecuentes son las encefalitis virales, los procesos psiquiátricos y el síndrome neuroléptico maligno. Varios síndromes previamente definidos de manera parcial o descriptiva en adultos y pacientes pediátricos probablemente eran casos de encefalitis anti-NMDAR. Conclusiones La encefalitis anti-NMDAR debe considerarse en pacientes jóvenes con manifestaciones psiquiátricas subagudas, movimientos anormales y alteraciones autonómicas. La caracterización clínica e inmunológica de esta enfermedad ha llevado a la identificación de nuevos anticuerpos que afectan a procesos de memoria, aprendizaje, conducta y psicosis. PMID:20964986

  4. Asociación entre enfermedad cardiovascular y anticuerpos contra Chlamydia pneumoniae

    Directory of Open Access Journals (Sweden)

    García-Elorriaga Guadalupe de los A

    2002-01-01

    Full Text Available Objetivo. Precisar si existe asociación entre enfermedad cardiovascular (ECV y anticuerpos contra Chlamydia en población mexicana. Material y métodos. Estudio transversal, realizado en la Unidad de Investigación en Inmunología e Infectología -Hospital de Infectología del Centro Médico Nacional La Raza (CMNR- y en el Servicio de Cirugía Cardiovascular y Asistencia Circulatoria, del Hospital General del CMNR, Instituto Mexicano del Seguro Social (IMSS, de agosto de 1998 a abril de 2000. Se determinaron anticuerpos IgG e IgM contra C. psittaci, C. trachomatis y C. pneumoniae mediante microinmunofluorescencia, en suero de 70 pacientes con ECV hospitalizados en el CMNR, mayores de 30 años, de uno u otro sexo, y se compararon con 140 sanos, pareados por edad y sexo. Se utilizaron muestras aleatorias simples, con un tamaño poblacional de 110, una prevalencia de 50% y un nivel de confianza de 99%. Para establecer la diferencia entre las proporciones de los títulos se utilizó ji cuadrada y se calculó la razón de momios. Resultados. El 94.3% (66/70 de los pacientes presentó IgG en contra de C. pneumoniae vs 37% (52/140 de los individuos sanos (p<0.001. Conclusiones. Existe una fuerte asociación entre anticuerpos IgG hacia C. pneumoniae y ECV.

  5. OBTENCIÓN DE ANTICUERPOS POLICLONALES IgY ANTIPARVOVIRUS CANINO A PARTIR DE YEMA DE HUEVO DE GALLINA

    OpenAIRE

    Pinto, J.; Barco, M.; Afanador, M.C.; Merchán, A.M.*;; Montañez, M.F.; Andrade, F; Torres, O.

    2005-01-01

    Inmunizando un grupo de diez gallinas de postura raza Lohmann de 16 semanas de edad con parvovirus canino (CPV) cepa vacunal, se obtuvieron anticuerpos IgY policlonales contra CPV en yema de huevo.En la extracción de los anticuerpos de la yema se requirieron dos pasos, el primero para la remoción de lípidos y el segundo para la precipitación de proteínas. Para la remoción de lípidos se usó el método PBS:Cloroformo y para la precipitación de los anticuerpos solubles (Inmunoglobulinas-IgY) se u...

  6. Asociación entre enfermedad cardiovascular y anticuerpos contra Chlamydia pneumoniae

    OpenAIRE

    García-Elorriaga Guadalupe de los A; Calderón-Abbo Moisés; González-Bonilla César R

    2002-01-01

    Objetivo. Precisar si existe asociación entre enfermedad cardiovascular (ECV) y anticuerpos contra Chlamydia en población mexicana. Material y métodos. Estudio transversal, realizado en la Unidad de Investigación en Inmunología e Infectología -Hospital de Infectología del Centro Médico Nacional La Raza (CMNR)- y en el Servicio de Cirugía Cardiovascular y Asistencia Circulatoria, del Hospital General del CMNR, Instituto Mexicano del Seguro Social (IMSS), de agosto de 1998 a abril de 2000. Se d...

  7. DESARROLLO Y ESTANDARIZACION DE TECNOLOGIAS PARA LA PRODUCCION DE ANTICUERPOS MONOCLONARES MODIFICADOS CON APLICACIONES EN BIOMEDICINA

    OpenAIRE

    AGUILLON GUTIERREZ, JUAN CARLOS

    2004-01-01

    Las proteínas recombinantes terapéuticas, conocidas como biofármacos, han revolucionado la industria farmacéutica, esperándose una creciente demanda en los próximos años. Dentro de éstos, destacan los anticuerpos recombinantes (AcR), que pueden clasificarse en quiméricos, humanizados y completamente humanos, hallándose varios de ellos disponibles comercialmente, con aplicaciones en el tratamiento del cáncer, enfermedades autoinmunes, rechazo de transplante renal, tratamiento de cardiopatía co...

  8. Anticuerpos antifosfolípido en el lupus eritematoso sistémico

    OpenAIRE

    López Soto, Alfonso

    1990-01-01

    INTRODUCCION: El lupus eritematoso sistémico (LES) es una enfermedad autoinmune que se caracteriza por la producción de numerosos autoanticuerpos. Recientemente, se ha descrito un nuevo grupo denominado anticuerpos antifosfolípido (AAF), cuyo estudio ha despertado un gran interés por sus implicaciones clínicas y patogenéticas. Los AAF son un grupo heterogéneo de autoanticuerpos adquiridos de forma espontánea, que van dirigidos contra estructuras fosfolipídicas de las membranas celulares.La de...

  9. Detección de anticuerpos contra artritis encefalitis caprina (AEC) mediante inmunoelectrotransferencia

    OpenAIRE

    Emiliano Tesoro Cruz; Rafael Hernández González; Alejandro Martínez Rodríguez; Hugo Ramírez Álvarez; María Elena Trujillo Ortega; Roberto Kretschmer Schmid; Álvaro Aguilar Setién

    2003-01-01

    En México la artritis encefalitis caprina (AEC) está presente, pero se ignora la frecuencia y prevalencia. El objetivo del presente trabajo fue evaluar la técnica de inmunoelectrotransferencia o western blot (WB) para la detección de anticuerpos anti-VAEC en sueros caprinos. Se evaluaron 50 sueros de cabras nativas seleccionadas al azar (25 de Amazcala, Querétaro, y 25 de Cuautitlán, Estado de México) por ensayo inmunoenzimático (ELISA) y WB. El criterio de positividad para WB fue el propuest...

  10. ¿Sabía usted? Anticuerpos antifosfolípidos

    Directory of Open Access Journals (Sweden)

    Javier Molina

    1992-02-01

    Full Text Available

    Los anticuerpos antifosfolípidos comprenden varias poblaciones de inmunoglobulinas, que pueden ocasionar falsos positivos biológicos con el VDRL, interferir con el complejo activador de la protrombina (anticoagulante lúpico o reaccionar con elfosfolípido cardiolipina en una prueba de enzimoinmunoanálisis (EIA.

  11. Cubeta para la incubación y lavado de anticuerpos

    OpenAIRE

    Nogal París, María Luisa; Revilla Novella, Yolanda

    2008-01-01

    Cubeta para la incubación y lavado de anticuerpos. La cubeta comprende un cuerpo (1) lavable, inerte y no poroso, que está dotado de unos pocillos (2) ubicados en su interior, cuyo número y tamaño puede variar en función del requerimiento experimental. En dichos pocillos (2) se introducen preferiblemente fragmentos o tiras (3) de nitrocelulosa, que contienen proteínas que han sido previamente transferidas desde un gel de poliacrilamida utilizando un campo eléctrico. Es...

  12. DETECCIÓN DE ANTICUERPOS IgM A LEPTOSPIRA EN HUMANOS EN RIESGO OCUPACIONAL EN VILLAVICENCIO, META

    Directory of Open Access Journals (Sweden)

    Luz Díaz P

    2008-04-01

    Full Text Available Objetivo. Determinar la seroprevalencia a la infección por leptospira en una población humana y los factores de riesgo ocupacional asociados en Villavicencio, Meta. Materiales y métodos. Se aplicó un modelo epidemiológico transversal con selección por conveniencia de grupos e individuos dentro de grupos. Se obtuvieron muestras de sangre por punción cubital de 273 personas correspondientes a 8 grupos de riesgo. Se obtuvo información de factores de riesgo mediante entrevista. Se determinaron anticuerpos IgM mediante ELISA indirecta. Se utilizó una prueba de c2 mediante el programa SPSS 11.0 para Windows. Resultados. La seroprevalencia general fue 19%. Por grupos fue para trabajadores de matadero 7%, veterinarios y auxiliares de clínica de pequeños animales 17%, estudiantes de último año de MVZ 17%, ordeñadores 21%, trabajadores de arrozales 23%, trabajadores de granjas porcícolas 35%, trabajadores de piscícolas 48%. Se encontraron 3 factores asociados, el estrato rural p = 0.0005 ICCR 1.50 a 3.83, tenencia de mascota canina p = 0.046 ICCR 1.03 a 3.26 y contacto con roedores en el trabajo p = 0.000037 ICCR = 1.73 a 4.75. Conclusiones. Se encontró una alta seroprevalencia general de infectados por Leptospira, siendo los grupos de más alta prevalencia los trabajadores piscícolas y de granjas porcícolas. Se reconoce una vez más el carácter ocupacional de la infección posiblemente por falta de medidas de higiene y protección laboral.

  13. Inmunodeficiencias primarias por déficit de anticuerpos en adultos

    Directory of Open Access Journals (Sweden)

    María Mercedes Bello Rodríguez

    2014-10-01

    Full Text Available Se realizó una investigación sobre los pacientes con inmunodeficiencias primarias por déficit de anticuerpos, atendidos en el servicio de inmunología del Hospital General “Dr. Ernesto Guevara” de Las Tunas, con el objetivo de caracterizar las inmunodeficiencias por déficit de anticuerpos en pacientes adultos, atendiendo al tipo de inmunoglobulina afectada, el sexo y la edad, así como las principales manifestaciones clínicas. Se evaluaron un total de diez pacientes tratados por esta causa entre los años 2005 y 2013. Para la evaluación de los resultados se utilizó el análisis de frecuencias simple. Las inmunodeficiencias diagnosticadas se correspondieron en un 50% con el déficit de las tres clases de inmunoglobulinas. Predominó el sexo masculino en un 70% y las edades más afectadas se correspondieron con la cuarta y quinta décadas de la vida. Las infecciones respiratorias y digestivas fueron las más frecuentes (80%, tanto por gérmenes bacterianos como virales, la infección por Giardia lamblia también apareció muy frecuentemente en los pacientes estudiados

  14. Prevalencia de anticuerpos anti envoltura nuclear y sus isotipos en sueros positivos para anticuerpos antinucleares Prevalence of antinuclear envelope antibodies and their isotypes in sera positive for antinuclear antibodies

    Directory of Open Access Journals (Sweden)

    Miriam Arcavi

    2006-08-01

    Full Text Available Los anticuerpos antinucleares detectados por inmunofluorescencia indirecta en células HEp-2 presentan una gran variedad de imágenes, entre ellas el patrón de envoltura nuclear que suele ser un hallazgo poco frecuente. Se procesaron 2594 sueros en los cuales se detectó un 37.6% de anticuerpos antinucleares. La prevalencia de anticuerpos anti-envoltura nuclear (ANEA fue del 1.2% presentando una alta asociación con hepatopatías autoinmunes (83% y baja con lupus eritematoso sistémico. En los 21 sueros de los pacientes que presentaron ANEA no se detectaron anticuerpos anti-ADNn hallándose 28.6% de anticuerpos anti-músculo liso y 19% de anticuerpos anti-mitocondriales. El corte triple de tejido de rata mostró ser un sustrato menos sensible que HEp-2 para la detección de ANEA. Al utilizar conjugados dirigidos contra diferentes isotipos de anticuerpos para la detección de ANEA, se encontró: 90.5% de IgG, 66.6% de IgA y 9.5% de IgM. Dos de los pacientes presentaron ANEA-IgA a altos títulos (³1:160 en ausencia de ANEA-IgG. En este trabajo se destaca la importancia de realizar pruebas complementarias que detecten anticuerpos anti-músculo liso, anti-mitocondriales y anti-ADNn, para orientar el diagnóstico clínico de los pacientes que presentan ANEA. Además, sostiene la postura de utilizar como conjugado para IFI-HEp2 anticuerpos anti-inmunoglobulinas totales en lugar de anti-IgG hasta tanto se clarifique el rol que juegan los anticuerpos IgA en estas enfermedades autoimunes.Antinuclear antibodies detected in HEp-2 cells by indirect immunofluorescence assay display a great variety of images, including the nuclear envelope pattern. This is quite a less frequent finding. Two thousand five hundred and ninety-four sera were processed, and 37.6% of ANA were detected. The prevalence of anti-nuclear envelope antibodies (ANEA was of 1.2%, with a high association with autoimmune liver diseases (83% and a low association with systemic lupus

  15. OBTENCIÓN DE ANTICUERPOS POLICLONALES IgY ANTIPARVOVIRUS CANINO A PARTIR DE YEMA DE HUEVO DE GALLINA

    Directory of Open Access Journals (Sweden)

    Pinto, J.

    2005-06-01

    Full Text Available Inmunizando un grupo de diez gallinas de postura raza Lohmann de 16 semanas de edad con parvovirus canino (CPV cepa vacunal, se obtuvieron anticuerpos IgY policlonales contra CPV en yema de huevo.En la extracción de los anticuerpos de la yema se requirieron dos pasos, el primero para la remoción de lípidos y el segundo para la precipitación de proteínas. Para la remoción de lípidos se usó el método PBS:Cloroformo y para la precipitación de los anticuerpos solubles (Inmunoglobulinas-IgY se usó el método de salting-out con sulfato de amonio ((NH42SO4. La evaluación del proceso se efectuó empleando el método comercial estándar “EGGstract IgY Purification System®” de PROMEGA.La metodología empleada permitió la obtención de anticuerpos IgY policlonales contra CPV a partir de yema de huevo de gallina en concentraciones altas por mililitro de yema, con una pureza aceptable y títulos altos; los resultados fueron comparables con el método comercial.

  16. Anticuerpos séricos contra la enfermedad de Newcastle e Influenza Aviar en aves rapaces de Chile.

    Directory of Open Access Journals (Sweden)

    Daniel González-Acuña

    2012-12-01

    Full Text Available Objetivo. Detectar la presencia de anticuerpos séricos sanguíneos contra los virus de la Enfermedad de Newcastle (ENC e Influenza aviar (IA, para comprender la contribución de las aves silvestres en la transmisión de estos virus en Chile. Materiales y métodos. Se analizaron 63 aves pertenecientes a los órdenes Falconiformes y Strigiformes desde centros de rehabilitación de aves de las zonas central y sur de Chile. Se realizaron las pruebas de inhibición de la hemoaglutinación (IHA para detectar anticuerpos contra el virus ENC e inmunodifusión en gel agar (IDGA y ELISA para IA. Resultados. Se detectaron 14 aves positivas (22.2% para anticuerpos séricos contra el virus de la ENC. En cambio, no se registraron anticuerpos séricos sanguíneos para el virus de la IA. Conclusiones. La presencia de aves rapaces positivas en los centros de rescate a los anticuerpos séricos contra el virus de la ENC puede ser explicada por el consumo de carne de pollos que han sido vacunados contra ENC o consumo de aves que han adquirido directamente el virus vacunal a través de los distintos procedimientos de administración (aerosoles, bebederos de la vacuna o por el ingreso a los centros de rescate de aves rapaces migratorias, las que podrían facilitar la diseminación de la infección desde los países de origen, hecho que debe ser investigado.

  17. Seroprevalencia de anticuerpos anti-Toxoplasma gondii en pacientes con afecciones Oncohematológicas

    Directory of Open Access Journals (Sweden)

    Dailín Cobos Valdes

    2009-01-01

    Full Text Available Se analiza la reactividad de 23 muestras de suero de pacientes con hemopatías malignas provenientes de la sala de hematología del Hospital Clínico Quirúrgico de Holguín, mediante la técnica de Inmunofluorescencia Indirecta, reportándose un 65,2% de seroprevalencia. La Toxoplasmosis es una enfermedad causada por el agente etiológico Toxoplasma gondii, parásito intracelular obligado ampliamente distribuido en todo el mundo y capaz de infectar un gran número de huéspedes, incluida la especie humana. Numerosas han sido las investigaciones sobre la presencia de anticuerpos anti- Toxoplasma gondii en individuos inmunodeficientes, donde los pacientes con enfermedades oncohematológicas son un grupo representativo dentro de esta población.

  18. Anticuerpos ANTI-HTLV-I/II en una población del Amazonas colombiano

    Directory of Open Access Journals (Sweden)

    Abraham Blank

    2004-03-01

    Full Text Available

    En Colombia ya son varias las regiones donde se ha informado la presencia de la infección por los retrovirus linfotrópicos humanos tipos I y II (HTLV-I y HTLV-II. La principal región endémica para HTLV-I es el sur de la costa pacífica. El HTLV-II se ha encontrado en grupos indígenas que viven en diferentes regiones rurales como en la Guajira, la Orinoquía, en la costa pacífica y en una familia en Cali (urbana. Hasta el momento los estudios hechos en el Amazonas colombiano no habían confirmado la presencia de estos retrovirus. Se pretende estudiar la presencia de anticuerpos contra HTLV-I y/o HTLV-II utilizando una prueba comercial de Western blot que confirma y diferencia la infección por cada uno de los dos retrovirus mencionados, en caso de encontrar pruebas reactivas en pruebas de tamización.

    Luego de aceptar la participación en este estudio, se buscó la presencia de anticuerpos contra los retrovirus HTLV-I/II con pruebas de tamización en un total de 401 muestras de suero de personas que atendieron al Hospital de Leticia y a la consulta médica en Puerto Nariño. La muestra correspondió a 238 personas de raza mestiza y 163 de origen amerindio. Se realizaron pruebas de ELISA y/o aglutinación de partículas. Las muestras con pruebas de tamización reactivas, se sometieron a un estudio confirmatorio de la infección mediante el estuche comercial de Western blot Problot 2.4 de GeneLabs. En una mujer amerindia se demostró anticuerpos contra el HTLV-II, enun hombre mestizo contra el HTLV-I y en otro hombre mestizo contra el HTLV-II. No había enfermedad asociada en las personas estudiadas.

    La prevalencia de infección por los HTLV en la muestra estudiada fue 0.75%. Aunque este porcentaje no es muy elevado, debe

  19. SISTEMA INMUNE Y GENÉTICA: UN ABORDAJE DIFERENTE A LA DIVERSIDAD DE ANTICUERPOS.

    Directory of Open Access Journals (Sweden)

    Matta Camacho Nubia Estela

    2011-12-01

    Full Text Available RESUMEN Es común encontrar en los libros de inmunología o de genética un capítulo con el título de “sistema inmune y genética”, sin embargo su asociación se centra en cómo la generación de anticuerpos rompió el paradigma “un gen, una proteína”, pues en el caso de la producción de anticuerpos, un gen produce millones de proteínas. El sistema inmune tiene muchos vínculos con la genética y la herencia; esta asociación se da porque cualquier sustancia o compuesto que produzca un organismo, es un antígeno potencial cuando es reconocido como extraño por el sistema inmune de otro organismo, sea este de la misma o de diferente especie. La producción de proteínas que potencialmente pueden ser antigénicas están ligadas al genotipo del individuo. La capacidad de responder y el tipo e intensidad de respuesta a los antígenos también ha sido demostrado que está correlacionado con el genotipo del individuo en cuestión, así como deficiencias en las respuestas inmunes pueden estar asociadas con mutaciones o polimorfismos genéticos que resultan en la susceptibilidad a enfermedades infecciosas. Este artículo se busca presentar ejemplos de la relación del sistema inmune y la genética, en la misma dirección de la conferencia ofrecida para la cátedra de Sede “Todo lo que usted quiere saber de genética y nunca se atrevió a preguntar”. Palabras claves: HLA, respuesta inmune, grupos sanguíneos, antígenos. ABSTRACT It is common to find in immunology or genetic books a chapter entitled “immune system and genetics”; this association focuses on how the generation of antibodies broke the paradigm “one gene, one protein”, since in this case one gene generates millions of proteins. However, the immune system has many more links to genetics and heredity. For example, any substance or compound that an organism produces is a potential antigen, when it is recognized as foreign by the immune system of another

  20. Evaluación de la respuesta de anticuerpos hacia antígenos de Pseudomonas aeruginosa.

    Directory of Open Access Journals (Sweden)

    Aniel Moya

    2007-04-01

    Full Text Available Pseudomonas aeruginosa es un patógeno extracelular que genera una respuesta de anticuerpos específicos con utilidad para el diagnóstico y vacunas. En el presente estudio nos propusimos evaluar en suero humano los niveles de anticuerpos contra antígenos relevantes de P. aeruginosa. Realizamos la determinación de anticuerpos IgG contra tres exoenzimas, consideradas como factores de virulencia de mayor importancia en infecciones. Este resultado dio paso a la evaluación del reconocimiento de IgG e IgA hacia antígenos de la envoltura celular bacteriana por ELISA de células enteras. Todos los sueros evaluados mostraron títulos de IgG e IgA superiores a los individuos sanos, con excepción de dos muestras de pacientes que no mostraron alto título. Este ensayo permitió analizar el nivel de reconocimiento hacia los antígenos más expuestos de la bacteria que incluyen principalmente LPS y proteínas de membrana externa. Se encontró diferencias entre los valores de densidad óptica a 450 nm de individuos sanos y enfermos. El método usado permitió seleccionar dos sueros de pacientes de diferentes tipos de infecciones que fueron comparados por Western blot. Se observó que aunque los sueros tenían reacción hacia distintos serotipos de P. aeruginosa, la intensidad del reconocimiento variaba según el tipo de infección.

  1. Encefalitis por anticuerpos contra el receptor de NMDA: experiencia con seis pacientes pediátricos. Potencial eficacia del metotrexato

    Science.gov (United States)

    Bravo-Oro, Antonio; Abud-Mendoza, Carlos; Quezada-Corona, Arturo; Dalmau, Josep; Campos-Guevara, Verónica

    2016-01-01

    Introducción La encefalitis por anticuerpos contra el receptor de N-metil-D-aspartato (NMDA) es una entidad cada vez más diagnosticada en edad pediátrica. A diferencia de los adultos, en muchos casos no se asocia a tumores y las manifestaciones iniciales en niños más frecuentes son crisis convulsivas y trastornos del movimiento, mientras que en los adultos predominan las alteraciones psiquiátricas. Casos clínicos Presentamos seis casos pediátricos confirmados con anticuerpos contra la subunidad NR1 del receptor de NMDA en suero y líquido cefalorraquídeo. Cinco de los casos comenzaron con crisis convulsivas como manifestación clínica inicial antes de desarrollar el cuadro clásico de esta entidad. En todos los casos se utilizaron esteroides como primera línea de tratamiento, con los que sólo se observó control de las manifestaciones en uno, por lo que el resto de los pacientes requirió inmunomoduladores de segunda línea. Todos los pacientes recibieron metotrexato como tratamiento inmunomodulador para evitar recaídas y la evolución fue a la mejoría en todos ellos. Conclusiones En nuestra serie de pacientes con encefalitis por anticuerpos contra el receptor de NMDA, ninguno se asoció a tumores. Todos los casos recibieron metotrexato por lo menos durante un año, no observamos eventos adversos clínicos ni por laboratorio, ni hubo secuelas neurológicas ni recaídas durante el tratamiento. Aunque es una serie pequeña y es deseable incrementar el número y tiempo de evolución, consideramos el metotrexato una excelente alternativa como tratamiento inmunomodulador para esta patología. PMID:24150952

  2. Anticuerpos séricos contra la enfermedad de Newcastle e Influenza Aviar en aves rapaces de Chile

    OpenAIRE

    Daniel González-Acuña; Álvaro Gaete; Lucila Moreno; Karen Ardiles; Fabiola Cerda-Leal; Christian Mathieu; René Ortega

    2012-01-01

    RESUMENObjetivo. Detectar la presencia de anticuerpos séricos sanguíneos contra los virus de la Enfermedad de Newcastle (ENC) e Influenza aviar (IA), para comprender la contribución de las aves silvestres en la transmisión de estos virus en Chile. Materiales y métodos. Se analizaron 63 aves pertenecientes a los órdenes Falconiformes y Strigiformes desde centros de rehabilitación de aves de las zonas central y sur de Chile. Se realizaron las pruebas de inhibición de la hemoaglutinación (IHA) p...

  3. Descripción de los anticuerpos, y manifestaciones clínicas de pacientes con polimiositis y dermatomiositis

    OpenAIRE

    Vega Castro, Kelly Patricia

    2014-01-01

    Introducción: La polimiositis y dermatomiositis, son enfermedades del grupo de miopatías inflamatorias, su curso es crónico, etiología autoinmune, tienen debilidad muscular simétrica de inicio proximal y la dermatomiositis se asocia a manifestaciones cutáneas. Genera importante situación de discapacidad física y emocional, costo social y económico elevado. La asociación de los anticuerpos circulantes con las manifestaciones clínicas, posibilidad de complicaciones y pronóstico ha tenido en los...

  4. Producción de un anticuerpo IgY específico contra el antígeno CD41 humano

    Directory of Open Access Journals (Sweden)

    Esteban J. Gutiérrez Calzado

    2009-01-01

    Full Text Available Desde hace dos décadas, la comunidad científica muestra un gran interés hacia la generación de anticuerpos en gallinas ponedoras por las ventajas que estas aportan al compararse con otros métodos tradicionales para este fin, sobre todo, en el hecho de lograrse en ellas, mejores respuestas de anticuerpos hacia antígenos de mamíferos muy conservados en la filogenia entre los que se encuentran glicoproteínas de membrana celular. El objetivo de este trabajo fue la generación de anticuerpos específicos contra la glicoproteína de membrana plaquetaria humana gpIIb/IIIa (antígeno CD41 en gallinas ponedoras. Para este propósito, se utilizaron gallinas de 22 semanas de edad, a las que se les aplicaron dosis de 20 ¿g de una preparación inmunopurificada de este antígeno plaquetario, emulsionada con adyuvante completo e incompleto de Freund para una primera y segunda inmunización respectivamente, a intervalos de un mes. Se cosecharon los huevos diariamente de los animales inmunizados a partir de un día antes de esta aplicación hasta 30 d posteriores a la segunda inyección, se procesaron estos para la extracción de los anticuerpos específicos presentes en ellos y se obtuvo la dinámica de producción de anticuerpos por el método clásico de Ouchterlony que se enfrentó a una preparación pura del antígeno. Las respuestas de anticuerpos obtenidas resultaron en títulos adecuados susceptibles de investigar en usos posteriores en la Medicina Transfusional específicamente para el análisis de la calidad de plasmas.

  5. EVIDENCIA DE LA PRESENCIA DE ANTICUERPOS DE Mycoplasma hyopneumoniae EN CERDOS PROVENIENTES DE GRANJAS DE CRIANZA ARTESANAL DEL SUR DE LIMA.

    OpenAIRE

    Ibarra C., Marco; Practica privada.; Noé M., Norma; Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima; Alvarado S., Arnaldo; Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima. Apdo. 41-0068; Perales C., Rosa; Facultad de Medicina Veterinaria, Universidad Nacional Mayor de San Marcos, Lima. Apdo. 41-0068

    2014-01-01

    Se realizó un estudio para determinar la presencia de anticuerpos de Mycoplasma hyopneumoniae en cerdos provenientes de granjas de crianza artesanal, mediante la detección de anticuerpos, utilizando el ensayo inmuno absorbente ligado a enzimas(ELISA). Ciento sesenta animales de 8 a 9 meses de edad procedentes de granjas de 4 distritos ubicados al Sur de Lima, fueron muestreados al momento de ser beneficiados en 2 carmales frigoríficos del valle de Lima. Se obtuvo una frecuencia de animales po...

  6. Utilidad de las muestras de sangre total desecada en papel de filtro en la detección de anticuerpos antitoxoplasma

    Directory of Open Access Journals (Sweden)

    Joaquim Gascon

    1989-04-01

    Full Text Available Se compara la técnica de Aglutinación Directa (AD utilizando muestras de sangre total desecada en papel de filtro, con la técnica de ELISA y la misma AD utilizando muestras de suero de los mismos pacientes, para la detección de anticuerpos antitoxoplasma. Los resultados muestran la validez del método de la sangre desecada en papel de filtro para la detección de anticuerpos antitoxoplasma con la técnica de AD, y se considera su utilidad en los estudios epidemiológicos de campo.

  7. Prevalencia de anticuerpos contra Brucella sp. En donantes del banco de sangre de un hospital de Lima

    Directory of Open Access Journals (Sweden)

    Abel Ortega

    2007-10-01

    Full Text Available El Perú es un país endémico de Brucelosis, por lo que existe el riesgo de transmisión a través de sangre donada por no ser parte del tamizaje regular que realizan los bancos de sangre. Para conocer la prevalencia de anticuerpos contra Brucella en donantes del banco de sangre del Hospital Edgardo Rebagliati Martins, se analizó 1003 muestras de suero. La prueba tamiz fue Rosa de Bengala (RB; las muestras positivas fueron evaluadas por las pruebas de aglutinación en tubo (AT y 2-Mercaptoetanol (2-ME. Dos donantes fueron positivos a RB, confirmados por AT y 2-ME, se encontró una prevalencia de 0,20% (IC99%: 0,01-0,92. Se demostró la presencia de donantes portadores de anticuerpos contra Brucella con posible Brucelosis activa, evidenciándose la posibilidad de transmisión de esta infección. Se debe realizar mayores estudios con la finalidad de conocer la realidad de otros bancos de sangre.

  8. Prevalencia de anticuerpos IgG al toxoide tetánico en trabajadores sanitarios

    Directory of Open Access Journals (Sweden)

    B. Pérez Bermúdez

    2014-09-01

    Full Text Available Introducción: En el año 2009 el Ministerio de Sanidad y Consumo de España publica una nueva guía para la vacunación de la Difteria y Tétanos. Existen discrepancias con los tiempos de inoculación de las dosis de recuerdo con otros países y sociedades médicas. Material y métodos: Estudio descriptivo. Las variables analizadas fueron: IgG-Toxoide Tetánico, tiempo última dosis de vacunación, dosis totales, edad, sexo, hospital, habito tabáquico e índice de masa corporal. Se construyó un modelo de Regresión Logística. Con el fin de determinar los puntos de corte más sensibles y específicos para las variables temporales (tiempo desde la última dosis y edad se calcularon las curvas R.O.C Resultados: Las variables, edad O,R= 17,56 (1,840 - 167,760, dosis de vacuna inoculadas al trabajador, O,R= 0,064 (0,006 - 0,908 y tiempo de la última dosis de vacunación, O,R= 1,03 (1,017 - 1,047, son las variables significativas en el análisis multivariante. Los puntos de cortes, para la edad son 54 años (Sensibilidad S= 0,72, Especificidad SP=0,77 y 15 años tras la última dosis años (S= 0,88, SP=0,86, por encima de este corte la probabilidad de no tener anticuerpos al Tétanos es alta. Conclusiones: Ante un trabajador que refiere o documenta que hace más de 15 años de la ultima dosis deberíamos plantearnos la revacunación, si además este trabajador refiere no tener más de 5 dosis inoculadas y tiene más de 54 años la revacunación sería muy recomendable.

  9. Evaluación de anticuerpos contra enfermedades prevenibles por vacunas en el binomio madre–recién nacido en hospitales de Ciudad de La Habana

    Directory of Open Access Journals (Sweden)

    Rolando Felipe Ochoa

    2007-08-01

    Full Text Available El sistema inmune es inmaduro en los recién nacidos, lo que los hace susceptibles a las enfermedades infecciosas, sin embargo, pueden ser parcialmente protegidos por los anticuerpos adquiridos a través de la placenta. Por ello, nos propusimos evaluar la transferencia transplacentaria de anticuerpos contra algunas enfermedades prevenibles por vacunas. Se realizó un ensayo prospectivo, aleatorio, en el binomio madre–recién nacido. Para ello se analizó un total de 96 pares de muestras de suero, tomadas en el salón de preparto y al nacimiento en hospitales de Ciudad de La Habana, durante el año 2004. Se emplearon técnicas inmunoenzimáticas para determinar los niveles de antitoxina tetánica (ATT, antitoxina diftérica (ATD y anticuerpos contra proteínas de membrana externa del meningococo B (PME, contra el polisacárido capsular del meningococo C (PSC y contra el polisacárido Vi de Salmonella Typhi. Se detectó un nivel apropiado de ATT, tanto en las madres como en los recién nacidos, predominando los valores correspondientes a la protección de larga duración (>1 UI/mL, con 88,54% y 92,71%, respectivamente. Se observó niveles de ATD inferiores a 0,1 UI/mL, límite para una protección confiable, en el 54,17% y 45,83% de las madres y los recién nacidos. El 90,63% de las madres y el 96,88% de los recién nacidos presentaron concentraciones de anticuerpos contra PME superiores a 2 µg/mL, así como el 38,54% y el 41,67% para anticuerpos contra PSC. La seroprotección contra la Salmonella Typhi (>1 µg/mL fue de 5,21% y 8,33%, respectivamente. La mayoría de los recién nacidos presentaron títulos superiores de anticuerpos al de sus madres, lo cual demuestra que la transferencia transplacentaria de anticuerpos es un mecanismo eficiente.

  10. Prevalencia de anticuerpos contra Leptospira en personas asintomáticos y en perros de Chancay, Lima 2001

    Directory of Open Access Journals (Sweden)

    Manuel Céspedes

    2007-10-01

    Full Text Available Objetivos. Determinar la prevalencia de anticuerpos contra Leptospiras en personas asintomáticas dedicadas a la agricultura, pesca y comercio y en perros domésticos de localidades de Chancay (Huaral, Lima. Material y métodos. Estudio transversal analítico, se tomó muestras de suero de 268 pobladores de tres localidades, en quienes se evaluó la presencia de anticuerpos totales contra Leptospiras por el método de ELISA IgG y la prueba de microaglutinación (MAT. Se buscaron los factores asociados con la positividad a Leptospiras calculando el OR con su intervalo de confianza al 95%. De la misma manera, se tomó muestras de suero de 241 perros a los que se realizó la prueba de MAT. Resultados. La prevalencia de anticuerpos contra Leptospira en población asintomática fue de 10,1% (IC95%: 6,3-13,9, la cual estuvo asociada con el abastecimiento de agua para consumo en quebrada o pozo (OR: 3,48, IC95%: 1,39-8,74, con el antecedente de nadar en el río o acequia (OR: 4,75, IC95%: 1,51-14,92 y con tener una edad entre 21-40 años (OR: 2,47, IC95%: 1,10-5,52. Los serovares más frecuentes fueron Icterohaemorrhagiae y Canicola según MAT. En canes, 27,8% (67/241 tuvieron serología positiva a leptospiras. Conclusiones. Existe una mediana prevalencia de serología positiva para Leptospiras en la población general asintomática y condiciones favorables para la presencia de Leptospiras en las localidades estudiadas. En estas zonas se recomienda realizar actividades educativas preventivas frecuentes, tomando en cuenta los resultados de este estudio y el personal de salud debe sospechar de la leptospirosis como una causa de enfermedad febril.

  11. DETECCIÓN DE ANTICUERPOS ANTI-Leishmania (Trypanosomatidae EN POBLACIONES CANINAS DEL DEPARTAMENTO DE SUCRE, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Luís Enrique Paternina Tuirán

    2015-11-01

    Full Text Available RESUMENEl objetivo de la investigación fue determinar la prevalencia de anticuerpos anti-Leishmania en perros del departamento de Sucre, Colombia. Se analizaron 122 perros del área rural de los municipios de Ovejas, Sampués y Sincelejo, mediante la técnica de inmunofluorescencia indirecta (IFI. Anticuerpos anti-Leishmania fueron detectados en el 69,6 % (IC95 % = 61,1 – 78,2 de la población canina estudiada. En el municipio de Sincelejo la seropositividad fue del 72 % (IC95 % = 61,1 – 82,8, en el municipio de Sampués del 68,4 % (IC95 % = 52,3 – 84,5 y en el municipio de Ovejas del 55,5 % (IC95 % = 21,2 – 86,3. Los animales seropositivos fueron principalmente caninos jóvenes y adultos. El 17,6 % de los perros seropositivos mostró signos clínicos compatibles con leishmaniasis canina, entre los cuales la onicogrifosis, alopecia y caquexia fueron los más comunes. La alta frecuencia de caninos con anticuerpos a Leishmania detectada en el presente estudio, pone de manifiesto la hiperendemicidad de la leishmaniasis canina en esta zona del país, así como el alto riesgo de brotes epidémicos de la enfermedad.ABSTRACTThe aim of this survey was to determine prevalence of antibodies against Leishmania in dogs from Sucre, Colombia. We analyzed 122 dogs in rural areas from municipalities of Sampués, Ovejas and Sincelejo, by indirect immunofluorescence (IFA. Anti-Leishmania antibodies were detected in 69.6 % (95 % CI = 61.1 to 78.2 of the selected canine population. In the municipality of Sincelejo, Sampues and Ovejas, the seropositivities were 72 % (95 % CI = 61.1 to 82.8, 68.4 % (95 % CI = 52.3 to 84.5 and 55.5 % (95 % CI = 21.2 to 86.3 respectively. Seropositive animals were mainly young and adult dogs. The 17.6 % of seropositive dogs showed clinical signs compatible with canine leishmaniasis; onychogryphosis, alopecia and cachexia were the most common ones. The detected high frequency of canines with antibodies against Leishmania in the

  12. Modelamiento del sistema inmune aviar para la optimización de la producción de anticuerpos específicos / Modelling of the avian immune system for the optimization of specific antibody production

    OpenAIRE

    Olarte Dussan, Fredy Andres

    2011-01-01

    Esta tesis presenta una metodología para optimizar la producción de anticuerpos específicos en aves. Anticuerpos (también conocidos como inmunoglobulinas) son herramientas biotecnológicas de gran valor usadas en investigación, diagnóstico y tratamiento. Usualmente, la producción de anticuerpos se realiza por medio de la inoculación en varias oportunidades de un animal con una concentración particular de un antígeno y la recolección de estas moléculas en las respuestas secundarias ...

  13. Vasculitis asociadas a anticuerpos anti-citoplasma de neutrófilos: Clínica y tratamiento

    OpenAIRE

    María Virginia Paolini; Juan Pablo Ruffino; Diego S. Fernández Romero

    2013-01-01

    Las vasculitis asociadas a anticuerpos anti-citoplasma de neutrófilos (ANCA) comprenden a un grupo de enfermedades caracterizadas por la inflamación de la pared de pequeños vasos. Analizamos las características epidemiológicas y clínicas en una serie de 47 pacientes: 23 (49%) granulomatosis de Wegener (GW), 15 (32%) poliangeítis microscópica (PAM) y nueve (19%) vasculitis limitada al riñón (VLR). La edad media al inicio de los síntomas fue de 50.7 ± 14.9 años. La manifestación clínica más fre...

  14. Seroprevalencia de anticuerpos contra Moquillo canino en perros no vacunados en dos municipios de Ciudad de la Habana

    Directory of Open Access Journals (Sweden)

    Márquez Álvarez, Mario:

    2006-09-01

    Full Text Available Esto es el resumen de un trabajorealizado con el objetivo de determinarla presencia de anticuerpos séricoscontra Moquillo Canino en perros novacunados de dos municipios de Ciudadde la Habana, se estudiaron 117 canesmayores de 1 año de edad y con accesoa la calle, 51 del municipio Boyeros y 57del municipio Cotorro, que no contabancon antecedentes de vacunaciónanterior. Se estudiaron además 9animales vacunados recientemente quese utilizaron como controles positivos delestudio. Se tomaron datos referentes ala edad y sexo de los animales y seextrajeron muestras de sangre quefueron centrifugadas para la obtenciónde suero. Para la determinación deanticuerpos se empleó un ELISAestandarizado por la División deBiotecnología y Control de la Calidad delCentro Nacional para la Producción deAnimales de Laboratorio (Cuba. Lasplacas se leyeron en un lector SensidentScan a 414 nm. Se consideró como valorde corte el valor promedio de laDensidad Óptica del suero controlnegativo. La actividad de anticuerpos delas muestras se midió sobre la base delvalor de Densidad Óptica obtenidoconsiderando positivas todas las quepresentaron valores por encima del Valorde Corte. Se establecieron rangosagrupando los valores individuales enaltos, medios y bajos. Se comprobó queexiste una alta seroprevalencia deanticuerpos contra el virus en losmunicipios estudiados, con valores deDensidad Óptica en su mayoría incluidosdentro de los rangos medio y alto, lo queevidencia una amplia circulación delagente en el área, sin que se observarainfluencia del sexo, la edad de losanimales y el municipio de procedenciasobre la respuesta inmune observada.

  15. ANTICUERPOS DIRIGIDOS A PEQUEÑAS MOLÉCULAS DE NEUROTRANSMISORES Y PÉPTIDOS: PRODUCCIÓN Y APLICACIÓN DE ANTICUERPOS A DOPAMINA, SEROTONINA, GABA, VASOPRESINA, PÉPTIDO VASOACTIVO INTESTINAL, NEUROPÉPTIDO Y, SOMATOSTATINA Y SUSTANCIA P

    OpenAIRE

    Buijs, Ruud M.; Ma. del Carmen Basualdo S.

    2009-01-01

    En el presente trabajo se describe un procedimiento por medio del cual pueden ser obtenidos anticuerpos a partir de moléculas pequeñas de neurotransmisores usando glutaraldehido como agente acoplador. Este procedimiento fue desarrollado bajo la condición de que el inmunógeno usado para la preparación del anticuerpo fuera, hasta donde fuese posible, de la misma identidad que la molécula transmisora fijada al tejido. Con el de fin de lograr mayor éxito, los péptidos, aminas o aminoácidos1 fuero...

  16. Asociación entre la presencia de anticuerpos anti-Ras y anti-VPH16 E4/E7 y lesiones intraepiteliales del cérvix

    Directory of Open Access Journals (Sweden)

    Vázquez-Corzo Sara

    2003-01-01

    Full Text Available OBJETIVO: Determinar si anticuerpos séricos contra E4, E7 y Ras pueden ser utilizados como marcadores de lesiones tempranas del cérvix uterino asociadas al virus del papiloma humano. MATERIAL Y MÉTODOS: Entre marzo de 1999 y abril de 2000 se realizó un estudio sero-epidemiológico de casos y controles en la clínica de displasias del Hospital General Doctor Gea González, en la Ciudad de México, en 116 muestras de suero para evaluar la presencia de anticuerpos anti-E4, E7 y Ras utilizando un ELISA de captura. Se estimaron razones de momios e intervalos de confianza de 95% RESULTADOS: Anticuerpos anti-E7 se asociaron a mujeres con lesiones NIC III, mientras que anticuerpos anti-E4 y anti-Ras fueron más frecuentes en lesiones NIC I-II. Al evaluar el perfil de anticuerpos que presentaron las mujeres, encontramos que a anticuerpos contra dos proteínas predicen la existencia de una lesión NIC I-II, y b la presencia de tres anticuerpos predicen una lesión NIC III. CONCLUSIONES: La detección de anticuerpos séricos contra E4, E7 y Ras en combinación con otras técnicas de diagnóstico, podrían ser de utilidad para detectar oportunamente a mujeres con lesiones tempranas asociadas al Virus del Papiloma Humano y en riesgo de desarrollar cáncer.

  17. Tuberculosis meníngea: desarrollo de inmunoensayos para detección de anticuerpos específicos y su potencial uso diagnóstico

    Directory of Open Access Journals (Sweden)

    María L. Gennaro

    2001-04-01

    Full Text Available

    En el mundo y en Colombia la tuberculosis meníngea (TBM es la causa más frecuente de las meningitis crónicas (1,2. Las características clínicas y los hallazgos de laboratorio la sugieren pero no la confirman, requiriéndose el cultivo que es demorado y de baja sensibilidad (2. La detección de anticuerpos contra una combinación de antígenos podría contribuir al diagnóstico (3.
    Para evaluarlo, nuestro objetivo fue determinar la utilidad diagnóstica de la detección de anticuerpos específicos para Mycobacterium tuberculosis en líquido cefalorraquídeo (LCR.

     

     

  18. Anticuerpos frente a virus West nile y otros virus transmitidos por artropodos en la poblacion del Delta del Ebro

    Directory of Open Access Journals (Sweden)

    Lozano Alvaro

    1998-01-01

    Full Text Available FUNDAMENTOS: El virus West Nile (VWN es un Flavivirus que se transmite al hombre a través de distintas especies de mosquitos y produce brotes y casos esporádicos de enfermedad en distintas regiones del Viejo Mundo, incluída la Cuenca Mediterránea. Las zonas húmedas europeas que acogen aves migratorias procedentes de África constituyen áreas de alto riesgo para esta infección, así como para otras infecciones víricas transmitidas por artrópodos. MÉTODOS: Con objeto de investigar la prevalencia de la infección por el VWN y otros virus de transmisión similar en la población humana del Delta del Ebro, se estudiaron 1037 muestras de suero, obtenidas en 10 localidades de la zona, para presencia de anticuerpos frente a VWN y otros 12 virus transmitidos por artrópodos (3 Alfavirus, 8 Flaviviridae y 1 Bunyaviridae mediante titulación por inhibición de la hemaglutinación (IHA. En algunos casos se estudió la presencia de IgM específica por IHA tras fraccionar el suero por centrifugación en gradientes de sacarosa. RESULTADOS: En total, se encontró reactividad significativa frente a alguno de los virus probados en 130 casos (12.5%; 4.1% frente a Alfavirus, 8.0% frente a Flaviviridae y 0.4% frente a Bunyaviridae. El análisis de los títulos de anticuerpos reveló porcentajes significativos de muestras con títulos elevados frente a antígenos de VWN y otros. La distribución de la seroprevalencia fue muy desigual, concentrándose fundamentalmente en 3 localidades del interior del Delta (Ampolla, San Jaime y Montells, donde la prevalencia de anticuerpos frente a Flaviviridae llegó a alcanzar el 30% y se observaron niveles residuales de IgM frente a VWN en algunos sueros. CONCLUSIONES: Estos resultados y los obtenidos previamente en otras regiones de la Península Ibérica sugieren que el VWN circula en la población humana de las zonas de riesgo y produce brotes epidémicos periódicos. Habida cuenta del alto porcentaje de

  19. Prevalencia de anticuerpos contra Trypanosoma cruzi en donadores de sangre del IMSS, Orizaba, Veracruz, México

    Directory of Open Access Journals (Sweden)

    Ramos-Ligonio Angel

    2006-01-01

    Full Text Available OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores del Hospital General Regional del Instituto Mexicano del Seguro Social (IMSS en la ciudad de Orizaba, Veracruz. MATERIAL Y MÉTODOS: Se examinaron muestras de donadores del banco de sangre del Hospital General Regional (HGRO del IMSS para la búsqueda de antiT. cruzi por ELISA, Western blot e IFI, utilizando una proteína recombinante (MBP::Hsp70 y un extracto crudo de epimastigotes. Las muestras fueron obtenidas entre los meses de octubre de 2001 a enero de 2002. RESULTADOS: Los 420 donadores de sangre analizados fueron seronegativos para HBV, HCV, BrA, VDRL y HIV. Después del tamizaje de los 420 donadores, se identificaron dos individuos seropositivos por las pruebas de ELISA, Western blot e IFI, con una seroprevalencia de 0.48%. CONCLUSIONES: En este estudio se muestran evidencias de seropositividad para T. cruzi en donadores de sangre del HGRO, lo que sugiere la existencia de riesgo de contaminación por transfusión sanguínea. Por tal motivo, es necesario aplicar programas para el tamizaje serológico a través de técnicas inmunológicas con alta sensibilidad y especificidad.

  20. Prevalencia de anticuerpos para Trypanosoma cruzi en caninos de dos municipios endémicos de Boyacá

    Directory of Open Access Journals (Sweden)

    Diego Manrique Abril

    2012-04-01

    Full Text Available Objetivo. evaluar la prevalencia de anticuerpos anti Trypanosoma cruzi (T. cruzi en una muestra de caninos domésticos residentes en dos municipios endémicos. Materiales y métodos. Se tomaron muestras séricas de 20 caninos procedentes de hogares donde residen mujeres gestantes seropositivas y 40 perros habitantes de hogares de mujeres gestantes seronegativas en Miraflores y Moniquira, Boyacá. El análisis se realizó mediante prueba diagnóstica rápida dipstick de InBios. Resultados. Se encontró prevalencia del 16.7% en Moniquirá y del 13.3% Miraflores respectivamente con una prevalencia general del 15% en los dos municipios. Se halló riesgo 3 veces mayor de que ocurra la infección en caninos, en los hogares donde residen gestantes seropositivas; además la infestación por pulgas y garrapatas en el animal, hábitat cercano a la vivienda, se relacionan con mayor seropositividad en el canino. Conclusiones. La raza, el sexo, la presencia de aves en la casa y al examen clínico general son considerados factores pronósticos en en la infección por Trypanosoma cruzi en caninos. Como factores protectores se identificó la desparasitación y vacunación de los animales.

  1. Presencia de anticuerpos sericos contra Neospora caninum en equinos en Chile Sera antibodies to Neospora caninum in Chilean horses

    Directory of Open Access Journals (Sweden)

    A.N. Patitucci

    2004-12-01

    Full Text Available Neospora sp. es un parásito protozoario causante de abortos y/o enfermedad del Sistema Nervioso Central (SNC en caninos, bovinos, ciervos, caprinos, ovinos, equinos y otros. En equinos, se lo ha involucrado como causa de aborto, mortalidad neonatal y enfermedades del SNC y viscerales. La especie que infecta a los equinos es distinta a Neospora caninum y se denomina Neospora hughesi. En Chile no existe evidencia de infección en equinos, sin embargo, la enfermedad ha sido informada en bovinos y caninos, por lo que el objetivo de este trabajo fue buscar anticuerpos contra la enfermedad en sueros equinos . Para ello se tomaron muestras de sangre a 145 equinos (87 de la IX Región y 58 de la VIII Región de Chile. Los sueros fueron analizados mediante Test de Aglutinación para Neospora (NAT. Cada suero se diluyó en 1:40 en solución salina tamponada (PBS pH 7.2 conteniendo 2- mercaptoetanol y fueron analizados en 1:40 y 1:80. Los sueros positivos a 1:80 fueron examinados a 1:160 y 1:320. Anticuerpos contra N.caninum (≥ 1:40 se encontraron en 32% (47/145 de los equinos estudiados. Debido a que N.caninum y N.hughesi dan reacción cruzada, ambos o uno de ellos podrían ser los responsables de la seropositividad. Estos resultados indican que equinos provenientes de la VIII y IX regiones de Chile son reaccionantes a la infección de Neospora, por lo que su diagnóstico presuntivo debería ser considerados ante la presencia de cuadros clínicos con sintomatología nerviosa y/o abortos en esta especie.Neospora caninum is a protozoan parasite that affects cattle and dogs, its infections seem to be widely prevalent in Chile. To date, nothing is known of the presence of N. caninum in horse population of the country. In South America, two seroprevalence studies have failed to find antibodies in Argentina and Brazil. The objective of the study was to investigate the presence of N. caninum exposure in horses of Chile. Sera from 145 asymptomatic horses (87

  2. Vasculitis asociadas a anticuerpos anti-citoplasma de neutrófilos: Clínica y tratamiento

    Directory of Open Access Journals (Sweden)

    María Virginia Paolini

    2013-04-01

    Full Text Available Las vasculitis asociadas a anticuerpos anti-citoplasma de neutrófilos (ANCA comprenden a un grupo de enfermedades caracterizadas por la inflamación de la pared de pequeños vasos. Analizamos las características epidemiológicas y clínicas en una serie de 47 pacientes: 23 (49% granulomatosis de Wegener (GW, 15 (32% poliangeítis microscópica (PAM y nueve (19% vasculitis limitada al riñón (VLR. La edad media al inicio de los síntomas fue de 50.7 ± 14.9 años. La manifestación clínica más frecuente fue el compromiso renal en 41 (87% pacientes, seguido por el pulmonar en 26 (55% y el otorrinolaringológico en 17 (36%. En 26 (55% se asoció compromiso renal y pulmonar. La forma clínica más frecuente fue la generalizada en 23 (49%, seguida por la grave en 18 (38%. El 89% presentaron determinaciones de ANCA positivas. Cuatro (8% no recibieron tratamiento inmunosupresor de inicio. De los 43 que recibieron tratamiento de inicio, 29 (67% tuvieron remisión completa, con un tiempo de remisión promedio de 35.3 meses. Once (26% presentaron recaídas, diez (91% recaídas mayores y uno (9% menor. Doce (28% fallecieron, siete en forma temprana y cinco durante la evolución de la enfermedad. Quince (31% evolucionaron a insuficiencia renal crónica. Los 26 pacientes en seguimiento tuvieron respuesta al tratamiento y 20 (77% de ellos estaban en remisión al finalizar el estudio. Las vasculitis asociadas a ANCA continúan siendo enfermedades de alta morbilidad y mortalidad, a pesar de las mejorías logradas con los tratamientos inmunosupresores.

  3. Asociación entre anticuerpos antifosfolípidos y complicaciones de la gestación en mujeres de Costa Rica

    Directory of Open Access Journals (Sweden)

    Roubier Rojas-Barahona

    2007-04-01

    Full Text Available Objetivo: Determinar asociación entre los anticuerpos antifosfolípidos y complicaciones de la gestación (aborto de cualquier tipo, preeclampsia, eclampsia, insuficiencia placentaria grave o parto antes de la semana 34 de gestación, tomando como base la población de pacientes del servicio de Obstetricia del Hospital México. Materiales y métodos: Estudio de casos y controles en la población de pacientes atendidas por el servicio de Obstetricia del Hospital México en el período comprendido entre enero de 2002 y diciembre de 2004. Se tomaron los datos del registro de egresos Hospitalarios, se hizo un análisis descriptivo, en análisis univariado y multivariado de las principales variables registradas. Resultados: El promedio de edad de las pacientes en los casos y los controles no mostró diferencia significativa. La provincia de San José reporta el mayor porcentaje de casos con un 39.9%, seguido por Heredia con un 26.8% y Alajuela con un 24.6%. En cuanto al número de gestaciones, se determinó que no influyen significativamente en relación con el aborto y otras complicaciones de la gestación. El análisis univariado y multivariado mantiene asociación entre los antecedentes clínicos de las gestaciones anteriores, además de los anticuerpos antifosfolípidos respecto al aborto y otras complicaciones de la gestación. Conclusión: Los anticuerpos antifosfolípidos deberían ser tomados en cuenta como parte del seguimiento del embarazo en pacientes con historia de abortos y complicaciones de la gestación en embarazos previos.

  4. OBTENCIÓN DE ANTICUERPOS ESPECÍFICOS PARA LA DETECCIÓN DEL VIRUS TaLMV DEL TOMATE DE ÁRBOL

    Directory of Open Access Journals (Sweden)

    Gutiérrrez Sánchez Pablo Andrés

    2011-08-01

    Full Text Available En Colombia el rendimiento del cultivo de árbol se ha visto seriamente afectado por la expansión de la enfermedad conocida como virosis. Esta patología se registró inicialmente en 1991 en el norte de Antioquia y su expansión ha alcanzado todas las regiones cultivadoras de este frutal en el país. Trabajos recientes han establecido la presencia de al menos dos especies de potyvirus asociadas a la virosis en los cultivos de tomate de árbol de Antioquia: Potato virus Y (PVY y Tamarillo leaf malformation virus (TaLMV, especie propuesta. Con el fin de reducir la diseminación de estos patógenos virales en el país, es necesario contar con herramientas de diagnóstico que permitan la certificación del material de siembra y la detección temprana en plantas asintomáticas. En este trabajo se presenta la obtención de anticuerpos específicos para la detección del virus TaLMV utilizando una región antigénica de 15 residuos de la cápside viral. La sensibilidad y especificidad de los anticuerpos fue evaluada mediante pruebas de ELISA y dot-blot utilizando proteína recombinante y péptidos sintéticos. La utilidad de estos anticuerpos fue validada a partir de una prueba piloto de detección de TaLMV en muestras de plantas de tomate de árbol obtenidas en el Oriente Antioqueño y los resultados comparados con los niveles de detección que ofrece la técnica de RT-PCR con cebadores específicos para la cápside viral de TaLMV.

  5. Bajo índice de sospecha para deficiencia de anticuerpos en niños sometidos a procedimientos quirúrgicos de Otorrinolaringología

    OpenAIRE

    AB Ramírez-López; CG Zúñiga-Lagunes; A Martínez-Viveros; EA Medina-Torres; C Murata; SE Espinosa-Padilla; SO Lugo-Reyes

    2016-01-01

    INTRODUCCIÓN: las inmunodeficiencias primarias están subdiagnosticadas en todo el mundo, aun en centros de tercer nivel de atención. Los defectos de anticuerpos constituyen el grupo más prevalente y suelen manifestarse clínicamente después de los 6 meses de edad como infecciones respiratorias recurrentes causadas por bacterias encapsuladas. Algunas cirugías de oído-nariz y garganta se indican en pacientes con infecciones respiratorias recurrentes o complicadas que no han respondido adecuadame...

  6. Encefalitis límbica autoinmune por anticuerpos anticanales de potasio dependientes de voltaje: a propósito de un caso

    OpenAIRE

    2016-01-01

    La encefalitis límbica (EL) se ha descrito como una entidad de origen viral o autoinmunitario secundaria a la presencia de autoanticuerpos antineuronales. Una de estas formas de presentación se asocia a la presencia de anticuerpo frente a canales de potasio voltaje dependientes (CKVD). Clínicamente se manifiesta como pérdida de memoria subaguda, cambios de comportamiento, desorientación progresiva, crisis epilépticas, trastornos psiquiátricos, insomnio, depresión, alucinaciones e hiponatremia...

  7. Complicaciones clínicas en una serie de pacientes con anticuerpos anticardiolipina Clinical complications in a series of patients with anticardiolipin antibodies

    OpenAIRE

    Pujol, A; E. Alegría; J González; Ch. Ngare; J. Pérez; J. A. Páramo

    2003-01-01

    Se han analizado las complicaciones clínicas determinadas con métodos objetivos en 68 pacientes de la Clínica Universitaria de Navarra con sospecha clínica de síndrome antifospolípido (SAF) y presencia de anticuerpos anticardiolipina (ACA). Se consideraron para el estudio, pacientes con título de IgG superior a 23 GPL. La patología más prevalente fue la trombosis: trombosis venosas (42,6%) y arteriales (22%). Otras complicaciones fueron abortos (23,8% de las 42 mujeres) y trombocitopenia (12,...

  8. Inmunodetección de anticuerpos anti-insulina libres en suero y unidos a la molécula de insulina en pacientes insulino-dependientes

    OpenAIRE

    Domínguez Romero, Leidy Yohana

    2014-01-01

    El uso de la terapia insulínica como tratamiento para la Diabetes, basado en la administración de Insulina Exógena (IE) de origen animal –con alta homología a la insulina humana, a nivel de la secuencia proteica, se asoció en sus inicios con la prevalencia de Anticuerpos Anti-Insulina (AAI) [1, 2], relacionados a su vez con alteraciones en la seguridad y eficacia de estas formulaciones [3-6]. Con la aparición de insulinas de origen recombinante –bajo la premisa de la identidad con la secuenci...

  9. Prueba de Elisa indirecta para la detección de anticuerpos IgM para el diagnóstico de Leptospirosis humana

    OpenAIRE

    Manuel Céspedes Z; Martha Glenny A; Vidal Felices A; Lourdes Balda J; Víctor Suárez M

    2002-01-01

    Para el diagnóstico temprano de enfermedades con cuadro clínico inespecífico como la leptospirosis, es necesario la confirmación laboratorial mediante pruebas específicas, con la finalidad de que el diagnóstico sea más acertado y rápido. Objetivo: se realizó un estudio comparativo entre la prueba de microaglutinacion (MAT) y la prueba de ELISA indirecta estandarizada con un "pool" de antígenos de Leptospira interrogans, para la detección de anticuerpos IgM, en muestras de suero de fase aguda ...

  10. Asociación entre la presencia de anticuerpos anti-Ras y anti-VPH16 E4/E7 y lesiones intraepiteliales del cérvix

    OpenAIRE

    Vázquez-Corzo Sara; Trejo-Becerril Catalina; Cruz-Valdez Aurelio; Hernández-Nevarez Pilar; Esquivel-Guadarrama Fernando Roger; Gutiérrez-Xicotencatl Ma de Lourdes

    2003-01-01

    Objetivo. Determinar si anticuerpos séricos contra E4, E7 y Ras pueden ser utilizados como marcadores de lesiones tempranas del cérvix uterino asociadas al virus del papiloma humano. Material y métodos. Entre marzo de 1999 y abril de 2000 se realizó un estudio sero-epidemiológico de casos y controles en la clínica de displasias del Hospital General Doctor Gea González, en la Ciudad de México, en 116 muestras de suero para evaluar la presencia de anticuerpos anti-E4, E7 y Ras utilizando un ELI...

  11. Optimización del ensayo vibriocida colorimétrico para la determinación de anticuerpos séricos contra V. cholerae del serogrupo O139

    OpenAIRE

    Joivier Vichi-Lozada; Edith Suzarte-Portal; Talena Ledón-Pérez; Rafael Fando-Calzada

    2011-01-01

    El título de anticuerpos vibriocidas es reconocido actualmente como el mejor marcador de inmunidad protectora ante la infección con Vibrio cholerae. Su evaluación permite estudiar la efectividad de vacunas durante ensayos preclínicos y clínicos, a través de la determinación de la funcionalidad de anticuerpos séricos, capaces de lisar células en presencia de complemento exógeno. Se han desarrollado distintos ensayos bactericidas con puntos finales y métodos de determinación del título vibrioci...

  12. Validación del ensayo Vibriocida colorimétrico para determinar anticuerpos séricos contra cepas candidatas vacunales de Vibrio cholerae

    Directory of Open Access Journals (Sweden)

    Bárbara Cedré

    2003-03-01

    Full Text Available El Instituto Finlay posee un grupo de cepas atenuadas candidatas a vacuna oral contra el cólera, las cuales fueron evaluadas desde el punto de vista de su capacidad inmunogénica mediante la determinación de anticuerpos por el método ELISA y principalmente por el ensayo Vibriocida. Este ensayo mide la funcionalidad de los anticuerpos estimulados por la cepa vacunal, por lo que se considera la herramienta más eficaz para medir el estado de la inmunidad en individuos vacunados contra el cólera y constituye el soporte analítico para el desarrollo de la vacuna anticolérica cubana. En este trabajo se evaluaron la precisión, la especificidad y la robustez del ensayo y los resultados obtenidos estuvieron dentro del criterio de aceptación de esta técnica (>50% de coincidencia. Se demostró que las variaciones entre las muestras negativas y positivas se debían precisamente al crecimiento de V. cholerae y que se pueden incorporar pequeños cambios al ensayo sin que esto traiga consigo variaciones en el título de la muestra ni falsos resultados. De acuerdo con los resultados obtenidos, el mismo se considera apto para la evaluación de la respuesta inmune estimulada por un candidato vacunal contra el cólera.

  13. Determinación de IgG y anticuerpos totales contra el Virus Dengue, en muestras obtenidas en papel filtro

    Directory of Open Access Journals (Sweden)

    María García

    1997-01-01

    Full Text Available Se propone como alternativa para la determinación de anticuerpos contra el virus del dengue, el uso de muestras de sangre total obtenidos en papel filtro, por ser un método sencillo y no requerir de muchos cuidados en el envío al laboratorio. Se evaluaron 100 muestras de suero obtenidas en tubos al vacío y sangre total en papel filtro respectivamente, de pacientes con diagnóstico clínico de Dengue clásico. Ambas muestras fueron evaluadas con los métodos serológicos de ELISA Indirecta para detectar IgG e Inhibición de la Hemoaglutinación para detectar anticuerpos totales. Por ELISA indirecta se obtuvo un total de 51 positivos y 49 negativos en suero; 45 positivos y 48 negativos en papel filtro, con una concordancia por índice Kappa de 0.92, sensibilidad de 88% y especificidad de 98%. Por Inhibición de la Hemaglutinación se obtuvo un total de 45 positivos y 55 negativos en suero; 40 positivos y 50 negativos en papel filtro, con una concordancia por índice Kappa de 0,88, sensibilidad de 87% y especificidad de 91%.

  14. Detección de anticuerpos contra Borrelia burgdorferi e identificación de garrapatas ixodidas en Piura Y Amazonas, Perú

    Directory of Open Access Journals (Sweden)

    Martha Glenny A

    2004-01-01

    Full Text Available Objetivos: Detectar anticuerpos IgG/IgM contra Borrelia burgdorferi en población general, procedentes de los departamentos de Piura y Amazonas e identificar especies de garrapatas probablemente incriminadas en la transmisión de la enfermedad de Lyme. Material y Métodos: Entre agosto del año 2001 y junio de 2002, se colectaron muestras de sangre de 232 pobladores procedentes de ocho localidades del Departamento de Piura y 12 del Departamento de Amazonas, para evaluar mediante ELISA Captia™ Lyme IgG/IgM (Trinity biotech la presencia de anticuerpos contra Borrelia burgdorferi. Además, se colectaron garrapatas en animales domésticos por búsqueda directa. Resultados: Se detectó seropositividad en 9,9 % de los sueros evaluados. Asimismo, de 433 garrapatas colectadas se identificaron los géneros: Ixodes (5,5%, Amblyomma (18,0%, Rhipicephalus (23,5%, Anocentor (31,1% y Boophilus (21,7%. Conclusiones: Existen personas seropositivas por Borrelia en Piura y Amazonas, coincidiendo con los hallazgos realizados en Sapillica en el año 1992, además se detectó la presencia de garrapatas del género Ixodes en Piura.

  15. Estudio del perfil de anticuerpos contra Helicobacter pylori producidos por pacientes con diferentes patologías gastroduodenales

    Directory of Open Access Journals (Sweden)

    Spinel Clara

    2004-12-01

    Full Text Available La colonización de la mucosa gástrica con Helicobacter pylori causa la infección bacteriana más frecuente a nivel mundial que es la mayor causa de enfermedades gastrointestinales en humanos. Con el objetivo de examinar el reconocimiento de antígenos de dos cepas de la bacteria en
    150 pacientes infectados y con inflamación (30 de gastritis crónica no atrófica G, úlcera duodenal (30 UD, patologías preneoplásicas (30 de gastritis atrófica GA y 30 de metaplasia intestinal MI y adenocarcinoma gástrico (30 C, se realizó un sistema de cultivo de Helicobacter pylori
    con células epiteliales gástricas. Los sobrenadantes de estos cocultivos fueron empleados como preparación antigénica en pruebas de inmunotransferencia, en las que se detectaron los anticuerpos
    IgG totales, al igual que sus cuatro subclases (IgG1, IgG2, IgG23, IgG4 en los sueros de los pacientes. Se encontró que los perfiles antigénicos de las dos cepas de Helicobacter pylori, aisladas de un paciente con úlcera duodenal y uno con adenocarcinoma gástrico, eran semejantes, con 23 proteínas comunes que incluían los principales factores de virulencia de la bacteria (CagA, VacA, Ureasa, Flagelina. Aunque los sueros mostraron un reconocimiento variado de cada uno de los antígenos, no se encontraron diferencias entre el número de antígenos reconocidos según la patología ni la cepa, tanto para las IgG totales (p = 0,98, como cada una de las subclases (IgG1:p = 0,97; IgG2: p = 0,72; IgG3: p = 0,61; IgG4: p = 0,84. Con el fin de analizar simultáneamente la respuesta de los pacientes hacia el total de los 23 antígenos, se aplicaron análisis multivariados gracias a los cuales se distinguieron cuatro proteínas, de 70,
    82, 90 kDa y VacA de 86 kDa como los principales antígenos implicados en la respuesta inmune de las personas infectadas. Adicionalmente, se diferenciaron dos grupos de patologías según el reconocimiento del conjunto de antígenos: por

  16. Anticuerpos anti 21 hidroxilasa séricos en pacientes con anticuerpos antifracción microsomal: Síndrome poliendocrino autoinmune Seric 21- hydroxilase antibodies in patients with anti-microsomal fraction antibodies: Autoimmune polyendocrine syndrome

    Directory of Open Access Journals (Sweden)

    Silvia Botta

    2007-04-01

    Full Text Available El síndrome poliendocrino autoinmune (SPA es la asociación de enfermedades endocrinas autoinmunes con otros desórdenes autoinmunes no endocrinos. Los tipos 1, 2 y 4 presentan adrenalitis autoinmune, esto indica la presencia de autoanticuerpos, y su marcador serológico específico es el anti 21 hidroxilasa (a21-OH. El SPA tipo 2 es la asociación de adrenalitis, enfermedad tiroidea y/o diabetes mellitus inducidas por autoanticuerpos. Como componentes menores, pueden estar asociados entre otros, vitiligo, alopecia y miastenia. Nuestros objetivos fueron: establecer la prevalencia de a21-OH séricos en pacientes con anticuerpos anti fracción microsomal (AFM positivos, enfermedad tiroidea autoinmune y/o afecciones endocrinas y no endocrinas autoinmunes; diagnosticar formas incompletas de SPA y estudiar individuos con probable riesgo de progresión a un SPA completo. Estudiamos 72 pacientes AFM positivos y 60 sujetos tomados como grupo control, AFM negativos. Hallamos a21-OH elevados en dos pacientes: A= 47 U/ml, hipotiroidismo autoinmune y miastenia; y B= 8.75 U/ml, hipotiroidismo autoinmune y vitiligo; ambos con ausencia de insuficiencia adrenal. La prevalencia de a21-OH encontrada fue del 2.8%. Las pacientes A y B corresponden a un SPA tipo 2 incompleto y latente en relación al componente adrenal. Considerando a los a21-OH marcadores de enfermedad autoinmune latente, el eventual riesgo de evolución hacia la afección clínica sugiere la necesidad de estrechos controles clínicos y bioquímicos periódicos.Autoimmune polyendocrine syndrome (APS is the association of autoimmune endocrine diseases, with other autoimmune nonendocrine disorders. APS types 1, 2 and 4 include autoimmune adrenalitis; this suggests the presence of autoantibodies. A specific serological marker for these is the anti 21- hydroxilase autoantibody (a21-OH. APS type 2 is the association of autoimmune adrenalitis, to autoimmune thyroid disease and/or diabetes mellitus, all

  17. DETERMINACIÓN DEL CATABOLISMO DE LOS ANTICUERPOS MATERNOS Y SU INTERACCIÓN CON DIFERENTES PLANES VACUNALES PARA LA ENFERMEDAD DE GUMBORO EN POLLOS DE ENGORDE

    Directory of Open Access Journals (Sweden)

    Robin O. J.

    2006-11-01

    Full Text Available Con el in de evaluar el catabolismo de los anticuerpos maternos y su interferencia con tres planes vacunales diferentes contra la enfermedad de Gumboro se realizó un estudio utilizando pollos de la estirpe Ross 308, divididos en cuatro grupos: grupo 1: control (sin vacuna; grupo 2: vacunado los días 1, 7 y 15; grupo 3: vacunados los días 1 y 12; y grupo 4: vacunado el día 12. En el primer experimento el biológico se suministró en el agua de bebida, y en el segundo se hizo en el pico. Se sacriicaron 15 aves de cada grupo a los 1, 12, 21 y 42 días de edad y se evaluó peso corporal, tamaño y peso de la bolsa de Fabricio, relación peso bolsa/peso corporal (PB/PC, grado de depleción linfoide, presencia de cepas estándar y/o variantes del virus y los títulos de anticuerpos para la enfermedad de Gumboro. El catabolismo de los anticuerpos maternos ocurrió entre los 21 y 28 días de edad. En los grupos vacunados no se evidenció una respuesta inmune activa frente a ningún plan vacunal. La relación PB/PC no indicó atroia de la bolsa en el experimento 1, aunque las lesiones histopatológicas en el último muestreo fueron grado 3; en el segundo experimento solamente el grupo 3 presentó una disminución en la relación PB/PC; las lesiones histopatológicas en el tercer y cuarto muestreos, en todos los grupos, fueron clasiicadas como grado 3 y 4. En los dos experimentos se detectó la presencia de cepas tanto clásicas como variantes y una baja respuesta humoral. Ninguno de los tres planes vacunales conirió adecuada protección a las aves.

  18. DETERMINACIÓN DEL CATABOLISMO DE LOS ANTICUERPOS MATERNOS Y SU INTERACCIÓN CON DIFERENTES PLANES VACUNALES PARA LA ENFERMEDAD DE GUMBORO EN POLLOS DE ENGORDE

    Directory of Open Access Journals (Sweden)

    R. Castañeda

    2006-01-01

    Full Text Available Con el in de evaluar el catabolismo de los anticuerpos maternos y su interferencia con tres planes vacunales diferentes contra la enfermedad de Gumboro se realizó un estudio utilizando pollos de la estirpe Ross 308, divididos en cuatro grupos: grupo 1: control (sin vacuna; grupo 2: vacunado los días 1, 7 y 15; grupo 3: vacunados los días 1 y 12; y grupo 4: vacunado el día 12. En el primer experimento el biológico se suministró en el agua de bebida, y en el segundo se hizo en el pico. Se sacriicaron 15 aves de cada grupo a los 1, 12, 21 y 42 días de edad y se evaluó peso corporal, tamaño y peso de la bolsa de Fabricio, relación peso bolsa/peso corporal (PB/PC, grado de depleción linfoide, presencia de cepas estándar y/o variantes del virus y los títulos de anticuerpos para la enfermedad de Gumboro. El catabolismo de los anticuerpos maternos ocurrió entre los 21 y 28 días de edad. En los grupos vacunados no se evidenció una respuesta inmune activa frente a ningún plan vacunal. La relación PB/PC no indicó atroia de la bolsa en el experimento 1, aunque las lesiones histopatológicas en el último muestreo fueron grado 3; en el segundo experimento solamente el grupo 3 presentó una disminución en la relación PB/PC; las lesiones histopatológicas en el tercer y cuarto muestreos, en todos los grupos, fueron clasiicadas como grado 3 y 4. En los dos experimentos se detectó la presencia de cepas tanto clásicas como variantes y una baja respuesta humoral. Ninguno de los tres planes vacunales conirió adecuada protección a las aves.

  19. OBTENCIÓN DE ANTICUERPOS ESPECÍFICOS PARA LA DETECCIÓN DEL Tamarillo leaf malformation virus (TALMV EN TOMATE DE ÁRBOL

    Directory of Open Access Journals (Sweden)

    YULIANA GALLO GARCÍA

    2011-01-01

    Full Text Available En Colombia el rendimiento del cultivo de tomate de árbol se ha visto seriamente afectado por la expansión de una enfermedad conocida como virosis de tomate de árbol. Esta patología se registró inicialmente en 1991 en el norte de Antioquia y su expansión ha alcanzado todas las regiones cultivadoras de este frutal en el país. Trabajos recientes han detectado la presencia de por lo menos dos especies del género Potyvirus (Potyviridae asociadas a esta enfermedad en los cultivos de tomate de árbol de Antioquia: Potato virus Y (PVY y Tamarillo leaf malformation virus (TaLMV, especie propuesta. Con el fin de reducir la diseminación de estos patógenos virales en el país, es necesario contar con herramientas de diagnóstico que permitan la certificación del material de siembra y la detección tem- prana en plantas asintomáticas. En este trabajo se obtuvieron anticuerpos policlonales específicos para la detección del virus TaLMV utilizando una región antigénica de 15 re- siduos de la cápside viral. La sensibilidad y especificidad de los anticuerpos anti-TaLMV fue evaluada mediante pruebas de ELISA y dot-blot utilizando proteína recombinante y péptidos sintéticos como controles. La utilidad de estos anticuerpos fue validada a partir de una prueba piloto de detección de TaLMV en muestras de plantas de tomate de árbol con y sin síntomas de virosis obtenidas en el oriente antioqueño. Los resultados serolgicos fueron comparados con los niveles de detección que ofrece la técnica de RT-PCR con cebadores específicos para la cápside viral de TaLMV.

  20. Asociación del anticuerpo anti-C1q con las manifestaciones clínicas, hematológicas e inmunológicas en el Lupus Eritematoso Sistémico : Estudio observacional retrospectivo de 135 casos.

    OpenAIRE

    Córica, María Emilia

    2012-01-01

    : Las concentraciones de anticuerpo anti-C1q están elevadas en los pacientes afectados de LES. Según algunos estudios la presencia de este anticuerpo está asociada a la nefropatía lúpica, sin embargo en otros estudios esta relación no se comprobó. En nuestro trabajo relacionamos la positividad del anticuerpo anti-C1q con las manifestaciones clínicas, hematológicas e inmunológicas de la enfermedad. A diferencia de estudios previos sólo pudimos establecer una relación estadísticamente significa...

  1. Desarrollo de superficies modificadas oro - anticuerpo anti-PSPB para su uso como biosensor en la detección de preñez bovina

    Directory of Open Access Journals (Sweden)

    Justo Laíz

    2011-05-01

    Full Text Available En este trabajo se presentan los resultados preliminares para el desarrollo de un biosensor amperométrico destinado a la cuantificación de Proteína B Específica de la Preñez (PSPB en fluidos biológicos como medio de diagnóstico clínico precoz de la preñez bovina. A la superficie de oro modificada con ácido mercaptoundecanoico (MUA se fijaron anticuerpos anti-PSPB y peroxidasa de rábano (HRP. Se verificó la inmovilización de las biomoléculas mediante voltamperometría cíclica y medida del ángulo de contacto.Se estudió el comportamiento electroquímico del electrodo desarrollado por medio de voltamperometría cíclica y medidas a potencial constante, estableciendo la relación entre el cambio de corriente catódica (al potencial de reducción de la quinona y la concentración de PSPB. Esta relación se ve afectada por la formación de complejos antígeno – anticuerpo que limitan el acceso del sustrato al sitio activo de la enzima, provocando una disminución en la señal eléctrica.El electrodo modificado de oro - anti-PSPB – HRP respondió de forma inversamente proporcional a la concentración de PSPB a un potencial de -200 mV (contra electrodo de referencia Ag/AgCl, tanto por voltamperometría cíclica como a potencial constante, y por tanto podría ser la base para el desarrollo de un biosensor amperométrico para detectar precozmente la preñez bovina.

  2. Bajo índice de sospecha para deficiencia de anticuerpos en niños sometidos a procedimientos quirúrgicos de Otorrinolaringología

    Directory of Open Access Journals (Sweden)

    AB Ramírez-López

    2016-06-01

    Full Text Available INTRODUCCIÓN: las inmunodeficiencias primarias están subdiagnosticadas en todo el mundo, aun en centros de tercer nivel de atención. Los defectos de anticuerpos constituyen el grupo más prevalente y suelen manifestarse clínicamente después de los 6 meses de edad como infecciones respiratorias recurrentes causadas por bacterias encapsuladas. Algunas cirugías de oído-nariz y garganta se indican en pacientes con infecciones respiratorias recurrentes o complicadas que no han respondido adecuadamente al tratamiento médico. Estos niños sometidos a procedimientos quirúrgicos luego de una historia de infecciones respiratorias recurrentes pueden constituir un grupo de alto riesgo para inmunodeficiencias primarias.   OBJETIVO: indagar qué tan frecuentes son los defectos de anticuerpos en niños sometidos a cualquiera de tres cirugías de otorrinolaringología.   MATERIALES Y MÉTODOS: revisamos los expedientes electrónicos de niños que hubieran sido sometidos a adenoamigdalectomía (ATT, drenaje endoscópico de senos paranasales (ESD y colocación de tubos timpánicos de ventilación (TVT en nuestro instituto durante 2011-2012, en busca de niveles séricos de inmunoglobulinas (IgE, IgG, IgA, IgM.   RESULTADOS: encontramos 112 procedimientos quirúrgicos en 87 pacientes, de los cuales la indicación para cirugía fue infecciosa en 37 (21 varones, 1 muerto, edad media 7.3 años, más frecuentemente rinosinusitis (19/37 y amigdalitis (9/37 crónicas. Los procedimientos incluyeron: 24 adenoamigdalectomías, 13 drenajes endoscópicos de senos paranasales y 6 colocaciones de tubos timpánicos de ventilación, para un total de 43; ocho pacientes (21.6% fueron sometidos a más de una cirugía. La IgE sérica se encontró en el expediente de 27 pacientes (72.9%, y “al menos IgG” en 18 (48.6%. Sólo 70% de las pruebas fueron ordenadas antes de la cirugía. Los resultados anormales incluyeron: IgE elevada en 10/27, Ig

  3. Asociación entre anticuerpos antifosfolípidos y complicaciones de la gestación en mujeres de Costa Rica

    Directory of Open Access Journals (Sweden)

    Roubier Rojas-Barahona

    2007-04-01

    Full Text Available Objetivo: Determinar asociación entre los anticuerpos antifosfolípidos y complicaciones de la gestación (aborto de cualquier tipo, preeclampsia, eclampsia, insuficiencia placentaria grave o parto antes de la semana 34 de gestación, tomando como base la población de pacientes del servicio de Obstetricia del Hospital México. Materiales y métodos: Estudio de casos y controles en la población de pacientes atendidas por el servicio de Obstetricia del Hospital México en el período comprendido entre enero de 2002 y diciembre de 2004. Se tomaron los datos del registro de egresos Hospitalarios, se hizo un análisis descriptivo, en análisis univariado y multivariado de las principales variables registradas. Resultados: El promedio de edad de las pacientes en los casos y los controles no mostró diferencia significativa. La provincia de San José reporta el mayor porcentaje de casos con un 39.9%, seguido por Heredia con un 26.8% y Alajuela con un 24.6%. En cuanto al número de gestaciones, se determinó que no influyen significativamente en relación con el aborto y otras complicaciones de la gestación. El análisis univariado y multivariado mantiene asociación entre los antecedentes clínicos de las gestaciones anteriores, además de los anticuerpos antifosfolípidos respecto al aborto y otras complicaciones de la gestación. Conclusión: Los anticuerpos antifosfolípidos deberían ser tomados en cuenta como parte del seguimiento del embarazo en pacientes con historia de abortos y complicaciones de la gestación en embarazos previos.Aim: To determine the association between antiphospholipid antibodies and pregnancy failures (abortion, preclampsia, eclampsia, placental insufficiency or delivery before the 34th week of gestation in Costa Rican women. Materials and Methods: The present is a case-control study, the participants belong to the Obstetrics Department of the Hospital Mexico. The period of the study was from January 2002 to December

  4. Patrón de immunoblotting y niveles de anticuerpos anti-Toxoplasma gondii en suero y humor acuoso de pacientes con lesiones de toxoplasmosis ocular

    Directory of Open Access Journals (Sweden)

    Morella Bouchard Pereira

    2014-07-01

    Full Text Available El objetivo de este estudio fue evaluar en muestras de suero y humor acuoso los niveles de anticuerpos anti-toxoplasma a través del Coeficiente de Goldmann y Witmer (CGW y el patrón de reconocimiento antigénico a través del immunoblotting (IB, en pacientes con serología positiva con y sin lesiones de toxoplasmosis ocular. Se recogieron simultáneamente muestras de suero y humor acuoso de 26 pacientes: un grupo de casos que poseían lesiones retinales de toxoplasmosis ocular en fase activa e inactiva (n=17 y un grupo control que requería cirugía ocular por presencia de cataratas (n=9. Las determinación de IgM e IgG específicas se realizó por ELISA de inmunocaptura e indirecto, respectivamente. Se utilizó la inmunodifusión radial para la cuantificación de la IgG total. El CGW resultó >2, indicativo de producción local de anticuerpos específicos en 12/17 de los casos, mientras que en los controles no se observó, esto evidenció una sensibilidad del 71% y una especificidad de 100%. En IB, la aparición de bandas diferentes en humor acuoso, indicativo de producción local de anticuerpos específicos se observaron en 11/17 de los casos y 1/9 de los controles, reflejando una sensibilidad de 65% y una especificidad de 89%. Al considerar las dos pruebas la sensibilidad se incrementó a un 73%, pero la especificidad disminuyó a 89%. En conclusión el IB es útil como prueba confirmatoria para diagnóstico de toxoplasmosis ocular, pero sólo como un complemento del coeficiente de GW especialmente en pacientes con lesiones atípicas donde el diagnóstico clínico es difícil. Aqueous humor and serum immunoblotting profiles and anti–toxoplasma gondii antibodies in patients with toxoplasmosis-induced retinal lesions Abstract The purpose of this study was to analize the anti-Toxoplasma gondii antibodies levels in serum and aqueous humor samples in patients with ocular toxoplasmosis by using Goldman and Witmer Coefficient (GWC and the

  5. Neuromielitis óptica con alta expresión de acuaporina-4 y anticuerpos anti-acuaporina-4 positivos en suero

    Directory of Open Access Journals (Sweden)

    Alejandra Báez

    2012-04-01

    Full Text Available La presencia de anticuerpos IgG en suero, con blanco en los canales de acuaporina-4, es específica de la neuromielitis óptica (NMO. El 60% de los pacientes con NMO presentan lesiones cerebrales en la resonancia magnética (RM; en un 8% (mayoría niños estas lesiones se consideraron "atípicas". Presentamos dos pacientes con NMO y lesiones en el SNC de alta expresión de acuaporina-4. Caso 1: varón de 50 años, que comenzó con pérdida de visión en ojo derecho (OD. Recibió tratamiento empírico con metilprednisolona 1 g/d x 3 días. Al mes presentó dolor generalizado y hemiparesia derecha; nuevamente recibió metilprednisolona 1 g/d x 5 días e IgG IV 400 mg/kg/d × 5 días. Recuperó la deambulación persistiendo el dolor y fenómenos paroxísticos en los 4 miembros. Potenciales evocados visuales: P100, ojo izquierdo (OI 123 mseg. OD sin respuesta. La RM de cerebro (FLAIR mostró hiperintensidad en nervio óptico derecho, hipotálamo y comisura blanca anterior. RM cervical: lesión medular extensa (5 cuerpos vertebrales. Caso 2: mujer de 53 años, con disminución de la agudeza visual en ambos ojos y parestesias en miembros inferiores que remitieron espontáneamente. Evolucionó al mes con cuadriparesia e incontinencia esfinteriana. Recibió metilprednisolona 1 g/d x 5 días, sin mejoría. Potenciales evocados visuales: P100 OI 124 mseg. OD 128 mseg. RM cerebro: (FLAIR hiperintensidad hipotalámica y periacueductal. RM cervical: lesión medular extensa (7 cuerpos vertebrales. Anticuerpos anti-acuaporina-4 positivos en ambos pacientes (inmunofluorescencia indirecta. Las lesiones consideradas "atípicas", como aquí, en sitios con alta densidad de proteínas canales de agua AQP4 deberán considerarse para el diagnóstico diferencial.

  6. Frecuencia de anticuerpos contra el virus C de la hepatitis en pacientes con cirrosis hepática en Yucatán, México

    Directory of Open Access Journals (Sweden)

    Góngora-Biachi Renán A

    2003-01-01

    Full Text Available OBJETIVO: En este estudio reportamos la prevalencia de anticuerpos contra el virus C de la hepatitis (Ac-VCH en un grupo de pacientes con cirrosis hepática (CH. MATERIAL Y MÉTODOS: Se hizo un estudio prospectivo, transversal y descriptivo, de marzo de 1998 a mayo de 1999. Se estudiaron a 153 pacientes (117 (76% hombres y 36 (24% mujeres con diagnóstico de CH, que eran atendidos en el Hospital General Agustín O' Horan y en el Centro de Investigaciones Regionales Doctor Hideyo Noguchi, en la ciudad de Mérida, Yucatán, México. Se aplicó un cuestionario con datos clínico-epidemiológicos y se determinó la presencia de Ac-VCH (ELISA de 2ª generación y RIBA-2 para confirmar el diagnóstico a cada paciente. Se determinó también el antígeno de superficie de la hepatitis B (AgsHB y anticuerpos contra el antígeno central de la hepatitis B (Anti-HBc mediante el método de ELISA. La presencia de Ac-VCH fue relacionada con las variables epidemiológicas de los sujetos. La prevalencia de anti-HCV y la frecuencia de características se compararon entre los pacientes positivos y negativos con las pruebas de c² y exacta de Fisher. RESULTADOS: El 32% de los pacientes con CH (35/117 (30% hombres y 14/36 (39% mujeres fueron positivos para los Ac-VCH. El alcoholismo estuvo presente en todos los hombres serorreactivos y en ninguna de las mujeres positivas (p< 0.001. Ninguna de las variables epidemiológicas analizadas estuvo asociada con la seropositividad. Los anti-HBc se encontraron en 16% de los pacientes positivos para Ac-VCH y en 12% de los seronegativos (p=0.69. CONCLUSIONES: La prevalencia encontrada fue mayor a los reportes previos realizados en población general de la Península de Yucatán (1.3%. La alta prevalencia de Ac-VCH en este grupo de pacientes sugiere que la CH está más frecuentemente asociada con el VCH en Yucatán, México, que con el virus B de la hepatitis. El alcoholismo probablemente actúa como un cofactor en el

  7. Determinación de Anticuerpos IgM contra Virus dengue partir de sangre absorbida en papel filtro: Un método alternativo y sencillo

    Directory of Open Access Journals (Sweden)

    María García M

    2000-01-01

    Full Text Available Objetivo: Se propone como alternativa la obtención de muestras de sangre total en papel filtro, para la determinación de anticuerpos IgM contra dengue, por ser un método de recolección sencillo y no requerir de muchos cuidados en el envío al laboratorio. Materiales y métodos: De 100 pacientes con diagnóstico clínico de dengue clásico, se obtuvieron en forma simultánea, muestras de suero en tubos al vacío y de sangre total en papel filtro. Ambas muestras fueron evaluadas con el método serológico ELISA Captura de IgM a los 30 días de obtenida la muestra. Resultados: De las 100 muestras 25 fueron positivas y 75 negativas en suero, y 24 positivas y 74 negativas en papel filtro. Se obtuvo una concordancia por índice Kappa de 0,97, sensibilidad y especificidad de 96,0% y 98,0% respectivamente; el valor predictivo positivo fue 96,0%, y valor predictivo negativo fue 98,0%. Conclusión: Se evidencia muy buena sensibilidad, especificidad y concordancia en la determinación de IgM contra dengue, al utilizar papel filtro en la obtención de muestra de sangre.

  8. SISTEMA INMUNE Y GENÉTICA:: UN ABORDAJE DIFERENTE A LA DIVERSIDAD DE ANTICUERPOS Immune System and Genetics:: A Different Approach to the Diversity of Antibodies

    Directory of Open Access Journals (Sweden)

    NUBIA ESTELA MATTA CAMACHO

    Full Text Available Es común encontrar en los libros de inmunología o de genética un capítulo con el título de -sistema inmune y genética-, sin embargo su asociación se centra en cómo la generación de anticuerpos rompió el paradigma -un gen, una proteína-, pues en el caso de la producción de anticuerpos, un gen produce millones de proteínas. El sistema inmune tiene muchos vínculos con la genética y la herencia; esta asociación se da porque cualquier sustancia o compuesto que produzca un organismo, es un antígeno potencial cuando es reconocido como extraño por el sistema inmune de otro organismo, sea este de la misma o de diferente especie. La producción de proteínas que potencialmente pueden ser antigénicas están ligadas al genotipo del individuo. La capacidad de responder y el tipo e intensidad de respuesta a antígenos también ha sido demostrado que están correlacionados con el genotipo del individuo en cuestión, así como deficiencias en las respuestas inmunes pueden estar asociadas con mutaciones o polimorfismos genéticos que resultan en la susceptibilidad a enfermedades infecciosas. Este manuscrito busca presentar ejemplos de la relación sistema inmune - genética, en la misma dirección de la conferencia ofrecida para la cátedra de Sede -Todo lo que usted quiere saber de genética y nunca se atrevió a preguntar-.It is common to find in immunology or genetic books a chapter entitled -immune system and genetics-; this association focuses on how the generation of antibodies broke the paradigm -one gene, one protein-, since in this case one gene generates millions of proteins. However, the immune system has many more links to genetics and heredity. For example, any substance or compound produced by an organism can be a potential antigen, when it is recognized as foreign by the immune system of another organism, belonging to the same or different species. The proteins, which are potentially antigenic are encoded by the individual s

  9. Seroprevalencia de anticuerpos bactericidas frente al meningococo C en Cantabria 10 meses tras la campaña de vacunación

    Directory of Open Access Journals (Sweden)

    Aledo Linos Alvaro Gonzalez de

    1998-01-01

    Full Text Available FUNDAMENTO: En febrero-marzo de 1997 se realizó en Cantabria (Comunidad Autónoma del Estado Español con 541.885 habitantes, de los cuales 107.787 tienen una edad entre 18 meses y 19 años una campaña de vacunación antimeningocócica dirigida a niños entre 18 meses y 19 años, que abarcó a todos sus municipios y alcanzó una cobertura mayor del 95%. En los 12 meses posteriores la eficacia vacunal fue del 95.68% en todas las edades. Para ayudar a decidir una revacunación se realizó un estudio de seroprevalencia de anticuerpos bactericidas en la población vacunada. MÉTODOS: en diciembre de 1997 se analizaron muestras de sangre de 414 niños vacunados, obtenidas al azar de extracciones oportunistas realizadas en Atención Primaria y en Hospitales Públicos de la Comunidad, y de niños escolarizados en las guarderías públicas dependientes de la Dirección General de Bienestar Social de Cantabria. Se analizó la tasa de anticuerpos bactericidas en el Centro Nacional de Microbiología, estableciéndose el nivel de "efecto vacunal" en la dilución 1/8. RESULTADOS: se obtuvieron los siguientes porcentajes de títulos > o = 1/8 (entre paréntesis, grupos de edad al vacunarse: 0% (18-24 meses, 4% (1.5 a 4 años, 7.1% (1.5 a 6 años, 51.3% (6 a 12 años y 81.2% (12 a 19 años. Debido a que la definición de "efecto vacunal" se cifró en la dilución 1/8 de forma artificial, y a que otros trabajos la cifran en 1/4, en 287 sueros con resultado <1/8 se repitió el ensayo bactericida con la dilución 1/4, resultando que 286 (el 99.6% también dieron negativo. Es decir, que el resultado final no variaría si situásemos el punto de corte en la dilución 1/4 en vez de en 1/8. No se encontraron diferencias significativas según la procedencia de municipios donde hubiera habido casos de meningitis C o no los hubiera habido. CONCLUSIONES: la actividad bactericida es muy baja en los menores de 4-6 años, inferior a lo publicado, y mayor por encima de esa

  10. Seroprevalencia de anticuerpos contra el poliovirus 1 en niños mexicanos Seroprevalence of antibodies against poliovirus type 1 in Mexican children

    Directory of Open Access Journals (Sweden)

    Juan Ruiz-Gómez

    2007-01-01

    Full Text Available OBJETIVO: Analizar la frecuencia y distribución de la prevalencia de anticuerpos contra el virus de la poliomielitis tipo 1 en niños menores de 10 años en México, además de contribuir a la evaluación del programa de vacunación. MATERIAL Y MÉTODOS: Se estudió la presencia de anticuerpos contra el poliovirus tipo 1 en una muestra de la Encuesta Nacional de Salud 2000. Los sueros se recolectaron entre noviembre de 1999 y junio de 2000 a nivel nacional. La muestra constó de 6 270 niños de uno a nueve años de edad y se utilizó la técnica de neutralización. RESULTADOS: La seropositividad fue de 99.3% (IC95%99.1-99.7. Se identificaron como factores de riesgo de susceptibilidad el analfabetismo (RM= 1.5, p= 0.002 y el bajo ingreso familiar (RM= 1.4, p= 0.0487 y como factor protector el acceso a la seguridad social (RM= 0.41, p=0.04. CONCLUSIONES: Las actividades del programa de vacunación que han llevado a cabo las instituciones de salud han dado resultados en el control y eliminación de la enfermedad. Sin embargo, los programas de vacunación no deben interrumpirse, incluso si se ha registrado 99.3% de seropositividad; no puede soslayarse que al convertir el 0.7% restante, se calcula que hay 190 000 niños susceptibles de contraer la enfermedad. Estos niños se localizan sobre todo en el sur del país.OBJECTIVE: To analyze the frequency and distribution of the prevalence of antibodies against the poliomyelitis type 1 virus in children 1-9 years old in Mexico. MATERIAL AND METHODS: Antibodies against poliovirus type 1 (neutralization method were studied in 6 270 sera selected from the 24 232 sera from children one to nine years old, collected by the 2000 National Health Survey (ENSA 2000 that was conducted from November 1999 to June 2000. RESULTS: Overall seroprevalence was 99.3% (95%CI: 99.1-99.7. Using bivariate analysis, absence of antibodies was shown to be associated with illiteracy (OR= 1.5, p=0.002 and low household income (OR= 1

  11. Asociación entre enfermedad cardiovascular y anticuerpos contra Chlamydia pneumoniae Association between cardiovascular disease and antibodies against Chlamydia pneumoniae

    Directory of Open Access Journals (Sweden)

    Guadalupe de los A García-Elorriaga

    2002-06-01

    Full Text Available Objetivo. Precisar si existe asociación entre enfermedad cardiovascular (ECV y anticuerpos contra Chlamydia en población mexicana. Material y métodos. Estudio transversal, realizado en la Unidad de Investigación en Inmunología e Infectología -Hospital de Infectología del Centro Médico Nacional La Raza (CMNR- y en el Servicio de Cirugía Cardiovascular y Asistencia Circulatoria, del Hospital General del CMNR, Instituto Mexicano del Seguro Social (IMSS, de agosto de 1998 a abril de 2000. Se determinaron anticuerpos IgG e IgM contra C. psittaci, C. trachomatis y C. pneumoniae mediante microinmunofluorescencia, en suero de 70 pacientes con ECV hospitalizados en el CMNR, mayores de 30 años, de uno u otro sexo, y se compararon con 140 sanos, pareados por edad y sexo. Se utilizaron muestras aleatorias simples, con un tamaño poblacional de 110, una prevalencia de 50% y un nivel de confianza de 99%. Para establecer la diferencia entre las proporciones de los títulos se utilizó ji cuadrada y se calculó la razón de momios. Resultados. El 94.3% (66/70 de los pacientes presentó IgG en contra de C. pneumoniae vs 37% (52/140 de los individuos sanos (pObjective. To evaluate the association between cardiovascular disease (CVD and antibodies against Chlamydia in Mexican population. Material and Methods. A cross-sectional study was conducted from August 1988 to April 2000, at the Immunology and Infectology Research Unit of Hospital de Infectología, Centro Médico Nacional La Raza (CMNR- and at the Cardiovascular Surgery and Circulatory Care, Hospital General CMNR, Instituto Mexicano del Seguro Social (IMSS. Study subjects were 70 CVD hospitalized patients, older than 30 years, from both genders. Serum IgG and IgM antibodies against C. psitaccii, C. trachomatis and C. pneumoniae were determined by microimmunofluorescence in study subjects and compared with those from 140 healthy individuals, matched by age and sex. Simple random sampling was used

  12. Prevalencia de anticuerpos contra virus dengue en el cantón de Golfito (2005 y en el Distrito Central de Puntarenas (2005-2006, Costa Rica

    Directory of Open Access Journals (Sweden)

    Margarita Lee-Lui

    2008-09-01

    Full Text Available Justificación y objetivo: La primo infección con el virus dengue varía desde asintomática hasta cuadros muy severos, como el dengue hemorrágico o el síndrome de choque por dengue. El Distrito Primero de Puntarenas ha sido una de las poblaciones más afectadas desde 1993, cuando aparecieron los primeros brotes, hasta hoy, con una disminución de la incidencia en los últimos años. La región Brunca fue la segunda en incidencia en el país en 1998, y si bien la endemicidad se ha mantenido, no existen estudios epidemiológicos sobre la prevalencia de esta enfermedad; los datos que aporta el Ministerio de Salud corresponden a la incidencia de casos clínicos en un período determinado. El objetivo de este estudio fue determinar la seroprevalencia en el Distrito Primero de Puntarenas y en Golfito para conocer la vulnerabilidad de la población de sufrir fiebre hemorrágica por dengue y analizar la situación asociada a los datos epidemiológicos de estas regiones, tales como edad, sexo y ubicación geográfica, ya que una población susceptible es la que presenta una alta seroprevalencia, unida a condiciones de hacinamiento y alta densidad vectorial. Métodos: El muestreo se realizó con el método EPI descrito por la OMS. Se recolectaron 210 muestras de suero en cada distrito, se desarrolló y estandarizó una prueba de ELISA de captura de antígeno para la detección de anticuerpos tipo IgG contra dengue, usando como referencia el método de reducción de placas de Dulbecco considerado estándar de oro. Resultados: La seroprevalencia contra dengue fue del 43.8% (92 y del 90% (189 en los distritos de Golfito y Central de Puntarenas, respectivamente, sin diferencias significativas respecto al sexo, la edad y la localidad. Se obtuvo un 83% y un 95% de correlación en Golfito y Puntarenas, respectivamente, entre los casos sintomáticos y la serología con el método estandarizado. Un 32% y un 42% del total de seropositivos en cada localidad

  13. Nivel de corte de los ELISAs para cuantificación de anticuerpos inducidos por la vacuna antimeningocócica VA-MENGOC-BC

    Directory of Open Access Journals (Sweden)

    Rolando Ochoa

    2001-06-01

    Full Text Available Para medir el grado de protección inducido por vacunas antimeningocócicas se ha establecido el Ensayo Bactericida en Suero (EBS y se perfeccionan otros ensayos inmunobiológicos, sin embargo, es necesario contar con pruebas sencillas como el ELISA, capaz de evaluar un gran número de muestras. Se estimó el nivel de corte de los ELISAs para la cuantificación de IgG humana contra los antígenos de VA-MENGOC-BC, vacuna antimeningocócica compuesta por vesículas proteicas de membrana externa de meningococo B y polisacárido capsular de meningococo C, con respecto a un panel de muestras de suero de lactantes, caracterizado por Ensayo Bactericida en Sangre Total (EBST. Los valores correspondientes a la máxima sensibilidad y especificidad fueron respectivamente; 2 μg/mL y 12 μg/mL para antipolisacárido C, y 1000 U/mL y 7000 U/mL para antiproteínas de membrana externa. La mayor coincidencia se obtuvo con 6 μg/mL y 2500 U/mL. Se evaluó otro panel de muestras de suero de adolescentes entre 14 y 18 años, por ELISA y EBS para Neisseria meningitidis serogrupos B y C, alcanzándose una buena concordancia. Doce años después de la inmunización con VA-MENGOC-BC persiste una importante concentración de anticuerpos contra los antígenos vacunales en los sueros estudiados.

  14. Validación de un ensayo ELISA para la determinación de anticuerpos anti LPS de Vibrio Cholerae

    Directory of Open Access Journals (Sweden)

    Yadira Pino

    2003-03-01

    Full Text Available Para evaluar la respuesta inmunológica de cualquier candidato vacunal es necesario contar en el laboratorio con técnicas estandarizadas y validadas. Es por ello que en este trabajo se realizaron los ensayos para la estandarización del ELISA indirecto, usado para la determinación de anticuerpos séricos anti-LPS Ogawa contra cólera en suero de humanos inoculados por vía oral, así como la evaluación de los parámetros de validación típicos de este ensayo. Para la selección de las condiciones óptimas se evaluaron la concentración de recubrimiento, condiciones de bloqueo y dilución de conjugado, con el objetivo de seleccionar las mejores respuestas para el control positivo, el control negativo y el blanco en cada caso.Una concentración de 25 μg/mL de LPS Ogawa en PBS, como recubrimiento, durante toda la noche; leche descremada al 0,5% en PBS, 30 min a temperatura ambiente como bloqueo y el conjugado anti-IgA-HRP diluido 1:5000, resultaron las variables óptimas para el ensayo. En cuanto a la validación de la técnica los parámetros evaluados fueron precisión, exactitud, límite de detección, especificidad y robustez. Para ello se siguió un protocolo de validación que permitiera evaluarlos, y en todos los casos el ensayo se consideró adecuado, siempre y cuando el coeficiente de variación resultara ser menor del 20%. En todos los parámetros evaluados se cumplió con este requisito, considerando así los resultados confiables y reproducibles.

  15. Prueba de Elisa indirecta para la detección de anticuerpos IgM para el diagnóstico de Leptospirosis humana

    Directory of Open Access Journals (Sweden)

    Manuel Céspedes Z

    2002-01-01

    Full Text Available Para el diagnóstico temprano de enfermedades con cuadro clínico inespecífico como la leptospirosis, es necesario la confirmación laboratorial mediante pruebas específicas, con la finalidad de que el diagnóstico sea más acertado y rápido. Objetivo: se realizó un estudio comparativo entre la prueba de microaglutinacion (MAT y la prueba de ELISA indirecta estandarizada con un "pool" de antígenos de Leptospira interrogans, para la detección de anticuerpos IgM, en muestras de suero de fase aguda de leptospirosis humana. Materiales y métodos: 40 muestras de pacientes con sospecha clínica y con títulos de 1:100-1:12800 por la prueba de MAT, 80 muestras negativas de pacientes aparentemente sanos con enfermedades como Brucelosis, Sífilis, Tifus murino, Hepatitis B, Fiebre Amarilla, Dengue y Enfermedad de Carrión fueron evaluados por ELISA IgM. Resultados: se obtuvo una sensibilidad de 97,5% y especificidad de 98,75%, no observándose reacción cruzada con otras enfermedades. Conclusión: ELISA IgM validado en el laboratorio es suficiente sensible, específico y de fácil aplicación para el uso como prueba de tamizaje en una infección por Leptospiras con la subsecuente confirmación por MAT.

  16. Generación de anticuerpos policlonales para la detección de la variante genotípica GIII de PVY, en cultivos de tomate de árbol y papa de Colombia

    Directory of Open Access Journals (Sweden)

    Yuliana Gallo García

    2012-04-01

    Full Text Available Normal 0 21 false false false ES-CO X-NONE X-NONE MicrosoftInternetExplorer4 Título en ingles: Generation of policlonal antibodies for detection of the PVY genotypic variant GIII in tamarillo and potato crops from Colombia Resumen: El potyvirus PVY es uno de los agentes causales más frecuentemente asociados a problemas virales en cultivos de papa y tomate de árbol en Colombia. Dada la importancia económica de las enfermedades causadas por PVY y a la necesidad de generar material de siembra certificado por su sanidad viral, es fundamental la generación de herramientas de diagnóstico que permitan la detección temprana de este virus. En este trabajo se reporta la obtención de anticuerpos policlonales específicos, útiles para la detección del genotipo III de PVY (GIII, una de las tres variantes que recientemente han sido reportadas en cultivos de papa y tomate de árbol de la región Andina de Colombia. Como antígeno, se utilizó un péptido sintético diseñado a partir de la región variable del extremo N-terminal del gen de la cápside viral. La sensibilidad de los anticuerpos fue evaluada mediante pruebas de ELISA y dot-blot utilizando péptidos sintéticos. Se realizó una prueba piloto para validar el uso de los anticuerpos a partir de plantas sintomáticas y asintomáticas obtenidas de una región donde confluyen cultivos de ambas solanáceas, encontrándose que los anticuerpos generados ofrecen mayores niveles de detección que los anticuerpos comerciales comúnmente utilizados para detectar los serotipos PVY-O,C y PVY-N de este virus. Palabras clave: anticuerpos policlonales; ELISA; potyvirus; RT-PCR; virus Y de la papa Abstract: PVY is one of the potyvirus more frequently associated with viral infections in tomato and tamarillo crops in Colombia. Due to the economic impact of PVY and the need to certify seeds as virus-free it is important to develop diagnostic tools that allow its premature detection. In this work, the

  17. UltramicroELISA indirecto para la deteccion de anticuerpos totales a citomegalovirus en suero humano Indirect Ultramicroelisa assay for the detection of human antibodies to cytomegalovirus using human serum samples

    Directory of Open Access Journals (Sweden)

    Jose Laferte

    1992-02-01

    Full Text Available Se normalizó un ultramicroELISA indirecto para la detección de anticuerpos a Citomegalovirus (CMV humano (UMELISA CMV. Se determinó la concentración óptima de antígeno en 30 ug/ml, la dilución de los sueros fue de 1:40 y la dilución de trabajo del conjugado fue de 1:1500. El UMELISA CMV fue comparado con las técnicas de aglutinación de latex para anticuerpos anti-CMV (Dupont de Neumors y la inmunofluorescencia indirecta (EFT. Los resultados mostraron un alto grado de concordancia y elevada copositividad y conegatividad del UMELISA con respecto a estos dos ensayos. El método es válido para el pesquisaje de anticuerpos en banco de sangre asi como para el diagnóstico de la infección mediante sueros pareados.We have standardized an indirect ultramicro ELISA assay for detecting antibodies to human Cytomegalovirus (CMV using human serum samples (UMELISA CMV. The optimal concentration of coating antigen (30 ug/ml, serum dilution (1:40 and anti-human conjugate working dilution (1:1500, were determined by a check board titration method. The UMELISA CMV was compared with the latex agglutination test for antibodies to CMV (Dupont de Nemours and with an indiret immunofluorescent method. The results have showed the high coincidence, sensitivity and especificity of the proposed assay regarding the two methods compared with, and supporting its use either for a blood donors screening or in the serological diagnosis of this infection by paired serum samples.

  18. Prevalencia de anticuerpos neutralizantes contra los serotipos del virus dengue en universitarios de Tabasco, México Prevalence of neutralizing antibodies to dengue virus serotypes in university students from Tabasco, Mexico

    Directory of Open Access Journals (Sweden)

    Gilma Guadalupe Sánchez-Burgos

    2008-10-01

    Full Text Available OBJETIVO: Determinar la seroprevalencia de anticuerpos neutralizantes de los serotipos del virus dengue en estudiantes universitarios de Tabasco, México, durante los meses de septiembre a noviembre del año 2005. MATERIAL Y MÉTODOS: Se determinó la presencia de IgG contra el virus en el suero de estudiantes que acudieron al centro clínico de la universidad; en los sueros positivos se determinaron los anticuerpos neutralizantes mediante el ensayo de reducción de placa lítica. RESULTADOS: La prevalencia de IgG contra el dengue fue de 9.1%; de esta proporción, los anticuerpos neutralizantes fueron DENV-1 (20%, DENV-2 (100%, DENV-3 (4% y DENV-4 (68%. CONCLUSIONES: Este estudio muestra que el serotipo transmitido con mayor frecuencia en el estado de Tabasco es el DENV-2, aunque no ha sido el aislado con más frecuencia. La elevada prevalencia de anticuerpos neutralizantes contra el DENV-4, al parecer de reacción cruzada, podría explicar la baja circulación de este serotipo en Tabasco.OBJECTIVE: Determine the seroprevalence of neutralizing antibodies to dengue virus in students from the state university of Tabasco, Mexico. MATERIAL AND METHODS: A transversal study was conducted of serum collected from students between September and November, 2005. The sera were screened for anti-dengue IgG and those that had evidence of dengue antibodies were analyzed by a plaque reduction neutralization test. RESULTS: Prevalence of anti-dengue IgG was 9.1%. The frequency of neutralizing antibodies was 100% for DENV-2, 68% for DENV-4, 20% for DENV-1, and 4 % for DENV-3. CONCLUSIONS: We found that in this population, DENV-2 circulates more than DENV-3 despite the fact that DENV-3 is more frequently isolated. Unexpectedly, neutralizing antibodies against DENV-4 were frequently found even though this serotype is almost extinct; thus, it is probable that cross-immunity could suppress DEN-4 transmission, as has been suggested.

  19. Péptidos y anticuerpos útiles para la elaboración de medicamentos para el tratamiento o prevención de enfermedades humanas neurodegenerativas, medicamentos así obtenidos y sus aplicaciones

    OpenAIRE

    Trullás Oliva, Ramón; Enguita, Marta; Abad, Alba

    2007-01-01

    Péptidos y anticuerpos útiles para la elaboración de medicamentos para el tratamiento o prevención de enfermedades humanas neurodegenerativas, medicamentos así obtenidos y sus aplicaciones. La presente invención describe inhibidores de la expresión génica del gen que codifica para la proteína NP1, que actúa como un inductor de apoptosis neural y neurodegeneración, útiles para la elaboración de medicamentos o composiciones farmacéuticas para el tratamiento o prevenci...

  20. Obtención de anticuerpos policlonales IgY antiparvovirus canino y evaluación en un sistema de aglutinación con látex

    Directory of Open Access Journals (Sweden)

    Jannet González-Figueredo

    2015-12-01

    Full Text Available La parvovirosis canina es una de las principales infecciones que provoca gastroenteritis, fundamentalmente en cachorros, con altos índices de morbiletalidad. Los diagnosticadores más utilizados se basan en la detección de partículas virales excretadas durante la fase aguda de la enfermedad. Algunos requieren equipos especializados, lo que aumenta los costos y el tiempo de diagnóstico. Por esto, la simplificación de estos métodos con alta sensibilidad y especificidad es prioritaria. En Cuba solo se logra un diagnóstico presuntivo sin la completa confirmación de la enfermedad, principalmente por la escasez o ausencia de un medio diagnóstico en toda la red de consultorios y clínicas veterinarias, rápido, eficaz y ajustable a nuestras condiciones. Este trabajo tuvo como objetivo obtener anticuerpos policlonales IgY a partir de yema de huevo de gallina y evaluarlos mediante un sistema de látex-aglutinación, para su posible uso como terapia y principalmente en el diagnóstico. Se inmunizaron por vía intramuscular dos gallinas de raza Leghorn con una cepa atenuada de parvovirus canino (PVC tipo 2. Se aplicaron 8 inoculaciones por ave cada 15 días. Se cosecharon los huevos y se purificaron los anticuerpos por el método de sulfato de dextrana/sulfato de sodio. Se determinó el título de IgY anti-PVC por el método de Inhibición de la Hemoaglutinación (IH y con antígeno de PVC acoplado a partículas de látex de poliestireno. Por IH se obtuvo un título de IgY anti-PVC de 1:1024. Las mezclas de anticuerpos con títulos alto y medio de ambas gallinas aglutinaron con los reactivos preparados con 230 y 460 µg/mL de antígeno. La mayor intensidad de la reacción y la mejor detectabilidad correspondieron a los reactivos elaborados con los anticuerpos de mayor título.

  1. Deficit de proteina Z de la coagulación y anticuerpos anti-proteina Z como factores de riesgo de recidiva trombotica arterial y venosa. Estudio prospectivo a largo plazo

    OpenAIRE

    Pardos Gea, José

    2016-01-01

    Antecedentes: La proteína Z (PZ) es un cofactor de la coagulación que unido a su proteasa activa (ZPI) forman el ultimo sistema anticoagulante descrito. Los modelos animales confirman que el déficit de PZ es trombofílico. El número y calidad de los estudios clínicos ha sido insuficiente para constatar este hecho. Los anticuerpos anti-PZ descritos en patología obstétrica nunca se habían testado en patología trombótica vascular. Objetivos: El objetivo inicial fue investigar si el déficit de PZ ...

  2. Determinación de anticuerpos anti-β2glicoproteína I en pacientes con síndrome antifosfolípido Anti- β2 glycoprotein antibodies in patients with antiphospholipid syndrome

    Directory of Open Access Journals (Sweden)

    Oscar Uribe Uribe

    2004-09-01

    Full Text Available EL objetivo de este estudio fue comparar la presencia de anticuerpos anti-β2glicoproteína I (anti- β2GPI con las pruebas convencionales de laboratorio de anticuerpos anticardiolipina (aCL y anticoagulante lúpico, y con las manifestaciones clínicas del síndrome antifosfolípido (SAF. Se incluyeron en el estudio 80 mujeres con SAF; 35 de ellas de la consulta de Reumatología y las otras 45 con historia de aborto recurrente espontáneo (ARE; 5 mujeres de la consulta de Reumatología sin SAF, 27 mujeres con ARE, sin SAF y un grupo control de 20 mujeres sanas en edad reproductiva. Se investigaron la presencia de anticuerpos IgG e IgM anticardiolipina (aCL e IgG anti- β2GPI por la técnica de ELISA, y el anticoagulante lúpico por la determinación del tiempo parcial de tromboplastina activado. Adicionalmente, se registraron las manifestaciones clínicas asociadas al SAF. De las pacientes con SAF, 25.7% del grupo de Reumatología (9/35 y 4.4% de las pacientes con ARE (2/45 fueron positivas para anticuerpos anti-β2GPI, mientras que ninguna de las mujeres sin SAF, ni de las mujeres del grupo control, fue positiva. La asociación entre la presencia de anti- β2GPI y los anticuerpos IgG e IgM aCL mostró una diferencia significativa en los títulos de 3+ (altamente positivos en contraste con los individuos negativos para anti- β2GPI. La positividad del anticoagulante lúpico también se correlacionó con la presencia de anticuerpos anti- β2GPI. No hubo diferencia significativa entre las diversas manifestaciones clínicas del SAF y la presencia de dichos anticuerpos. En conclusión, la determinación de anticuerpos anti- β2GPI tiene una alta especificidad en pacientes con SAF pero no se asoció con ninguna manifestación clínica en particular. The objective of this study was to compare the presence of anti-β2glycoprotein (anti- β2GPI antibodies with the conventional laboratory tests of anticardiolipin antibodies (aCL and lupus anticoagulant

  3. Los niveles de anticuerpos anti factor plaquetario 4-heparina y el índice 4T para trombocitopenia inducida por heparina

    Directory of Open Access Journals (Sweden)

    Marta E. Martinuzzo

    2012-02-01

    Full Text Available La trombocitopenia inducida por heparina (HIT es un efecto adverso del tratamiento con heparina, mediada por anticuerpos anti complejo factor plaquetario 4 (PF4-heparina (HPIA. La HIT es frecuentemente moderada pero pueden desarrollarse complicaciones trombóticas. El diagnóstico precoz es importante. La detección de HPIA por ELISA tiene alta sensibilidad pero baja especificidad (títulos bajos sin significación clínica. El índice de las 4T (índice 4T puede detectar pacientes con alto riesgo de HIT. El propósito del estudio fue correlacionar los niveles de HPIA y el índice 4T de un grupo de pacientes derivados a nuestro centro. Evaluamos 84 pacientes, 34 de ellos desarrollaron trombosis. Cada médico completó un cuestionario clínico que fue remitido con la muestra a nuestro centro. Los cuestionarios fueron analizados por un investigador externo y el índice 4T se calculó previamente al ensayo. Los HPIA se determinaron por un ELISA (Asserachrom HPIA que detecta los 3 isotipos, IgG, IgM e IgA, único reactivo disponible en Argentina. Los resultados se expresaron como porcentaje de absorbancia (%ABS. La correlación del índice 4T con los HPIA fue 0.472 (rho spearman, p < 0.001. Los pacientes con índice 4T ≥ 6 presentaban %ABS mayores que los ≤ 5 (67 vs. 39, p < 0.001. Aquéllos con trombosis presentaron títulos mayores que los que no la desarrollaron (%ABS 59 vs. 39, p = 0.017. En conclusión: Los títulos altos de HPIA medidos por ELISA, que detecta los 3 isotipos, correlacionaron claramente con el índice 4T ≥ 6 y fueron más frecuentes en los pacientes con trombosis, coincidiendo con lo ya descripto para ensayos de ELISA específicos para isotipo IgG.

  4. Complicaciones clínicas en una serie de pacientes con anticuerpos anticardiolipina Clinical complications in a series of patients with anticardiolipin antibodies

    Directory of Open Access Journals (Sweden)

    A. Pujol

    2003-12-01

    Full Text Available Se han analizado las complicaciones clínicas determinadas con métodos objetivos en 68 pacientes de la Clínica Universitaria de Navarra con sospecha clínica de síndrome antifospolípido (SAF y presencia de anticuerpos anticardiolipina (ACA. Se consideraron para el estudio, pacientes con título de IgG superior a 23 GPL. La patología más prevalente fue la trombosis: trombosis venosas (42,6% y arteriales (22%. Otras complicaciones fueron abortos (23,8% de las 42 mujeres y trombocitopenia (12,1%. En cuanto a la localización de la trombosis venosa, el predominio correspondió a extremidades inferiores (51,7%, seguida de tromboflebitis superficial (27,5% y tromboembolismo pulmonar (20,6%. Entre las complicaciones arteriales, las más frecuentes fueron enfermedad cerebrovascular (86,6% y la cardiopatía isquémica (13,4%. No existió correlación entre la presencia de títulos elevados de ACA y la prevalencia o severidad de las manifestaciones clínicas. En la serie de 68 pacientes con ACA IgG 23 GPL se aprecia un elevado porcentaje de trombosis venosas y arteriales detectadas con métodos objetivos. La presencia de ACA constituye un factor de riesgo protrombótico.An analysis was made of clinical complications, determined with objective methods, in 68 patients at the University Clinic of Navarra with the clinical suspicion of antiphospholipid syndrome (APS and presence of anticardiolipin antibodies (ACA. Patients with IgG higher than 23 GPL were considered for the study. The most prevalent pathology was thrombosis: venous thrombosis (42.6% and arterial thrombosis (22%. Other complications were abortions (23.8% of the 42 women and thrombocytopenia (12.1%. With respect to the localisation of venous thrombosis, predominance corresponded to lower extremities (51.7%, followed by superficial thrombophlebitis (27.5% and pulmonary thromboembolism (20.6%. Among the arterial complications, the most frequent were cerebrovascular disease (86.6 % and

  5. Urticaria crónica con alteraciones de la función tiroidea y anticuerpos antiperoxidasa tiroidea Chronic urticaria with alterations of the thyroid function and thyroid peroxidase antibodies

    Directory of Open Access Journals (Sweden)

    Diego S. Fernández Romero

    2005-06-01

    Full Text Available La urticaria crónica es una enfermedad frecuente, caracterizada por la presencia de ronchas y/o angioedema con una duración superior a las 6 semanas. En un número importante de pacientes se comporta como una enfermedad autoinmune asociada frecuentemente con alteraciones en la función tiroidea y con la presencia de anticuerpos antitiroideos. Presentamos una serie de 70 pacientes consecutivos con diagnóstico de urticaria crónica a los cuales les investigamos la función tiroidea y la presencia de anticuerpos antiperoxidasa tiroidea. Siete (10% tenían diagnóstico de enfermedad tiroidea previa al momento de la consulta. A los 63 pacientes restantes se les estudió los niveles de tirotrofina sérica, 11 de los cuales (17% presentaron valores anormales, que sumados a los 7 con enfermedad previa llegan a 18 (26% con función tiroidea alterada. A 61 pacientes se les investigó anticuerpos antiperoxidasa tiroidea, 22 (36% fueron positivos. De 57 pacientes sin diagnóstico de patología tiroidea previa al momento de la consulta por urticaria, a los que se les estudió tanto los niveles de tirotrofina sérica como la presencia de anticuerpos antiperoxidasa tiroidea, 24 (42% presentaron alguno de los estudios alterados. El alto porcentaje de alteraciones tiroideas en nuestra serie de pacientes resalta la necesidad de estudiar la función tiroidea y la presencia de anticuerpos antiperoxidasa tiroidea en pacientes con urticaria crónica.Chronic urticaria is a frequent pathology, characterized by the presence of hives and/or angioedema lasting longer than 6 weeks. In an important number of patients it behaves as an autoimmune illness, frequently associated with alterations in thyroid function and thyroid antibodies. We herein describe a consecutive series of 70 patients with a diagnosis of chronic urticaria. Seven (10% had a diagnosis of thyroid illness previous to their first consultation. Thyroid function and thyroid antibodies were studied in the

  6. Detection of PMTV Using Polyclonal Antibodies Raised Against a Capsid-Specific Peptide Antigen / Detección de PMTV Utilizando Anticuerpos Policlonales Contra un Péptido Antigénico Derivado de la Cápside Viral

    Directory of Open Access Journals (Sweden)

    Yuliana Gallo García

    2013-12-01

    Full Text Available Potato mop-top virus (PMTV; genus Pomovirus;family Virgaviridae is the causing agent of the spraing disease in potato (Solanum tuberosum. PMTV is transmitted by Spongospora subterranea f. sp. subterranea (Sss. This disease has a widespread distribution in potato growing regions around the world. The possibility of obtaining strain specific antibodies at low cost can greatly increase the sensitivity and use of serological tests in seed certification programs, plant breeding and quarantine regulations to avoid dissemination of this injurious virus. This work presents an alternative procedure for the production of PMTV specific antibodies useful in serological test such as ELISAand lateral flow. In contrast to standard methods requiring theisolation of viral particles or expression of recombinant capsid, this method uses peptides mimicking the N-terminal region of PMTV capsid protein as antigen for the production of specific polyclonal antibodies. The antibodies were tested against bait plants grown in soil infested with viruliferous Sss, as well as potato plants obtained from naturally Sss infested fields in Colombia. PMTV was detected in 9/14 and 24/28 foliage samples of N. benthamiana and S. phureja, respectively. In the case of field plants, the virus wasdetected in eight out of 12 root tissues evaluated. The minimumpeptide concentration detected by ELISA was of the order of 0.1 nM. / Potato mop-top virus (PMTV; género Pomovirus; familia Virgaviridae es transmitido por Spongospora subterranea f. sp. subterranea (Sss, agente causal de la sarna polvosa de la papa. Esta enfermedad tiene una amplia distribución en las regiones cultivadoras de papa alrededor del mundo. La posibilidad de obtener anticuerpos específicos contra cepas de este virus, puede incrementar la sensibilidad y la utilización de pruebas serológicas en programas de certificación de semilla, mejoramiento genético y regulaciones cuarentenarias que eviten su diseminaci

  7. Optimización del ensayo vibriocida colorimétrico para la determinación de anticuerpos séricos contra V. cholerae del serogrupo O139

    Directory of Open Access Journals (Sweden)

    Joivier Vichi-Lozada

    2011-01-01

    Full Text Available El título de anticuerpos vibriocidas es reconocido actualmente como el mejor marcador de inmunidad protectora ante la infección con Vibrio cholerae. Su evaluación permite estudiar la efectividad de vacunas durante ensayos preclínicos y clínicos, a través de la determinación de la funcionalidad de anticuerpos séricos, capaces de lisar células en presencia de complemento exógeno. Se han desarrollado distintos ensayos bactericidas con puntos finales y métodos de determinación del título vibriocida diferentes. La presencia de cápsula en el serogrupo O139 de Vibrio cholerae constituye un impedimento para la lisis eficiente de las células bajo condiciones del ensayo vibriocida utilizado en cepas del serogrupo O1. Por tal razón, se hace necesario adaptar los ensayos bactericidas existentes para V. cholerae O1, con la finalidad de utilizarlos con el serogrupo O139. A partir de un ensayo vibriocida colorimétrico, desarrollado para el serogrupo O1, se optimizaron las condiciones necesarias para una eficiente lisis celular del serogrupo O139 por anticuerpos específicos y el complemento. Este método colorimétrico tiene la ventaja que mediante la adición de glucosa y un indicador de pH al medio de cultivo utilizado para el crecimiento de las células sobrevivientes, puede determinarse visualmente el título de forma clara e inequívoca. Los mejores resultados se obtuvieron después del crecimiento de la cepa diana en cuñas de agar LB, al usar una concentración inicial de vibrión diana de 106 UFC/mL, una concentración inicial del complemento de 100 %, disolución salina fisiológica como diluente y tiempo de reacción de vibriolisis de una hora. Estas condiciones de experimentación permitieron obtener resultados exactos y precisos para V. cholerae O139.

  8. Detección de anticuerpos Anti-brucella en focas de Weddell (Leptonychotes weddellii de Cabo Shirref, Antártica Detection of anti-brucella antibodies in Weddell seals (Leptonychotes weddellii from cape Shirref, Antarctica

    Directory of Open Access Journals (Sweden)

    O. BLANK

    2002-01-01

    Full Text Available Posterior al hallazgo de anticuerpos anti-Brucella en muestras de lobo fino antártico (Arctocephalus gazella, el estudio serológico en Pinnipedia Antárticos se continuó con el fin de determinar la presencia de anticuerpos anti-Brucella en otras especies. Se colectaron muestras de sangre y de fluido extravascular de 12 ejemplares de foca de Weddell (Leptonychotes weddellii encontrados en el Sitio de Especial Interés Científico (SEIC Nº 32 y sitio CCAMLR Ecosystem Monitoring Program (CEMP N° 2, "Cabo Shirreff e Islotes San Telmo" (62º 47' S; 60º 27' W, localizado en la costa Noroeste de la isla Livingston (Shetland del Sur, Antártica. Las muestras obtenidas fueron analizadas por la técnica convencional Rosa de Bengala (RB y dos inmunoensayos enzimáticos de competencia: Compelisa®, y c-ELISA. De las muestras estudiadas se identificaron cinco con anticuerpos anti-Brucella, siendo las pruebas inmunoenzimáticas las técnicas más sensibles. Estos resultados muestran una alta probabilidad de presencia de infección por una bacteria del género Brucella en ejemplares L. weddellii y plantean la necesidad de realizar estudios complementarios, que permitan conocer la etiología y entender la epidemiología de Brucella en esta región del mundoAfter the finding of anti-Brucella antibodies in samples of Antarctic fur seal (Arctocephalus gazella, the serological study on Antarctic Pinniped was continued in order to determine the presence of anti-Brucella antibodies in other species. Blood and extra vascular fluid samples were taken from 12 Weddell seals (Leptonychotes weddellii at the Site of Special Scientific Interest (SSSI Nº 32 and CCAMLR* Ecosystem Monitoring Program (CEMP site N° 2 "Cape Shirreff and San Telmo Islets" (62º 47' S; 60º 27' W, located on the Norwest coast Livingston Island (South Shetland Islands, Antarctica. The samples were tested by the conventional Rose Bengal test (RB and two competitive enzymatic immunoassay

  9. Toxocara seroprevalence in children from a subtropical city in Argentina Prevalencia de anticuerpos anti Toxocara en niños de una ciudad subtropical de Argentina

    Directory of Open Access Journals (Sweden)

    José Mario ALONSO

    2000-08-01

    Full Text Available Most studies from Argentina have focused on toxocariasis as an environmental problem of big cities, and there are no available data about children infection from small or middle-sized cities. In order to assess the prevalence of anti-Toxocara antibodies in infantile population, 206 children from Resistencia, of both sexes, aged 1-14 years old were studied by Elisa testing with E/S T. canis L2 antigens. Hematological parameters and immunoglobulin levels were determined; five days' stool samples were studied and epidemiological data were obtained by means of a questionnaire to parents. Results showed that 73% of the children had one or more dogs living at home, 57% reported geophagia and 37.9% were positive for Toxocara serology, but there was no significant difference in prevalence neither for boys and girls, nor concerning age. An increased risk of infection was observed in age groups 5-6 and 7-8 for boys, and in age groups 3-4 and 5-6 for girls.La mayoría de los estudios realizados en Argentina, han enfocado a la Toxocariosis como un problema medioambiental propio de las grandes ciudades y no existen datos acerca de esta infección entre los niños de ciudades medianas o pequeñas. A fin de determinar la prevalencia de anticuerpos anti-Toxocara en la población infantil de la ciudad de Resistencia, se estudiaron 206 niños de ambos sexos, con edades comprendidas entre los 1-14 años, mediante el test de Elisa, empleando antígenos E/S de larva L2 de Toxocara canis. También se evaluaron los niveles de inmunoglobulinas séricas y los parámetros hematológicos; se efectuaron análisis coproparasitológico seriados en heces de 5 días y se recolectó información epidemiológica mediante cuestionario a los padres. Los resultados obtenidos señalan que el 73% de los niños tenían uno o mas perros viviendo en la casa, que el 57% tenían antecedentes de geofagia y que el 37.9% tenían serología positiva para Toxocara, aunque no hubo diferencias

  10. POLYCLONAL ANTIBODIES TO DETECT THE CP-RT PROTEIN OF Potato Mop-Top VIRUS ANTICUERPOS POLICLONALES PARA LA DETECCIÓN DE LA PROTEÍNA CP-RT DEL Potato Mop-Top VIRUS

    Directory of Open Access Journals (Sweden)

    Derly Andrade Molina

    2012-06-01

    últiples submuestras por tejido bajo análisis. Con el fin de ampliar el rango de herramientas para la detección de PMTV, se obtuvieron anticuerpos dirigidos al dominio RT de la proteína CP-RT. Se secuenció dicho dominio en el aislamiento colombiano R25 de PMTV y se realizaron análisis bioinformáticos para ubicar regiones peptídicas con alto potencial inmunogénico. El péptido seleccionado fue inoculado en conejos para obtener anticuerpos, cuya utilidad fue evaluada a partir de pruebas de ELISA indirecto en plantas señuelo de Nicotiana benthamiana inoculadas con quistosoros de Sss y en plantas de papa obtenidas en La Unión (Antioquia. Estas pruebas estuvieron acompañadas con evaluaciones de RT-PCR. Se obtuvo la totalidad del dominio RT, así como 441 nt del gen CP. Los análisis filogenéticos identificaron la cepa R25 como asociada al linaje de PMTV mundialmente distribuido. Se obtuvieron 19,26 mg de anticuerpos, los que resultaron efectivos para detectar PMTV. Ya que CP-RT es responsable de la transmisión del PMTV por Sss, estos anticuerpos permitirán no sólo apoyar los programas de diagnóstico, sino también estudios básicos y epidemiológicos tendientes a evaluar las interacciones del PMTV y Sss.

  11. Prevalencia de anticuerpos IgG específicos dirigidos a Mycobacterium avium en caprinos y ovinos en el sur de la Guajira y norte del Cesar

    Directory of Open Access Journals (Sweden)

    María Fernanda Cepeda

    2016-06-01

    enviados para su procesamiento al Laboratorio de Investigaciones Biomédicas y Biotecnológicas (LIBB del programa de Bacteriología y Laboratorio Clínico de la Universidad de Santander UDES Bucaramanga. Los resultados del procesamiento de las pruebas de ELISA serán ingresados en una base de datos proporcionada por la institución responsable del control de calidad de pruebas, Laboratorios VECOL, para su posterior análisis. El análisis estadístico será realizado mediante la aplicación del paquete estadístico Graphpad Prism (La Jolla, CA, USA. Resultados: Como resultado de este trabajo se plantea la determinación de la prevalencia de anticuerpos específicos de tipo IgG dirigidos a M. avium en caprinos y ovinos, información que aportará herramientas encaminadas a la construcción de un perfil sanitario en los municipios del sur de la Guajira y el Norte del Cesar. Conclusiones: El conocimiento de la prevalencia de M. avium en ovinos y caprinos de la región del sur de la Guajira y el norte del Cesar, se concibe como un aspecto de importancia epidemiológica al ser considerada una infección de notificación obligatoria según la Organización Mundial de Sanidad Animal (OIE según su sigla en inglés dado que estos departamentos encabezan el listado de las regiones con mayor actividad económica basada en la producción y consumo de estos animales y sus productos, adicionalmente, los ovinos y caprinos tienen la capacidad de ser reservorios para este agente infeccioso, llegando a convertirse en potencial causa del desarrollo de enfermedades en estas poblaciones específicas, así como, la importancia que pueden representar desde el punto de vista de su potencial zoonótico.

  12. Asociación entre la presencia de anticuerpos anti-Ras y anti-VPH16 E4/E7 y lesiones intraepiteliales del cérvix Association between anti-Ras and anti-HPV16 E4/E7 antibodies with cervical intraepithelial lesions

    Directory of Open Access Journals (Sweden)

    Sara Vázquez-Corzo

    2003-10-01

    Full Text Available OBJETIVO: Determinar si anticuerpos séricos contra E4, E7 y Ras pueden ser utilizados como marcadores de lesiones tempranas del cérvix uterino asociadas al virus del papiloma humano. MATERIAL Y MÉTODOS: Entre marzo de 1999 y abril de 2000 se realizó un estudio sero-epidemiológico de casos y controles en la clínica de displasias del Hospital General Doctor Gea González, en la Ciudad de México, en 116 muestras de suero para evaluar la presencia de anticuerpos anti-E4, E7 y Ras utilizando un ELISA de captura. Se estimaron razones de momios e intervalos de confianza de 95% RESULTADOS: Anticuerpos anti-E7 se asociaron a mujeres con lesiones NIC III, mientras que anticuerpos anti-E4 y anti-Ras fueron más frecuentes en lesiones NIC I-II. Al evaluar el perfil de anticuerpos que presentaron las mujeres, encontramos que a anticuerpos contra dos proteínas predicen la existencia de una lesión NIC I-II, y b la presencia de tres anticuerpos predicen una lesión NIC III. CONCLUSIONES: La detección de anticuerpos séricos contra E4, E7 y Ras en combinación con otras técnicas de diagnóstico, podrían ser de utilidad para detectar oportunamente a mujeres con lesiones tempranas asociadas al Virus del Papiloma Humano y en riesgo de desarrollar cáncer.OBJECTIVE: To evaluate whether serum antibodies anti-E4, E7 and Ras could be used as markers for early cervical lesions associated with HPV (human papillomavirus. MATERIAL AND METHODS: A seroepidemiological case-control study was conducted between March 1999 and April 2000 at the dysplasia clinic of Hospital General Doctor Gea Gonzalez, in Mexico City, to evaluate the presence of antibodies anti-E4, E7, and Ras through a sandwich ELISA. Analysis was done using odds ratios and 95% confidence intervals. RESULTS: Anti-E7 antibodies were associated to women with CIN III lesions, while anti-E4 and Ras antibodies were strongly associated with CIN I-II lesions. The antibody profile of women with different

  13. Antimalaric antiobodies in school children in El Bagre, Colombia Detección de anticuerpos antimaláricos en un grupo de escolares del municipio de El Bagre, Antioquia

    Directory of Open Access Journals (Sweden)

    Isabel Polanco

    1998-01-01

    Full Text Available A cases and controls study was carried out in 1996 in El Bagre, Colombia, endemic zone for malaria, in order to determine the relationship between nutritional situation and immune response to malaria in 51 children with malaria and 49 without it; IgG and IgM antibodies were determined by means of indirect inmunofluorescence .against P. falciparum antigens (Strain FCB2. Nutritional situation was evaluated according to USA National Center for Health Statistics. No child was found positive for IGM antibodies; concerning IgG response, it was positive in 29 (56.9% malaric children but only in 4 (8.2% of the non-malaric ones (p<0.00001 . Difference was also signjficant (p<0.00001 for malarja antecedents in the previous year (70.6% in malaric children vs 10.2% jn the nonmalaric ones. Of the 29 malaric seropositive children 20 (69% were malnourished (p<0.01 . En 1996, en el municipio de El Bagre (Antioquia-Colombia, zona endémica para malaria y con altos niveles de desnutrición, se realizó un estudio de casos y controles con el objeto de determinar la relación entre el estado nutricional y la respuesta inmune humoral de niños con y sin malaria. Se trabajó con un grupo de 100 niños entre 4 y 9 años de edad, 51 con malaria y 49 sin ella, al cual se le determinaron los niveles de anticuerpos antimaláricos IgG e IgM por la técnica de inmunofluorescencia indirecta (IFI, empleando antigenos de P. falciparum cepa FCB 2 mantenida en cultivo continuo. El estado nutricional se evaluó por comparación de las medidas antropométricas con la referencia de crecimiento del National Center for Health Statistics (NCHS de los Estados Unidos. Los resultados mostraron diferencias en la tasa de positividad de anticuerpos IgG entre los niños maláricos y los no maláricos. En efecto: Veintinueve niños maláricos (56.9% y sólo 4 de los no maláricos (8.2% tenían dichos anticuerpos (P<0.00001 ; la diferencia también fue significativa para el antecedente de

  14. Prevalencia de anticuerpos contra diarrea viral bovina, virus sincitial bovino, rinotraqueitis infecciosa bovina, leucosis bovina, Neospora caninum, parainfluenza bovina (PI3 y paratuberculosis, en ganadería bovina de fincas ubicadas en Aguachica y Rio de Oro, Cesar

    Directory of Open Access Journals (Sweden)

    Tatiana Gálvis García

    2016-06-01

    Full Text Available Introducción: En el área de la ganadería los problemas caracterizados por infertilidad, abortos, muerte embrionaria, crías con malformaciones neurológicas y físicas son de gran importancia, ya que hay múltiples etiologías y se encuentran ampliamente distribuidos a nivel mundial. Lo anterior ocasiona serias pérdidas económicas y afectando la exportación de carne de los bovinos debido a la restricción de normas de sanidad, donde se encuentran las enfermedades como diarrea viral bovina, rinotraqueitis infecciosa bovina, leucosis bovina y Neospora caninum. Objetivo: Determinar la prevalencia de anticuerpos contra diarrea viral bovina (DVB, virus sincitial respiratorio bovino (BRSV, virus de la rinotraqueitis infecciosa bovina (IBR, leucosis enzoótica bovina (BLV, N. caninum, Parainfluenza bovina (PI3 y paratuberculosis (ParaTBC, en bovinos de Aguachica y Rio de Oro, Cesar. Materiales y métodos: Tipo de estudio: Descriptivo de corte transversal, se realizó en 27 fincas ubicadas en zona rural de los municipios de Aguachica y Rio de Oro, Cesar. El Tamaño de la muestra se estimó en 905 bovinos. De cada animal se tomó sangre por punción venosa de la vena coccígea en tubos sin anticoagulante mediante el uso de sistema de vacío Vacutainer®. Cada muestra fue etiquetada adecuadamente con los códigos de identificación asignada, las muestras se centrifugaron a 1500 rpm y se transportó al laboratorio en recipientes con hielo. Se realizó alícuotas en viales de 1,5 ml y se almacenaron a -20 ° C para su posterior procesamiento. Determinación de anticuerpos específicos: Las pruebas para detectar anticuerpos específicos fue mediante ensayo de inmunoabsorción enzimática (ELISA, de las casas comerciales INGEZIM (BRSV, DBV, BLV, N. caninum, IBR, PARACHEK 2 (ParaTBC y BIO-X DIAGNOSTIC (PI3. La validación de las pruebas se realizó mediante los respectivos controles positivos y negativos los cuales se procesaron por duplicado. Resultados

  15. OBTENCIÓN DE ANTICUERPOS ESPECÍFICOS PARA LA DETECCIÓN DEL Tamarillo leaf malformation virus (TALMV EN TOMATE DE ÁRBOL Specific Antibodies to Detect Tamarillo leaf malformation virus (TaLMV in Tamarillo

    Directory of Open Access Journals (Sweden)

    YULIANA GALLO GARCÍA

    2011-08-01

    Full Text Available En Colombia el rendimiento del cultivo de tomate de árbol se ha visto seriamente afectado por la expansión de una enfermedad conocida como virosis de tomate de árbol. Esta patología se registró inicialmente en 1991 en el norte de Antioquia y su expansión ha alcanzado todas las regiones cultivadoras de este frutal en el país. Trabajos recientes han detectado la presencia de por lo menos dos especies del género Potyvirus (Potyviridae asociadas a esta enfermedad en los cultivos de tomate de árbol de Antioquia: Potato virus Y (PVY y Tamarillo leaf malformation virus (TaLMV, especie propuesta. Con el fin de reducir la diseminación de estos patógenos virales en el país, es necesario contar con herramientas de diagnóstico que permitan la certificación del material de siembra y la detección temprana en plantas asintomáticas. En este trabajo se obtuvieron anticuerpos policlonales específicos para la detección del virus TaLMV utilizando una región antigénica de 15 residuos de la cápside viral. La sensibilidad y especificidad de los anticuerpos anti-TaLMV fue evaluada mediante pruebas de ELISA y dot-blot utilizando proteína recombinante y péptidos sintéticos como controles. La utilidad de estos anticuerpos fue validada a partir de una prueba piloto de detección de TaLMV en muestras de plantas de tomate de árbol con y sin síntomas de virosis obtenidas en el oriente antioqueño. Los resultados serológicos fueron comparados con los niveles de detección que ofrece la técnica de RT-PCR con cebadores específicos para la cápside viral de TaLMV.In Colombia, yields of tamarillo are seriously affected by a complex viral disease known as virosis. This pathology was first reported in 1991 in the north of Antioquia and currently affects all tamarillo growing regions in the country. Recent works have demonstrated the association of two potyviruses (potyviridae with this disease: Potato virus Y (PVY and Tamarillo leaf malformation virus

  16. Fraccionamiento y estudio de subpoblaciones linfocitarias en distintos grupos de am??gdalas palatinas

    OpenAIRE

    S??nchez Rozas, Jos?? Antonio

    1989-01-01

    Se ha estudiado en linfocitos de am??gdala de distintos grupos cl??nicos de amigdalitis la expresi??n de una amplia bacteria de anticuerpos monoclonales y otros marcadores con la finalidad de investigar la existencia o no en am??gdalas de c??lulas inmaduras previrgenes y determinar la secuencia madurativa de diferenciaci??n en distintos grupos cl??nicos de am??gdala.

  17. Anticuerpos circulantes contra Influenza Aviar y Newcastle en zanates (Quiscalus mexicanus de la ciudad de Guatemala (Avian flu and Newcastle Antibodies in Great-tailed Grackles (Quiscalus mexicanus in Guatemala city.

    Directory of Open Access Journals (Sweden)

    Escobar, Luis E.

    2011-03-01

    Full Text Available ResumenAunque el zanate (Quiscalus mexicanus está distribuido en todaGuatemala y se encuentra estrechamente ligado a poblaciones humanas,se sabe muy poco acerca de su estado sanitario y su papel comoreservorio de enfermedades aviares de importancia. Esta investigacióngenera información sobre el papel del zanate en la epizootiología de la Influenza Aviar (IA; Orthomyxoviridae y de Newcastle (ENC;Paramixoviridae, midiendo los anticuerpos circulantes en zanates norelacionados a granjas avícolas. Se colectaron 71 muestras de suero dezanates urbanos asintomáticos del la ciudad de Guatemala entre abril yjulio de 2008 y se analizaron con la prueba de Inhibición de laHemoaglutinación.SummaryDespite the Great-tailed Grackle (Quiscalus mexicanus is distributed in all Guatemala and it is so close to human populations, few is knownabout its sanitarian status and role as reservoir of important aviandiseases. This research provides information about the role of the Greattailed Grackle in the epizootiology of Avian Influenza (AI;Orthomyxoviridae and Newcastle Disease (NCD; Paramixoviridae,measuring the antibodies of Grackles non-related to avian farms. Wecollected 71 serum samples from urban Great-tailed Grackles without any symptoms in Guatemala City from April to June of 2008, and analyzed with hemagglutination Inhibition Test.

  18. Neospora caninum antibodies in dairy cattle of Lages Municipality, Santa Catarina State, Brazil Anticuerpos séricos contra Neospora caninum en rebaños lecheros de la ciudad de Lages, Estado de Santa Catarina, Brasil

    Directory of Open Access Journals (Sweden)

    AB Moura

    2012-01-01

    Full Text Available Bovines are the main intermediary host of the protozoan Neospora caninum, which is a major cause of bovine abortions and neonatal mortality worldwide. Sera were collected from 373 dairy cattle and 33 dogs on 19 dairy farms in Lages city, Santa Catarina State, Brazil, to determine the prevalence of N. caninum antibodies and risk factors. Tests for N. caninum antibodies were done using an indirect immunofluorescent antibody test (IFAT. Positive reactions with titers ≥ 1:200 (cattle and ≥ 1:50 (dogs were found in 86 (23.1% and seven (21.2% bovines and dogs, respectively. Of the bovines, four (1.1% were calves, 33 (8.8% were heifers, 314 (84.2% were lactating cows, 19 (5.1% were dry cows and three (0.8% were bulls. Infection was primarily found in animals with low milk production (P = 0.008. The presence of seropositive dogs on the properties did not affect the prevalence of bovine infection. No correlation between bovine reproductive disorders and the prevalence of N. caninum antibodies was observed. Our results showed that N. caninum infection is widespread among dairy cattle of Lages, Santa Catarina.Los bovinos son los principales hospederos intermediarios del coccidio Neospora caninum. En esta especie se concentran la mayoría de los daños reproductivos. A fin de determinar la prevalencia de N. caninum e identificar factores de riesgo para la infección en el ganado lechero de la ciudad de Lages, Estado de Santa Catarina, se tomaron muestras de sangre de bovinos (n = 373 y los perros (n = 33 en 19 propiedades. La detección de anticuerpos contra N. caninum fue realizada por medio de IFA. Fueron consideradas positivas las muestras con títulos ≥ 200 (ganado bovino y ≥ 50 (perros. Informaciones relacionadas con la categoría de los animales, la raza, la frecuencia y tipo de trastornos de la reproducción, la producción de leche y la presencia de los perros fueron obtenidos mediante un cuestionario. Los datos fueron analizados con la

  19. Eficacia experimental de anticuerpos IgY producidos en huevos, contra el veneno de la serpiente peruana Bothrops atrox Experimental efficacy of IgY antibodies produced in eggs against the venom of the Peruvian snake Bothrops atrox

    Directory of Open Access Journals (Sweden)

    Julio C. Mendoza

    2012-03-01

    Full Text Available Objetivos. Desarrollar un protocolo de inmunización para producir inmunoglobulinas IgY de origen aviar contra el veneno de la serpiente peruana Bothrops atrox y evaluar la capacidad neutralizante. Materiales y métodos. Se inmunizaron seis gallinas de postura de la raza hy line brown con 500 μg/dosis de veneno de B. atrox en un periodo de dos meses. Cada semana, los huevos fueron colectados para el aislamiento de inmunoglobulinas IgY a partir de la yema, usando dos pasos consecutivos con αcido caprνlico y sulfato de amonio. La detecciσn de anticuerpos se realizσ por inmunodifusiσn doble mientras que el tνtulo y reactividad cruzada se determinaron por las técnicas de ELISA y Western blot. El cálculo de DL50 y de la DE50 del antiveneno IgY producido se realizó utilizando el método de Probits. Resultados. La masa de anticuerpos aislados fue de 8,5 ± 1,35 mg de IgY/mL de yema. Asimismo, la DE50 del antiveneno aviar fue calculada en 575 μL de antiveneno/mg de veneno. Adicionalmente, los ensayos de reactividad cruzada mostraron que el veneno de B. atrox comparte mas epνtopes comunes con el veneno de B. brazili (47% que con otros veneno del mismo género, en tanto que los venenos de Lachesis muta (19% y Crotalus durissus (12% mostraron una baja reactividad cruzada. Conclusiones. Se ha obtenido IgY purificada contra el veneno de B. atrox con capacidad neutralizante y se ha demostrado su utilidad como herramienta inmunoanalítica para evaluar la reactividad cruzada con venenos de otras especies.Objectives. To develop an immunization protocol in order to produce avian IgY immunoglobulins against Bothrops atrox Peruvian snake venom and to evaluate its neutralizing capacity. Materials and methods. Six Hy Line Brown hens were immunized each two weeks using 500μg/doses of B. atrox venom in a period of two months. Each week, eggs were collected for IgY isolation from yolk using two consecutive steps with caprilic acid and ammonium sulfate

  20. Estudio del anticuerpo DOG1 en el diagnóstico de tumores del estroma gastrointestinal - GIST The role of the DOG1 antibody in the diagnosis of gastrointestinal stromal tumours - GIST

    Directory of Open Access Journals (Sweden)

    M.R. Mercado

    2011-08-01

    Full Text Available Los tumores del estroma gastrointestinal (GIST poseen mutaciones en los genes del receptor de la tirosín quinasa (RTKs KIT y PDGFRA. La posibilidad de bloquear esta actividad ha significado una nueva esperanza terapéutica. El diagnóstico de GIST recae en la expresión inmunohistoquímica del c-KIT, pero un 4-15% son c-KIT negativos (aún en presencia de mutación, y sin embargo estos pacientes podrían beneficiarse del tratamiento con inhibidores tirosín quinasa (TKIs. El DOG1 es un nuevo anticuerpo cuya sensibilidad y especificidad parece ser superior o igual a la del c-KIT. El objetivo de este trabajo es evaluar la sensibilidad (Se y especificidad (Sp de DOG1 en GIST de tipo usual (c-KIT positivos, de tipo inusual (c-KIT negativos y frente a otros tumores fusocelulares mesenquimales, y comparar la validez diagnóstica del DOG1 frente al c-KIT. Estudiamos 40 GIST, 39 c-KIT positivos y un c-KIT negativo. Se realizó un panel inmunohistoquímico con los anticuerpos: c-KIT, CD34, actina músculo liso, DOG1 y S100, en los GIST como en siete tumores fusocelulares. La Se y Sp de GIST para DOG1 fue del 100 y 97,5% para c-KIT. La inmunoreactividad para DOG1 en todos los tumores fusocelulares fue negativa. La validez diagnóstica de DOG1 y C-KIT fue similar a la hora de detectar GIST y no GIST. DOG1 es un marcador específico y sensible para el diagnóstico y diagnóstico diferencial de GISTs (es capaz de detectar algunos GIST sin mutación en RTK. El DOG1 debería de formar parte del panel inmunohistoquímico para el diagnóstico de GIST.Gatrointestinal stromal tumours (GIST harbour oncogenic mutations in tyrosin kynases receptors (RTKs including KIT and PDGFRA. The inhibition of this activity has been regarded as the primary target for the treatment of these patients. Diagnosis of GIST relies on c-KIT inmunoreactivity; however there is a 4-15% of GISTs that are C-KIT negative which may lead to underdiagnosis of GISTs and possible withholding of

  1. Efecto de la vacunación anti-leptospira en bovinos lecheros sobre la producción de anticuerpos anti-leptospira en trabajadores de lecherías de cuatro zonas de Costa Rica

    Directory of Open Access Journals (Sweden)

    Rafael González

    2007-07-01

    Full Text Available Objetivo: Este estudio experimental midió el efecto indirecto de la vacuna anti-Leptospira Leptoferm-5® (Pfizer® en la producción de anticuerpos anti-Leptospira en trabajadores de lecherías de cuatro zonas lecheras de Costa Rica. Materiales y Métodos: Tomaron parte en el estudio 171 vaqueros, 94 en el grupo tratamiento y 77 en el grupo control. A cada vaquero se le tomó una muestra sanguínea en tres diferentes momentos durante un año: la primera, antes de aplicar la vacuna en los animales, la segunda a los 6 meses y la tercera un año después de la primera vacunación. Se utilizó la técnica de micro aglutinación para la detección de anticuerpos anti-Leptospira interrogans serovares pomona, hardjo, canícola y grippotyphosa en el laboratorio del INCIENSA. Se utilizó la razón de prevalencias y el riesgo relativo para determinar si existió asociación entre la vacunación anti-Leptospira a las vacas y la seropositividad en los vaqueros. Resultados: En los tres muestreos se obtuvo un 10.27% (50/487 de muestras positivas a cualquiera de los serovares de Leptospira interrogans a los que fueron analizados. Tanto en el grupo tratamiento como en el control se observaron cambios en la seropositividad entre los distintos muestreos, con un aumento entre el primer y segundo muestreo (p Objective: This experimental study assessed the indirect effect of the anti-Leptospira vaccine Leptoferm-5® (Pfizer® regarding the production of anti-Leptospira antibodies in dairymen from four dairy areas in Costa Rica. Materials and Methods: 171 dairymen took part in the study; 94 in the treatment group and 77 in the control group. Three blood samples were taken from each worker three times throughout a year period: before the vaccination of the animals, and six and twelve months after the initial vaccination. The microscopic agglutination test (MAT was used to detect anti-Leptospira interrogans antibodies, specifically towards pomona, hardjo, canicola

  2. Prevalencia de anticuerpos anti-Leptospira spp. en personas con exposición laboral en el departamento del Tolima / Prevalence of anti-Leptospira spp. antibodies among people with occupational exposure in Tolima Department

    Directory of Open Access Journals (Sweden)

    Blanca L. Guzmán-Barragán

    2016-05-01

    Full Text Available Resumen Objetivo: estimar la prevalencia de anticuerpos IgM contra Leptospira spp., mediante el Ensayo de Inmunoabsorción Ligado a Enzimas (elisa, en la población de riesgo laboral de 8 municipios del Tolima. Metodología: se obtuvieron muestras de sangre de 261 empleados, las cuales fueron analizadas mediante la técnica de elisa para la detección de anticuerpos IgM anti-Leptospira spp., seguido de mat y serotipificación. Resultado: se estimó una seroprevalencia del 25,29%, con una seroreactividad mayor en trabajadores de plantas de beneficio animal (34,2%, recolección de residuos sólidos (27,1% y trabajadores de acueducto y alcantarillado (14,8%. La actividad en plantas de beneficio animal se identificó como factor de riesgo de Leptospira spp. (OR=1,86. Los serovares identificados fueron L. Bratislava (16, Ballum (5, Tarassovi (3, Hebdomadis (2, Sejroe (2 y Icterhemorragiae (1. El municipio de Libano presento el mayor porcentaje de positividad (36,96%, seguido de Espinal y Guamo con 28,57% cada uno. Discusión: la evaluación del sistema de vigilancia indicó deficiencia en recursos y debilidades de los profesionales de la salud al desconocer los procedimientos, investigación, diagnóstico y notificación de la enfermedad. Conclusiones: la leptospirosis está presente en poblaciones de riesgo laboral en el Tolima y se hace necesario abordar esta problemática en la población de otros municipios y los animales transmisores de la enfermedad. / Abstract Objective: to estimate the prevalence of IgM antibodies against Leptospira spp. Using the enzyme-linked immunosorbent assay (elisa in a population at occupational risk from 8 municipalities of the Tolima department, Colombia. Methodology: blood samples were collected from 261 employees and analyzed with the elisa technique to detect IgM and anti-Leptospira spp. antibodies. This was followed by mat and serotyping. Results: a seroprevalence of 25.29% was estimated, with higher

  3. Determinación de las condiciones de ensayo óptimas en un ELISA para la detección de anticuerpos séricos IgG anti-LPS de Pseudomonas aeruginosa O11

    Directory of Open Access Journals (Sweden)

    Tania Valmaseda

    2004-12-01

    Full Text Available La selección de sueros de donantes sanos para la obtención de una gamma hiperinmune contra la infección por Pseudomona aeruginosa, así como la evaluación de la respuesta inmunológica de cualquier candidato vacunal contra este microorganismo necesita contar en el laboratorio con técnicas estandarizadas. En este trabajo se realizaron los ensayos necesarios para el montaje y la optimización de un ELISA indirecto para la determinación de anticuerpos séricos de clase IgG anti- LPS de P. aeruginosa O11. Se evaluaron la concentración de recubrimiento, condiciones de bloqueo, dilución de trabajo de las muestras a evaluar y del conjugado con el fin de seleccionar en cada caso las mejores respuestas para el control positivo, el control negativo y el blanco del ensayo. Una concentración de 1,5 μg/mL de LPS O11 en PBS toda la noche a 4 °C como recubrimiento, la necesidad de no incluir un paso adicional de bloqueo y el conjugado humano anti IgG-HRP diluido 1:3000, 1 h a 37 °C resultaron las variables óptimas para el ensayo. Por otra parte, se estableció el rango lineal de la curva del control positivo y se seleccionó la dilución de trabajo 1:100 para las muestras de sueros a evaluar.

  4. Rabbit IgG antibodies against Phospholipase A2 from Crotalus durissus terrificus neutralize the lethal activity of the venom Los anticuerpos IgG de conejos anti-fosfolipasa A2 de Crotalus durissus terrificus neutralizan la actividad letal del veneno

    Directory of Open Access Journals (Sweden)

    Juan P. Rodríguez

    2006-12-01

    Full Text Available Crotalus durissus terrificus (C.d.t. (South American rattlesnake venom possesses myotoxic and neurotoxic activities, both of which are also expressed by crotoxin, the principal toxin of this venom. Crotoxin contains a basic phospholipase A2 (PLA2 and a non toxic acidic protein, crotapotin. We have produced and investigated the ability of IgG antibodies raised in rabbits against PLA2 to neutralize the lethality of the whole venom. PLA2 was isolated by gel filtration chromatography (Sephadex G-75. Specific antibodies were obtained by subcutaneous and intramuscular inoculation of PLA2 (700 µg with Freund adjuvant. Groups of six mice (20 + 2 g were inoculated with 0.5 ml i.p. of C. d. t. venom (4 µg or a mixture of venom that had been preincubated with the desired volume of IgG antibodies. Mortality, recorded 24 and 48 h after inoculation, showed that IgG anti-PLA2 were more effective than anticrotalic serum in neutralizing the lethal activity. These results demonstrate that it could be possible to obtain an anti-venom made by specific antibodies with a high level of protection against the lethal component of C.d.t. venom, and/or the inclusion of these antibodies as a supplement in heterologous anti-venoms.El veneno de Crotalus durissus terrificus (C.d.t. (Cascabel de Sud América posee actividad miotóxica y neurotóxica, actividades que también exhibe el complejo crotoxina, principal componente tóxico de este veneno. El complejo crotoxina está constituido por una fosfolipasa A2 básica (PLA2 y una proteína acídica no tóxica, el crotapotín. En este trabajo se estudió la capacidad neutralizante de anticuerpos IgG anti-PLA2 sobre la letalidad inducida por el veneno entero. El antígeno PLA2, fue aislado por cromatografía de filtración en gel (Sephadex G-75. Se inocularon conejos machos por vía subcutánea e intramuscular, con 700 µg de PLA2 y adyuvante para la obtención de anticuerpos específicos. La capacidad neutralizante del

  5. Soroprevalência de anticorpos contra vírus herpes simples 1-2 no Brasil Seroprevalencia de anticuerpos contra virus herpes simples 1-2 en Brasil Seroprevalence of herpes simplex 1-2 antibodies in Brazil

    Directory of Open Access Journals (Sweden)

    Sue Ann Costa Clemens

    2010-08-01

    Full Text Available OBJETIVO: Estimar a soroprevalência de anticorpos por vírus herpes simples (HSV-1 e HSV-2 e analisar fatores associados no Brasil. MÉTODOS: Estudo transversal realizado entre 1996 e 1997 em 1.090 indivíduos com idade entre um e 40 anos da população geral, em quatro diferentes regiões geográficas no Brasil. Foram analisadas amostras sangüíneas para detecção de anticorpos para HSV-1 e HSV-2 com teste tipo-específico Elisa. Foram descritas freqüências e proporções, comparadas entre grupos utilizando o teste de Fisher bilateral exato. Foi realizada análise de regressão logística para avaliar influência das variáveis sociodemográficas e histórico de DST, sobre a soroprevalência de HSV-1 e/ou HSV-2. RESULTADOS: As soroprevalências de anticorpos para HSV-1 e HSV-2, ajustadas por idade, foram 67,2% e 11,3% respectivamente, sem diferença quanto ao sexo e maiores na Região Norte. As soroprevalências aumentaram com a idade, e para HSV-2 o maior aumento ocorreu na adolescência e entre adultos jovens. Indivíduos soropositivos para HSV-1 apresentaram maior risco de serem positivos para HSV-2 (15,7% quando comparados com os negativos para HSV-1 (4,7%. Na análise multivariada, o histórico de DST aumentou significativamente (OR=3,2 a probabilidade de soropositividade para HSV-2. CONCLUSÕES: As soroprevalências para HSV-1 e para HSV-2 variam com a idade e entre as regiões do Brasil. História pregressa de DST é importante fator de risco para aquisição de infecção por HSV-2.OBJETIVO: Estimar la seroprevalencia de anticuerpos por virus herpes simples (HSV-1 y HSV-2 en diferentes áreas geográficas en Brasil y analizar factores asociados. MÉTODOS: Estudio transversal realizado entre 1996 y 1997 con individuos de la población en general en cuatro diferentes áreas geográficas en Brasil y estratificados por edad (de uno a 40 años y sexo, de los cuales 1.090 fueron incluidos en el análisis final. Fueron analizadas muestras

  6. Respuesta de anticuerpos inducidos por la vacuna antimeningocócica cubana VA-MENGOC-BC® frente a la cepa de Neisseria meningitidis B:4:P1.19,15 en adolescentes después de 12 años de inmunizados

    Directory of Open Access Journals (Sweden)

    María A. Camaraza

    2006-12-01

    Full Text Available Se estudió la respuesta de anticuerpos inducida por la vacuna antimeningocócica cubana VA-MENGOC-BC® contra la cepa de Neisseria meningitidis B:4:P1.19,15 mediante el Ensayo Bactericida del Suero (EBS y ELISA de tipo indirecto, para medir anticuerpos contra vesículas de membrana externa (VME de N. meningitidis B a 184 adolescentes de un politécnico de Ciego de Ávila que fueron inmunizados en campañas masivas 12 años antes. Se realizaron extracciones de sangre antes de aplicar la primera dosis (T0, 4 semanas después de ésta (T1 y 4 semanas después de la segunda dosis (T2. Transcurridos 12 años de esta vacunación el 42% de los adolescentes presentó títulos bactericidas ≥ 1:4 frente a la cepa homóloga (B:4:P1.19,15 y el 98% mostró anticuerpos detectables contra las VME. En el EBS; el porcentaje de seroconversión T1/T0 fue del 57% y T2/T0 del 60%. Mediante ELISA la seroconversión fue del 59% y 54%, respectivamente, por lo que se demostró que la aplicación de una sola dosis después de 12 años indujo una respuesta inmune importante que puede sugerir una respuesta anamnésica.

  7. Detección de anticuerpos IgA y PCR como primeras opciones en el diagnóstico de infección perinatal por el VIH-1 IgA antibody detection and PCR as first options in the diagnosis of perinatal HIV-1 infection

    OpenAIRE

    Ma del Carmen Basualdo; Kathya Moran; Patricia Alcántara; Elizabeth González; Esteban Puentes; Carmen Soler

    2004-01-01

    OBJETIVO: Evaluar la sensibilidad y especificidad de la reacción en cadena de la polimerasa y de las pruebas de ELISA e inmunoblot para anticuerpos IgA específicos, como únicos métodos en el diagnóstico de infección perinatal del VIH-1. MATERIAL Y MÉTODOS: Estudio de evaluación comparativa, efectuado entre febrero y octubre de 2001 en la Unidad de Investigación en Retrovirus Humanos de la Universidad Nacional Autónoma de México. Se incluyeron 90 muestras de niños infectados y 153 de no infect...

  8. Evaluación de la calidad de los reactivos que se utilizan en la tecnica de contrainmunoelectroforesis para la determinación de anticuerpos antirrábicos Evaluation of the quality of the reagents employed in the counterimmunoelectrophoresis technique for the determination of rabies antibodies

    Directory of Open Access Journals (Sweden)

    A. M. Díaz

    1991-02-01

    Full Text Available En este estudio se comprobó que el Instituto Butantan produce antígenos y sueros indicadores que se pueden utilizar con éxito en la prueba de contrainmunoelectroforesis para titular anticuerpos antirrábicos en personas inmunizadas. No se pudieron demostrar diferencias estadísticamente significativas entre los resultados de las pruebas de estandarización realizadas en el Instituto Butantan y las pruebas de control de referencia llevadas a cabo en el Centro Panamericano de Zoonosis. Se propone que el Instituto Butantan produzca y distribuya a nivel nacional los reactivos para que los laboratorios de diagnóstico apliquen la técnica de contrainmunoelectroforesis para la determinación de anticuerpos antirrábicos.This study demonstrated that the antigens and indicator sera produced by the Butantan Institute may be employed with success in the counterimmunoelectrophoresis technique for the titration of rabies antibodies in sera from immunized individuals. No statistically significant differences were demonstrated between the results obtained in the standardization tests carried out at the Butantan Institute and the reference control tests performed at the Pan American Zoonoses Center. It is proposed that the Butantan Institute be in charge of the production and distribution of these reagents at the national level.

  9. Prevalencia de anticuerpos contra Trypanosoma cruzi en donadores de sangre del IMSS, Orizaba, Veracruz, México Prevalence of antibodies against Trypanossoma cruzi in blood bank donors from the IMSS General Hospital in Onizaba, Veracruz, Mexico

    Directory of Open Access Journals (Sweden)

    Angel Ramos-Ligonio

    2006-02-01

    Full Text Available OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores del Hospital General Regional del Instituto Mexicano del Seguro Social (IMSS en la ciudad de Orizaba, Veracruz. MATERIAL Y MÉTODOS: Se examinaron muestras de donadores del banco de sangre del Hospital General Regional (HGRO del IMSS para la búsqueda de antiT. cruzi por ELISA, Western blot e IFI, utilizando una proteína recombinante (MBP::Hsp70 y un extracto crudo de epimastigotes. Las muestras fueron obtenidas entre los meses de octubre de 2001 a enero de 2002. RESULTADOS: Los 420 donadores de sangre analizados fueron seronegativos para HBV, HCV, BrA, VDRL y HIV. Después del tamizaje de los 420 donadores, se identificaron dos individuos seropositivos por las pruebas de ELISA, Western blot e IFI, con una seroprevalencia de 0.48%. CONCLUSIONES: En este estudio se muestran evidencias de seropositividad para T. cruzi en donadores de sangre del HGRO, lo que sugiere la existencia de riesgo de contaminación por transfusión sanguínea. Por tal motivo, es necesario aplicar programas para el tamizaje serológico a través de técnicas inmunológicas con alta sensibilidad y especificidad.OBJECTIVE: To estimate the prevalence of antibodies against Trypanosoma cruzi in blood donors from Hospital General Regional (HGRO of the Mexican Institute of Social Security (IMSS per its abbreviation in Spanish. MATERIAL AND METHODS: Between October 2001 and January 2002, blood samples were collected from voluntary donors at the blood bank of the Hospital General Regional of IMSS in Orizaba; Veracruz, Mexico. The samples were assayed for anti-T. cruzi by ELISA, Western blot and IFI, using a recombinant protein (MBP::Hsp70, and crude extract from epimastigotes. RESULTS: A total of 420 blood donors were studied; two of them were seropositive for ELISA, Western blot and IFI, with a seroprevalence of 0.48%. CONCLUSIONS: Some blood donors at the HGRO hospital were seropositive for T

  10. Hantavirus antibodies in rodents and human cases with pulmonary syndrome, Río Negro, Argentina Anticuerpos contra hantavirus en roedores y casos humanos con síndrome pulmonar, Río Negro, Argentina

    Directory of Open Access Journals (Sweden)

    Edmundo Larrieu

    2008-10-01

    Full Text Available In Río Negro Province, Argentina, human cases of hantavirus pulmonary syndrome (HPS appeared in the region of subantartic forests. The Andes virus (ANDV has been identified in the region both in Oligoryzomys longicaudatus rodents and in humans, with the main transmission being from rodents to humans but also showing the possibility of human to human transmission. Between 1996 and 2004, in 40 campaigns, 29.960 night-traps for capturing live rodents were set up. Blood samples were obtained from the rodents and processed using enzyme immunoassay with recombinant antigens made from ANDV. A total of 1767 rodents were captured, with a capture success of 5.9% and an antibody prevalence of 2.1%. Important differences were observed among the species captured from Andes and Steppe regions. Seropositive Oligoryzomys longicaudatus, Abrotrix olivaceus, Abrotrix xanhtothinus and Loxodontomus microtus were captured. During the 1993-2004 period, 40 HPS cases were registered.En la Provincia de Río Negro, Argentina, se presentaron casos humanos de síndrome pulmonar por hantavirus (SPH en la región de los bosques subantárticos. El virus Andes (AND fue identificado en la región, tanto en el roedor Oligoryzomys longicaudatus como en seres humanos, demostrándose la transmisión principalmente del roedor al hombre y la posibilidad de la transmisión de persona a persona. Para ello, se procedió a la colocación de 29.960 trampas para captura viva de roedores, tipo Sherman, en 40 operativos efectuados desde 1996 hasta 2004. Se obtuvieron muestras de sangre de los roedores, las que fueron procesadas mediante enzimoinmunoensayo con antígenos recombinantes elaborados a partir de virus AND. Fueron capturados 1767 roedores, con un éxito de trampeo del 5.9% y una prevalencia de anticuerpos contra hantavirus del 2.1%. Se observaron importantes diferencias en las especies capturadas en cada una de las regiones. Se capturaron O. longicaudatus, Abrothrix olivaceus y

  11. Neuromielitis óptica con alta expresión de acuaporina-4 y anticuerpos anti-acuaporina-4 positivos en suero Neuromyelitis optica with high aquaporin-4 expression and positive serum aquaporin-4 autoantibodies

    Directory of Open Access Journals (Sweden)

    Alejandra Báez

    2012-04-01

    Full Text Available La presencia de anticuerpos IgG en suero, con blanco en los canales de acuaporina-4, es específica de la neuromielitis óptica (NMO. El 60% de los pacientes con NMO presentan lesiones cerebrales en la resonancia magnética (RM; en un 8% (mayoría niños estas lesiones se consideraron "atípicas". Presentamos dos pacientes con NMO y lesiones en el SNC de alta expresión de acuaporina-4. Caso 1: varón de 50 años, que comenzó con pérdida de visión en ojo derecho (OD. Recibió tratamiento empírico con metilprednisolona 1 g/d x 3 días. Al mes presentó dolor generalizado y hemiparesia derecha; nuevamente recibió metilprednisolona 1 g/d x 5 días e IgG IV 400 mg/kg/d × 5 días. Recuperó la deambulación persistiendo el dolor y fenómenos paroxísticos en los 4 miembros. Potenciales evocados visuales: P100, ojo izquierdo (OI 123 mseg. OD sin respuesta. La RM de cerebro (FLAIR mostró hiperintensidad en nervio óptico derecho, hipotálamo y comisura blanca anterior. RM cervical: lesión medular extensa (5 cuerpos vertebrales. Caso 2: mujer de 53 años, con disminución de la agudeza visual en ambos ojos y parestesias en miembros inferiores que remitieron espontáneamente. Evolucionó al mes con cuadriparesia e incontinencia esfinteriana. Recibió metilprednisolona 1 g/d x 5 días, sin mejoría. Potenciales evocados visuales: P100 OI 124 mseg. OD 128 mseg. RM cerebro: (FLAIR hiperintensidad hipotalámica y periacueductal. RM cervical: lesión medular extensa (7 cuerpos vertebrales. Anticuerpos anti-acuaporina-4 positivos en ambos pacientes (inmunofluorescencia indirecta. Las lesiones consideradas "atípicas", como aquí, en sitios con alta densidad de proteínas canales de agua AQP4 deberán considerarse para el diagnóstico diferencial.Disease-specific aquaporin-4 antibodies (NMO-IgG are the main effector of lesions in neuromyelitis optica (NMO patients. Brain MRI lesions are detected in 60% of them, with 8% (almost infants at sites of high

  12. Obtención de un anticuerpo contra la proteína p65 del virus de la tristeza de los cítricos y resultados preliminares de la expresión in vivo Obtaining a citric tristeza virus p65 protein antibody and preliminary results of p65 in vivo expression

    Directory of Open Access Journals (Sweden)

    Acosta Orlando

    2003-12-01

    Full Text Available El virus de la tristeza de los cítricos (CTV pertenece a la familia Closteroviridae que incluye a los únicos virus vegetales que poseen en su genoma genes homólogos a las proteínas de choque térmico celulares HSP70. Recien­temente se ha demostrado que las proteínas virales HSP70h, como la p65 de CTV, realizan funciones para el ensam­blaje del virión, como proteína de unión a microtúbulos y de movimiento célula a célula. De allí la importancia de desarrollar trabajos relacionados con esta proteína en el CTV, considerado el patógeno más deletéreo para los cítricos. En el presente estudio, fueron utilizados cuatro péptidos sintéticos correspondientes a la región carboxi-terminal de la proteína de choque térmico p65 del virus de la tristeza de los cítricos (CTV, para inmunizar conejos con el objetivo de obtener anticuerpos policlonales. Todos los péptidos utilizados fueron inmunogénicos. Ninguno de los anticuerpos obtenidos reaccionó contra el extracto de plantas no infectadas pero sí detectaron las proteínas p65 presentes en los extractos proteicos de cítricos infectados con el CTV. Se demostró un comportamiento inmunológico del anticuerpo anti p65 que parece ser independiente de la severidad sintomática del aislado de CTV utilizado, sobre la base de la exposición del anticuerpo a dos aislados colombianos con características serológicas diferentes. Se demostró que el ORF que codifica en el CTV para el homólogo de la HSP70 se expresa in vivo aunque el anticuerpo anti p65 solamente detectó extractos proteicos concentrados de plantas infectadas, lo que apoya lo informado en otros estudios sobre la baja concentración de esta proteína en plantas infectadas con el CTV. Es la primera vez que se obtiene en Colombia un anticuerpo policlonal anti CTV y, particularmente, contra p65, proteína que interviene en el ensamblaje y movimiento viral. La adaptación de una técnica de obtención de anticuerpos anti p65 a

  13. Hallazgos de anticuerpos contra Leptospira sp., serovariedades Panama, Lai, Australis, Shermani y Patoc, en un grupo de monos rhesus (Macaca mulatta en condiciones de cautiverio Antibodies findings against Leptospira sp., of the serovars Panama, Lai, Australis, Shermani, and Patoc, in a group of rhesus monkeys (Macaca mulatta in conditions of captivity

    Directory of Open Access Journals (Sweden)

    A Ibáñez-Contreras

    2010-01-01

    Full Text Available La leptospirosis ha emergido como una importante enfermedad infecciosa, lo que ha ocurrido en diferentes entornos desde urbanos hasta medios naturales; los portadores son animales salvajes o domésticos. El objetivo fue evaluar la presencia de anticuerpos contra Leptospira en monos rhesus en condiciones de bioterio. Se utilizaron 59 monos de diferentes etapas fisiológicas. Se determinaron anticuerpos contra Leptospira a partir de la prueba de aglutinación microscópica (TAM, utilizando como antígenos 25 serovariedades de Leptospira. Se observó que de los 59 animales, únicamente el 30,50% reaccionaron contra una o más serovariedades de Leptospira. En este trabajo se determinaron anticuerpos contra cuatro serovariedades de Leptospira: Panama, Lai, Australis y Shermani, consideradas como patógenas, y once de las muestras reaccionaron contra la serovariedad Patoc, considerada no patógena y saprófita. Ninguno de los animales que resultaron positivos contra Leptospira presentó signos clínicos compatibles con leptospirosis.During the last decade leptospirosis has emerged as a worldwide and very important infectious disease, affecting different environments from urban to rural, with carriers usually being wild or domestic animals. The objective of this study was to evaluate the presence of antibodies against Leptospira in rhesus monkeys (Macaca mulatta in a Research Center. Fifty nine non-human primates of different physiological stages were studied. The animals were held in groups and in individual cages. Blood samples were obtained from the saphenous vein to determine the presence of antibodies through the microscopic agglutination test (MA, using twenty five serovars of Leptospira as antigens. It was observed that 18 out of the 59 monkeys (30.50% reacted against one or more serovars of Leptospira. In this study, antibodies of 4 serovars of Leptospira, (Panama, Lai, Australis, and Shermani were detected. All 4 serovars were considered

  14. Utilización de un anticuerpo monoclonal en el diagnóstico directo e indirecto del virus IPN en peces infectados experimentalmente Utilization of a monoclonal antibody in the diagnosis of infectious pancreatic necrosis virus in fish

    Directory of Open Access Journals (Sweden)

    F. CIFUENTES

    1999-01-01

    Full Text Available El virus de la necrosis pancreática infecciosa, virus IPN, es el agente causal de una enfermedad altamente contagiosa que afecta a peces salmonídeos jóvenes, éstos cuando sobreviven pueden convertirse en portadores que pueden transmitir la enfermedad. Para contribuir al diagnóstico rápido y efectivo del virus tanto en peces con la infección aguda, como en peces portadores, es que ensayamos la aplicación de un anticuerpo monoclonal en la detección del virus en animales infectados experimentalmente. Utilizamos alevines de truchas arcoiris (Oncorhynchus mykiss y de salmones coho (Oncorhynchus kisutch infectados con virus IPN aislado en Chile. Para detectar a los antígenos virales empleamos ensayos de ELISA inmunodot e inmunofluorescencia. Los resultados muestran que en los peces con la enfermedad aguda el virus se detecta aplicando directamente los inmunoensayos en extractos de peces enteros. En cambio, para detectar al virus en los peces portadores fue necesario incorporar un paso adicional para amplificar al virus en cultivos celulares. A pesar de lo cual, sin embargo, los métodos se optimizaron de manera que el procedimiento completo se realizó en menos de tres días para ELISA e inmunodot y menos de un día y medio para la inmunofluorescencia. Debido a que la técnica de inmunofluorescencia permite la identificación inequívoca de una o pocas células infectadas, es que ensayamos condiciones para diagnosticar al virus IPN desde improntas de peces portadores del virus. Demostramos que los antígenos virales pueden ser facilmente identificados por medio de la tinción directa de improntas de órganos de peces con el tamaño adecuadoThe infectious pancreatic necrosis virus, IPNV, is the etiological agent of a highly contagious disease that affects young salmon. If they survive, they become carriers and can transmit the disease. To contribute to the fast and effective diagnosis in fish with the acute infection, as well as of carrier

  15. A3 Altitude Test Facility

    Science.gov (United States)

    Dulreix, Lionel J.

    2009-01-01

    This slide presentation shows drawings, diagrams and photographs of the A3 Altitude Test Facility. It includes a review of the A3 Facility requirements, and drawings of the various sections of the facility including Engine Deck and Superstructure, Test Cell and Thrust Takeout, Structure and Altitude Support Systems, Chemical Steam generators, and the subscale diffuser. There are also pictures of the construction site, and the facility under construction. A Diagram of the A3 Steam system schematic is also shown

  16. Efectos adversos metabólicos y nutricionales asociados a la terapia biológica del cáncer

    OpenAIRE

    Sara Alonso Castellanos; María Soto Célix; Judith Alonso Galarreta; Ana del Riego Valledor; Alberto Miján de la Torre

    2014-01-01

    Introducción: Los diferentes tipos de cáncer constituyen una de las principales causas de morbi-mortalidad en el mundo. La terapia clásica antitumoral (cirugía, quimioterapia, radioterapia) ha incrementado notoriamente la supervivencia. Las terapias biológicas, con mecanismos de acción selectivos y frecuentemente específicos, constituyen una incorporación relativamente reciente al tratamiento oncológico; entre las más utilizadas se incluyen: citoquinas, anticuerpos monoclonales e inhibidores ...

  17. PRODUCCIÓN DE LA PROTEÍNA DE CHOQUE TÉRMICO HSC70 RECOMBINANTE EN Escherichia Coli BL21(DE3 PARA GENERAR ANTICUERPOS POLICLONALES PRODUCTION OF RECOMBINANT HEAT SHOCK PROTEIN HSC70 IN Escherinchia coli BL21(DE3 TO OBTAIN POLYCLONAL ANTIBODIES

    Directory of Open Access Journals (Sweden)

    Rocio Cely Castro

    2006-07-01

    Full Text Available Antecedentes. Los organismos vivos responden al estrés aumentando la síntesis de proteínas. El estrés por choque térmico ha sido el más estudiado y las proteínas que se inducen, se han denominado genéricamente como proteínas de choque térmico. Objetivo.En este trabajo se establecieron las condiciones óptimas de producción de la proteína HSC70, expresada en E.coli BL21 (DE3 y de los anticuerpos policlonales que permitan identificarla. Material y métodos. Mediante varios ensayos se establecieron las concentraciones óptimas del agente inductor isopropil- -D-thiogalacto­piranosido (PTG, del inóculo bacteriano, de empleo de los plásmidos de expresión pET-3a y pET-28a (+; y el método más eficiente para la recuperación de las formas soluble o insoluble de la proteína y de anticuerpos policlonales que la identifiquen. Resultados. Encontramos que el inóculo de cinco colonias con IPTG (2mM en tubos con cinco mililitros de medio modificado e incubadas por 24 horas a 37°C con agitación constante (200 r.p.m y tratamiento de sonicación, produce el mejor rendimiento de HSC70. La calidad de la proteína inducida se estableció mediante “Western blotting”. Conclusión. La proteína recombinante así obtenida permitió, generar anticuerpos policlonales que a su vez permiten detectar la proteína HSC70 natural en la membrana citoplasmática de diferentes células por inmunofluorescencia, en ELISA, en Western Blot y en pruebas de bloqueo de infección de rotavirus.Background. Live organisms respond against stressing conditions raising the production of stress proteins. The heat shock stress is a very well kwon condition that produces heat shock proteins. Objective. In this work we determined the optimum conditions to produce HSC70 protein in E. coli BL12 (DE3 under stress conditions, and the best way to obtain its polyclonal antibodies. Materials and methods. The best concen­trations for isopropyl- ß -D

  18. A3 TEST STAND CONSTRUCTION

    Science.gov (United States)

    2008-01-01

    THIS IMAGE SHOWS THE DEVELOPMENT AND CONSTRUCTION OF THE A3 TEST STAND IN SUPPORT OF THE ARES/CLV UPPER STAGE ENGINE AT STENNIS SPACE CENTER, MISSISSIPPI. THIS IMAGE IS EXTRACTED FROM A HIGH DEFINITION VIDEO FILE AND IS THE HIGHEST RESOLUTION AVAILABLE.

  19. A-3 steel work completed

    Science.gov (United States)

    2009-01-01

    Stennis Space Center engineers celebrated a key milestone in construction of the A-3 Test Stand on April 9 - completion of structural steel work. Workers with Lafayette (La.) Steel Erector Inc. placed the last structural steel beam atop the stand during a noon ceremony attended by more than 100 workers and guests.

  20. Encefalitis aguda mediada por anticuerpos contra el receptor ionotrópico de glutamato activado por N-metil-D-aspartato (NMDAR: análisis de once casos pediátricos en Argentina (Premio Benito Yelín

    Directory of Open Access Journals (Sweden)

    Elisa Pérez

    2013-09-01

    Full Text Available Las encefalitis son procesos inflamatorios de diverso origen, entre las cuales se incluyen las autoinmunes. La identificación de anticuerpos contra el receptor N-metil-D-aspartato permitió la caracterización clínico-inmunológica de una entidad susceptible a tratamiento inmunomodulador. Descripta originalmente en mujeres jóvenes, asociada a teratoma de ovario, es hoy una entidad reconocida en niños aun en ausencia de tumores detectables. El objetivo del trabajo, realizado a través de la revisión de historias clínicas, fue describir las características clínicas, evolutivas y los hallazgos en estudios complementarios de once niños con diagnóstico confirmado de esta entidad a través de la identificación de los anticuerpos específicos. Todos debutaron con síntomas psiquiátricos, en nueve de ellos asociando a convulsiones, y dos a movimientos extrapiramidales. En su evolución, todos presentaron compromiso del lenguaje, nueve, síntomas autonómicos graves, en uno con hipoventilación y requerimientos de ARM. La RM de cerebro fue anormal en tres. Ocho tuvieron EEG con asimetría del voltaje y/o amplitud, tres de ellos presentaron espigas. En el LCR seis tuvieron pleocitosis y tres de siete bandas oligoclonales positivas. Cinco, serologías IgM para micoplasma. El aumento de CPK en coincidencia con antipsicóticos ocurrió en cinco. Con el tratamiento inmunomodulador, cinco tuvieron recuperación total, tres, alteraciones conductuales/cognitivas y uno déficits severo. Un paciente resolvió su cuadro clínico sin tratamiento. En ninguno se detectó tumor asociado. Concluimos que frente a un niño con encefalopatía aguda y clínica compatible con esta entidad, una vez descartada causa infecciosa, se debe comenzar tratamiento inmunomodulador precozmente, evitar la utilización de fármacos antipsicóticos y realizar la búsqueda de posibles tumores ocultos.

  1. Marcadores inflamatórios e anticorpos anti-chlamydia em pacientes com síndrome metabólica Marcadores inflamatorios y anticuerpos anti-chlamydia en pacientes con síndrome metabólico Inflammatory markers and antichlamydial antibodies in patients with metabolic syndrome

    Directory of Open Access Journals (Sweden)

    Rosecler Riethmuller Franco

    2011-02-01

    ão mostraram diferença significativa em pacientes com SM, com e sem eventos.FUNDAMENTO: El síndrome metabólico está asociado al aumento de riesgo de eventos cardiovasculares. Marcadores inflamatorios y anticuerpos anti-Chlamydia han sido relacionados al desarrollo y a la progresión de la aterosclerosis y de los eventos cardiovasculares. OBJETIVO: Evaluar los marcadores inflamatorios interleucina-6 (IL-6 y factor de necrosis tumoral-alfa (TNF-α y los anticuerpos anti-Chlamydia pneumoniae en pacientes con síndrome metabólico (SM, con y sin eventos cardiovasculares. MÉTODOS: Estudio transversal constituido por 147 individuos. De estos, 100 (68% con SM y sin eventos cardiovasculares; y 47 (32% con SM y con eventos cardiovasculares. De los individuos que habían sufrido eventos cardiovasculares, 13 (6,11% presentan infarto agudo de miocardio (IAM, y diez (4,7%, accidente cerebro vascular (ACV. El diagnóstico del SM fue determinado por los criterios del NCEP-ATPIII. RESULTADOS: La media de edad de los sujetos con eventos cardiovasculares fue de 61,26 ± 8,5 y de 59,32 ± 9,9 en los individuos sin esos eventos (p=0,279, habiendo predominio del sexo femenino. El grupo con SM y sin evento presentó mayor peso, altura, IMC y circunferencia abdominal. Para los individuos con eventos cardiovasculares (p=0,001, los marcadores inflamatorios IL-6 y TNF-α y la enfermedad vascular periférica fueron significativamente mayores. Se obtuvieron niveles elevados de anticuerpos IgG para Chlamydia pneumoniae en el grupo SM, sin eventos y de IgA en el grupo con eventos cuando fueron comparados los dos grupos. Con relación al IAM y al ACV, los anticuerpos anti-Chlamydia pneumoniae no demostraron significación estadística, comparados al grupo sin eventos cardiovasculares. Asociación fue observada con el uso de estatinas, hipoglicemiantes orales, inyectables y antiinflamatorios no esteroides en el grupo con esos eventos. CONCLUSIÓN: Marcadores inflamatorios se encuentran

  2. Frecuencia de anticuerpos contra el virus C de la hepatitis en pacientes con cirrosis hepática en Yucatán, México Frequency of antibodies against the hepatitis C virus in patients with hepatic cirrhosis in Yucatan, Mexico

    Directory of Open Access Journals (Sweden)

    Renán A Góngora-Biachi

    2003-10-01

    Full Text Available OBJETIVO: En este estudio reportamos la prevalencia de anticuerpos contra el virus C de la hepatitis (Ac-VCH en un grupo de pacientes con cirrosis hepática (CH. MATERIAL Y MÉTODOS: Se hizo un estudio prospectivo, transversal y descriptivo, de marzo de 1998 a mayo de 1999. Se estudiaron a 153 pacientes (117 (76% hombres y 36 (24% mujeres con diagnóstico de CH, que eran atendidos en el Hospital General Agustín O' Horan y en el Centro de Investigaciones Regionales Doctor Hideyo Noguchi, en la ciudad de Mérida, Yucatán, México. Se aplicó un cuestionario con datos clínico-epidemiológicos y se determinó la presencia de Ac-VCH (ELISA de 2ª generación y RIBA-2 para confirmar el diagnóstico a cada paciente. Se determinó también el antígeno de superficie de la hepatitis B (AgsHB y anticuerpos contra el antígeno central de la hepatitis B (Anti-HBc mediante el método de ELISA. La presencia de Ac-VCH fue relacionada con las variables epidemiológicas de los sujetos. La prevalencia de anti-HCV y la frecuencia de características se compararon entre los pacientes positivos y negativos con las pruebas de c² y exacta de Fisher. RESULTADOS: El 32% de los pacientes con CH (35/117 (30% hombres y 14/36 (39% mujeres fueron positivos para los Ac-VCH. El alcoholismo estuvo presente en todos los hombres serorreactivos y en ninguna de las mujeres positivas (pOBJECTIVE: To report the prevalence of antibodies against the hepatitis C virus (anti-HCV in a group of patients with hepatic cirrhosis (HC. MATERIAL AND METHODS: A prospective transversal and descriptive study was carried out from March 1998 to May 1999. Study subjects were 153 patients; 117 (76% male and 36 (24% female, diagnosed with HC. They were attended at the General Hospital Agustín O' Horan and at Regional Research Center Doctor Hideyo Noguchi, in Merida, Yucatan, Mexico. A clinical-epidemiologic questionnaire completed by interview was used for data collection. Anti-HCV were detected

  3. Factores bióticos y abióticos que determinan la seroprevalencia de anticuerpos contra Trypanosoma Cruzi en el municipio de Palmar de Bravo, Puebla, México Biotic and abiotic determinants of seroprevalence of antibodies against Trypanosoma cruzi in Palmar de Bravo, Puebla, Mexico

    Directory of Open Access Journals (Sweden)

    Francisca Sosa-Jurado

    2004-02-01

    Full Text Available OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi y su relación con los factores bióticos y abióticos en Palmar de Bravo, Puebla, México. MATERIAL Y MÉTODOS: Estudio transversal efectuado en agosto de 2000 a septiembre de 2001, con una muestra aleatoria simple de 390 voluntarios residentes en Palmar de Bravo, Puebla, México. Se hizo determinación de anticuerpos contra T cruzi con técnicas serológicas validadas, búsqueda del vector y de reservorios domésticos, así como determinación de asociación entre caso positivo y factores de riesgo bióticos y abióticos. El análisis estadístico consistió en índice Kappa para las pruebas diagnósticas, empleando tabla de contingencia de 2 x 2; ji cuadrada corregida de Yates, exacta de Fisher y la razón de posibilidad para estimar la significancia de la asociación de factores bióticos y abióticos. RESULTADOS: La seroprevalencia fue de 4% en la población humana estudiada y de los reservorios (equinos, porcinos y caninos, sólo 10% de los caninos resultaron reactivos. Los vectores identificados fueron T barberi y T pallidipennis, con índice de dispersión e índice de colonización de 55 y 40%, respectivamente. Los factores de riesgo más importantes fueron la altitud (>2 150 y OBJECTIVE: To establish the relationship between seroprevalence for antibodies against Trypanosoma cruzi and its relationship with biotic and abiotic factors. MATERIAL AND METHODS: A cross-sectional study was conducted between August 2000 and September 2001. The study population consisted of a simple random sample of 390 volunteers residing in Palmar de Bravo, Puebla, Mexico. Sample and data collection procedures included assaying antibodies against T cruzi with validated assays, and searching for domestic reservoirs and triatomine bugs. The relationship between biotic and abiotic factors with seropositivity was assessed. Statistical analysis was conducted using Kappa values for

  4. Anticuerpos antinucleares, imágenes y características obtenidas por inmunofluorescencia: Importancia de los isotipos IgA, IgM e IgG Antinuclear antibodies, patterns and characteristics obtained by immunofluorescence: The importance of the IgA, IgM and IgG isotypes

    Directory of Open Access Journals (Sweden)

    Miriam Arcavi

    2009-10-01

    Full Text Available La técnica de elección para el screening de anticuerpos antinucleares (ANA es la inmunofluorescencia indirecta que utiliza como sustrato una línea de células epiteliales de carcinoma de laringe humano (IFI-HEp2, y como antisuero, anti-IgG o anti-Ig totales. Los ANA-IgG son los más importantes para el diagnóstico y monitoreo de las enfermedades del tejido conectivo (ETC, mientras los ANA-IgM son de menor relevancia clínica en estos pacientes. Sin embargo, poco se sabe de los ANA-IgA ya que estos Ac han sido menos investigados. El objetivo de este trabajo fue estudiar la prevalencia de los diferentes isotipos de inmunoglobulinas de anticuerpos antinucleares en los pacientes con ETC y evaluar la conveniencia de utilizar conjugados monovalentes o polivalentes. Se procesaron 100 sueros de pacientes con diversas ETC empleando IFI-HEp2, en los cuales se detectó 38% de ANA-IgA (títulos ≥ 1:80 y 12% de ANA-IgM (títulos ≤ 1:160. En 29 casos se detectó IgA en ausencia de IgM, en 3 casos IgM en ausencia de IgA. En todos los casos los ANA-IgG estuvieron presentes. En 6 sueros se observó un cambio de imagen con conjugado anti-IgA y en 3 con conjugado anti-IgM. Debido a la alta prevalencia de ANA-IgA detectada por IFI-HEp2, se destaca la conveniencia de utilizar conjugado anti-Ig totales en lugar de anti-IgG, mientras se desconozca la relevancia de los ANA-IgA en el diagnóstico, pronóstico y seguimiento de las enfermedades reumáticas sistémicas.The indirect immunofluorescence with epitelial cell line from human laryngeal carcinoma as substrate (IIF-HEp2 and anti-IgG or anti-total Ig as antisera, is the technique currently used for the detection of antinuclear antibodies. The most important antibodies for the diagnosis and follow-up of connective tissue diseases (CTD are the IgG-ANA, while the IgM-ANA have no clinical relevance. However the IgA-ANA have not been thoroughly investigated so far. The aim of this work was to study the prevalence

  5. 15 CFR 4a.3 - Classification levels.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Classification levels. 4a.3 Section 4a.3 Commerce and Foreign Trade Office of the Secretary of Commerce CLASSIFICATION, DECLASSIFICATION, AND PUBLIC AVAILABILITY OF NATIONAL SECURITY INFORMATION § 4a.3 Classification levels. Information...

  6. 42 CFR 2a.3 - Application; coordination.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Application; coordination. 2a.3 Section 2a.3 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS PROTECTION OF IDENTITY-RESEARCH SUBJECTS § 2a.3 Application; coordination. (a) Any person engaged in (or who intends...

  7. 32 CFR 242a.3 - Open meetings.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Open meetings. 242a.3 Section 242a.3 National... PUBLIC MEETING PROCEDURES OF THE BOARD OF REGENTS, UNIFORMED SERVICES UNIVERSITY OF THE HEALTH SCIENCES § 242a.3 Open meetings. (a) Members shall not jointly conduct or dispose of business of the Board...

  8. Estudio del genoma y del transcriptoma en las fases evolutivas de las gammapatías monoclonales

    OpenAIRE

    López Corral, Lucía

    2013-01-01

    [ES] Los estudios epidemiológicos han demostrado que la práctica totalidad de los mielomas múltiples están precedidos por una fase premaligna. En este sentido, la gammapatía monoclonal de significado incierto (GMSI) y el mieloma múltiple quiescente (MMQ) se consideran entidades premalignas y asintomáticas que difieren de forma significativa en la tasa de progresión a MM sintomático. A pesar de su comportamiento clínico radicalmente distinto, las tres entidades comparten aparentemente la misma...

  9. Auto-anticorpos anti-β2-glicoproteína I e síndrome metabólica Anticuerpos anti-β2-glicoproteína I y síndrome metabólico Anti-beta2-glycoprotein I autoantibodies and metabolic syndrome

    Directory of Open Access Journals (Sweden)

    Rodrigo B. Krás Borges

    2011-04-01

    Full Text Available FUNDAMENTO: A síndrome metabólica (SM é uma entidade pró-aterogênica. Autoanticorpos tais como β2-glicoproteína I (β2-gpI podem influenciar o aparecimento de ateromas. Estudos anteriores confirmaram uma associação entre anticorpos IgA anti-β2-gpI e isquemia cerebral, infarto do miocárdio, doença arterial periférica e doença da carótida. OBJETIVO: O objetivo desse estudo de caso-controle foi avaliar uma possível associação entre anticorpos anti-β2-gpI e anticardiolipina (aCL com SM não-complicada. MÉTODOS: Pacientes com SM sem histórico de eventos vasculares e indivíduos-controle, consistindo em pacientes da Enfermaria de Ortopedia admitidos devido a doenças musculoesqueléticas foram incluídos no estudo. Idade, sexo, etnia, histórico de hipertensão, tabagismo, hipercolesterolemia e diabetes mellitus foram avaliados como fatores de risco em ambos os grupos. Anticorpos IgG, IgM, e IgA anti-β2-gpI e aCL foram detectados através de imunoensaios enzimáticos. RESULTADOS: Um total de 68 pacientes com SM e 82 controles foram estudados. Os pacientes com SM tinham média de idade superior à dos controles (P = 0,001, enquanto homens (P = 0,003; OR 0,31; IC95%: 0,15-0,16 e etnia caucasiana (P = 0,004; OR 0,25; IC95%:0,10-0,60 eram predominantes nos controles. Histórico de hipertensão, hipercolesterolemia e diabetes mellitus foi mais prevalente nos pacientes com SM do que nos controles (P FUNDAMENTO: El síndrome metabólico (SM es una entidad pro-aterogénica. Autoanticuerpos tales como β2-glicoproteína I (β2-GPI pueden influir en la aparición de ateromas. Estudios previos han confirmado una asociación entre anticuerpos IgA anti-β2-GPI y la isquemia cerebral, infarto de miocardio, enfermedad arterial periférica y enfermedad carotidea. OBJETIVO: El objetivo de este estudio de caso-control fue evaluar una posible asociación entre los anticuerpos anti-β2-GPI y anticardiolipina (aCL con SM complicada. MÉTODOS: Se

  10. Obtención de un conjugado anti IgG de ratón - FITC mediante la tecnología IgY para uso como anticuerpo secundario en la detección de antígenos de superficie celular

    Directory of Open Access Journals (Sweden)

    Esteban J. Gutiérrez Calzado

    2007-01-01

    Full Text Available Desde el año 1996, el Centro Europeo para la Validación de Métodos Alternativos recomendó el uso de la IgY como sustituto de la IgG de mamíferos con el objetivo de reducir al mínimo las situaciones de daño que se les causa a los animales que se someten a la producción de anticuerpos (Acs. En 1999, la tecnología IgY se aprobó por la Oficina Federal Veterinaria del gobierno suizo como un método alternativo para sustentar el cuidado y bienestar de los animales. Muchas de las publicaciones relacionadas con IgY demuestran las características desde el punto de vista bioquímico de esta inmunoglobulina que la hace tomar ventajas sobre la IgG, entre las que refiere que los complejos inmunes que contienen Acs aviares, no pueden interactuar con los receptores Fc o del complemento sobre las células, por lo que el reemplazamiento de los Acs de mamíferos por sus similares en gallinas pudieran evitar interferencias en muchos ensayos diagnósticos. Este conocimiento ha sido la base objetiva de este trabajo que consistió en la obtención de Acs IgY anti IgG de ratón con elevado grado de pureza, los que fueron conjugados por unión covalente vía grupos amino primarios libres al isotiocianato de fluoresceína (FITC. Estos conjugados mostraron poseer una razón molar FITC/proteína en intervalos reportados para un buen desempeño. La dilución óptima de trabajo obtenida para ellos fue muy adecuada y demostró su utilidad como Acs secundarios en el conteo de antígenos de superficie celular linfocitario humano por sus resultados comparables con los reactivos similares de origen mamífero ensayados en paralelo.

  11. Desarrollo de un Sistema ELISA para cuantificar IgG de ratón tomando como base la tecnología IgY

    Directory of Open Access Journals (Sweden)

    Esteban J. Gutiérrez Calzado

    2007-01-01

    Full Text Available Se conoce que desde 1893, se había descrito un experimento en el que se demostraba que en el proceso de inmunización de gallinas, el resultado consistía en la transferencia de anticuerpos específicos hacia la yema de sus huevos. Tomando como base este conocimiento, este trabajo se enfocó en demostrar que los anticuerpos de yema de huevo obtenidos a partir de gallinas inmunizadas con una preparación comercial de IgG de ratón pueden constituir una alternativa a sus similares en mamíferos al conjugarse con la enzima peroxidasa y utilizarse como reactivos en técnicas ELISA para la determinación de anticuerpos monoclonales murinos del tipo IgG. Para esto, se desarrollaron esquemas de inmunización en paralelo en gallinas y conejos a los que se les aplicaron diversas dosis del antígeno (IgG de ratón demostrándose que las gallinas son capaces de brindar títulos de anticuerpos aunque menores que en el conejo, sí razonables en sus yemas de huevo contra este antígeno, útiles para procesos posteriores. Se demuestra que el método del m-peryodato de sodio es aplicable a los anticuerpos de yema de huevo (IgY para conjugarlos a la enzima peroxidasa para su uso exitoso en inmunoensayos como el ELISA. El Sistema ELISA desarrollado sobre la base de los anticuerpos IgY mostró en su desempeño algunas ventajas a su similar desarrollado con conjugado de anticuerpos de mamíferos. Este trabajo demuestra que la obtención de anticuerpos IgY en este caso, es una fórmula que reduce los costos de producción de conjugados enzimáticos al menos tres veces, lo que conjuntamente con los elementos bioéticos la convierte en una vía atractiva para complementar los procesos tradicionales de producción de anticuerpos.

  12. A3 Subscale Diffuser Test Article Design

    Science.gov (United States)

    Saunders, G. P.

    2009-01-01

    This paper gives a detailed description of the design of the A3 Subscale Diffuser Test (SDT) Article Design. The subscale diffuser is a geometrically accurate scale model of the A3 altitude rocket facility. It was designed and built to support the SDT risk mitigation project located at the E3 facility at Stennis Space Center, MS (SSC) supporting the design and construction of the A3 facility at SSC. The subscale test article is outfitted with a large array of instrumentation to support the design verification of the A3 facility. The mechanical design of the subscale diffuser and test instrumentation are described here

  13. Prevalencia de anticuerpos antitreponémicos y características sociodemográficas de la población mexicana adulta en el año 2000 Anti-Treponema pallidum seroprevalence and sociodemographic characteristics in Mexican adult population, 2000

    Directory of Open Access Journals (Sweden)

    Carlos J Conde-González

    2007-01-01

    Full Text Available OBJETIVO: Determinar la frecuencia de anticuerpos antitreponémicos en mexicanos adultos de ambos sexos y las características de la población relacionadas con la infección sifilítica. MATERIAL Y MÉTODOS: Se analizaron para anti-Treponema pallidum 12 010 sueros seleccionados de forma aleatoria de la Encuesta Nacional de Salud 2000, con aplicación de un algoritmo conformado por técnicas serológicas treponémicas y no treponémicas, de tamizaje y confirmatorias, y se realizó un análisis estadístico para identificar los factores vinculados con la seropositividad. RESULTADOS: La seroprevalencia de anticuerpos antitreponémicos fue de 3.1% (IC95% 2.5-3.7. Las características relacionadas de modo significativo con la exposición a la infección fueron la mayor edad (RM 3.3, sexo masculino (RM 1.3, residencia en la región geográfica sur del país (RM 1.7, vivir en unión libre (RM 2.7 o ser viudo (RM 1.8, inicio de relaciones sexuales a edad temprana (RM 6.3 y, en las mujeres en particular, se identificó el antecedente de mortinatos (RM 1.8 y el informe de falta de uso del condón como método anticonceptivo (RM 14.1. CONCLUSIONES: Los hallazgos del estudio demuestran que la magnitud del antecedente de la infección por el treponema en la población mexicana adulta es considerablemente mayor respecto del que permite calcular la notificación oficial de casos de la enfermedad. Como sucede con otras infecciones de transmisión sexual, aspectos sociodemográficos, de género y las prácticas sexuales no seguras incrementan la transmisión del agente etiológico. En México existe la necesidad de reforzar la vigilancia de la infección sifilítica a través de un diagnóstico oportuno y eficaz de los casos, más su adecuado tratamiento, para coadyuvar al control del padecimiento.OBJECTIVE: To measure for the first time in a population based study the prevalence of antibodies against Treponema pallidum among the Mexican adult population and

  14. Pesquisa de anticuerpos seroneutralizantes para pestivirus y herpesvirus en ovinos, caprinos y camélidos sudamericanos de Chile Survey for antibodies to pestivirus and herpesvirus in sheep, goats, alpacas (Lama pacos, llamas (Lama glama guanacos (Lama guanicoe and vicuña (Vicugna vicugna from Chile

    Directory of Open Access Journals (Sweden)

    M Celedón

    2001-01-01

    Full Text Available Se investigó la presencia de anticuerpos por dilución punto final seroneutralizante (DPFSN para pestivirus (cepa NADL del virus de la diarrea viral bovina y para herpesvirus (cepa Los Angeles del virus herpes bovino 1, en muestras de sueros de 321 ovinos, 322 caprinos, 74 alpacas (Lama pacos , 43 llamas (Lama glama , 48 guanacos (Lama guanicoe y 34 vicuñas (Vicugna vicugna , procedentes de diferentes regiones del país. Para pestivirus se detectó reacción serológica positiva en 60 (18,7% ovinos, en 21 (6,5% caprinos, en 8 (10,8% alpacas y en 6 (14% llamas. Los guanacos y vicuñas fueron seronegativos para pestivirus. Para herpesvirus, la seropositividad se obtuvo en 8 (2,5% ovinos y 62 (19,3% caprinos. No se detectaron anticuerpos para herpesvirus en las muestras de camélidos. Según la distribución geográfica los mayores porcentajes de positividad resultaron ser: para pestivirus en ovinos de 2/3 predios de la XII Región (con positividad de 66,7% y 82,1%, con rangos de títulos de 16 a 710 y, para herpesvirus en caprinos de 5/6 predios de la IV Región (con positividad de 4,2%, 13,3%, 28,6%, 61,5% y 66,7%, con rango de títulos de 2 a 45. Las alpacas y llamas serorreaccionantes a pestivirus se encontraban ubicadas en la Región Metropolitana, en confinamiento en conjunto con otras especies de rumiantes, en cambio que las especies silvestres, guanacos y vicuñas fueron muestreadas en sus lugares de origen. Se confirma que en Chile existe infección por pestivirus en ovinos, caprinos, llamas y alpacas y por herpesvirus en ovinos y caprinosMicrotitration serum virus-neutralization tests were used to determine antibody titres for pestivirus: bovine viral diarrhea virus (NADL strain and herpesvirus: bovine herpes virus 1 (Los Angeles strain in 321 sheep, 322 goats, 74 alpacas (Lama pacos , 43 llamas (Lama glama , 48 guanacos (Lama guanicoe and 34 vicuñas (Vicugna vicugna , from several Regions of Chile. Antibodies to pestivirus were found

  15. Prevalencia de anticuerpos contra virus dengue en el cantón de Golfito (2005 y en el Distrito Central de Puntarenas (2005-2006, Costa Rica Dengue seroprevalence in Golfito and the central district of Puntarenas, Costa Rica 2005-2006

    Directory of Open Access Journals (Sweden)

    Margarita Lee-Lui

    2008-09-01

    Full Text Available Justificación y objetivo: La primo infección con el virus dengue varía desde asintomática hasta cuadros muy severos, como el dengue hemorrágico o el síndrome de choque por dengue. El Distrito Primero de Puntarenas ha sido una de las poblaciones más afectadas desde 1993, cuando aparecieron los primeros brotes, hasta hoy, con una disminución de la incidencia en los últimos años. La región Brunca fue la segunda en incidencia en el país en 1998, y si bien la endemicidad se ha mantenido, no existen estudios epidemiológicos sobre la prevalencia de esta enfermedad; los datos que aporta el Ministerio de Salud corresponden a la incidencia de casos clínicos en un período determinado. El objetivo de este estudio fue determinar la seroprevalencia en el Distrito Primero de Puntarenas y en Golfito para conocer la vulnerabilidad de la población de sufrir fiebre hemorrágica por dengue y analizar la situación asociada a los datos epidemiológicos de estas regiones, tales como edad, sexo y ubicación geográfica, ya que una población susceptible es la que presenta una alta seroprevalencia, unida a condiciones de hacinamiento y alta densidad vectorial. Métodos: El muestreo se realizó con el método EPI descrito por la OMS. Se recolectaron 210 muestras de suero en cada distrito, se desarrolló y estandarizó una prueba de ELISA de captura de antígeno para la detección de anticuerpos tipo IgG contra dengue, usando como referencia el método de reducción de placas de Dulbecco considerado estándar de oro. Resultados: La seroprevalencia contra dengue fue del 43.8% (92 y del 90% (189 en los distritos de Golfito y Central de Puntarenas, respectivamente, sin diferencias significativas respecto al sexo, la edad y la localidad. Se obtuvo un 83% y un 95% de correlación en Golfito y Puntarenas, respectivamente, entre los casos sintomáticos y la serología con el método estandarizado. Un 32% y un 42% del total de seropositivos en cada localidad

  16. 38 CFR 8a.3 - Effective date.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Effective date. 8a.3... INSURANCE § 8a.3 Effective date. (a) Where the grant was approved prior to August 11, 1971, VMLI shall be effective August 11, 1971, if on that date, the eligible veteran was obligated under a mortgage loan,...

  17. On The Structure of A=3 Nuclei

    CERN Document Server

    Abbas, Syed Afsar

    2011-01-01

    The hole in the charge distribution of $^3{\\text He}$ is a major problem in A=3 nuclei. The canonical wavefucntion of A=3 nuclei which does well for electromagnetic properties of A=3 nuclei fails to produce the hole in A=3 nuclei. The hole is normally assumed to arise from explicit quark degree of freedom. Very often quark degrees of freedom are imposed to propose a different short range part of the wavefunction for A=3 to explain the hole in $^3{\\text He}$. So an hybrid model with nucleonic degree of freedom in outer part and quark degrees of freedom in the inner part of the nucleus have been invoked to understand the above problem. Here we present a different picture with a new wavefunction working at short range within nucleonic degrees of freedom itself. So the above problem is explained here based entirely on the nucleonic degree of freedom only.

  18. Steel erected at A-3 Test Stand

    Science.gov (United States)

    2008-01-01

    Workers erect the first fabricated steel girders to arrive at the A-3 Test Stand at Stennis Space Center. Steel work began at the construction site Oct. 29 and is scheduled to continue into next spring.

  19. Detección de anticuerpos para BVDV y BoHV-1 en llamas de la región de Tandil - Provincia de Buenos Aires Detection of antibodies to BVDV and BoHV-1 in llamas from Tandil - Province of Buenos Aires

    Directory of Open Access Journals (Sweden)

    P.E. Morán

    2010-12-01

    Full Text Available La llama (Lama glama es la especie predominante de camélidos sudamericanos de la República Argentina, con una población aproximada de 200.000 animales. El aumento de la actividad productiva ha incrementado el transporte y la distribución de animales hacia diferentes regiones del país. Como consecuencia, estas especies interactúan con el ganado doméstico posibilitando la diseminación de agentes infecciosos propios y comunes entre especies. Considerando que los camélidos sudamericanos son susceptibles a la infección con pestivirus y herpesvirus, se planteó realizar un relevamiento serológico de anticuerpos neutralizantes para el virus de la diarrea viral bovina (BVDV y el herpesvirus bovino 1 (BoHV-1. Se analizaron 49 animales de dos rebaños de llamas de la región de Tandil mediante la técnica de seroneutralización sobre cultivos celulares de la línea Madin Darby Bovine Kidney. El 22% (11/49 de los animales expresaron seropositividad a BoHV-1, mientras que el 2% (1/49 fue positivo a BVDV. Estos resultados sugieren circulación viral en la población analizada. Es necesario el monitoreo continuo en las poblaciones de estos rumiantes para identificar factores de riesgo involucrados en la epidemiología de estos agentes virales, considerando los potenciales efectos sobre los programas de control y erradicación.Llama (Lama glama is the predominant species of South American camelids in Argentine Republic, with an estimated population of 200.000 animals. The increasing of productive activity raised the animals transport and distribution to different regions of the country. As a result, the direct contact of these species with cattle increase opportunities for spreading own and common infectious agents among species. Considering that American camelids are susceptible to pestivirus and herpesvirus infections, it was proposed to carry out a serological searching of neutralizing antibodies to bovine viral diarrhea (BVDV and bovine

  20. Detección de anticuerpos IgA y PCR como primeras opciones en el diagnóstico de infección perinatal por el VIH-1 IgA antibody detection and PCR as first options in the diagnosis of perinatal HIV-1 infection

    Directory of Open Access Journals (Sweden)

    Ma del Carmen Basualdo

    2004-02-01

    Full Text Available OBJETIVO: Evaluar la sensibilidad y especificidad de la reacción en cadena de la polimerasa y de las pruebas de ELISA e inmunoblot para anticuerpos IgA específicos, como únicos métodos en el diagnóstico de infección perinatal del VIH-1. MATERIAL Y MÉTODOS: Estudio de evaluación comparativa, efectuado entre febrero y octubre de 2001 en la Unidad de Investigación en Retrovirus Humanos de la Universidad Nacional Autónoma de México. Se incluyeron 90 muestras de niños infectados y 153 de no infectados. El cultivo viral fue la prueba de referencia. Se estandarizaron ensayos de ELISA e inmunoblot y la reacción en cadena de la polimerasa para una región conservada del gen gag. Se analizaron los resultados utilizando el paquete informático SPSS 10.0. RESULTADOS: La sensibilidad y especificidad de la prueba de ELISA fueron 61.1 y 90.8%, respectivamente. En el inmunoblot encontramos 82.2 y 95.4%, respectivamente, en tanto que la reacción en cadena de la polimerasa demostró tener sensibilidad de 98.3% y especificidad de 100% con sólo un falso negativo. CONCLUSIONES: Los resultados indican que la realización simultánea de la reacción en cadena de la polimerasa y el inmunoblot para IgA logran sensibilidad y especificidad de 100% y 96%, respectivamente, por lo cual se consideran útiles para el diagnóstico perinatal de VIH-1.OBJECTIVE: To evaluate the sensitivity and specificity of the polymerase chain reaction (PCR, enzyme-linked immunosorbent assay (ELISA and IgA-specific immunoblot assays as ancillary methods to diagnose human immunodeficiency virus (HIV-1 perinatal infection. MATERIAL AND METHODS: A comparative study was conducted between February and October 2001 at the Human Retrovirus Research Unit of Mexico's National University. Ninety infected and 153 non-infected children were included in the study. Viral cultures were the gold standard tests. Standardized PCR for a conserved region of the gag gene and HIV-specific IgA antibody

  1. Indicación de la determinación de los anticuerpos para los virus de la hepatitis C y de la hepatitis A en los protocolos de atención a los niños inmigrantes Indication of determination of antibodies against hepatitis C and A viruses in the protocol for the care of young immigrants

    Directory of Open Access Journals (Sweden)

    Rosa M. Masvidal Aliberch

    2010-08-01

    Full Text Available Objetivo: Valorar la determinación sistemática de los anticuerpos para el virus de la hepatitis C (Ac. VHC y para el virus de la hepatitis A (Ac. VHA dentro de los protocolo de atención a niños inmigrantes (PANI. Métodos: Estudio descriptivo, transversal y multicéntrico. Se determinaron los Ac. VHC y Ac.VHA, en niños de 6 meses a 15 años procedentes de países de baja renta que habían inmigrado hacía menos de 12 meses. Se registró la edad, el sexo y el país de origen. Se ha comparado el coste de la vacunación (con vacuna HA y vacuna HA-HB, precio de sanidad pública y precio de venta al público a todos los niños inmigrantes sin cribado, con el coste de la vacunación sólo a los no inmunes. Resultados: Se determinaron los Ac. VHC a 1055 niños/as, un caso resultó positivo: 0,09% (IC95%: 0-0,53%. Se determinaron los Ac. VHA a 992 niños/as, y fueron positivos el 38% (IC 95%: 35,0-41,1; en los de América Central y del Sur (n=352 el 34,9%; del Magreb (n=246 el 44,7%; de Indo-Pakistán (n=162 el 58,6%. Según el país de procedencia, la edad y el precio de la vacuna utilizada, es eficiente la determinación de los Ac. VHA previamente a la vacunación para el VHA. Conclusiones: La baja prevalencia de Ac. VHC en población infantil inmigrada no justifica su determinación sistemática. Valorar la determinación de los Ac. VHA en cada niño inmigrante en particular puede aumentar la eficiencia de los PANI.Objectives: To evaluate systematic determination of antibodies against hepatitis C virus (HCV and hepatitis A virus (HAV within the protocols for the care of young immigrants (PCYI. Methods: We performed a descriptive, cross-sectional, multicenter study. Antibodies against HCV and HAV were determined in children aged from 6 months to 15 years from low-income countries who had immigrated to Spain less than 12 months previously. Age, sex and country of origin were registered. The cost of vaccinating all immigrant children (with the HA

  2. Distribución heterogénea de la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores de sangre en Puebla, México Heterogeneous distribution of the prevalence of anti-Trypanosoma cruzi antibodies among blood donors in the State of Puebla, Mexico

    Directory of Open Access Journals (Sweden)

    Víctor M Monteón

    2005-04-01

    Full Text Available OBJETIVO: Identificar la seroprevalencia de anticuerpos anti Trypanosoma cruzi (Ac anti-T. cruzi en donadores de sangre que habitan en ámbito rural y suburbano, así como las regiones del estado de mayor riesgo y factores asociados. MATERIAL Y MÉTODOS: Estudio transversal realizado de enero a diciembre de 2003. Se analizaron 2 489 donadores de sangre reclutados en 10 puestos de sangrado del Instituto Mexicano del Seguro Social (IMSS distribuidos en las siete regiones económicas del estado de Puebla, México. Se determinó la seroprevalencia mediante las pruebas serológicas obligatorias del panel viral y, además, para T. cruzi, región de reclutamiento y de origen de los donadores. RESULTADOS: La seroprevalencia de Ac anti-T. cruzi fue de 1.24% (31/2 489 comparable con la obtenida para el virus de la hepatitis C (1.5% y por arriba de la del virus de la inmunodeficiencia humana (0.4% y del antígeno de superficie del virus de la hepatitis B (0.3%. Las regiones de Tehuacán-Sierra Negra y Mixteca fueron las de mayor riesgo con seroprevalencias, por el origen del donador, de 2.6% para T. cruzi, mientras que en los originarios de las regiones Sierra nororiental y Angelópolis no se detectaron casos positivos. Se observó asociación entre ser seropositivo y mayor de 40 años y ser originario de las regiones de Tehuacán-Sierra Negra y Mixteca. CONCLUSIONES: La distribución de seroprevalencia a T. cruzi es heterogénea, oscila desde 0% hasta 2.6%, y se reconoce a Tehuacán-Sierra Negra y Mixteca como las regiones de mayor riesgo.OBJECTIVE: To determine the seroprevalence and associated factors, of antibodies against Trypanosoma cruzi (T. cruzi Ab among blood donors living in rural and suburban areas and risk regions. MATERIAL AND METHODS: A cross-sectional study was conducted from January to December 2003, in 2489 blood donors of seven regions of Puebla, who were evaluated for mandatory viral and T. cruzi serological tests using validated

  3. A3 TEST STAND DEVELOPMENT AND CONSTRUCTION

    Science.gov (United States)

    2008-01-01

    THIS IMAGE DOCUMENTS THE DEVELOPMENT AND CONSTRUCTION OF THE A3 TEST STAND IN SUPPORT OF THE ARES/CLV UPPER STAGE ENGINE DEVELOPMENT AT STENNIS SPACE CENTER, MISSIPPI IN SUPPORT OF THE DEVELOPMENT OF THE CONSTELLATION/ARES PROJECT. THIS IMAGE IS EXTRACTED FROM A HIGH DEFINITION VIDEO FILE AND IS THE HIGHEST RESOLUTION AVAILABLE

  4. A3 Subscale Rocket Hot Fire Testing

    Science.gov (United States)

    Saunders, G. P.; Yen, J.

    2009-01-01

    This paper gives a description of the methodology and results of J2-X Subscale Simulator (JSS) hot fire testing supporting the A3 Subscale Diffuser Test (SDT) project at the E3 test facility at Stennis Space Center, MS (SSC). The A3 subscale diffuser is a geometrically accurate scale model of the A3 altitude simulating rocket test facility. This paper focuses on the methods used to operate the facility and obtain the data to support the aerodynamic verification of the A3 rocket diffuser design and experimental data quantifying the heat flux throughout the facility. The JSS was operated at both 80% and 100% power levels and at gimbal angle from 0 to 7 degrees to verify the simulated altitude produced by the rocket-rocket diffuser combination. This was done with various secondary GN purge loads to quantify the pumping performance of the rocket diffuser. Also, special tests were conducted to obtain detailed heat flux measurements in the rocket diffuser at various gimbal angles and in the facility elbow where the flow turns from vertical to horizontal upstream of the 2nd stage steam ejector.

  5. TMS delivered for A-3 Test Stand

    Science.gov (United States)

    2010-01-01

    A state-of-the-art thrust measurement system for the A-3 Test Stand under construction at NASA's John C. Stennis Space Center was delivered March 17. Once completed, the A-3 stand (seen in background) will allow simulated high-altitude testing on the next generation of rocket engines for America's space program. Work on the stand began in 2007, with activation scheduled for 2012. The stand is the first major test structure to be built at Stennis since the 1960s. The recently delivered TMS was fabricated by Thrust Measurement Systems in Illinois. It is an advanced calibration system capable of measuring vertical and horizontal thrust loads with an accuracy within 0.15 percent at 225,000 pounds.

  6. A 3D Data Transformation Processor

    Science.gov (United States)

    2012-10-01

    ecution traces, e.g., for reverse engineering of malicious soft- ware, and post- mortem analysis of a system that has suffered an attack. Because of the...require the high bandwidth and low latency only pos - sible with a 3D implementation. 3. DESIGN GOALS Our proposed architecture has two major goals: (1...platforms without requiring software modifications or specialized hard- ware [24]. Such a primitive can be used to perform post- mortem analysis for

  7. Inmunofluorescencia con Crithidia luciliae para la detección de anticuerpos anti-ADN: Imágenes atípicas y su relación con enfermedad de Chagas y leishmaniasis Immunofluorescence assay with Crithidia luciliae for the detection of anti-DNA antibodies: Atypical images and their relationship with Chagas’ disease and leishmaniasis

    Directory of Open Access Journals (Sweden)

    Gloria Griemberg

    2006-02-01

    Full Text Available Los anticuerpos anti-ADN nativo pueden detectarse por inmunofluorescencia indirecta con Crithidia luciliae, observándose tinción fluorescente anular del kinetoplasto que contiene ADN de doble cadena. En algunos casos pueden observarse imágenes fluorescentes en flagelo, membrana y corpúsculo basal, consideradas atípicas. Como C. luciliae pertenece a la familia Trypanosomatidae, que incluye patógenos para el hombre como Trypanosoma cruzi y Leishmaniaspp., se consideró que las imágenes atípicas pudieran deberse a reacciones cruzadas. Se realizaron estudios serológicos para Chagas a 105 muestras provenientes de zona endémica (Corrientes y no endémica (Buenos Aires para T. cruzi que presentaban imágenes atípicas con C. luciliae. La serología para Chagas resultó positiva en el 64.7% de las muestras de Buenos Aires y en el 78.3% de las de Corrientes que presentaban frente a C. luciliae imagen conjunta de membrana y flagelo. No presentaron la imagen conjunta ninguna de las muestras de dadores de sangre normales, ni de pacientes con enfermedades del tejido conectivo, excepto dos con lupus que también eran chagásicos. Todas las muestras de pacientes chagásicos analizadas frente a C. luciliae presentaron la imagen conjunta. Se estudiaron también 46 muestras de pacientes con leishmaniasis, 28 de ellos coinfectados con T. cruzi. La imagen conjunta se observó en el 88.0% de las muestras de leishmaniásicos y en el 78.5% de las de coinfectados. Los resultados sugieren que C. luciliae podría ser un sustrato alternativo, económico y de bajo riesgo para el diagnóstico serológico de enfermedad de Chagas, aunque no discrimina la infección por Leishmania. El hallazgo de la imagen conjunta en la detección de anti-ADN nativo señala la conveniencia de realizar en esos pacientes, estudios clínicos y de laboratorio para enfermedad de Chagas y leishmaniasis.Anti-native DNA antibodies can be detected by indirect immunofluorescence assay with

  8. “四个圈”的A3 奥迪A3 Sportback

    Institute of Scientific and Technical Information of China (English)

    耗子; Eric(图)

    2010-01-01

    虽然奥迪A3从诞生至今已走过了14个年头.但在国内汽车市场它只能算是初来乍到。人们对它并不熟悉.以至于每当有“A3”的字眼儿出现.总会涌入一批奇瑞A3的仰慕者。希望你能记住,14年前奇瑞还没建厂呢!

  9. Purificación de la hormona Gonadotropina Coriónica humana (HCG por cromatografía de inmunoafinidad.

    Directory of Open Access Journals (Sweden)

    Dayami Dorta Hernández

    2006-06-01

    Full Text Available En el presente trabajo se repota la purificación de la hormona Gonadotropina Coriónica Humana (HCG a escala experimental, a partir de concentrados de orina de mujeres gestales, utilizando el método de inmunopurificación por cromatografía de afinidad. Para ello se acoplaron convalentemente anticuerpos monoclonales específicos por la subunidad ß de la HCG a polímeros de Sefarosa CL 4B activada con Bromuro de Cianógeno (PHARMACIA, Suecia. Se logró aislar la glicoproteína HCG con más de un 95 % de pureza, utilizando KSCN 3M como tampón de elución. La proteína obtenida mantuvo su actividad natural, determinada por Dipstick Cromatográfico y análisis por Western-blot.

  10. 华硕A3N

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    @@ 可以看家的笔记本 是否想过一台平时仅用于工作、娱乐的笔记本电脑还能帮您抓获闯入家中的盗贼呢?如此神奇、超乎想像的笔记本电脑就是记本电脑厂商华硕电脑近日最新推出的一款产品--华硕A3N.这款超级笔记本电脑内置35万象素高品质摄像头和高灵敏麦克风,是全球首款内置Game face功能的笔记本电脑,具有强大的网络视讯能力.同时,只要加载华硕独家的Video security(看门狗)软件,还可摇身一变成为奇特的家庭防盗装置.

  11. A 3-D shape model of Interamnia

    Science.gov (United States)

    Sato, Isao

    2015-08-01

    A 3-D shape model of the sixth largest of the main belt asteroids, (704) Interamnia, is presented. The model is reproduced from its two stellar occultation observations and six lightcurves between 1969 and 2011. The first stellar occultation was the occultation of TYC 234500183 on 1996 December 17 observed from 13 sites in the USA. An elliptical cross section of (344.6±9.6km)×(306.2±9.1km), for position angle P=73.4±12.5 was fitted. The lightcurve around the occultation shows that the peak-to-peak amplitude was 0.04 mag. and the occultation phase was just before the minimum. The second stellar occultation was the occultation of HIP 036189 on 2003 March 23 observed from 39 sites in Japan and Hawaii. An elliptical cross section of (349.8±0.9km)×(303.7±1.7km), for position angle P=86.0±1.1 was fitted. A companion of 8.5 mag. of the occulted star was discovered whose separation is 12±2 mas (milli-arcseconds), P=148±11 . A combined analysis of rotational lightcurves and occultation chords can return more information than can be obtained with either technique alone. From follow-up photometric observations of the asteroid between 2003 and 2011, its rotation period is determined to be 8.728967167±0.00000007 hours, which is accurate enough to fix the rotation phases at other occultation events. The derived north pole is λ2000=259±8, β2000=-50±5 (retrograde rotation); the lengths of the three principal axes are 2a=361.8±2.8km, 2b=324.4±5.0km, 2c=297.3±3.5km, and the mean diameter is D=326.8±3.0km. Supposing the mass of Interamnia as (3.5±0.9)×10-11 solar masses, the density is then ρ=3.8±1.0 g cm-3.

  12. Evaluación serológica de una proteína recombinante a partir de una cepa aislada del virus de la fiebre amarilla en el Perú: un estudio piloto

    Directory of Open Access Journals (Sweden)

    Carlos Yábar V

    2003-10-01

    Full Text Available Objetivo: Evaluar serológicamente una proteína recombinante de 66 kDa (Er66 de una cepa del virus de la fiebre amarilla aislada en el Perú usando anticuerpos inmunoreactivos. Material y métodos: La proteína Er66 fue expresada in vitro en la bacteria Escherichia coli y enfrentada a títulos de 1/100, 1/50 y 1/25 de anticuerpos monoclonales, y a sueros con anticuerpos IgM e IgG inmunoreactivos contra el virus de la fiebre amarilla mediante ensayos de Western blot (WB. Asimismo, se evaluaron proteínas totales de las cepas de referencia del virus dengue (DEN y fiebre amarilla como controles de antigenicidad. Resultados: La proteína recombinante Er66 presentó antigenicidad contra títulos de 1/50 y 1/25 de anticuerpo monoclonal (MAB8701; sin embargo, no se observó inmunoreactividad en sueros positivos para fiebre amarilla y dengue. Los ensayos con extractos crudos de la cepa de fiebre amarilla Asibi 17D (PTFA revelaron que la antigenicidad de las proteínas virales comprendidas entre 60 y 80 kDa fue afectada negativamente a temperaturas desnaturalizantes de 100°C. En cambio, tratamientos con ß-mercaptoetanol sin calor generó un aumento de la antigenicidad de dichas proteínas. Siguiendo este mismo principio, la proteína Er66 fue sometida a tratamientos desnaturalizantes con ß-mercaptoetanol sin incluir calor y fue enfrentada nuevamente a los sueros reactivos. El resultado final reveló que la proteína Er66 generó inmunoreactividad frente a sueros con altos títulos de anticuerpos IgM e IgG para fiebre amarilla mientras que en otras muestras se observó una débil señal. Conclusiones: Los datos obtenidos en este trabajo demuestran que la Er66 pudo ser reconocida por anticuerpos IgM e IgG específicos para fiebre amarilla presentes en sueros de pacientes infectados. Los datos presentados en este artículo sugieren el uso de proteínas recombinantes como posibles candidatas de valor diagnóstico para la FA.

  13. 45 CFR 12a.3 - Collecting the information.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Collecting the information. 12a.3 Section 12a.3... PROPERTY TO ASSIST THE HOMELESS § 12a.3 Collecting the information. (a) Canvass of landholding agencies. On a quarterly basis, HUD will canvass landholding agencies to collect information about...

  14. 26 CFR 1.662(a)-3 - Other amounts distributed.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Other amounts distributed. 1.662(a)-3 Section 1.662(a)-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Estates and Trusts Which May Accumulate Income Or Which Distribute Corpus § 1.662(a)-3 Other amounts distributed. (a)...

  15. 8 CFR 274a.3 - Continuing employment of unauthorized aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Continuing employment of unauthorized aliens. 274a.3 Section 274a.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTROL OF EMPLOYMENT OF ALIENS Employer Requirements § 274a.3 Continuing employment...

  16. A system for finding a 3D target without a 3D image

    Science.gov (United States)

    West, Jay B.; Maurer, Calvin R., Jr.

    2008-03-01

    We present here a framework for a system that tracks one or more 3D anatomical targets without the need for a preoperative 3D image. Multiple 2D projection images are taken using a tracked, calibrated fluoroscope. The user manually locates each target on each of the fluoroscopic views. A least-squares minimization algorithm triangulates the best-fit position of each target in the 3D space of the tracking system: using the known projection matrices from 3D space into image space, we use matrix minimization to find the 3D position that projects closest to the located target positions in the 2D images. A tracked endoscope, whose projection geometry has been pre-calibrated, is then introduced to the operating field. Because the position of the targets in the tracking space is known, a rendering of the targets may be projected onto the endoscope view, thus allowing the endoscope to be easily brought into the target vicinity even when the endoscope field of view is blocked, e.g. by blood or tissue. An example application for such a device is trauma surgery, e.g., removal of a foreign object. Time, scheduling considerations and concern about excessive radiation exposure may prohibit the acquisition of a 3D image, such as a CT scan, which is required for traditional image guidance systems; it is however advantageous to have 3D information about the target locations available, which is not possible using fluoroscopic guidance alone.

  17. Nuclear receptor 4a3 (nr4a3 regulates murine mast cell responses and granule content.

    Directory of Open Access Journals (Sweden)

    Gianni Garcia-Faroldi

    Full Text Available Nuclear receptor 4a3 (Nr4a3 is a transcription factor implicated in various settings such as vascular biology and inflammation. We have recently shown that mast cells dramatically upregulate Nuclear receptor 4a3 upon activation, and here we investigated the functional impact of Nuclear receptor 4a3 on mast cell responses. We show that Nuclear receptor 4a3 is involved in the regulation of cytokine/chemokine secretion in mast cells following activation via the high affinity IgE receptor. Moreover, Nuclear receptor 4a3 negatively affects the transcript and protein levels of mast cell tryptase as well as the mast cell's responsiveness to allergen. Together, these findings identify Nuclear receptor 4a3 as a novel regulator of mast cell function.

  18. 26 CFR 1.25A-3 - Hope Scholarship Credit.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Hope Scholarship Credit. 1.25A-3 Section 1.25A-3... Rates During A Taxable Year § 1.25A-3 Hope Scholarship Credit. (a) Amount of the credit—(1) In general. Subject to the phaseout of the education tax credit described in § 1.25A-1(c), the Hope Scholarship...

  19. Impact of Annexin A3 expression in gastric cancer cells.

    Science.gov (United States)

    Yu, S Y; Li, Y; Fan, L Q; Zhao, Q; Tan, B B; Liu, Y

    2014-01-01

    Annexin A3 participates in various biological processes, including tumorigenesis, drug resistance, and metastasis. The aim of this study was to investigate the expression of Annexin A3 in gastric cancer and its relationship with cell differentiation, migration, and invasion of gastric cancer cells. Annexin A3 expression in gastric cancer tissues was detected by quantitative real-time PCR and Western blotting. The proliferation of gastric cancer cells was measured by the MTT assay. Cell migration and invasion were determined via wound healing and transwell assays, respectively. Knock down of endogenous Annexin A3 in gastric cancer BGC823 cells was performed using siRNA technology. The expression of Annexin A3 was significantly upregulated in gastric cancer tissues, and negatively correlated with the differentiation degree. Silencing of endogenous Annexin A3 suppressed the proliferation, migration, and invasion of BGC823 cells. Additionally, the expression of p21, p27, TIMP-1, and TIMP-2 was upregulated, and the expression of PCNA, cyclin D1, MMP-1, and MMP-2 decreased in cells treated with Annexin A3-siRNA. Annexin A3 was upregulated in gastric cancer cells. Deletion of endogenous Annexin A3 significantly inhibited gastric cancer cell proliferation, migration, and invasion.

  20. Pharmacology and therapeutic applications of A3 receptor subtype.

    Science.gov (United States)

    Fishman, Pnina; Bar-Yehuda, Sara

    2003-01-01

    The present study summarizes the biological effects elicit upon A(3) adenosine receptor (A(3)AR) activation in normal and tumor cells. Anti-inflamatory response is mediated upon A(3)AR activation in neutrophils, eosinophils and macrophages via direct effect on cell degranulation or the production of anti-inflamatory cytokines. In basophils, which highly express A(3)AR, degranulation and mediator release upon receptor activation lead to pro-inflammatory effects resulting in bronchospasm and asthma. In other normal cells such as cardiomyocytes, neuronal cells and bone marrow cells A(1)AR activation induces cytoprotective effects in vitro. In vivo, A(3)AR agonists act as cardio- and neuroprotective agents and attenuate ischemic damage. Furthermore, agonists to A(3)AR induce granulocyte colony stimulating factor (G-CSF) production and myeloprotective effect in chemotherapy treated mice. Interestingly, A(3)AR agonists inhibit tumor cell growth both in vitro and in vivo through a cytostatic effect mediated via the de-regulation of the Wnt signaling pathway. The variety of activities elicit by A(3)AR agonists suggest their potential use as therapeutic agents in inflammation, brain/cardiac ischemia and cancer. Antagonists to A(3)AR may be implemented to the therapy of asthma and additional allergic conditions.

  1. HBV subgenotype misclassification expands quasi-subgenotype A3.

    Science.gov (United States)

    Pourkarim, M R; Amini-Bavil-Olyaee, S; Lemey, P; Maes, P; Van Ranst, M

    2011-06-01

    Recently, we proposed a new classification for 'subgenotype A' of hepatitis B virus (HBV), in which the novel 'quasi-subgenotype A3' group comprising HBV 'subgenotype A3', 'tentative A4', and A5 was introduced. Newly 'Tentative subgenotype A7' strains from Cameroon were introduced by Hubschen et al. However, our meticulous phylogenetic analysis demonstrated that these isolates should also be classified into 'quasi-subgenotype A3'. Such misclassification can be avoided by following established principles for HBV subgenotyping. Moreover, their close evolutionary relationship with A3 highlights our hypothesis that geographical origin may be an important factor in further classification of HBV subgenotypes.

  2. Simple groups with orders 2a3b5cpd,2a3b7cpd and 2a3b5c7d

    Institute of Scientific and Technical Information of China (English)

    JIANG Youyi; TAN Mingshu; LIU Xuefei

    2004-01-01

    This work deals with the power exponent r1 and r2 respectively of the maximal and second-maximal prime factors of the order of simple K4-group, and the classification for simple {5,7}'- K4-group G (i.e. |G| can not be divided by 5 nor by 7 or |π(G)| = 4 ), simple 5' - K4 -group G (i.e. |G| can not divided by 5 and |π(G)| =4) and simple 7'- K4 -group G (i.e. |G| can not divided by 7 and |π(G)| =4). It is derived that r1 =1, 2 and 4, and r2 is not greater than 4. All the simple K4 -groups with order 2a3b5cpd, 2a3b7cpd and 2a3b5c7d are obtained.

  3. Using Toyota's A3 Thinking for Analyzing MBA Business Cases

    Science.gov (United States)

    Anderson, Joe S.; Morgan, James N.; Williams, Susan K.

    2011-01-01

    A3 Thinking is fundamental to Toyota's benchmark management philosophy and to their lean production system. It is used to solve problems, gain agreement, mentor team members, and lead organizational improvements. A structured problem-solving approach, A3 Thinking builds improvement opportunities through experience. We used "The Toyota…

  4. 42 CFR 5a.3 - Definition of Underserved Rural Community.

    Science.gov (United States)

    2010-10-01

    ... county; or (2) If it is within a Metropolitan county, all Census Tracts that are assigned a Rural-Urban... 42 Public Health 1 2010-10-01 2010-10-01 false Definition of Underserved Rural Community. 5a.3... PROVISIONS RURAL PHYSICIAN TRAINING GRANT PROGRAM § 5a.3 Definition of Underserved Rural...

  5. El virus sincitial respiratorio humano: una panorámica

    Directory of Open Access Journals (Sweden)

    Mylene Corzo-López

    2013-01-01

    Full Text Available Las infecciones respiratorias agudas, son la principal causa de morbilidad y mortalidad en niños de todo el mundo. Dentro de las principales infecciones virales con características respiratorias, ocupa un lugar preponderante las provocadas por el virus sincitial respiratorio humano. Este virus es uno de los patógenos más importantes que causa infección en el tracto respiratorio en niños pequeños, ancianos y pacientes inmunodeprimidos. Su distribución es mundial. Las epidemias causadas por este virus ocurren anualmente, durante los meses de invierno en los países de clima templado y durante las estaciones de lluvia en los países de clima tropical. Este virus se encuentra dividido en dos subgrupos antigénicos bien definidos, A y B. Los estudios de variabilidad genética, se focalizan en la glicoproteína G, debido al alto grado de variabilidad genética y antigénica que presenta esta entre los diversos aislamientos. En Cuba fue detectado por primera vez en 1964 como el agente causal del brote de bronquiolitis desatado este año. Este virus causa infecciones leves como severas en hospederos susceptibles. Dichas infecciones son prevenidas con el empleo de medicamentos profilácticos como por ejemplo: péptidos sintéticos, anticuerpos policlonales y monoclonales humanizados, antígenos virales recombinantes, sin embargo, el más aplicado es el palivizumab (anticuerpo monoclonal humanizado. Se ha observado, que con el empleo de este anticuerpo se ha logrado disminuir a nivel mundial la tasa de hospitalización de los hospederos más susceptibles. Actualmente se investigan otros medicamentos los cuales presentan un modo de acción diferente al palivizumab.

  6. The A3 adenosine receptor: history and perspectives.

    Science.gov (United States)

    Borea, Pier Andrea; Varani, Katia; Vincenzi, Fabrizio; Baraldi, Pier Giovanni; Tabrizi, Mojgan Aghazadeh; Merighi, Stefania; Gessi, Stefania

    2015-01-01

    By general consensus, the omnipresent purine nucleoside adenosine is considered a major regulator of local tissue function, especially when energy supply fails to meet cellular energy demand. Adenosine mediation involves activation of a family of four G protein-coupled adenosine receptors (ARs): A(1), A(2)A, A(2)B, and A(3). The A(3) adenosine receptor (A(3)AR) is the only adenosine subtype to be overexpressed in inflammatory and cancer cells, thus making it a potential target for therapy. Originally isolated as an orphan receptor, A(3)AR presented a twofold nature under different pathophysiologic conditions: it appeared to be protective/harmful under ischemic conditions, pro/anti-inflammatory, and pro/antitumoral depending on the systems investigated. Until recently, the greatest and most intriguing challenge has been to understand whether, and in which cases, selective A(3) agonists or antagonists would be the best choice. Today, the choice has been made and A(3)AR agonists are now under clinical development for some disorders including rheumatoid arthritis, psoriasis, glaucoma, and hepatocellular carcinoma. More specifically, the interest and relevance of these new agents derives from clinical data demonstrating that A(3)AR agonists are both effective and safe. Thus, it will become apparent in the present review that purine scientists do seem to be getting closer to their goal: the incorporation of adenosine ligands into drugs with the ability to save lives and improve human health.

  7. Annexin A3 as a negative regulator of adipocyte differentiation.

    Science.gov (United States)

    Watanabe, Takenori; Ito, Yoshimasa; Sato, Asuka; Hosono, Takashi; Niimi, Shingo; Ariga, Toyohiko; Seki, Taiichiro

    2012-10-01

    Annexin A3 is a protein belonging to the annexin family, and it is mainly present in cellular membranes as a phospholipid-binding protein that binds via the calcium ion. However, its physiological function remains to be clarified. We examined the expression of annexin A3 in mouse tissues and found for the first time that annexin A3 mRNA and its protein were expressed more strongly in adipose tissues than in other tissues. In adipose tissues, annexin A3-expressing cells were present in the stromal vascular fraction, and precisely identical to Pref-1-positive preadipocytes, Pref-1 being an epidermal growth factor repeat-containing transmembrane protein that inhibits adipogenesis. In 3T3-L1 cells, used as a model of adipogenesis, annexin A3 was down-regulated at an early phase of adipocyte differentiation, and this pattern paralleled that of Pref-1. Suppression of annexin A3 in these cells with siRNA caused elevation of the PPARγ2 mRNA level and lipid droplet accumulation. In conclusion, our data suggest that annexin A3 is a negative regulator of adipocyte differentiation.

  8. 助力A3彩色商务

    Institute of Scientific and Technical Information of China (English)

    靖程

    2008-01-01

    随着商务应用的不断发展,无论是在专业领域,还是普通的商业办公,都出现了越来越多的A3幅面打印环境。用户需求领域的扩张与打印机门槛的不断降低促使A3幅面打印不再为高端应用所专有。目前市场中A3激光打印机产品也不再仅仅局限于黑白打印,佳能LBP5960就是一款A3幅面彩色激光打印机,

  9. A 3D digital medical photography system in paediatric medicine.

    Science.gov (United States)

    Williams, Susanne K; Ellis, Lloyd A; Williams, Gigi

    2008-01-01

    In 2004, traditional clinical photography services at the Educational Resource Centre were extended using new technology. This paper describes the establishment of a 3D digital imaging system in a paediatric setting at the Royal Children's Hospital, Melbourne.

  10. Corrosion Behaviors of Steel A3 Exposed to Thiobacillus Ferrooxidans

    Institute of Scientific and Technical Information of China (English)

    Jianhua LIU; Xin LIANG; Songmei LI

    2008-01-01

    The corrosion behaviors of steel A3 in synergistic action of Thiobacillus ferrooxidans (T.f) and electrochemically accelerated corrosion were studied by electrochemical, microbiology and surface analysis methods. The open circuit potential (Eocp) and electrochemical impedance spectroscopy (EIS) of the steel A3 electrodes were measured in leathen culture medium without and with T.f (simply called T.f solution in the following paper)in immersion electrode way at the time of the 2nd, 5th, 10th, 20th and 30th days, respectively. It was found that Eocp of the electrode for immersion in leathen culture medium shifted negatively with the immersion time while that for immersion in T.f solutions shifted negatively, then positively and finally negatively. On the 20th day, the corrosion of steel A3 for immersion in culture medium was in pitting initiation stage while that for immersion in T.f solutions was in pitting growth stage. It was found that the corrosion of steel A3 was accelerated by T.f. The morphology of corrosion product of steel A3 immersion in T.f solutions observed through scanning electron microscopy (SEM) transformed from solid globules to tabular plates and to spongy globules and plates.

  11. Inhibition of arenavirus by A3, a pyrimidine biosynthesis inhibitor.

    Science.gov (United States)

    Ortiz-Riaño, Emilio; Ngo, Nhi; Devito, Stefanie; Eggink, Dirk; Munger, Joshua; Shaw, Megan L; de la Torre, Juan Carlos; Martínez-Sobrido, Luis

    2014-01-01

    Arenaviruses merit significant interest as important human pathogens, since several of them cause severe hemorrhagic fever disease that is associated with high morbidity and significant mortality. Currently, there are no FDA-licensed arenavirus vaccines available, and current antiarenaviral therapy is limited to an off-labeled use of the nucleoside analog ribavirin, which has limited prophylactic efficacy. The pyrimidine biosynthesis inhibitor A3, which was identified in a high-throughput screen for compounds that blocked influenza virus replication, exhibits a broad-spectrum antiviral activity against negative- and positive-sense RNA viruses, retroviruses, and DNA viruses. In this study, we evaluated the antiviral activity of A3 against representative Old World (lymphocytic choriomeningitis virus) and New World (Junin virus) arenaviruses in rodent, monkey, and human cell lines. We show that A3 is significantly more efficient than ribavirin in controlling arenavirus multiplication and that the A3 inhibitory effect is in part due to its ability to interfere with viral RNA replication and transcription. We document an additive antiarenavirus effect of A3 and ribavirin, supporting the potential combination therapy of ribavirin and pyrimidine biosynthesis inhibitors for the treatment of arenavirus infections.

  12. Isopropyl alcohol tank installed at A-3 Test Stand

    Science.gov (United States)

    2009-01-01

    An isopropyl alcohol (IPA) tank is lifted into place at the A-3 Test Stand being built at NASA's John C. Stennis Space Center. Fourteen IPA, water and liquid oxygen (LOX) tanks are being installed to support the chemical steam generators to be used on the A-3 Test Stand. The IPA and LOX tanks will provide fuel for the generators. The water will allow the generators to produce steam that will be used to reduce pressure inside the stand's test cell diffuser, enabling operators to simulate altitudes up to 100,000 feet. In that way, operators can perform the tests needed on rocket engines being built to carry humans back to the moon and possibly beyond. The A-3 Test Stand is set for completion and activation in 2011.

  13. Liquid oxygen tank installed at A-3 Test Stand

    Science.gov (United States)

    2009-01-01

    A liquid oxygen (LOX) tank is lifted into place at the A-3 Test Stand being built at NASA's John C. Stennis Space Center. Fourteen LOX, isopropyl alcohol (IPA) and water tanks are being installed to support the chemical steam generators to be used on the A-3 Test Stand. The IPA and LOX tanks will provide fuel for the generators. The water will allow the generators to produce steam that will be used to reduce pressure inside the stand's test cell diffuser, enabling operators to simulate altitudes up to 100,000 feet. In that way, operators can perform the tests needed on rocket engines being built to carry humans back to the moon and possibly beyond. The A-3 Test Stand is set for completion and activation in 2011.

  14. Water tank installed at A-3 Test Stand

    Science.gov (United States)

    2009-01-01

    A water tank is lifted into place at the A-3 Test Stand being built at NASA's John C. Stennis Space Center. Fourteen water, liquid oxygen (LOX) and isopropyl alcohol (IPA) tanks are being installed to support the chemical steam generators to be used on the A-3 Test Stand. The IPA and LOX tanks will provide fuel for the generators. The water will allow the generators to produce steam that will be used to reduce pressure inside the stand's test cell diffuser, enabling operators to simulate altitudes up to 100,000 feet. In that way, operators can perform the tests needed on rocket engines being built to carry humans back to the moon and possibly beyond. The A-3 Test Stand is set for completion and activation in 2011.

  15. Mutations in ALDH1A3 cause microphthalmia.

    Science.gov (United States)

    Aldahmesh, M A; Khan, A O; Hijazi, H; Alkuraya, F S

    2013-08-01

    Microphthalmia is an important inborn error of eye development that can be associated with multisystem involvement. Anophthalmia is more severe and rarer. Single mutations in an expanding list of genes are known to cause this spectrum of anomaly. In one branch of a multiplex family with microphthalmia and anophthalmia, autozygome analysis excluded all known microphthalmia genes at the time of doing this study. Exome sequencing and autozygome filtration identified a novel homozygous variant in ALDH1A3. Subsequently, we identified another homozygous variant in 2 of the 10 probands with microphthalmia we specifically screened for mutations in ALDH1A3. Interestingly, the other branch of the original family was found to segregate anophthalmia/syndactyly with a novel homozygous SMOC1 variant. Our data support the very recent and independent identification of ALDH1A3 as a disease gene in microphthalmia. Locus heterogeneity should be considered in consanguineous families even for extremely rare phenotypes.

  16. Role of A3 adenosine receptor in diabetic neuropathy.

    Science.gov (United States)

    Yan, Heng; Zhang, Enshui; Feng, Chang; Zhao, Xin

    2016-10-01

    Neuropathy is the most common diabetic complication. Although the A1 and A2A adenosine receptors are important pharmacological targets in alleviating diabetic neuropathy, the role of the A3 adenosine receptor remains unknown. Because the A3 adenosine receptor regulates pain induced by chronic constriction injury or chemotherapy, its stimulation might also attenuate diabetic neuropathy. This study examines the effects of systemic treatment with the A3 adenosine receptor agonist 1-deoxy-1-[6-[[(3-iodophenyl)methyl]amino]-9H-purin-9-yl]-N-methyl-β-d-ribofuranuronamide (IB-MECA) on diabetic neuropathy and explores the putative mechanisms underlying its pharmacological effects. We show that IB-MECA alleviated mechanical hyperalgesia and thermal hypoalgesia in mice 2 weeks but not 4 weeks after streptozocin (STZ) treatment. Furthermore, IB-MECA prevented the reduction in sciatic motor nerve conduction velocity and sensory nerve conduction velocity in diabetic mice 2 weeks but not 4 weeks after STZ treatment. Similarly, IB-MECA inhibited the activation of nuclear factor-κB and decreased the generation of tumor necrosis factor-α in the spinal cord of mice 2 weeks but not 4 weeks after STZ treatment. These phenomena were associated with reduction of A3 adenosine receptor expression in the spinal cord after long-term diabetes. Our results suggest that the A3 adenosine receptor plays a critical role in regulating diabetic neuropathy and that reduction in A3 adenosine receptor expression/function might contribute to the progression of diabetic neuropathy. © 2016 Wiley Periodicals, Inc.

  17. Description and Operation of the A3 Subscale Facility

    Science.gov (United States)

    Saunders, G. P.; Varner, D. G.; Grover, J. B.

    2010-01-01

    The purpose of this paper is to give an overview of the general design and operation of the A3 Subscale test facility. The goal is to provide the reader with a general understanding of what the major facility systems are, where they are located, and how they are used to meet the objectives supporting the design of the A3 altitude rocket test facility. This paper also provides the reader with the background information prior to reading the subsequent papers detailing the design and test results of the various systems described herein.

  18. The A3 adenosine receptor (A3AR): therapeutic target and predictive biological marker in rheumatoid arthritis.

    Science.gov (United States)

    Fishman, Pnina; Cohen, Shira

    2016-09-01

    The Gi protein-associated A3 adenosine receptor (A3AR) is over-expressed in inflammatory cells, and this high expression is also reflected in the peripheral blood mononuclear cells of patients with autoimmune inflammatory diseases such as rheumatoid arthritis, psoriasis, and Crohn's disease. CF101, a selective agonist with high affinity to the A3AR, is known to induce robust anti-inflammatory effect in experimental animal models of adjuvant-, collagen-, and tropomyosin-induced arthritis. The effect is mediated via a definitive molecular mechanism entailing deregulation of the nuclear factor-κB (NF-κB) and the Wnt signal transduction pathways resulting in apoptosis of inflammatory cells. CF101 was found to be safe and well tolerated in all preclinical, phase I, and phase II human clinical studies. In two phase II clinical studies where CF101 was administered to rheumatoid arthritis (RA) patients as a stand-alone drug, a significant anti-rheumatic effect and a direct significant correlation were found between receptor expression at baseline and patients' response to the drug, suggesting that A3AR may be utilized as a predictive biomarker. The A3AR is a promising therapeutic target in rheumatoid arthritis and can be used also as a biological marker to predict patients' response to CF101. This is a unique type of a personalized medicine approach which may pave the way for a safe and efficacious treatment for this patient population.

  19. A 3-portal approach for arthroscopic subtalar arthrodesis

    NARCIS (Netherlands)

    Beimers, L.; de Leeuw, P.A.J.; van Dijk, C.N.

    2009-01-01

    We present a 3-portal approach for arthroscopic subtalar arthrodesis with the patient in the prone position. The prone position allows the use of the two standard posterior portals and it allows for accurate control of hindfoot alignment during surgery. Furthermore, the introduction of talocalcaneal

  20. The stringent response in Streptomyces coelicolor A3(2)

    NARCIS (Netherlands)

    Strauch, E.; Takano, E.; Baylis, H.A.; Bibb, M.J.

    1991-01-01

    The stringent response was elicited in the antibiotic producer Streptomyces coelicolor A3(2) either by amino acid depletion (nutritional shiftdown) or by the addition of serine hydroxamate; both led to increased levels of ppGpp and to a reduction in transcription from the four promoters of the rrnD

  1. A 3D Serious City Building Game on Waste Disposal

    Science.gov (United States)

    Cuccurullo, Stefania; Francese, Rita; Passero, Ignazio; Tortora, Genoveffa

    2013-01-01

    The environmental priority requires structural interventions that will be effective in the long period only if they are accompanied by modifications of behaviors, orientations and beliefs, specially investing in the new generations. This paper presents a 3D Virtual World serious game named Pappi World, designed according to pedagogical theories…

  2. A 3D translation stage calibrated with Michelson interferometers

    Science.gov (United States)

    Lin, Hui-Hung; Hung, Kuo-Kai; Wang, Lu-Yu; Su, Wei-Hung

    2016-09-01

    A 3D translation stage which meets the requirement of the next-generation lithography is proposed. The Michelson interferometer is used to evaluate the moving distance for this 3-dimensional translation stage. With the help of Michelson interferometer, accuracy in the order of nanometers is desirable.

  3. Embryonic staging using a 3D virtual reality system

    NARCIS (Netherlands)

    C.M. Verwoerd-Dikkeboom (Christine); A.H.J. Koning (Anton); P.J. van der Spek (Peter); N. Exalto (Niek); R.P.M. Steegers-Theunissen (Régine)

    2008-01-01

    textabstractBACKGROUND: The aim of this study was to demonstrate that Carnegie Stages could be assigned to embryos visualized with a 3D virtual reality system. METHODS: We analysed 48 3D ultrasound scans of 19 IVF/ICSI pregnancies at 7-10 weeks' gestation. These datasets were visualized as 3D 'holog

  4. ALDH1A3 mutations cause recessive anophthalmia and microphthalmia.

    Science.gov (United States)

    Fares-Taie, Lucas; Gerber, Sylvie; Chassaing, Nicolas; Clayton-Smith, Jill; Hanein, Sylvain; Silva, Eduardo; Serey, Margaux; Serre, Valérie; Gérard, Xavier; Baumann, Clarisse; Plessis, Ghislaine; Demeer, Bénédicte; Brétillon, Lionel; Bole, Christine; Nitschke, Patrick; Munnich, Arnold; Lyonnet, Stanislas; Calvas, Patrick; Kaplan, Josseline; Ragge, Nicola; Rozet, Jean-Michel

    2013-02-01

    Anophthalmia and microphthalmia (A/M) are early-eye-development anomalies resulting in absent or small ocular globes, respectively. A/M anomalies occur in syndromic or nonsyndromic forms. They are genetically heterogeneous, some mutations in some genes being responsible for both anophthalmia and microphthalmia. Using a combination of homozygosity mapping, exome sequencing, and Sanger sequencing, we identified homozygosity for one splice-site and two missense mutations in the gene encoding the A3 isoform of the aldehyde dehydrogenase 1 (ALDH1A3) in three consanguineous families segregating A/M with occasional orbital cystic, neurological, and cardiac anomalies. ALDH1A3 is a key enzyme in the formation of a retinoic acid gradient along the dorso-ventral axis during early eye development. Transitory expression of mutant ALDH1A3 open reading frames showed that both missense mutations reduce the accumulation of the enzyme, potentially leading to altered retinoic acid synthesis. Although the role of retinoic acid signaling in eye development is well established, our findings provide genetic evidence of a direct link between retinoic-acid-synthesis dysfunction and early-eye-development anomalies in humans.

  5. A3幅面新神笔:爱普生新A3打印机

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    从1998年至今,爱普生A3喷墨打印机EX系列以及之后推出的Stylus Photo1290在中国市场上创造了累计销售54万台的纪录,成为设计用户点名率最高的A3幅面产品。最近,Stylus Photo1390打印机又加入了这个充满荣耀的家族。

  6. Adenosine A3 receptor activation is neuroprotective against retinal neurodegeneration.

    Science.gov (United States)

    Galvao, Joana; Elvas, Filipe; Martins, Tiago; Cordeiro, M Francesca; Ambrósio, António Francisco; Santiago, Ana Raquel

    2015-11-01

    Death of retinal neural cells, namely retinal ganglion cells (RGCs), is a characteristic of several retinal neurodegenerative diseases. Although the role of adenosine A3 receptor (A3R) in neuroprotection is controversial, A3R activation has been reported to afford protection against several brain insults, with few studies in the retina. In vitro models (retinal neural and organotypic cultures) and animal models [ischemia-reperfusion (I-R) and partial optic nerve transection (pONT)] were used to study the neuroprotective properties of A3R activation against retinal neurodegeneration. The A3R selective agonist (2-Cl-IB-MECA, 1 μM) prevented apoptosis (TUNEL(+)-cells) induced by kainate and cyclothiazide (KA + CTZ) in retinal neural cultures (86.5 ± 7.4 and 37.2 ± 6.1 TUNEL(+)-cells/field, in KA + CTZ and KA + CTZ + 2-Cl-IB-MECA, respectively). In retinal organotypic cultures, 2-Cl-IB-MECA attenuated NMDA-induced cell death, assessed by TUNEL (17.3 ± 2.3 and 8.3 ± 1.2 TUNEL(+)-cells/mm(2) in NMDA and NMDA+2-Cl-IB-MECA, respectively) and PI incorporation (ratio DIV4/DIV2 3.3 ± 0.3 and 1.3 ± 0.1 in NMDA and NMDA+2-Cl-IB-MECA, respectively) assays. Intravitreal 2-Cl-IB-MECA administration afforded protection against I-R injury decreasing the number of TUNEL(+) cells by 72%, and increased RGC survival by 57%. Also, intravitreal administration of 2-Cl-IB-MECA inhibited apoptosis (from 449.4 ± 37.8 to 207.6 ± 48.9 annexin-V(+)-cells) and RGC loss (from 1.2 ± 0.6 to 8.1 ± 1.7 cells/mm) induced by pONT. This study demonstrates that 2-Cl-IB-MECA is neuroprotective to the retina, both in vitro and in vivo. Activation of A3R may have great potential in the management of retinal neurodegenerative diseases characterized by RGC death, as glaucoma and diabetic retinopathy, and ischemic diseases.

  7. Workshop on hypersonic flow OREX A-1 and A-3

    OpenAIRE

    Wada, Yasuhiro; 和田 安弘

    1994-01-01

    Hypersonic flows around the Orbital Reentry Experiment (OREX) were solved as an entry of the hypersonic CFD (Computational Fluid Dynamics) workshop. Here, the subjects OREX A-1 and A-3 were chosen, being ideal and non-equilibrium gas flow problems, respectively. For the non-equilibrium gas calculation, Park's two-temperature model and Blottner's seven-species chemical reaction model were used in order to take accounts of thermal non-equilibrium effects as well as chemical ones. In this comput...

  8. Bacoside A3--a triterpenoid saponin from Bacopa monniera.

    Science.gov (United States)

    Rastogi, S; Pal, R; KulshreshthaDK

    1994-05-01

    A new triterpenoid saponin, bacoside A3, a constituent of bacosides the saponin mixture of Bacopa monniera, was isolated and characterized. Its structure was established as 3-beta-[O-beta-D-glucopyranosyl(1-->3)-O- [alpha-L-arabinofuranosyl(1-->2) ]O-beta-D-glucopyranosyl)oxy]jujubogenin by chemical and spectral analyses. The cis-isomer of ebelin lactone was also obtained as one of the artefacts of the aglycone and its structure revised.

  9. A 3D bus interconnect for network line cards

    OpenAIRE

    Engel, J; Kocak, T

    2004-01-01

    In this paper, we propose a 3D bus architecture as a processor-memory interconnection system to increase the throughput of the memory system currently used on line cards. The 3D bus architecture allows multiple processing elements on a line card to access a shared memory. The main advantage of the proposed architecture is to increase the network processor off-chip memory bandwidth while diminishing the latency otherwise caused by the single bus competition.

  10. Phonons in A3C60 Lattice and Structural Dynamics

    Directory of Open Access Journals (Sweden)

    Sven Larsson

    2010-01-01

    Full Text Available The critical temperature ( of superconductivity in A3C60 compounds is generally lower smaller with alkali atoms (A. Furthermore decreases with applied pressure. In the BCS model, these trends are explained by the lower density of states at the Fermi level for a decreased lattice constant (R. There is more than one counterexample, however, suggesting that BCS does not give the whole truth. The most important one is that the compound with the largest lattice constant, Cs3C60, is not superconducting at all at ambient pressure. In this paper we derive a novel model where a negative lattice contribution to Hubbard U, proportional to 1/R, is taken into account. It is possible to explain why A3C60 compounds with A = Li, and Na have a low or are not superconducting at all, and why Cs3C60 is superconducting only at applied pressure and then with the highest of all C60 alkali fullerides. It is concluded that the density of states mechanism derived in the BCS model is in doubt. Nevertheless superconductivity in A3C60 depends on electron-phonon coupling. The dominating phonon is the bond stretching Ag phonon, a breathing phonon for the whole fullerene molecular ion.

  11. Accuracy analysis and design of A3 parallel spindle head

    Science.gov (United States)

    Ni, Yanbing; Zhang, Biao; Sun, Yupeng; Zhang, Yuan

    2016-03-01

    As functional components of machine tools, parallel mechanisms are widely used in high efficiency machining of aviation components, and accuracy is one of the critical technical indexes. Lots of researchers have focused on the accuracy problem of parallel mechanisms, but in terms of controlling the errors and improving the accuracy in the stage of design and manufacturing, further efforts are required. Aiming at the accuracy design of a 3-DOF parallel spindle head(A3 head), its error model, sensitivity analysis and tolerance allocation are investigated. Based on the inverse kinematic analysis, the error model of A3 head is established by using the first-order perturbation theory and vector chain method. According to the mapping property of motion and constraint Jacobian matrix, the compensatable and uncompensatable error sources which affect the accuracy in the end-effector are separated. Furthermore, sensitivity analysis is performed on the uncompensatable error sources. The sensitivity probabilistic model is established and the global sensitivity index is proposed to analyze the influence of the uncompensatable error sources on the accuracy in the end-effector of the mechanism. The results show that orientation error sources have bigger effect on the accuracy in the end-effector. Based upon the sensitivity analysis results, the tolerance design is converted into the issue of nonlinearly constrained optimization with the manufacturing cost minimum being the optimization objective. By utilizing the genetic algorithm, the allocation of the tolerances on each component is finally determined. According to the tolerance allocation results, the tolerance ranges of ten kinds of geometric error sources are obtained. These research achievements can provide fundamental guidelines for component manufacturing and assembly of this kind of parallel mechanisms.

  12. Accuracy Analysis and Design of A3 Parallel Spindle Head

    Institute of Scientific and Technical Information of China (English)

    NI Yanbing; ZHANG Biao; SUN Yupeng; ZHANG Yuan

    2016-01-01

    As functional components of machine tools, parallel mechanisms are widely used in high efficiency machining of aviation components, and accuracy is one of the critical technical indexes. Lots of researchers have focused on the accuracy problem of parallel mechanisms, but in terms of controlling the errors and improving the accuracy in the stage of design and manufacturing, further efforts are required. Aiming at the accuracy design of a 3-DOF parallel spindle head(A3 head), its error model, sensitivity analysis and tolerance allocation are investigated. Based on the inverse kinematic analysis, the error model of A3 head is established by using the first-order perturbation theory and vector chain method. According to the mapping property of motion and constraint Jacobian matrix, the compensatable and uncompensatable error sources which affect the accuracy in the end-effector are separated. Furthermore, sensitivity analysis is performed on the uncompensatable error sources. The sensitivity probabilistic model is established and the global sensitivity index is proposed to analyze the influence of the uncompensatable error sources on the accuracy in the end-effector of the mechanism. The results show that orientation error sources have bigger effect on the accuracy in the end-effector. Based upon the sensitivity analysis results, the tolerance design is converted into the issue of nonlinearly constrained optimization with the manufacturing cost minimum being the optimization objective. By utilizing the genetic algorithm, the allocation of the tolerances on each component is finally determined. According to the tolerance allocation results, the tolerance ranges of ten kinds of geometric error sources are obtained. These research achievements can provide fundamental guidelines for component manufacturing and assembly of this kind of parallel mechanisms.

  13. A 3D Optical Metamaterial Made by Self-Assembly

    KAUST Repository

    Vignolini, Silvia

    2011-10-24

    Optical metamaterials have unusual optical characteristics that arise from their periodic nanostructure. Their manufacture requires the assembly of 3D architectures with structure control on the 10-nm length scale. Such a 3D optical metamaterial, based on the replication of a self-assembled block copolymer into gold, is demonstrated. The resulting gold replica has a feature size that is two orders of magnitude smaller than the wavelength of visible light. Its optical signature reveals an archetypal Pendry wire metamaterial with linear and circular dichroism. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Topological Quantum Information in a 3D Neutral Atom Array

    Science.gov (United States)

    2015-01-02

    v Prescribed by ANSI Std. Z39.18 12-23-2014 Final 12-01-2008-9-30-2014 ( DARPA ) TOPOLOGICAL QUANTUM INFORMATION IN A 3D NEUTRAL ATOM ARRAY FA9550-09...1-0041 David Weiss Penn State UP76XR0 AFOSR DARPA Approved for public release Work was performed to build core elements of a quantum computer...Hamiltonian within our trapped neutral atoms architecture. quantum computing, ultracold atoms David Weiss 814-861-3578 1 DARPA Final Report Grant

  15. A 3D Babcock-Leighton Solar Dynamo Model

    CERN Document Server

    Miesch, Mark S

    2014-01-01

    We present a 3D kinematic solar dynamo model in which poloidal field is generated by the emergence and dispersal of tilted sunspot pairs (more generally Bipolar Magnetic Regions, or BMRs). The axisymmetric component of this model functions similarly to previous 2D Babcock-Leighton (BL) dynamo models that employ a double-ring prescription for poloidal field generation but we generalize this prescription into a 3D flux emergence algorithm that places BMRs on the surface in response to the dynamo-generated toroidal field. In this way, the model can be regarded as a unification of BL dynamo models (2D in radius/latitude) and surface flux transport models (2D in latitude/longitude) into a more self-consistent framework that captures the full 3D structure of the evolving magnetic field. The model reproduces some basic features of the solar cycle including an 11-yr periodicity, equatorward migration of toroidal flux in the deep convection zone, and poleward propagation of poloidal flux at the surface. The poleward-p...

  16. con el aborto provocado

    Directory of Open Access Journals (Sweden)

    José Luis Redondo Calderón

    2008-01-01

    Full Text Available Las vacunas de células diploides humanas (WI-38, MRC-5 tienen un origen éticamente objetable, dado que dichas células proceden de abortos provocados. Entre ellas destacan vacunas empleadas contra rubéola, sarampión, parotiditis, rabia, poliomielitis, viruela, hepatitis A, varicela y herpes zóster. Actualmente se encuentran en desarrollo otras vacunas cultivadas en células (293, PER.C6 transformadas mediante virus, procedentes de abortos. Entre ellas hay vacunas contra la gripe, virus respiratorio sincitial, parainfl uenza, HIV, virus del Nilo Occidental, virus Ébola, Marburg y Lassa, hepatitis B y C, glosopeda, encefalitis japonesa, dengue, tuberculosis, carbunco, peste, tétanos y paludismo. También con igual origen se trabaja en la elaboración de anticuerpos monoclonales y otras proteínas, terapia génica y genómica. Existe la tecnología necesaria para producir todo lo descrito sin recurrir a abortos provocados. Debe indicarse en los prospectos de vacunas y otros productos el origen de las células empleadas. Debe facilitarse el acceso a las vacunas existentes no cultivadas en células procedentes de abortos provocados. Debe potenciarse la investigación de opciones en aquellos casos en los que no exista una vacuna no originada en células procedentes de abortos provocados. Debe potenciarse la elaboración de anticuerpos monoclonales y de otras proteínas, así como la terapia génica y la genómica sin recurrir a células procedentes de abortos provocados. No sería consecuente rechazar productos obtenidos a partir de células troncales embrionarias y aceptar los originados en células procedentes de abortos provocados. Se debe evitar que la biotecnología basada en el aborto provocado invada todos los terrenos de la medicina.

  17. Calidad de vida de los pacientes con inmunodeficiencias primarias de anticuerpos

    Directory of Open Access Journals (Sweden)

    Rodolfo Muriel-Vizcaíno

    2016-02-01

    análisis de covarianza. Se incluyeron 28 pacientes. La mediana de edad fue 5 años y 5 meses. Resultados: el promedio de edad al diagnóstico fue de 6 años con 3 meses. La mediana de retraso diagnóstico fue de 3 años 3 meses. El promedio de calidad de vida en los pacientes fue de 74.1 (DE ± 13.8 y de 83.3 (DE ± 10.1 para los controles (p = 0.005. La relación entre calidad de vida, retraso diagnóstico y presencia de complicaciones se analizó mediante un modelo lineal que fue marginalmente significativo (p = 0.056. Se encontró correlación negativa entre concentraciones de IgG en el último año y la calidad de vida. Se observó que, en los pacientes que presentaban bronquiectasias, conforme aumentan los años de retraso en el diagnóstico la calidad de vida disminuye de forma significativa (p = 0.007. Conclusiones: consideramos necesario evaluar la calidad de vida para conocer el estado de salud de los pacientes con inmunodeficiencias primarias y para su seguimiento durante el tratamiento con el objeto de incidir no sólo en la reducción del número de infecciones, hospitalizaciones y complicaciones, sino también en la mejoría de su calidad de vida. Deberá diseñarse un instrumento específico para evaluar la calidad de vida de los pacientes con inmunodeficiencias primarias.

  18. Anticuerpos antifosfolípidos en nefropatía membranosa idiopática

    OpenAIRE

    Ardiles A,Leopoldo; Blackburn T,Eileen; Alruiz S,Paula; Flores W,Claudio; Mezzano A,Sergio

    2005-01-01

    Background: Antiphospholipid antibodies have been found in the sera from patients with idiopathic and secondary glomerulopathies, mainly related to lupus. No special attention has been devoted to idiopathic membranous nephropathy, a glomerular disease with a high frequency of thrombotic complications, particularly of the renal vein. Aim: To study the presence and significance of antiphospholipid antibodies in idiopathic membranous nephropathy. Material and methods: Anticardiolipin and anti-ß2...

  19. Uso de una conantokina y anticuerpos policlonales para identificar la subunidad NR2B del receptor

    OpenAIRE

    2010-01-01

    Objetivo. Proponer una metodología de identificación de la subunidad NR2B, mediante el uso de conantokina G, así como una adecuada extracción de la subunidad NR2B. Materiales y métodos. Se ensayaron dos metodologías para la extracción de la subunidad NR2B de cerebro de rata adulta, la primera buscó la extracción de la subunidad a partir de la membrana mediante la utilización del detergente deoxicolato de sodio y la segunda, garantizó primero la solubilización y eliminación de proteínas citopl...

  20. A 3D Printed Toolbox for Opto-Mechanical Components

    Science.gov (United States)

    P. Torres, Juan; Valencia, Alejandra

    2017-01-01

    In this article we present the development of a set of opto-mechanical components (a kinematic mount, a translation stage and an integrating sphere) that can be easily built using a 3D printer based on Fused Filament Fabrication (FFF) and parts that can be found in any hardware store. Here we provide a brief description of the 3D models used and some details on the fabrication process. Moreover, with the help of three simple experimental setups, we evaluate the performance of the opto-mechanical components developed by doing a quantitative comparison with its commercial counterparts. Our results indicate that the components fabricated are highly customizable, low-cost, require a short time to be fabricated and surprisingly, offer a performance that compares favorably with respect to low-end commercial alternatives. PMID:28099494

  1. Chapter A3. Cleaning of Equipment for Water Sampling

    Science.gov (United States)

    Wilde, Franceska D.; Radtke, Dean B.; Gibs, Jacob; Iwatsubo, Rick T.

    1998-01-01

    The National Field Manual for the Collection of Water-Quality Data (National Field Manual) describes protocols and provides guidelines for U.S. Geological Survey (USGS) personnel who collect data used to assess the quality of the Nation's surface-water and ground-water resources. Chapter A3 describes procedures for cleaning the equipment used to collect and process samples of surface water and ground water and procedures for assessing the efficacy of the equipment-cleaning process. This chapter is designed for use with the other chapters of this field manual. Each chapter of the National Field Manual is published separately and revised periodically. Newly published and revised chapters will be posted on the USGS page 'National Field Manual for the Collection of Water-Quality Data.' The URL for this page is http://pubs.water.usgs.gov/twri9A/ (accessed September 20, 2004).

  2. A 3D Printed Toolbox for Opto-Mechanical Components

    CERN Document Server

    Salazar-Serrano, L J; Torres, J P

    2016-01-01

    Nowadays is very common to find headlines in the media where it is stated that 3D printing is a technology called to change our lives in the near future. For many authors, we are living in times of a third industrial revolution. Howerver, we are currently in a stage of development where the use of 3D printing is advantageous over other manufacturing technologies only in rare scenarios. Fortunately, scientific research is one of them. Here we present the development of a set of opto-mechanical components that can be built easily using a 3D printer based on Fused Filament Fabrication (FFF) and parts that can be found on any hardware store. The components of the set presented here are highly customizable, low-cost, require a short time to be fabricated and offer a performance that compares favorably with respect to low-end commercial alternatives.

  3. Piebaldism in a 3-month-old infant: Case report

    Directory of Open Access Journals (Sweden)

    Milankov Olgica

    2014-01-01

    Full Text Available Introduction. Piebaldism is an autosomal dominant disorder characterized by the congenital absence of melanocytes in the affected areas of skin and hair due to mutations of the KIT protooncogene, which affects the differentiation and migration of melanoblasts. Case report. A 3 ½ month old male infant was admitted to hospital due to depigmentation of skin in the area of forehead, trunk and extremities. On admission, he had multiple, irregularly shaped areas of leucoderma present at the forehead, abdomen, lower legs and left forearm. Based on the characteristic skin features and family history, we diagnosed the boy’s leucoderma as piebaldism. Conclusion. Vitiligo differs from piebaldism by the presence of unstable hypopigmented lesions that are acquired later in life. Albinism presents with widespread skin involvement and lacks the characteristic hyperpigmented macules within hypopigmented areas.

  4. Subcutaneous scrotal dirofilariasis in a 3- year- old boy

    Directory of Open Access Journals (Sweden)

    Biserka Pigac

    2016-07-01

    Full Text Available Dirofilariasis is a zoonosis caused by parasites the genus Dirofilaria, most common species are D. repens and D. immitis. This parasitosis rarely affects humans and it is usually asymptomatic. Canines are considered to be the reservoir of the parasite, yet the parasite is transmitted via mosquito bite. We present a case of subcutaneous scrotal dirofilariasis in a 3-year-old boy from north- western part of Croatia, where this zoonosis's not endemic, which characterizes this entity as rarity in this part of the country. In this case, parasitic infestation was manifested as painless scrotal nodule up to 1 cm in its largest diameter. Surgical excision revealed a thread- like material exiting the incision site. According to well –preserved morphologic characteristics, the specimen was characterized as a helminth of the genus Dirofilaria. We emphasize the importance of dirofilariasis in patients with subcutaneous nodules. And increase the awareness level of these parasites among clinicians and pathologists.

  5. Initial Test Results from a 3-axis Vibrating Ring Gyroscope

    Energy Technology Data Exchange (ETDEWEB)

    Gallacher, B J; Neasham, J A; Burdess, J S; Harris, A J [INSAT University of Newcastle upon Tyne NE1 7RU (United Kingdom)

    2006-04-01

    There are several application areas where the simultaneous measurement of rates of rotation about three mutually orthogonal axes is required. In this paper the principle features of a 3-axis vibrating ring gyroscope are described. The fabrication process for the gyroscope is presented and employs standard MEMS techniques. The modal properties for the ring are measured experimentally using laser vibrometry and electrostatic sensing and compared with the design predictions. In operation as a rate gyroscope it is necessary to excite the primary motion of the gyroscope and control is amplitude. As Q-factors of vibratory gyroscope are typically of the order 10{sup 3}-10{sup 4} slight variations in environmental conditions will perturb the natural frequency of the primary mode significantly. To ensure the primary motion of the gyroscope is maintained with constant amplitude a control scheme employing both frequency tracking and amplitude control is required. An electronic control system using digital signal processing (DSP) has been developed to ensure excitation of the primary motion occurs at resonance with controlled amplitude. The control scheme employs an embedded processor to generate the drive frequency (via a D/A converter) and to monitor the primary vibration (via an A/D converter). Experimental results from the control scheme highlighting its effectiveness over conventional PLL approaches are presented.

  6. A 3D printed electromagnetic nonlinear vibration energy harvester

    Science.gov (United States)

    Constantinou, P.; Roy, S.

    2016-09-01

    A 3D printed electromagnetic vibration energy harvester is presented. The motion of the device is in-plane with the excitation vibrations, and this is enabled through the exploitation of a leaf isosceles trapezoidal flexural pivot topology. This topology is ideally suited for systems requiring restricted out-of-plane motion and benefits from being fabricated monolithically. This is achieved by 3D printing the topology with materials having a low flexural modulus. The presented system has a nonlinear softening spring response, as a result of designed magnetic force interactions. A discussion of fatigue performance is presented and it is suggested that whilst fabricating, the raster of the suspension element is printed perpendicular to the flexural direction and that the experienced stress is as low as possible during operation, to ensure longevity. A demonstrated power of ˜25 μW at 0.1 g is achieved and 2.9 mW is demonstrated at 1 g. The corresponding bandwidths reach up-to 4.5 Hz. The system’s corresponding power density of ˜0.48 mW cm-3 and normalised power integral density of 11.9 kg m-3 (at 1 g) are comparable to other in-plane systems found in the literature.

  7. Spectral analysis of the Dirac operator on a 3-sphere

    CERN Document Server

    Fang, Yan-Long; Vassiliev, Dmitri

    2016-01-01

    We study the (massless) Dirac operator on a 3-sphere equipped with Riemannian metric. For the standard metric the spectrum is known. In particular, the eigenvalues closest to zero are the two double eigenvalues +3/2 and -3/2. Our aim is to analyse the behaviour of eigenvalues when the metric is perturbed in an arbitrary smooth fashion from the standard one. We derive explicit asymptotic formulae for the two eigenvalues closest to zero. Note that these eigenvalues remain double eigenvalues under perturbations of the metric: they cannot split because of a particular symmetry of the Dirac operator in dimension three (it commutes with the antilinear operator of charge conjugation). Our asymptotic formulae show that in the first approximation our two eigenvalues maintain symmetry about zero and are completely determined by the increment of Riemannian volume. Spectral asymmetry is observed only in the second approximation of the perturbation process. As an example we consider a special family of metrics, the so-cal...

  8. Multiphysics & Parallel Kinematics Modeling of a 3DOF MEMS Mirror

    Directory of Open Access Journals (Sweden)

    Mamat N.

    2015-01-01

    Full Text Available This paper presents a modeling for a 3DoF electrothermal actuated micro-electro-mechanical (MEMS mirror used to achieve scanning for optical coherence tomography (OCT imaging. The device is integrated into an OCT endoscopic probe, it is desired that the optical scanner have small footprint for minimum invasiveness, large and flat optical aperture for large scanning range, low driving voltage and low power consumption for safety reason. With a footprint of 2mm×2mm, the MEMS scanner which is also called as Tip-Tilt-Piston micro-mirror, can perform two rotations around x and y-axis and a vertical translation along z-axis. This work develops a complete model and experimental characterization. The modeling is divided into two parts: multiphysics characterization of the actuators and parallel kinematics studies of the overall system. With proper experimental procedures, we are able to validate the model via Visual Servoing Platform (ViSP. The results give a detailed overview on the performance of the mirror platform while varying the applied voltage at a stable working frequency. The paper also presents a discussion on the MEMS control system based on several scanning trajectories.

  9. Computing Radiative Transfer in a 3D Medium

    Science.gov (United States)

    Von Allmen, Paul; Lee, Seungwon

    2012-01-01

    A package of software computes the time-dependent propagation of a narrow laser beam in an arbitrary three- dimensional (3D) medium with absorption and scattering, using the transient-discrete-ordinates method and a direct integration method. Unlike prior software that utilizes a Monte Carlo method, this software enables simulation at very small signal-to-noise ratios. The ability to simulate propagation of a narrow laser beam in a 3D medium is an improvement over other discrete-ordinate software. Unlike other direct-integration software, this software is not limited to simulation of propagation of thermal radiation with broad angular spread in three dimensions or of a laser pulse with narrow angular spread in two dimensions. Uses for this software include (1) computing scattering of a pulsed laser beam on a material having given elastic scattering and absorption profiles, and (2) evaluating concepts for laser-based instruments for sensing oceanic turbulence and related measurements of oceanic mixed-layer depths. With suitable augmentation, this software could be used to compute radiative transfer in ultrasound imaging in biological tissues, radiative transfer in the upper Earth crust for oil exploration, and propagation of laser pulses in telecommunication applications.

  10. A 3D radiative transfer framework. IX. Time dependence

    Science.gov (United States)

    Jack, D.; Hauschildt, P. H.; Baron, E.

    2012-10-01

    Context. Time-dependent, 3D radiation transfer calculations are important for the modeling of a variety of objects, from supernovae and novae to simulations of stellar variability and activity. Furthermore, time-dependent calculations can be used to obtain a 3D radiative equilibrium model structure via relaxation in time. Aims: We extend our 3D radiative transfer framework to include direct time dependence of the radiation field; i.e., the ∂I/∂t terms are fully considered in the solution of radiative transfer problems. Methods: We build on the framework that we have described in previous papers in this series and develop a subvoxel method for the ∂I/∂t terms. Results: We test the implementation by comparing the 3D results to our well tested 1D time dependent radiative transfer code in spherical symmetry. A simple 3D test model is also presented. Conclusions: The 3D time dependent radiative transfer method is now included in our 3D RT framework and in PHOENIX/3D.

  11. A 3D radiative transfer framework IX. Time dependence

    CERN Document Server

    Jack, D; Baron, E

    2012-01-01

    Context. Time-dependent, 3D radiation transfer calculations are important for the modeling of a variety of objects, from supernovae and novae to simulations of stellar variability and activity. Furthermore, time-dependent calculations can be used to obtain a 3D radiative equilibrium model structure via relaxation in time. Aims. We extend our 3D radiative transfer framework to include direct time dependence of the radiation field; i.e., the $\\partial I/ \\partial t$ terms are fully considered in the solution of radiative transfer problems. Methods. We build on the framework that we have described in previous papers in this series and develop a subvoxel method for the $\\partial I/\\partial t$ terms. Results. We test the implementation by comparing the 3D results to our well tested 1D time dependent radiative transfer code in spherical symmetry. A simple 3D test model is also presented. Conclusions. The 3D time dependent radiative transfer method is now included in our 3D RT framework and in PHOENIX/3D.

  12. Cardiometabolic Health in Submariners Returning from a 3-Month Patrol

    Directory of Open Access Journals (Sweden)

    Heath G. Gasier

    2016-02-01

    Full Text Available Confined space, limited exercise equipment, rotating shift work and reduced sleep may affect cardiometabolic health in submariners. To test this hypothesis, 53 male U.S. Submariners (20–39 years were studied before and after a 3-month routine submarine patrol. Measures included anthropometrics, dietary and physical activity, biomarkers of cardiometabolic health, energy and appetite regulation, and inflammation. Before deployment, 62% of submariners had a body fat % (BF% ≥ 25% (obesity, and of this group, 30% met the criteria for metabolic syndrome. In obese volunteers, insulin, the homeostatic model assessment of insulin resistance (HOMA-IR, leptin, the leptin/adiponectin ratio, and pro-inflammatory chemokines growth-related oncogene and macrophage-derived chemokine were significantly higher compared to non-obese submariners. Following the patrol, a significant mean reduction in body mass (5% and fat-mass (11% occurred in the obese group as a result of reduced energy intake (~2000 kJ during the patrol; and, independent of group, modest improvements in serum lipids and a mean reduction in interferon γ-induced protein 10 and monocyte chemotactic protein 1 were observed. Since 43% of the submariners remained obese, and 18% continued to meet the criteria for metabolic syndrome following the patrol, the magnitude of weight loss was insufficient to completely abolish metabolic dysfunction. Submergence up to 3-months, however, does not appear to be the cause of obesity, which is similar to that of the general population.

  13. Plasma environment of Titan: a 3-D hybrid simulation study

    Directory of Open Access Journals (Sweden)

    S. Simon

    2006-05-01

    Full Text Available Titan possesses a dense atmosphere, consisting mainly of molecular nitrogen. Titan's orbit is located within the Saturnian magnetosphere most of the time, where the corotating plasma flow is super-Alfvénic, yet subsonic and submagnetosonic. Since Titan does not possess a significant intrinsic magnetic field, the incident plasma interacts directly with the atmosphere and ionosphere. Due to the characteristic length scales of the interaction region being comparable to the ion gyroradii in the vicinity of Titan, magnetohydrodynamic models can only offer a rough description of Titan's interaction with the corotating magnetospheric plasma flow. For this reason, Titan's plasma environment has been studied by using a 3-D hybrid simulation code, treating the electrons as a massless, charge-neutralizing fluid, whereas a completely kinetic approach is used to cover ion dynamics. The calculations are performed on a curvilinear simulation grid which is adapted to the spherical geometry of the obstacle. In the model, Titan's dayside ionosphere is mainly generated by solar UV radiation; hence, the local ion production rate depends on the solar zenith angle. Because the Titan interaction features the possibility of having the densest ionosphere located on a face not aligned with the ram flow of the magnetospheric plasma, a variety of different scenarios can be studied. The simulations show the formation of a strong magnetic draping pattern and an extended pick-up region, being highly asymmetric with respect to the direction of the convective electric field. In general, the mechanism giving rise to these structures exhibits similarities to the interaction of the ionospheres of Mars and Venus with the supersonic solar wind. The simulation results are in agreement with data from recent Cassini flybys.

  14. A 3D measurement of the offset in paleoseismological studies

    Science.gov (United States)

    Ferrater, Marta; Echeverria, Anna; Masana, Eulàlia; Martínez-Díaz, José J.; Sharp, Warren D.

    2016-05-01

    The slip rate of a seismogenic fault is a crucial parameter for establishing the contribution of the fault to the seismic hazard. It is calculated from measurements of the offset of linear landforms, such channels, produced by the fault combined with their age. The three-dimensional measurement of offset in buried paleochannels is subject to uncertainties that need to be quantitatively assessed and propagated into the slip rate. Here, we present a set of adapted scripts to calculate the net, lateral and vertical tectonic offset components caused by faults, together with their associated uncertainties. This technique is applied here to a buried channel identified in the stratigraphic record during a paleoseismological study at the El Saltador site (Alhama de Murcia fault, Iberian Peninsula). After defining and measuring the coordinates of the key points of a buried channel in the walls of eight trenches excavated parallel to the fault, we (a) adjusted a 3D straight line to these points and then extrapolated the tendency of this line onto a simplified fault plane; (b) repeated these two steps for the segment of the channel in the other side of the fault; and (c) measured the distance between the two resulting intersection points with the fault plane. In doing so, we avoided the near fault modification of the channel trace and obtained a three-dimensional measurement of offset and its uncertainty. This methodology is a substantial modification of previous procedures that require excavating progressively towards the fault, leading to possible underestimation of offset due to diffuse deformation near the fault. Combining the offset with numerical dating of the buried channel via U-series on soil carbonate, we calculated a maximum estimate of the net slip rate and its vertical and lateral components for the Alhama de Murcia fault.

  15. The Physics and Applications of a 3D Plasmonic Nanostructure

    Science.gov (United States)

    Terranova, Brandon B.

    In this work, the dynamics of electromagnetic field interactions with free electrons in a 3D metallic nanostructure is evaluated theoretically. This dissertation starts by reviewing the relevant fundamentals of plasmonics and modern applications of plasmonic systems. Then, motivated by the need to have a simpler way of understanding the surface charge dynamics on complex plasmonic nanostructures, a new plasmon hybridization tree method is introduced. This method provides the plasmonicist with an intuitive way to determine the response of free electrons to incident light in complex nanostructures within the electrostatic regime. Next, a novel 3D plasmonic nanostructure utilizing reflective plasmonic coupling is designed to perform biosensing and plasmonic tweezing applications. By applying analytical and numerical methods, the effectiveness of this nanostructure at performing these applications is determined from the plasmonic response of the nanostructure to an excitation beam of coherent light. During this analysis, it was discovered that under certain conditions, this 3D nanostructure exhibits a plasmonic Fano resonance resulting from the interference of an in-plane dark mode and an out-of-plane bright mode. In evaluating this nanostructure for sensing changes in the local dielectric environment, a figure of merit of 68 is calculated, which is competitive with current localized surface plasmon resonance refractometric sensors. By evaluating the Maxwell stress tensor on a test particle in the vicinity of the nanostructure, it was found that under the right conditions, this plasmonic nanostructure design is capable of imparting forces greater than 10.5 nN on dielectric objects of nanoscale dimensions. The results obtained in these studies provides new routes to the design and engineering of 3D plasmonic nanostructures and Fano resonances in these systems. In addition, the nanostructure presented in this work and the design principles it utilizes have shown

  16. 16 CFR Appendix A3 to Part 305 - Refrigerator-Freezers With Partial Automatic Defrost

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Refrigerator-Freezers With Partial Automatic Defrost A3 Appendix A3 to Part 305 Commercial Practices FEDERAL TRADE COMMISSION REGULATIONS UNDER... LABELING RULEâ) Pt. 305, App. A3 Appendix A3 to Part 305—Refrigerator-Freezers With Partial...

  17. Actualización en el tratamiento de la osteoporosis: manejo desde una unidad del dolor (1.ª parte

    Directory of Open Access Journals (Sweden)

    R. Álvarez Álvarez

    2014-12-01

    Full Text Available La osteoporosis (OP se define como una enfermedad esquelética caracterizada por una resistencia ósea disminuida que predispone a un aumento en el riesgo de fracturas. En Europa se producen 2,7 millones de fracturas por fragilidad, tanto en hombres como mujeres, con un coste directo de 36 billones de euros. Estas fracturas se asocian con un incremento en la morbilidad y mortalidad. El riesgo de fractura osteoporótica viene determinado por la presencia de uno o más factores de riesgo y el descenso de la densidad mineral ósea (DMO valorado mediante la técnica Dual Energy X-ray absortiometry (DEXA, densitometría. La indicación de tratamiento se realiza en función del riesgo absoluto de fractura por fragilidad. En los pacientes con un bajo riesgo de fractura son suficientes las medidas higiénicas, prevención de caídas y mantener una ingesta adecuada de calcio y vitamina D. En los pacientes con un riesgo moderado se debe individualizar la necesidad de tratamiento farmacológico e iniciar el tratamiento en aquellos con alto riesgo de fractura. Los fármacos más utilizados son los bifosfonatos, inhibidores de la reabsorción ósea, también se utilizan fármacos osteoanabólicos como la hormona teriparatida y anticuerpos monoclonales como el denosumab.

  18. Actualización en el tratamiento de la osteoporosis: algoritmo de decisión: manejo desde una unidad del dolor (2.ª parte

    Directory of Open Access Journals (Sweden)

    F. Mendoza Garcés

    2015-04-01

    Full Text Available La heterogeneidad de los pacientes con osteoporosis hace necesaria una aproximación individualizada para conseguir un equilibrio entre los beneficios y limitaciones de los tratamientos disponibles. La indicación de este se realiza en función del riesgo absoluto de fractura por fragilidad. En los pacientes con un bajo riesgo de fractura son suficientes las medidas higiénicas, prevención de caídas y mantener una ingesta adecuada de calcio y vitamina D. En los pacientes con un riesgo moderado se debe individualizar la necesidad de tratamiento farmacológico e iniciar el tratamiento en aquellos con alto riesgo de fractura. Los fármacos más utilizados son los bifosfonatos, inhibidores de la reabsorción ósea, también se utilizan fármacos osteoanabólicos como la hormona teriparatida, y anticuerpos monoclonales como el denosumab. En los pacientes cuyo dolor no se controla de manera satisfactoria se ha de valorar la indicación de tratamientos mínimamente invasivos como bloqueos espinales, vertebroplastia o cifoplastia.

  19. [Illness due the Ebola virus: epidemiology and clinical manifestations within the context of an international public health emergency].

    Science.gov (United States)

    Carod-Artal, Francisco J

    2015-03-16

    Introduccion. La epidemia causada por el virus del Ebola en Africa occidental afecta a Guinea, Liberia, Sierra Leona, Nigeria, Mali y Senegal, y es la mas grave desde que se tiene noticia de este filovirus causante de fiebre hemorragica. En este articulo se revisan las caracteristicas epidemiologicas y las manifestaciones clinicas asociadas a la enfermedad por el virus del Ebola. Desarrollo. Hasta el 23 de febrero de 2015 se habian contabilizado 23.729 casos de ebola, con un 40,1% de mortalidad. En la actual epidemia, el virus se transmite al ser humano por tres vias: contacto con fluidos y secreciones de sujetos enfermos ya diagnosticados, contacto con cadaveres durante las ceremonias de enterramiento, y contagio a familiares y personal sanitario por enfermos sin diagnosticar. El Ebola causa una enfermedad grave en humanos. Tras un periodo de incubacion variable (2-21 dias), se inicia un sindrome febril, cefalea, mialgias, artralgias, vomitos y diarrea. La fase avanzada cursa con hemorragias, fracaso de multiples organos, hipotension y choque. Se desconoce la incidencia de manifestaciones neurologicas, aunque se han descrito hemorragias cerebrales y sindromes postinfecciosos en otras fiebres he­morragicas virales. Los cuidados de soporte son vitales. No existe un tratamiento efectivo demostrado, aunque varios pacientes han sido tratados con un coctel de anticuerpos monoclonales (ZMapp). Conclusiones. La identificacion y diagnostico precoz de casos sospechosos, el aislamiento de sujetos enfermos y las medidas de proteccion en el personal sanitario son fundamentales para contener esta epidemia.

  20. Leishmania mexicana: aspectos taxonómicos y rareza de la infección humana en Três Braços, Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    César Augusto Cuba Cuba

    1984-09-01

    Full Text Available Del estúdio de 51 stocks de Leishmania aislados de pacientes humanos de leishmaniasis cutaneomucosa en Três Braços, Bahia, Brasil, los autores describen, en detalle, el análisis de los dos únicos stocks de L. mexicana, identificando uno de ellos como L. mexicana amazonensis. El otro aislado permanece en posición taxonómica no definida pues considerándosele como un miembro de L. mexicana, encuéntranse dificultades para su identificación subespecífica. Evaluan también los parâmetros biológicos e isoenzimáticos y discuten el papel de los anticuerpos monoclonales en la tipificación de éstos stocks. Los autores remarcan la rareza de la transmisión de parásitos del complejo L. mexicana en esta región, aun cuando estudien epidemiológicamente por mais de 8 anos la infección humana.

  1. Deteccion de citomegalovirus mediante la tecnica de inmunoperoxidasa y aislamiento viral Cytomegalovirus detection by Immunoperoxidase assay and viral isolation

    Directory of Open Access Journals (Sweden)

    Maritza Alvarez

    1991-06-01

    Full Text Available En el presente estudio se comparó la técnica de inmunoperoxidasa para la detección de citomegalovirus (IPCMV utilizando anticuerpos monoclonales que reconocen proteínas precoces virales con el método convencional de aislamiento viral en fibroblastos humanos. Un total de 150 muestras de orina fueron examinadas encontrando una sensibilidad de un 89.8% y una especificidad de 91.3% de la técnica de IPCMV comparada con el aislamiento viral. Una de las ventajas que presentó la IPCMV fue la rapidez con que fueron obtenidos los resultados (48 horas mientras que el aislamiento viral fue como promedio 14 días.An Immunoperoxidase assay was applied to detect early antigens of Cytomegalovirus (CMV in 150 urine samples from immunocompromised patients, using the commercial available monoclonal antibody against CMV El3. The detection of early antigen by IP (IPCMV is compared to the conventional cell culture isolation regarding specificity and sensitivity in order to evaluate is usefulness in the diagnostic of CMV infections. The IPCMV showed a sensitivity of 89.8% and a specificity of 91.3% when compared to the isolation method. The great advantage of the IPCMV is based on the shorter time results are achieved, since 48-72 Hs can be enough to provide evidence of CMV infection, while in the isolation technique cytopatho-genic effect was present around 14 days after sample inoculation.

  2. Nuevos retos en el tratamiento y la investigación del cáncer de mama

    Directory of Open Access Journals (Sweden)

    Ana Lluch Hernández

    Full Text Available La terapia contra el cáncer ha experimentado importantes avances que se han producido con una celeridad inusitada. El arsenal terapéutico se ha intensificado en eficacia contando con los citostáticos o lo que se conoce comúnmente como "quimioterapia", fármacos de diferentes mecanismos de acción que inducen la apoptosis o muerte celular pero de su escasa especificidad para atacar exclusivamente la célula tumoral, afectando también a células sanas. Recientemente aparecen las nuevas terapias dirigidas contra un objetivo concreto, una proteína o un receptor de membrana ubicada en la célula tumoral,. Las primeras terapias antidiana introducidas fueron anticuerpos monoclonales de administración intravenosa, sin embargo en los últimos años hemos asistido a un verdadero "boom" con el desarrollo de una nueva familia de terapias dirigidas orales, llamadas inhibidores de tirosinquinasa. Estas novedades en apoyo a la cirugía y la oncorradiología con sus avances espectaculares de los últimos años han contribuido de forma muy importante a una mejora del control de la enfermedad o en la calidad de vida de los pacientes.

  3. Linfomas de la órbita y anexos oculares: Correlación clínico patológica de 25 casos

    Directory of Open Access Journals (Sweden)

    Erica A. Rojas Bilbao

    2010-08-01

    Full Text Available Se evaluaron las características clínicas, histológicas y la evolución de una cohorte de pacientes con linfomas de la órbita y anexos oculares. Entre 1995 y 2008 se estudiaron 25 casos de linfomas de la órbita y anexos oculares en un centro oncológico de referencia. En cada caso se analizó el inmunofenotipo usando un panel de anticuerpos monoclonales (CD45, CD20, CD3, CD5, CD23, BCL2, BCL6, BCL10, Ki67, CD30, CD15, BCL1, Kappa, Lambda, CD138. Las lesiones fueron evaluadas utilizando el sistema de clasificación de linfomas (OMS, 2008. Se analizaron 23 linfomas primarios y dos secundarios. Los subtipos histológicos fueron: 16 linfomas B de la zona marginal asociados a las mucosas (MALT, cuatro linfomas difusos de células grandes B, dos linfomas foliculares y un paciente con linfoma Hodgkin. De los 25 casos estudiados, 22 presentaron estadios localizados. El linfoma MALT fue el subtipo más frecuente. En este estudio se observó enfermedad localizada en la mayoría de los casos y con baja progresión a distancia.

  4. Lack of Association between a 3'UTR VNTR Polymorphism of Dopamine Transporter Gene (SLC6A3) and ADHD in a Brazilian Sample of Adult Patients

    Science.gov (United States)

    Aperecida da Silva, Maria; Cordeiro, Quirino; Louza, Mario; Vallada, Homero

    2011-01-01

    Objective: To investigate a possible association between a 3'UTR VNTR polymorphism of the dopamine transporter gene (SLC6A3) and ADHD in a Brazilian sample of adult patients. Method: Study Case-control with 102 ADHD adult outpatients ("DSM-IV" criteria) and 479 healthy controls. The primers' sequence used were: 3'UTR-Forward: 5' TGT GGT…

  5. Lack of Association between a 3'UTR VNTR Polymorphism of Dopamine Transporter Gene (SLC6A3) and ADHD in a Brazilian Sample of Adult Patients

    Science.gov (United States)

    Aperecida da Silva, Maria; Cordeiro, Quirino; Louza, Mario; Vallada, Homero

    2011-01-01

    Objective: To investigate a possible association between a 3'UTR VNTR polymorphism of the dopamine transporter gene (SLC6A3) and ADHD in a Brazilian sample of adult patients. Method: Study Case-control with 102 ADHD adult outpatients ("DSM-IV" criteria) and 479 healthy controls. The primers' sequence used were: 3'UTR-Forward: 5' TGT GGT GAT GGG…

  6. Identification and function of adenosine A3 receptor in afferent arterioles.

    Science.gov (United States)

    Lu, Yan; Zhang, Rui; Ge, Ying; Carlstrom, Mattias; Wang, Shaohui; Fu, Yiling; Cheng, Liang; Wei, Jin; Roman, Richard J; Wang, Lei; Gao, Xichun; Liu, Ruisheng

    2015-05-01

    Adenosine plays an important role in regulation of renal microcirculation. All receptors of adenosine, A1, A2A, A2B, and A3, have been found in the kidney. However, little is known about the location and function of the A3 receptor in the kidney. The present study determined the expression and role of A3 receptors in mediating the afferent arteriole (Af-Art) response and studied the interaction of A3 receptors with angiotensin II (ANG II), A1 and A2 receptors on the Af-Art. We found that the A3 receptor expressed in microdissected isolated Af-Art and the mRNA levels of A3 receptor were 59% of A1. In the isolated microperfused Af-Art, A3 receptor agonist IB-MECA did not have a constrictive effect. Activation of A3 receptor dilated the preconstricted Af-Art by norepinephrine and blunted the vasoconstrictive effect of both adenosine A1 receptor activation and ANG II on the Af-Art, respectively. Selective A2 receptor antagonist (both A2A and A2B) had no effect on A3 receptor agonist-induced vasodilation, indicating that the dilatory effect of A3 receptor activation is not mediated by activation of A2 receptor. We conclude that the A3 receptor is expressed in the Af-Art, and activation of the A3 receptor dilates the Af-Art.

  7. Data of evolutionary structure change: 1BS7A-3CPMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BS7A-3CPMA 1BS7 3CPM A A -----SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDM... 3CPM A 3CPMA THR CA 223 GLY CA 250 ILE CA 233 3CPM... A 3CPMA IKKYSDKLVPF ILE CA 313 ARG CA 309 GLN CA 237 3CPM

  8. Data of evolutionary structure change: 1BS5A-3CPMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BS5A-3CPMA 1BS5 3CPM A A -----SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDM...line> 3CPM A 3CPMA THR CA 218 GLY CA 252 ILE CA 234 3CPM... A 3CPMA IKKYSDKLVPFILE CA 320 ARG CA 317 GLN CA 243 3CPM

  9. Towards a 3D geo-information standard in the Netherlands

    NARCIS (Netherlands)

    Stoter, J.E.; Reuvers, M.; Vosselman, G.; Goos, J.; Van Berlo, L.; Zlatanova, S.; Verbree, E.; Klooster, R.

    2010-01-01

    This paper presents the ongoing research project in The Netherlands in which a large number of stakeholders are realising a 3D testbed based on selected use cases and test areas. The findings of the project will result in a Proof of Concept for a 3D Geoinformation standard and a 3D data infrastructu

  10. Data of evolutionary structure change: 1M40A-3BLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1M40A-3BLMA 1M40 3BLM A A HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEE...612 SER CA 833 ARG CA 954 GLY CA 1118 3BLM... A 3BLMA SGQAITYASR...confEVID> 1 3BLM A 3BLMA 2.768623113632202 2 3BLM

  11. Data of evolutionary structure change: 1CE7A-3CTKA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available K A 3CTKA LFPGVTNRVTL ...bChain>A 3CTKA HGKTINGQEIA ...dbChain> 3CTKA HKSSPQCTTINP ure>HH ...1CE7A-3CTKA 1CE7 3CTK A A YERGDLDVTAQTTGAGYFSFITLLRDYVSSGSFSNAIPL...IETEVVDRGLY-GSFKPNFKVLNLENNWGDISDAIHKSSPQCTTINPALQLISPSNDPWVVNKVSQISPDMGILKFKS EEEEEEE HHHHHHH

  12. Data of evolutionary structure change: 2A3KA-2QCTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available Chain>A 2QCTA IKGVY-GPKAY ...2A3KA-2QCTA 2A3K 2QCT A A --------NTPREVTLHFLRTAGHPLTRWALQRQPPSPK...dbID> A 2A3KA HYWPT---EEETY ...ure> ---EEEEEure> ATOM 1001 CA ...278 TYR CA 308 2QCT A 2QCT

  13. Data of evolutionary structure change: 1CH1A-3MBAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CH1A-3MBAA 1CH1 3MBA A A MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPE...4 ALA CA 195 GLU CA 242 LEU CA 314 3MBA... A 3MBAA NNAANAGKMSAML...12298584 2.589318037033081 1 3MBA... A 3MBAA

  14. Data of evolutionary structure change: 1CH2A-3MBAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CH2A-3MBAA 1CH2 3MBA A A MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPE...0 ALA CA 205 GLU CA 261 LEU CA 324 3MBA... A 3MBAA NNAANAGKMSAML...494857788 2.5804030895233154 1 3MBA... A 3MBAA

  15. Effets de l'élimination de la végétation concurrente sur l'humidité du sol et sur la croissance initiale d'une plantation monoclonale d'Eucalyptus 12ABLxsaligna

    Directory of Open Access Journals (Sweden)

    N'zala, D.

    1995-01-01

    Full Text Available Effects of the Herbaceous Vegetation Removing on the Soil Moisture and on the Initial Growth of a Monoclonal Plantation of Eucalyptus 12 ABL x Saligna. A trial has been carried out in congolese coastal savanna in order to determine the distance to which herbaceous vegetation should be removed around young Eucalyptus 12 ABL x saligna. Eucalyptus were planted within weeded circles of variable radius : 0, 35, 70, 105, 140 and 175 cm. Eight months afterplanting, the herbaceous vegetation did not have a negative sensible effect on the revival of the Eucalyptus. Twenty seven months after planting the rate of survival was still high. It accounted for about 59 % and superior to 78 % in the proof and other treatments respectively. The observations made on the vigor and the growth has shown that plants within circles of 0 and 35 cm radius were competed with spontaneous vegetation. Weedings within circles of 70 and 105 cm of radius were sufficient to preserve enough soil moisture and therefore to ensure the survival and to increase in very important proportions the growth of young Eucalyptus. A radius higher 105 cm has shown any significant advantage. It has been found that plantation watering mainly during dry season was capital to help plant juvenile growth.

  16. 75 FR 910 - Airworthiness Directives; General Electric Company CF34-1A, -3A, -3A1, -3A2, -3B, and -3B1...

    Science.gov (United States)

    2010-01-07

    ... instructions related to operators who fly a regional jet (RJ) with the CF34-3A1 engine as a business jet (BJ.... We also estimate that it would take about 2 work-hours per engine to perform the required actions... Company CF34-1A, -3A, -3A1, -3A2, -3B, and -3B1 Turbofan Engines AGENCY: Federal Aviation...

  17. De novo mutations in ATP1A3 cause alternating hemiplegia of childhood

    DEFF Research Database (Denmark)

    Heinzen, Erin L; Swoboda, Kathryn J; Hitomi, Yuki;

    2012-01-01

    and their unaffected parents to identify de novo nonsynonymous mutations in ATP1A3 in all seven individuals. In a subsequent sequence analysis of ATP1A3 in 98 other patients with AHC, we found that ATP1A3 mutations were likely to be responsible for at least 74% of the cases; we also identified one inherited mutation...... in a case of familial AHC. Notably, most AHC cases are caused by one of seven recurrent ATP1A3 mutations, one of which was observed in 36 patients. Unlike ATP1A3 mutations that cause rapid-onset dystonia-parkinsonism, AHC-causing mutations in this gene caused consistent reductions in ATPase activity without...... affecting the level of protein expression. This work identifies de novo ATP1A3 mutations as the primary cause of AHC and offers insight into disease pathophysiology by expanding the spectrum of phenotypes associated with mutations in ATP1A3....

  18. Nightglow vibrational distributions in the A3Σu+ and A'3Δu states of O2 derived from astronomical sky spectra

    Directory of Open Access Journals (Sweden)

    A. M. Widhalm

    2004-09-01

    Full Text Available Astronomical sky spectra from the Keck I telescope on Mauna Kea have been used to obtain vibrational distributions in the O2A3Σu+ and O2(A'3Δu states from rotationally-resolved Herzberg I and Chamberlain band emissions in the terrestrial nightglow. The A3Σu+ distribution is similar to that presented in earlier publications, with the exception that there is significant population in the previously undiscerned v=0 level. The vibrational distributions of the A'3Δu and A3Σu+ states are essentially the same when comparison is made in terms of the level energies. The intensity of Chamberlain band emission at the peak of the distribution is about one-fourth that of the Herzberg I emission, as previously shown, and may be related primarily to radiative efficiency. The peaks in both population distributions are about 0.25eV below the O(3P+O(3P dissociation limit. We compare these Herzberg state distributions with that of the O2(b1Σg+ state, concurring with others that the intense nightglow emission associated with b1Σg+(v=0 is a reflection of direct transfer from the Herzberg states. This process takes place following O2 collisions, with simultaneous production of very high a1Δg and b1Σg+ vibrational levels.

  19. Expression of annexin A3 in gastric cancer and its correlation with proliferation and apoptosis.

    Science.gov (United States)

    Zhai, Jing-Ming; Sun, Shi-Jun; Wang, Wei; Zeng, Chao

    2014-01-01

    Annexin A3 has been identified as a novel biomarker in different types of cancers. However, little is known about its clinical significances and and biological roles in gastric cancer. In this study, we assessed annexin A3 expression in 80 patients with gastric cancer and explore its correlation with prognosis Moreover, correlations with Ki-67, Bcl-2 and Bax were also investigated. Expression of annexin A3 was increased in gastric cancer compared with that in normal gastric tissues. Annexin A3 expression was significantly associated with tumor volume and TNM stage (pA3 was positive correlated with Ki-67 and Bcl-2 expression. Our study showed annexin A3 might be a potential prognostic marker for gastric cancer and involved in tumorigenesis by regulating apoptosis and proliferation.

  20. A3电源的三种待机控制电路

    Institute of Scientific and Technical Information of China (English)

    李洪臣

    2005-01-01

    三洋A3机芯电源(简称A3电源),因电路简单、电压稳定,被我国许多电视生产厂家采用。在不同型号彩电中,A3电源的待机电路不尽相同,常有以下三种待机控制电路。

  1. A role of autophagy in PTP4A3-driven cancer progression.

    Science.gov (United States)

    Huang, Yu-Han; Al-Aidaroos, Abdul Qader O; Yuen, Hiu-Fung; Zhang, Shu-Dong; Shen, Han-Ming; Rozycka, Ewelina; McCrudden, Cian M; Tergaonkar, Vinay; Gupta, Abhishek; Lin, You Bin; Thiery, Jean Paul; Murray, James T; Zeng, Qi

    2014-10-01

    Autophagy, a "self-eating" cellular process, has dual roles in promoting and suppressing tumor growth, depending on cellular context. PTP4A3/PRL-3, a plasma membrane and endosomal phosphatase, promotes multiple oncogenic processes including cell proliferation, invasion, and cancer metastasis. In this study, we demonstrate that PTP4A3 accumulates in autophagosomes upon inhibition of autophagic degradation. Expression of PTP4A3 enhances PIK3C3-BECN1-dependent autophagosome formation and accelerates LC3-I to LC3-II conversion in an ATG5-dependent manner. PTP4A3 overexpression also enhances the degradation of SQSTM1, a key autophagy substrate. These functions of PTP4A3 are dependent on its catalytic activity and prenylation-dependent membrane association. These results suggest that PTP4A3 functions to promote canonical autophagy flux. Unexpectedly, following autophagy activation, PTP4A3 serves as a novel autophagic substrate, thereby establishing a negative feedback-loop that may be required to fine-tune autophagy activity. Functionally, PTP4A3 utilizes the autophagy pathway to promote cell growth, concomitant with the activation of AKT. Clinically, from the largest ovarian cancer data set (GSE 9899, n = 285) available in GEO, high levels of expression of both PTP4A3 and autophagy genes significantly predict poor prognosis of ovarian cancer patients. These studies reveal a critical role of autophagy in PTP4A3-driven cancer progression, suggesting that autophagy could be a potential Achilles heel to block PTP4A3-mediated tumor progression in stratified patients with high expression of both PTP4A3 and autophagy genes.

  2. Pharmacology of the Adenosine A3 Receptor in the Vasculature and Essential Hypertension

    Science.gov (United States)

    Ho, Ming-Fen; Low, Leanne M.; Rose’Meyer, Roselyn B.

    2016-01-01

    Background Essential hypertension is considered to be a multifactorial disorder and its aetiology has yet to be clearly identified. As the adenosine receptors have a significant role in mediating vasodilation, alterations in their structures or signalling pathways may be involved in the development of hypertension. This study aimed to measure the expression of adenosine A3 receptors in a range of cardiovascular tissues and determine whether they could be altered with essential hypertension, and to functionally test responses to adenosine A3 receptor agonists in coronary blood vessels using the isolated perfused heart preparation. Methods mRNA samples from cardiovascular tissues and a range of blood vessels were collected from 10 week old male spontaneously hypertensive rats and age-gender matched Wistar rats (n = 8). The Langendorff heart perfusion preparation was used to characterise adenosine A3 receptor mediated coronary vasodilation in the rat heart. Results Adenosine A3 receptor agonists induced coronary vasodilation. The expression of adenosine A3 receptors in cardiovascular tissues was altered in a tissue-specific pattern. Specifically, down-regulation of adenosine A3 receptor expression occurred in hypertensive hearts, which might be associated with attenuated vasodilator responses observed in coronary vessels to adenosine A3 receptor agonists. Conclusions This study demonstrated alterations in the expression of adenosine A3 receptors occurred in a tissue specific mode, and reduced adenosine A3 receptor mediated coronary vasodilation in hearts from spontaneously hypertensive rats. Our findings with regard to changes in the adenosine A3 receptor in hypertensive hearts suggest that adenosine A3 receptor might play a role in the physiopathology of essential hypertension and potentially open the way to pharmacologic manipulation of vasomotor activity by the use of adenosine A3 receptor agonists. PMID:26907173

  3. SLC9A3R1 stimulates autophagy via BECN1 stabilization in breast cancer cells.

    Science.gov (United States)

    Liu, Hong; Ma, Yan; He, Hong-Wei; Wang, Jia-Ping; Jiang, Jian-Dong; Shao, Rong-Guang

    2015-01-01

    Autophagy, a self-catabolic process, has been found to be involved in abrogating the proliferation and metastasis of breast cancer. SLC9A3R1 (solute carrier family 9, subfamily A [NHE3, cation proton antiporter 3], member 3 regulator 1), a multifunctional scaffold protein, is involved in suppressing breast cancer cells proliferation and the SLC9A3R1-related signaling pathway regulates the activation of autophagy processes. However, the precise regulatory mechanism and signaling pathway of SLC9A3R1 in the regulation of autophagy processes in breast cancer cells remains unknown. Here, we report that the stability of BECN1, the major component of the autophagic core lipid kinase complex, is augmented in SLC9A3R1-overexpressing breast cancer MDA-MB-231 cells, subsequently stimulating autophagy by attenuating the interaction between BECN1 and BCL2. Initially, we found that SLC9A3R1 partially stimulated autophagy through the PTEN-PI3K-AKT1 signaling cascade in MDA-MB-231 cells. SLC9A3R1 then attenuated the interaction between BECN1 and BCL2 to stimulate the autophagic core lipid kinase complex. Further findings revealed that SLC9A3R1 bound to BECN1 and subsequently blocked ubiquitin-dependent BECN1 degradation. And the deletion of the C-terminal domain of SLC9A3R1 resulted in significantly reduced binding to BECN1. Moreover, the lack of C-terminal of SLC9A3R1 neither reduced the ubiquitination of BECN1 nor induced autophagy in breast cancer cells. The decrease in BECN1 degradation induced by SLC9A3R1 resulted in the activity of autophagy stimulation in breast cancer cells. These findings indicate that the SLC9A3R1-BECN1 signaling pathway participates in the activation of autophagy processes in breast cancer cells.

  4. Forskolin stimulates phosphorylation and membrane accumulation of UT-A3.

    Science.gov (United States)

    Blount, Mitsi A; Klein, Janet D; Martin, Christopher F; Tchapyjnikov, Dmitry; Sands, Jeff M

    2007-10-01

    UT-A1 is regulated by vasopressin and is localized to the apical membrane and intracellular compartment of inner medullary collecting duct (IMCD) cells. UT-A3 is also expressed in the IMCD and is regulated by forskolin in heterologous systems. The goal of the present study is to investigate mechanisms by which vasopressin regulates UT-A3 in rat IMCD. In fresh suspensions of rat IMCD, forskolin increases the phosphorylation of UT-A3, similar to UT-A1. Biotinylation studies indicate that UT-A3 is located in the plasma membrane. Forskolin treatment increases the abundance of UT-A3 in the plasma membrane similar to UT-A1. However, these two transporters do not form a complex through a protein-protein interaction, suggesting that transporter function is unique to each protein. While immunohistochemistry localized UT-A3 to the basal and lateral membranes, a majority of the staining was cytosolic. Immunohistochemistry of vasopressin-treated rat kidney sections also localized UT-A3 primarily to the cytosol with basal and lateral membrane staining but also showed some apical membrane staining in some IMCD cells. This suggests that under normal conditions, UT-A3 functions as the basolateral transporter but in a high cAMP environment, the transporter may move from the cytosol to all plasma membranes to increase urea flux in the IMCD. In summary, this study confirms that UT-A3 is located in the inner medullary tip where it is expressed in the basolateral membrane, shows that UT-A3 is a phosphoprotein in rat IMCD that can be trafficked to the plasma membrane independent of UT-A1, and suggests that vasopressin may induce UT-A3 expression in the apical plasma membrane of IMCD.

  5. Identification of A3 adenosine receptor agonists as novel non-narcotic analgesics.

    Science.gov (United States)

    Janes, K; Symons-Liguori, A M; Jacobson, K A; Salvemini, D

    2016-04-01

    Chronic pain negatively impacts the quality of life in a variety of patient populations. The current therapeutic repertoire is inadequate in managing patient pain and warrants the development of new therapeutics. Adenosine and its four cognate receptors (A1 , A2A , A2B and A3 ) have important roles in physiological and pathophysiological states, including chronic pain. Preclinical and clinical studies have revealed that while adenosine and agonists of the A1 and A2A receptors have antinociceptive properties, their therapeutic utility is limited by adverse cardiovascular side effects. In contrast, our understanding of the A3 receptor is only in its infancy, but exciting preclinical observations of A3 receptor antinociception, which have been bolstered by clinical trials of A3 receptor agonists in other disease states, suggest pain relief without cardiovascular side effects and with sufficient tolerability. Our goal herein is to briefly discuss adenosine and its receptors in the context of pathological pain and to consider the current data regarding A3 receptor-mediated antinociception. We will highlight recent findings regarding the impact of the A3 receptor on pain pathways and examine the current state of selective A3 receptor agonists used for these studies. The adenosine-to-A3 receptor pathway represents an important endogenous system that can be targeted to provide safe, effective pain relief from chronic pain.

  6. A 3D visible evaluation of landslide risk degree under integration of GIS and artificial intelligence

    Institute of Scientific and Technical Information of China (English)

    QIAO; Jianping; ZHU; Axing; CHEN; Yongbo; WANG; Rongxun

    2003-01-01

    Artificial intelligence has been used to obtain background factors (basic environmental factors) from landslide specialists. A 3D visible evaluation map may be charted by fuzzy evaluation, and the traditional plane map may be decoded into a 3D map by using factor weight from specialists system and technology of RS and GIS for quantitative sampling of these factors.

  7. Data of evolutionary structure change: 1AT1A-3GD5A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AT1A-3GD5A 1AT1 3GD5 A A ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELL...KHKVIASCFFEASTRTRLSFQTSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQQTEGRLDNLHVAMVGD...EEYAHYAG-IPVINALTD-HEHPCQVVADLLTIRENFGRLAGLKLAYVGDGN--NVAHSLLLGCAKVG-MSIAVATPEGFTPDPAVSARASEIAGRTGAEVQIL--RD...ndex> 3GD5 A 3GD5A A... 1 3GD

  8. Data of evolutionary structure change: 1A3FB-2NOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A3FB-2NOTA 1A3F 2NOT B A NLYQFKNMIKCTV-PSRSWWDFADYGCYCGRGGSGTPVD.../alignment> 0 2NOT A -63.236000061035156 -0.9380000233650208 39.66899871826172 ...1853027 -0.6859999895095825 -0.4410000145435333 tion> 1.2616660594940186 2.680095911026001 ...

  9. Data of evolutionary structure change: 1A3FC-2NOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A3FC-2NOTA 1A3F 2NOT C A NLYQFKNMIKCTV-PSRSWWDFADYGCYCGRGGSGTPVD...alignment> 0 2NOT A 2NOTA... -64.45500183105469 -19.80900001525879 21.614999771118164 ...732971191 0.11699999868869781 -0.3540000021457672 tion> 1.2609390020370483 2.6845290660858154 ...

  10. Data of evolutionary structure change: 1A3DA-2NOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A3DA-2NOTA 1A3D 2NOT A A NLYQFKNMIKCTV-PSRSWWDFADYGCYCGRGGSGTPVD... 2NOTA DAEKK-GCSPK -50.040000915527344 -42.42599868774414 -29.486000061035156 ....4659999907016754 0.8759999871253967 -0.12399999797344208 tion> 1.2927329540252686 2.6646618843078613 ...

  11. Data of evolutionary structure change: 1A3FA-2NOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A3FA-2NOTA 1A3F 2NOT A A NLYQFKNMIKCTV-PSRSWWDFADYGCYCGRGGSGTPVD...ignment> 0 2NOT A 2NOTA...in> -65.49500274658203 5.223999977111816 14.175999641418457 ...99998712539673 0.8920000195503235 tion> 1.2738020420074463 2.701137065887451 ...

  12. Changes in Strength Abilities of Adolescent Girls: The Effect of a 3-Year Physical Education Curriculum

    Science.gov (United States)

    Czarniecka, Renata; Milde, Katarzyna; Tomaszewski, Pawel

    2012-01-01

    Study aim: To evaluate changes in strength abilities of adolescent girls that underwent a 3-year physical education curriculum. Material and methods: The research participants comprised 141 girls aged 13.3 plus or minus 0.35 years who participated in a 3-year physical education curriculum (PEC). Evaluation was based on the following EUROFIT…

  13. 26 CFR 1.50A-3 - Recomputation of credit allowed by section 40.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Recomputation of credit allowed by section 40. 1.50A-3 Section 1.50A-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY INCOME TAX... installation of new equipment or by the retooling of existing equipment (such as for a model changeover in...

  14. Planning and Implementing a 3D Printing Service in an Academic Library

    Science.gov (United States)

    Gonzalez, Sara Russell; Bennett, Denise Beaubien

    2014-01-01

    Initiating a 3D printing service in an academic library goes beyond justification of its value and gaining the necessary library and administrative support. Additional aspects such as policies, environmental safety, training, publicizing, maintenance, and scope of service must be considered. This article provides a guide to developing a 3D print…

  15. COL4A3 expression correlates with pathogenesis, pathologic behaviors, and prognosis of gastric carcinomas.

    Science.gov (United States)

    Nie, Xiao-cui; Wang, Jian-Ping; Zhu, Wan; Xu, Xiao-yan; Xing, Ya-nan; Yu, Miao; Liu, Yun-peng; Takano, Yasuo; Zheng, Hua-chuan

    2013-01-01

    COL4A3 protein belongs to type IV collagen family and is closely linked to kidney diseases and cancer. To clarify the roles of COL4A3 in gastric carcinogenesis and subsequent progression, its expression was examined by immunohistochemistry on tissue microarrays containing gastric carcinomas, adjacent intestinal metaplasia, pure intestinal metaplasia, and gastritis. Gastric carcinoma tissue and cell lines were studied for COL4A3 expression by Western blotting and reverse transcription-polymerase chain reaction. We found that COL4A3 was differentially expressed in GES-1, AGS, BGC-823, GT-3 TKB, HGC-27, KATO-III, MGC-803, MKN28, MKN45, SCH, SGC-7901, and STKM-2 at both messenger RNA and protein levels. Carcinomas showed statistically lower COL4A3 expression than matched nonneoplastic mucosa (P carcinoma (P carcinoma than gastritis (P carcinomas regardless of invasion into the muscularis propria (P carcinomas showed COL4A3 expression. Kaplan-Meier analysis indicated that COL4A3 expression was negatively associated with a favorable prognosis of overall, advanced, and intestinal-type gastric carcinomas (P carcinoma. COL4A3 overexpression might be used as a marker of gastric intestinal metaplasia and mucinous and signet ring cell carcinoma.

  16. Modulation of kidney urea transporter UT-A3 activity by alpha2,6-sialylation.

    Science.gov (United States)

    Qian, Xiaoqian; Sands, Jeff M; Song, Xiang; Chen, Guangping

    2016-07-01

    Two urea transporters, UT-A1 and UT-A3, are expressed in the kidney terminal inner medullary collecting duct (IMCD) and are important for the production of concentrated urine. UT-A1, as the largest isoform of all UT-A urea transporters, has gained much attention and been extensively studied; however, the role and the regulation of UT-A3 are less explored. In this study, we investigated UT-A3 regulation by glycosylation modification. A site-directed mutagenesis verified a single glycosylation site in UT-A3 at Asn279. Loss of the glycosylation reduced forskolin-stimulated UT-A3 cell membrane expression and urea transport activity. UT-A3 has two glycosylation forms, 45 and 65 kDa. Using sugar-specific binding lectins, the UT-A3 glycosylation profile was examined. The 45-kDa form was pulled down by lectin concanavalin A (Con A) and Galant husnivalis lectin (GNL), indicating an immature glycan with a high amount of mannose (Man), whereas the 65-kDa form is a mature glycan composed of acetylglucosamine (GlcNAc) and poly-N-acetyllactosame (poly-LacNAc) that was pulled down by wheat germ agglutinin (WGA) and tomato lectin, respectively. Interestingly, the mature form of UT-A3 glycan contains significant amounts of sialic acid. We explored the enzymes responsible for directing UT-A3 sialylation. Sialyltransferase ST6GalI, but not ST3GalIV, catabolizes UT-A3 α2,6-sialylation. Activation of protein kinase C (PKC) by PDB treatment promoted UT-A3 glycan sialylation and membrane surface expression. The PKC inhibitor chelerythrine blocks ST6GalI-induced UT-A3 sialylation. Increased sialylation by ST6GalI increased UT-A3 protein stability and urea transport activity. Collectively, our study reveals a novel mechanism of UT-A3 regulation by ST6GalI-mediated sialylation modification that may play an important role in kidney urea reabsorption and the urinary concentrating mechanism.

  17. A3(国际版)——迟到的礼物

    Institute of Scientific and Technical Information of China (English)

    神速蜗牛

    2003-01-01

    作为一款网络游戏,A3有着丰富的剧情和人物设定,我们经常可以在A3海报“传奇英雄”画面中看到那悠长的文字介绍。是的,在A3的世界中,NPC们早已不是只会四处走动的木偶,他们有着自己的灵魂,自己的过去,自己的传说。当你加入A3的世界,你会觉得这里充满了“生的气息”,这也就是A3的3A之一——Alive的意义所在了。

  18. Heterologous expression of active human uridine diphosphate glucuronosyltransferase 1A3 in Chinese hamster lung cells

    Institute of Scientific and Technical Information of China (English)

    Ya-Kun Chen; Xin Li; Shu-Qing Chen; Su Zeng

    2005-01-01

    AIM: To obtain the active human recombinant uridine diphosphate glucuronosyltransferase 1A3 (UGT1A3) enzyme from Chinese hamster lung (CHL) cells.METHODS: The full-length UGT1A3 gene was amplified by reverse transcription-polymerase chain reaction (RT-PCR)using total RNA from human liver as template. The correct fragment confirmed by sequencing was subcloned into the mammalian expression vector pcDNA3.1 (+), and the recombinant vector was transfected into CHL cells using a calcium phosphate method. Expressed UGT1A3 protein was prepared from CHL cells resistant to neomycin (G418). Then the protein was added into a reaction mixture for glucuronidation of quercetin. The glucuronidation activity of UGT1A3 was determined by reverse phase-high performance liquid chromatography (RP-HPLC) coupled with a diode array detector (DAD). The quercetin glucuronide was confirmed by hydrolysis with β-glucuronidase. Control experiments were performed in parallel. The transcriptions of recombinants were also determined by RT-PCR.RESULTS: The gene was confirmed to be an allele (UGT1A3-3) of UGT1A3 by DNA sequencing. The fragment was introduced into pcDNA3.1 (+) successfully. Several colonies were obtained under the selection pressure of G418.The result of RT-PCR showed transcription of recombinants in mRNA level. Glucuronidation assay and HPLC analysis indicated UGT1A3 expressed heterologously in CHL cells was in an active form, and one of the gulcuronides corresponding to quercetin was also detected.CONCLUSION: Correct sequence of UGT1A3 gene can be obtained, and active UGT1A3 enzyme is expressed heterologously in CHL cells.

  19. A cytosolic juxtamembrane interface modulates plexin A3 oligomerization and signal transduction.

    Directory of Open Access Journals (Sweden)

    Rachael Barton

    Full Text Available Plexins (plxns are transmembrane (TM receptors involved in the guidance of vascular, lymphatic vessel, and neuron growth as well as cancer metastasis. Plxn signaling results in cytosolic GTPase-activating protein activity, and previous research implicates dimerization as important for activation of plxn signaling. Purified, soluble plxn extracellular and cytosolic domains exhibit only weak homomeric interactions, suggesting a role for the plxn TM and juxtamembrane regions in homooligomerization. In this study, we consider a heptad repeat in the Danio rerio PlxnA3 cytosolic juxtamembrane domain (JM for its ability to influence PlxnA3 homooligomerization in TM-domain containing constructs. Site-directed mutagenesis in conjunction with the AraTM assay and bioluminescent energy transfer (BRET² suggest an interface involving a JM heptad repeat, in particular residue M1281, regulates PlxnA3 homomeric interactions when examined in constructs containing an ectodomain, TM and JM domain. In the presence of a neuropilin-2a co-receptor and semaphorin 3F ligand, disruption to PlxnA3 homodimerization caused by an M1281F mutation is eliminated, suggesting destabilization of the PlxnA3 homodimer in the JM is not sufficient to disrupt co-receptor complex formation. In contrast, enhanced homodimerization of PlxnA3 caused by mutation M1281L remains even in the presence of ligand semaphorin 3F and co-receptor neuropilin-2a. Consistent with this pattern of PlxnA3 dimerization in the presence of ligand and co-receptor, destabilizing mutations to PlxnA3 homodimerization (M1281F are able to rescue motor patterning defects in sidetracked zebrafish embryos, whereas mutations that enhance PlxnA3 homodimerization (M1281L are not. Collectively, our results indicate the JM heptad repeat, in particular residue M1281, forms a switchable interface that modulates both PlxnA3 homomeric interactions and signal transduction.

  20. Annexin A3 is a mammary marker and a potential neoplastic breast cell therapeutic target.

    Science.gov (United States)

    Zeidan, Bashar; Jackson, Thomas R; Larkin, Samantha E T; Cutress, Ramsey I; Coulton, Gary R; Ashton-Key, Margaret; Murray, Nick; Packham, Graham; Gorgoulis, Vassilis; Garbis, Spiros D; Townsend, Paul A

    2015-08-28

    Breast cancers are the most common cancer-affecting women; critically the identification of novel biomarkers for improving early detection, stratification and differentiation from benign tumours is important for the reduction of morbidity and mortality.To identify and functionally characterise potential biomarkers, we used mass spectrometry (MS) to analyse serum samples representing control, benign breast disease (BBD) and invasive breast cancer (IDC) patients. Complementary and multidimensional proteomic approaches were used to identify and validate novel serum markers.Annexin A3 (ANX A3) was found to be differentially expressed amongst different breast pathologies. The diagnostic value of serum ANX A3 was subsequently validated by ELISA in an independent serum set representing the three groups. Here, ANX A3 was significantly upregulated in the benign disease group sera compared with other groups (P A3 was abundantly expressed in benign and to a lesser extent malignant neoplastic epithelium. Finally, we illustrated ANX A3 expression in cell culture lysates and conditioned media from neoplastic breast cell lines, and its role in neoplastic breast cell migration in vitro.This study confirms the novel role of ANX A3 as a mammary biomarker, regulator and therapeutic target.

  1. Identification of a signature motif for the eIF4a3-SECIS interaction.

    Science.gov (United States)

    Budiman, Michael E; Bubenik, Jodi L; Driscoll, Donna M

    2011-09-01

    eIF4a3, a DEAD-box protein family member, is a component of the exon junction complex which assembles on spliced mRNAs. The protein also acts as a transcript-selective translational repressor of selenoprotein synthesis during selenium deficiency. Selenocysteine (Sec) incorporation into selenoproteins requires a Sec Insertion Sequence (SECIS) element in the 3' untranslated region. During selenium deficiency, eIF4a3 binds SECIS elements from non-essential selenoproteins, preventing Sec insertion. We identified a molecular signature for the eIF4a3-SECIS interaction using RNA gel shifts, surface plasmon resonance and enzymatic foot printing. Our results support a two-site interaction model, where eIF4a3 binds the internal and apical loops of the SECIS. Additionally, the stability of the complex requires uridine in the SECIS core. In terms of protein requirements, the two globular domains of eIF4a3, which are connected by a linker, are both critical for SECIS binding. Compared to full-length eIF4a3, the two domains in trans bind with a lower association rate but notably, the uridine is no longer important for complex stability. These results provide insight into how eIF4a3 discriminates among SECIS elements and represses translation.

  2. Blockade of S100A3 activity inhibits murine hair growth.

    Science.gov (United States)

    Guan, W; Deng, Q; Yu, X L; Yuan, Y S; Gao, J; Li, J J; Zhou, L; Xia, P; Han, G Y Q; Han, W; Yu, Y

    2015-10-28

    Using mouse gene expression microarray analysis, we obtained dynamic expression profiles of the whole genome in a depilation-induced hair growth mouse model. S100A3 expression increased during the anagen phase and returned to normal during the telogen phase. The effects of S100A3 blockade on the hair growth cycle were examined in mice after subcutaneous injection of an anti-mouse S100A3 antibody. Protein localization of S100A3 was confined to the hair shafts during the anagen phase and the sebaceous glands during the telogen phase. S100A3 blockade delayed hair follicle entry into the anagen phase, decreased hair elongation, and reduced the number of hair follicles in the subcutis, which correlated with the downregulated expression of hair growth induction-related genes in vivo. The present study demonstrates that anti-S100A3 antibody inhibits mouse hair growth, suggesting that S100A3 can be used as a target for hair loss treatment.

  3. Vasopressin regulation of the renal UT-A3 urea transporter.

    Science.gov (United States)

    Stewart, G S; Thistlethwaite, A; Lees, H; Cooper, G J; Smith, Craig

    2009-03-01

    Facilitative urea transporters in the mammalian kidney play a vital role in the urinary concentrating mechanism. The urea transporters located in the renal inner medullary collecting duct, namely UT-A1 and UT-A3, are acutely regulated by the antidiuretic hormone vasopressin. In this study, we investigated the vasopressin regulation of the basolateral urea transporter UT-A3 using an MDCK-mUT-A3 cell line. Within 10 min, vasopressin stimulates urea flux through UT-A3 transporters already present at the plasma membrane, via a PKA-dependent process. Within 1 h, vasopressin significantly increases UT-A3 localization at the basolateral membrane, causing a further increase in urea transport. While the basic trafficking of UT-A3 to basolateral membranes involves both protein kinase C and calmodulin, its regulation by vasopressin specifically occurs through a casein kinase II-dependent pathway. In conclusion, this study details the effects of vasopressin on UT-A3 urea transporter function and hence its role in regulating urea permeability within the renal inner medullary collecting duct.

  4. Estudo das alterações moleculares do gene ABO em doadores de sangue fenotipados como A3 e A3B

    OpenAIRE

    Alexandre Enéas Domingues

    2007-01-01

    O sistema sanguíneo ABO é o mais importante grupo sanguíneo na medicina transfusional. Atualmente, a determinação do tipo sanguíneo dos doadores de sangue é feita através de testes sorológicos rotineiros de laboratório, porém outros testes realizados com o DNA humano obtido de amostra de sangue, tornam-se complementos valiosos para a determinação correta do grupo sanguíneo do doador e do receptor, aumentando a segurança transfusional. Estudos realizados com o grupo sanguíneo A3 e A3B demonstr...

  5. The transcription factor NR4A3 controls CD103+ dendritic cell migration

    Science.gov (United States)

    Seo, Goo-Young; Andreyev, Aleksander Y.; Marcovecchio, Paola; Blatchley, Amy; Kronenberg, Mitchell; Hedrick, Catherine C.

    2016-01-01

    The transcription factor NR4A3 (also known as NOR-1) is a member of the Nr4a family of nuclear receptors and is expressed in myeloid and lymphoid cells. Here, we have shown that Nr4a3 is essential for the migration of CD103+ dendritic cells (DCs) to lymph nodes (LNs). Nr4a3-deficient mice had very few CD103+ migratory DCs (mDCs) present in LNs, and mixed-chimera studies revealed that this migratory defect was cell intrinsic. We further found that CD103+ DCs from Nr4a3-deficient mice displayed a marked loss of surface expression of the chemokine CCR7. This defect in CCR7 expression was confined to CD103+ DCs, as CCR7 expression on T lymphocytes was unaffected. Moreover, CCR7 was not induced on CD103+ DCs from Nr4a3-deficient mice in response to either administration of the TLR7 agonist R848 or infection with Citrobacter rodentium in vivo. The transcription factor FOXO1 has been shown to regulate CCR7 expression. We found that FOXO1 protein was reduced in Nr4a3-deficient DCs through an AKT-dependent mechanism. Further, we found a requirement for NR4A3 in the maintenance of homeostatic mitochondrial function in CD103+ DCs, although this is likely independent of the NR4A3/FOXO1/CCR7 axis in the regulation of DC migration. Thus, NR4A3 plays an important role in the regulation of CD103+ mDCs by regulating CCR7-dependent cell migration. PMID:27820700

  6. 真的是人间吗?——走进A3

    Institute of Scientific and Technical Information of China (English)

    金瀛

    2003-01-01

    不知道为什么,现在A3的名字是如此的响亮,这款韩国的十八禁游戏,似乎让国内的不少玩家如此期待,也许宣传海报上靓丽的A3主角MM是引起大家兴趣的原因,但是有多少人明白A3是一款什么样的游戏呢?

  7. Hide and seek: a comparative autoradiographic in vitro investigation of the adenosine A3 receptor

    Energy Technology Data Exchange (ETDEWEB)

    Haeusler, D.; Fuchshuber, F.; Girschele, F.; Hacker, M.; Wadsak, W.; Mitterhauser, Markus [Medical University of Vienna, Department of Biomedical Imaging and Image-guided Therapy, Vienna (Austria); Grassinger, L. [University of Applied Sciences Wiener Neustadt, Department of Biomedical Analytics, Wiener Neustadt (Austria); Hoerleinsberger, W.J. [Medical University of Vienna, Department of Biomedical Imaging and Image-guided Therapy, Vienna (Austria); University of Vienna, Cognitive Science Research Platform, Vienna (Austria); Hoeftberger, R.; Leisser, I. [Medical University of Vienna, Institute of Neurology, Vienna (Austria); Shanab, K.; Spreitzer, H. [University of Vienna, Department of Drug and Natural Product Synthesis, Vienna (Austria); Gerdenitsch, W. [Medical University of Vienna, Institute of Biomedicinal Research, Vienna (Austria)

    2015-05-01

    Since the adenosine A3 receptor (A3R) is considered to be of high clinical importance in the diagnosis and treatment of ischaemic conditions (heart and brain), glaucoma, asthma, arthritis, cancer and inflammation, a suitable and selective A3R PET tracer such as [{sup 18}F]FE rate at SUPPY would be of high clinical value for clinicians as well as patients. A3R was discovered in the late 1990s, but there is still little known regarding its distribution in the CNS and periphery. Hence, in autoradiographic experiments the distribution of A3R in human brain and rat tissues was investigated and the specific binding of the A3R antagonist FE rate at SUPPY and MRS1523 compared. Immunohistochemical staining (IHC) experiments were also performed to validate the autoradiographic findings. For autoradiographic competition experiments human post-mortem brain and rat tissues were incubated with [{sup 125}I]AB-MECA and highly selective compounds to block the other adenosine receptor subtypes. Additionally, IHC was performed with an A3 antibody. Specific A3R binding of MRS1523 and FE rate at SUPPY was found in all rat peripheral tissues examined with the highest amounts in the spleen (44.0 % and 46.4 %), lung (44.5 % and 45.0 %), heart (39.9 % and 42.9 %) and testes (27.4 % and 29.5 %, respectively). Low amounts of A3R were found in rat brain tissues (5.9 % and 5.6 %, respectively) and human brain tissues (thalamus 8.0 % and 9.1 %, putamen 7.8 % and 8.2 %, cerebellum 6.0 % and 7.8 %, hippocampus 5.7 % and 5.6 %, caudate nucleus 4.9 % and 6.4 %, cortex 4.9 % and 6.3 %, respectively). The outcome of the A3 antibody staining experiments complemented the results of the autoradiographic experiments. The presence of A3R protein was verified in central and peripheral tissues by autoradiography and IHC. The specificity and selectivity of FE rate at SUPPY was confirmed by direct comparison with MRS1523, providing further evidence that [{sup 18}F]FE rate at SUPPY may be a suitable A3 PET

  8. Physical properties of ferroelectric superlattice A3/B3 system in electric field

    Institute of Scientific and Technical Information of China (English)

    Jiang Wei; Lo Veng-Cheong; Bai Bao-Dong

    2005-01-01

    Based on the differential operator technique, a transverse Ising model (TIM) in the effective-field theory is developed to study the physical properties of a ferroelectric superlattice A3/B3 system. The effects of an external electric field on the polarization, susceptibility and pyroelectric coefficient of the ferroelectric superlattice A3/B3 system are discussed in detail. The susceptibility of the ferroelectric superlattice A3/B3 system decreases with the increase of the electric field, implying that the polarization is weak.

  9. Encefalitis asociada a anticuerpos contra los receptores NMDA: Reconocimiento de un nuevo síndrome neuropsiquiátrico.

    OpenAIRE

    Revilla, Fredy J.; McMasters, Matthew D.; Kobet, Christopher A.; Espay, Alberto J.

    2013-01-01

    Los síndromes paraneoplásicos se caracterizan por la presencia de signos y síntomas que ocurren lejos del sitio deltumor o de sus metástasis. Muchos de estos síndromes son mediados por hormonas, citoquinas, u otras sustanciassecretadas por células tumorales, así como por una respuesta inmune contra el tumor. La presencia de anticuerposgenerados para combatir el tumor puede resultar en un síndrome neurológico si las células del sistema nervioso sonafectadas. Las primeras descripciones de tales...

  10. Estrategias en la Manufactura de Anticuerpos Biosimilares (Fase I): Evolución del Modelo de Negocio

    OpenAIRE

    Calo Fernández, Bruno

    2013-01-01

    El desarrollo de esta Tesis tiene como principal objetivo analizar el impacto que la introducción de nuevas tecnologías de biomanufactura (tecnologías desechables) va a tener en los procesos de producción de compuestos biosimilares, tanto en términos de la reducción del tiempo de proceso como en la disminución de los costes de producción. Para ello, se ha desarrollado una herramienta que, a partir de una metodología basada en la planificación de tiempos de operación (metodología PTO), podrá s...

  11. Los complejos Chaperonina(MSP63inducen anticuerpos de reacciones cruzadas, bactericidas y opsonofagocítica.

    Directory of Open Access Journals (Sweden)

    Juan Marzoa

    2009-08-01

    Full Text Available Alteration of the native structure of antigens can lead to the loss of protective epitopes. Our previous results showed that separation of the meningococcal outer membrane proteins in native conditions revealed the existence of protein complexes that could be relevant for the development of new vaccine formulations. The aim of this work was to analyse the immunogenic characteristics of a highly conserved 700 kDa chaperonin complex (CxChap detected and purified by using high resolution clear native electrophoresis. Analysis of the anti-CxChap serum by Western-blotting revealed the presence of antibodies against the MSP63 but also against the macrophage infectivity potentiator-like protein (MIP, which is coopurified with the chaperonin complex. Antibodies raised by immunisation with CxChap chaperonin complex show bactericidal and opsonophagocytic activity.

  12. Encefalitis límbica por anticuerpos anticanales de potasio dependientes de voltaje: Caso clínico

    OpenAIRE

    2009-01-01

    Limbic encephalitis (LE) can be associated to cancer, viral infection or be idiopathic. One form is associated to voltage dependent potassium channel (VKC) antibodies. The clinical presentation includes impairment of consciousness, amnesia and temporal lobe seizures; typical abnormalities are also found in brain magnetic resonance. We report a 68 year-old male who had LE associated to VKC antibodies. The patient was treated with steroids with a partial response. At the moment of the report he...

  13. Constructing and Analyzing Fusion Promoter of Partial Sericin 1 and Bombyx A3 Cytoplasmic Actin

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Previous report showed that the 209 bp DNA sequence upstream of the sericin 1 transcriptional start site (-586 to -378 bp) is involved in promoting transcription and responsible for the tissue specificity of sericin 1 promoter in silkworm Bombyx mori. In the present study, this 209 bp sequence exhibited enhancive effect by assembling in two different locations of ubiquitous Bombyx A3 cytoplasmic actin promoter. Sf-9 cells were transfected with recombinant plasmids using Cellfectin reagent. Firefly luciferase gene located downstream of fusion promoter was considered as a reporter, whereas the activity of the co-transfected Renilla luciferase gene (pGL2-SV40) provides an internal control. This 209 bp region up-regulates the strength of A3 promoter significantly (P < 0.01) when it enters into A3 promoter with respect to the position in sericin 1 gene promoter. This 209-bp fragment was almost functionless when being located upstream of A3 promoter.

  14. Molecular docking analysis of RN18 and VEC5 in A3G-Vif inhibition.

    Science.gov (United States)

    Sinha, Chanda; Nischal, Anuradha; Pant, Kamlesh K; Bandaru, Srinivas; Nayarisseri, Anuraj; Khattri, Sanjay

    2014-01-01

    The HIV-1 protein Vif is essential for in vivo viral replication that targets the human DNA-editing enzyme, APOBEC3G (A3G), which inhibits replication of retroviruses. The Vif-A3G interactions are believed to be important targets for antiviral drug development. Since the interactions of A3G and Vif evade the ubiquitination pathways in human host, the viral replication precedes which otherwise spreads infection. In this study, two potent Vif inhibitors RN 18 and VEC5 have been evaluated for their inhibitory potential employing ligand receptor and protein-protein interactions studies. VEC 5 showed better interaction with Vif than RN18. Predicted data show that VEC5 bound Vif and RN18 bound Vif showed diminished interaction to A3G compared to inhibitor unbound Vif. However, this should be further validated using in vitro studies.

  15. A Hierarchy of New Nonlinear Evolution Equations Associated with a 3 × 3 Matrix Spectral Problem

    Institute of Scientific and Technical Information of China (English)

    GENG Xian-Guo; LI Fang

    2009-01-01

    A 3 × 3 matrix spectral problem with three potentials and the corresponding hierarchy of new nonlinear evolution equations are proposed. Generalized Hamiltonian structures for the hierarchy of nonlinear evolution equations are derived with the aid of trace identity.

  16. DEEP REDUCTION OF DARBOUX TRANSFORMATION TO A 3×3 SPECTRAL PROBLEM

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    he Darboux transformation of a 3×3 spectral problem which is associated with the higherorder nonlinear Schr dinger equation is given. Some solutions of the higher-order nonlinear Schr dinger equation are provided by taking different "seeds".

  17. Determinant Solutions to a (3+1)-Dimensional Generalized KP Equation with Variable Coefficients

    Institute of Scientific and Technical Information of China (English)

    Alrazi ABDELJABBAR; Wenxiu MA; Ahmet YILDIRIM

    2012-01-01

    A system of linear conditions is presented for Wronskian and Grammian solutions to a (3+1)-dimensional generalized vcKP equation. The formulations of these solutions require a constraint on variable coefficients.

  18. Hanford environmental analytical methods (methods as of March 1990). Appendix A3-R

    Energy Technology Data Exchange (ETDEWEB)

    Goheen, S.C.; McCulloch, M.; Daniel, J.L.

    1993-05-01

    Techniques in use at the Hanford Reservation as of March, 1990 for the analysis of liquids and radioactive effluents are described. Limitations and applications of the techniques are included. This report is Appendix A3-R.

  19. On an asymptotic distribution of dependent random variables on a 3-dimensional lattice.

    Science.gov (United States)

    Harvey, Danielle J; Weng, Qian; Beckett, Laurel A

    2010-06-15

    We define conditions under which sums of dependent spatial data will be approximately normally distributed. A theorem on the asymptotic distribution of a sum of dependent random variables defined on a 3-dimensional lattice is presented. Examples are also presented.

  20. 26 CFR 1.408A-3 - Contributions to Roth IRAs.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Contributions to Roth IRAs. 1.408A-3 Section 1... (CONTINUED) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.408A-3 Contributions to Roth... contributions to Roth IRAs: Q-1. What types of contributions are permitted to be made to a Roth IRA? A-1....

  1. Characterization of a novel qepA3 variant in Enterobacter aerogenes.

    Science.gov (United States)

    Wang, Dongguo; Huang, Xitian; Chen, Jiayu; Mou, Yonghua; Qi, Yongxiao

    2016-02-10

    Five isolates harboring qepA were studied by polymerase chain reaction (PCR) amplification and relevant methods. One was determined to be a novel qepA3 from Enterobacter aerogenes, and four involved three qepA1 and one qepA2 determinants from Escherichia coli; the qepA3 changed five amino acids. These results characterized genetic structures A, B, C, D, and E.

  2. Decomposing a planar graph into an independent set and a 3-degenerate graph

    DEFF Research Database (Denmark)

    Thomassen, Carsten

    2001-01-01

    We prove the conjecture made by O. V. Borodin in 1976 that the vertex set of every planar graph can be decomposed into an independent set and a set inducing a 3-degenerate graph. (C) 2001 Academic Press.......We prove the conjecture made by O. V. Borodin in 1976 that the vertex set of every planar graph can be decomposed into an independent set and a set inducing a 3-degenerate graph. (C) 2001 Academic Press....

  3. A3 Adenosine receptors mediate oligodendrocyte death and ischemic damage to optic nerve.

    Science.gov (United States)

    González-Fernández, Estíbaliz; Sánchez-Gómez, María Victoria; Pérez-Samartín, Alberto; Arellano, Rogelio O; Matute, Carlos

    2014-02-01

    Adenosine receptor activation is involved in myelination and in apoptotic pathways linked to neurodegenerative diseases. In this study, we investigated the effects of adenosine receptor activation in the viability of oligodendrocytes of the rat optic nerve. Selective activation of A3 receptors in pure cultures of oligodendrocytes caused concentration-dependent apoptotic and necrotic death which was preceded by oxidative stress and mitochondrial membrane depolarization. Oligodendrocyte apoptosis induced by A3 receptor activation was caspase-dependent and caspase-independent. In addition to dissociated cultures, incubation of optic nerves ex vivo with adenosine and the A3 receptor agonist 2-CI-IB-MECA(1-[2-Chloro-6-[[(3-iodophenyl)methyl]amino]-9H-purin-9-yl]-1-deoxy-N-methyl-b-D-ribofuranuronamide)-induced caspase-3 activation, oligodendrocyte damage, and myelin loss, effects which were prevented by the presence of caffeine and the A3 receptor antagonist MRS 1220 (N-[9-Chloro-2-(2-furanyl)[1,2,4]-triazolo [1,5-c]quinazolin-5-yl]benzene acetamide). Finally, ischemia-induced injury and functional loss to the optic nerve was attenuated by blocking A3 receptors. Together, these results indicate that adenosine may trigger oligodendrocyte death via activation of A3 receptors and suggest that this mechanism contributes to optic nerve and white matter ischemic damage.

  4. Correlations between the MEG-A3 gene and incidence of breast cancer.

    Science.gov (United States)

    Hou, Xinming; Guo, Feng; Sun, Qinghui

    2016-12-01

    The aim of the present study was to examine the interrelations between MEG-A3 gene and incidence of breast cancer. The expression of MEG-A3 gene in the tissue samples of patients with breast cancer and normal controls at RNA and protein levels was determined. Subsequently, the relative expression of RNA for the same patient was measured at different time-points (1, 3, 6, 8, 12 and 24 months), and the protein expression levels were determined using western blotting. The results showed that, the mRNA level in MEG-A3 gene of samples of patients with breast cancer was significantly higher than that of normal women (pA3 gene expression increased apparently with the prolongation and aggravation of the disease. In conclusion, there is a close correlation between MEG-A3 gene and the incidence of breast cancer; thus, MEG-A3 gene contributes to the occurrence and deterioration of breast cancer to some extent. It provides a theoretical basis for later disease treatment.

  5. Characterization of Genetic Structures of the QepA3 Gene in Clinical Isolates of Enterobacteriaceae

    Directory of Open Access Journals (Sweden)

    Dongguo eWang

    2015-10-01

    Full Text Available QepA is one of the genes that confer quinolone resistance in bacteria. The aim of this study was to analyze the genetic structures of plasmids that carry a qepA3, a recently discovered allele of qepA in Enterobacteriaceae clinical isolates. 656 non-redundant Enterobacteriaceae clinical isolates were screened for the qepA3 gene and five isolated were identified to carry the gene. Plasmids were isolated from these isolates and were found to increase antibiotic resistance once the plasmids were transferred to Escherichia coli. These plasmids were subcloned and sequenced to analyze the genetic structures surrounding the the qepA3 gene. The results showed that the five plasmids had different genetic structures; one of qepA3-containning isolates had either the blaCTX-M-14 or blaTEM-12 gene in place of the blaTEM-1 gene. The structures of both pKP3764 and pECL3786 have not been previously described. In comparison with pHPA, there were a number of changes in DNA sequences up- and down-stream the qepA3 gene. These findings provide better understanding of the genetic variations in qepA3 and would be useful for diagnosis and control of quinolone resistance in clinical settings.

  6. Characterization of genetic structures of the QepA3 gene in clinical isolates of Enterobacteriaceae

    Science.gov (United States)

    Wang, Dongguo; Huang, Xitian; Chen, Jiayu; Mou, Yonghua; Li, Haijun; Yang, Liqin

    2015-01-01

    QepA is one of the genes that confer quinolone resistance in bacteria. The aim of this study was to analyze the genetic structures of plasmids that carry a qepA3, a recently discovered allele of qepA in Enterobacteriaceae clinical isolates. 656 non-redundant Enterobacteriaceae clinical isolates were screened for the qepA3 gene and five isolates were identified to carry the gene. Plasmids were isolated from these isolates and were found to increase antibiotic resistance once the plasmids were transferred to Escherichia coli. These plasmids were subcloned and sequenced to analyze the genetic structures surrounding the qepA3 gene. The results showed that the five plasmids had different genetic structures; two of the qepA3-containning isolates had either the blaCTX-M-14 or blaTEM-12 gene instead of the blaTEM-1 gene. The structures of both pKP3764 and pECL3786 have not been previously described. In comparison with pHPA, there were a number of changes in DNA sequences up- and down-stream of the qepA3 gene. These findings provide better understanding of the genetic variations in qepA3 and would be useful for diagnosis and control of quinolone resistance in clinical settings. PMID:26528280

  7. NR4A3 suppresses lymphomagenesis through induction of pro-apoptotic genes.

    Science.gov (United States)

    Deutsch, Alexander Ja; Rinner, Beate; Pichler, Martin; Troppan, Katharina; Pansy, Katrin; Bischof, Marco; Fechter, Karoline; Hatzl, Stefan; Feichtinger, Julia; Wenzl, Kerstin; Frisch, Marie-Therese; Stiegelbauer, Verena; Prokesch, Andreas; Krogsdam, Anne Margrethe; Sill, Heinz; Thallinger, Gerhard G; Greinix, Hildegard T; Wang, Chenguang; Beham-Schmid, Christine; Neumeister, Peter

    2017-03-01

    Nuclear orphan receptor NR4A1 exerts an essential tumor suppressor function in aggressive lymphomas. In this study, we investigated the hypothesized contribution of the related NR4A family member NR4A3 to lymphomagenesis. In aggressive lymphoma patients, low expression of NR4A3 was associated with poor survival. Ectopic expression or pharmacological activation of NR4A3 in lymphoma cell lines led to a significantly higher proportion of apoptotic cells. In a mouse NSG xenograft model of lymphoma (stably transduced SuDHL4 cells), NR4A3 expression abrogated tumor growth, compared to vector control and uninduced cells which formed massive tumors. Transcript analysis of four different aggressive lymphoma cell lines overexpressing either NR4A3 or NR4A1 revealed that apoptosis was driven similarly by induction of BAK, Puma, BIK, BIM, BID and Trail. Overall, our results showed that NR4A3 possesses robust tumor suppressor functions of similar impact to NR4A1 in aggressive lymphomas.

  8. 直热式三极功率管2A3的应用

    Institute of Scientific and Technical Information of China (English)

    唐道济

    2007-01-01

    2A3是1933年RCA开发的著名低内阻功率三极管,线性极好,有极优美的音色。20世纪30年代的2A3是单屏结构,40年代起为双屏结构。大多数单屏2A3是RCA、Sylyanina、National Union、Arcturus制造,Philco、Latayette、Triad、Silvertone是贴牌,都在胶木管基上用刻字方式标志。不同灯丝电压的同类管有6A3、6B4G(管基不同),耗散功率更大的衍生管有JJ2A3-40(Ppm 40W),曙光2A3B(Ppm 20W)等。

  9. Hamster SRD5A3 lacks steroid 5α-reductase activity in vitro.

    Science.gov (United States)

    Chávez, B; Ramos, L; García-Becerra, R; Vilchis, F

    2015-02-01

    According to current knowledge, two steroid 5α-reductases, designated type 1 (SRD5A1) and type 2 (SRD5A2), are present in all species examined to date. These isozymes play a central role in steroid hormone physiology by catalyzing the reduction of 3-keto-4-ene-steroids into more active 5α-reduced derivatives, including the conversion of testosterone (T) to dihydrotestosterone (DHT). A third 5α-reductase (SRD5A3, -type 3), which is overexpressed in hormone-refractory prostate cancer cells, has been identified; however, its enzymatic characteristics are practically unknown. Here, we isolated a cDNA encoding hamster Srd5a3 (hSrd5a3) and performed functional metabolic assays to investigate its biochemical properties. The cloned cDNA encodes a 330 amino acid protein that is 87% identical to the homologous protein in mice and 78% to that in humans. However, hSrd5a3 exhibits low sequence homology with its counterparts hSrd5a1 (19%) and hSrd5a2 (17%). A fusion protein consisting of hSrd5a3 and green fluorescent protein provided evidence for cytoplasmic localization in transfected mammalian cells. Real-time PCR analysis revealed that, Srd5a3 mRNA was present in nearly all hamster tissues, with high expression in the cerebellum, Harderian gland and testis. Functional assays expressing hSrd5a3 cDNA in HEK-293 cells revealed that this isozyme is unable to reduce T into DHT. Further expression assays confirmed that similar to testosterone, progesterone, androstenedione and corticosterone are not reduced by hSrd5a3 or human SRD5A3. Together, these results indicate that hSrd5a3 lacks the catalytic activity to transform 3-keto-4-ene-compounds; therefore 5α-reductase type 3 may not be involved in 5α-reduction of steroids.

  10. Dual Mode of Action for Plusbacin A3 in Staphylococcus aureus.

    Science.gov (United States)

    O'Connor, Robert D; Singh, Manmilan; Chang, James; Kim, Sung Joon; VanNieuwenhze, Michael; Schaefer, Jacob

    2017-02-23

    We have used C{F}, N{F}, and N{P} rotational-echo double resonance NMR to determine the location and conformation of (19)F and (15)N double-labeled plusbacin A3 and of double-labeled deslipo-plusbacin A3, each bound to the cell walls of whole cells of Staphyloccocus aureus grown in media containing [1-(13)C]glycine. The (31)P is primarily in wall teichoic acid. Approximately 25% of plusbacin headgroups (the cyclic depsipeptide backbone) are in a closed conformation (N-F separation of 6 Å), while 75% are in a more open conformation (N-F separation of 12 Å). The closed headgroups have no contact with wall teichoic acid, whereas the open headgroups have a strong contact. This places the closed headgroups in hydrophobic regions of the cell wall and the open headgroups in hydrophilic regions. None of the plusbacin tails have contact with the (31)P of either wall teichoic acid or the cell membrane and thus are in hydrophobic regions of the cell wall. In addition, both heads and tails of plusbacin A3 have contact with the glycyl (13)C incorporated in cell-wall peptidoglycan pentaglycyl bridges and with (13)C-labeled purines near the membrane surface. We interpret these results in terms of a dual mode of action for plusbacin A3: first, disruption of the peptidoglycan layer nearest to the membrane surface by closed-conformation plusbacin A3 leading to an inhibition of chain extension by transglycosylation; second, thinning and disruption of the membrane (possibly including disruption of ATP-binding cassette transporters embedded in the membrane) by open-conformation plusbacin A3, thereby leading to release of ATP to the hydrophilic regions of the cell wall and subsequent binding by plusbacin A3.

  11. Adenosine A3 Receptor: A promising therapeutic target in cardiovascular disease.

    Science.gov (United States)

    Nishat, Shamama; Khan, Luqman A; Ansari, Zafar M; Basir, Seemi F

    2016-01-01

    Cardiovascular complications are one of the major factors for early mortality in the present worldwide scenario and have become a major challenge in both developing and developed nations. It has thus become of immense importance to look for different therapeutic possibilities and treatments for the growing burden of cardiovascular diseases. Recent advancements in research have opened various means for better understanding of the complication and treatment of the disease. Adenosine receptors have become tool of choice in understanding the signaling mechanism which might lead to the cardiovascular complications. Adenosine A3 receptor is one of the important receptor which is extensively studied as a therapeutic target in cardiovascular disorder. Recent studies have shown that A3AR is involved in the amelioration of cardiovascular complications by altering the expression of A3R. This review focuses towards the therapeutic potential of A3AR involved in cardiovascular disease and it might help in better understanding of mechanism by which this receptor may prove useful in improving the complications arising due to various cardiovascular diseases. Understanding of A3AR signaling may also help to develop newer agonists and antagonists which might be prove helpful in the treatment of cardiovascular disorder.

  12. PapA3 is an acyltransferase required for polyacyltrehalose biosynthesis in Mycobacterium tuberculosis.

    Science.gov (United States)

    Hatzios, Stavroula K; Schelle, Michael W; Holsclaw, Cynthia M; Behrens, Christopher R; Botyanszki, Zsofia; Lin, Fiona L; Carlson, Brian L; Kumar, Pawan; Leary, Julie A; Bertozzi, Carolyn R

    2009-05-08

    Mycobacterium tuberculosis possesses an unusual cell wall that is replete with virulence-enhancing lipids. One cell wall molecule unique to pathogenic M. tuberculosis is polyacyltrehalose (PAT), a pentaacylated, trehalose-based glycolipid. Little is known about the biosynthesis of PAT, although its biosynthetic gene cluster has been identified and found to resemble that of the better studied M. tuberculosis cell wall component sulfolipid-1. In this study, we sought to elucidate the function of papA3, a gene from the PAT locus encoding a putative acyltransferase. To determine whether PapA3 participates in PAT assembly, we expressed the protein heterologously and evaluated its acyltransferase activity in vitro. The purified enzyme catalyzed the sequential esterification of trehalose with two palmitoyl groups, generating a diacylated product similar to the 2,3-diacyltrehalose glycolipids of M. tuberculosis. Notably, PapA3 was selective for trehalose; no activity was observed with other structurally related disaccharides. Disruption of the papA3 gene from M. tuberculosis resulted in the loss of PAT from bacterial lipid extracts. Complementation of the mutant strain restored PAT production, demonstrating that PapA3 is essential for the biosynthesis of this glycolipid in vivo. Furthermore, we determined that the PAT biosynthetic machinery has no cross-talk with that for sulfolipid-1 despite their related structures.

  13. Mast cell adenosine receptors function: a focus on the A3 adenosine receptor and inflammation

    Directory of Open Access Journals (Sweden)

    Noam eRudich

    2012-06-01

    Full Text Available Adenosine is a metabolite, which has long been implicated in a variety of inflammatory processes. Inhaled adenosine provokes bronchoconstriction in asthmatics or chronic obstructive pulmonary disease (COPD patients, but not in non-asthmatics. This hyper responsiveness to adenosine appears to be mediated by mast cell activation. These observations have marked the receptor that mediates the bronchoconstrictor effect of adenosine on mast cells, as an attractive drug candidate. Four subtypes (A1, A2a, A2b and A3 of adenosine receptors have been cloned and shown to display distinct tissue distributions and functions. Animal models have firmly established the ultimate role of the A3 adenosine receptor (A3R in mediating hyper responsiveness to adenosine in mast cells, although the influence of the A2b adenosine receptor was confirmed as well. In contrast, studies of the A3R in humans have been controversial. In this review, we summarize data on the role of different adenosine receptors in mast cell regulation of inflammation and pathology, with a focus on the common and distinct functions of the A3R in rodent and human mast cells. The relevance of mouse studies to the human is discussed.

  14. von Willebrand factor A1 domain can adequately substitute for A3 domain in recruitment of flowing platelets to collagen

    NARCIS (Netherlands)

    Bonnefoy, A.; Romijn, R. A.; Vandervoort, P. A. H.; Van Rompaey, I.; Vermylen, J.; Hoylaerts, M. F.

    2006-01-01

    Background: Binding of von Willebrand factor (VWF) to platelet GPIb alpha and to collagen is attributed to VWF A1 and A3 domains, respectively. Objectives: Using VWF, VWF lacking A1 (Delta A1-VWF) or A3 (Delta A3-VWF) and VWF with defective A3 (H1786A-VWF), in combination with recombinant A1 (residu

  15. Investigating the role of CheA-3 in Dusulfovibrio Vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Ray, Jayashee; Keller, Kimberley; Krierim, Bernhard; Auer, Manfred; Keasling, Jay; Wall, Judy; Mukhopadhyay, Aindrila

    2010-05-22

    Multiple sets of chemotaxis genes including three cheA homologs were identified in the genome sequence of the anaerobic bacterium Desulfovibrio vulgaris Hildenborough. Each CheA is a histidine kinase (HK) and part of a two component signal transduction system. Knock out mutants in the three cheA genes were created using single cross-over homologous recombination insertion. We studied the phenotypes of the cheA mutants in detail and discovered that ?cheA-3 has a non swarming/swimming phenotype both in the soft agar plates and Palleroni chamber assays. CheA-3 shows similarity to the Shewanella oneidensis CheA-3 and the Vibrio cholerae CheA-2 that are responsible for chemotaxis in the respective organisms. We did not find any morphological or structural differences between the three Delta cheA mutants and the wild type cells in electron microscopy. Our results from these studies are presented.

  16. Atmospheric nonequilibrium mini-plasma jet created by a 3D printer

    Energy Technology Data Exchange (ETDEWEB)

    Takamatsu, Toshihiro, E-mail: toshihiro@plasma.es.titech.ac.jp [Kobe University Graduate School of Medicine, Department of Gastroenterology, 7-5-1 Kusunoki-cho, Chuo-ku, Kobe, 650-0017 (Japan); Tokyo Institute of Technology, Department of Energy Sciences, J2-32, 4259 Nagatsuta, Midori-ku, Yokohama, 226-8502 (Japan); Kawano, Hiroaki; Miyahara, Hidekazu; Okino, Akitoshi [Tokyo Institute of Technology, Department of Energy Sciences, J2-32, 4259 Nagatsuta, Midori-ku, Yokohama, 226-8502 (Japan); Azuma, Takeshi [Kobe University Graduate School of Medicine, Department of Gastroenterology, 7-5-1 Kusunoki-cho, Chuo-ku, Kobe, 650-0017 (Japan)

    2015-07-15

    In this study, a small-sized plasma jet source with a 3.7 mm head diameter was created via a 3D printer. The jet’s emission properties and OH radical concentrations (generated by argon, helium, and nitrogen plasmas) were investigated using optical emission spectrometry (OES) and electron spin resonance (ESR). As such, for OES, each individual gas plasma propagates emission lines that derive from gases and ambient air inserted into the measurement system. For the case of ESR, a spin adduct of the OH radical is typically observed for all gas plasma treatment scenarios with a 10 s treatment by helium plasma generating the largest amount of OH radicals at 110 μM. Therefore, it was confirmed that a plasma jet source made by a 3D printer can generate stable plasmas using each of the aforementioned three gases.

  17. Synthesis of Calystegine A(3) from Glucose by the Use of Ring-Closing Metathesis

    DEFF Research Database (Denmark)

    Monrad, Rune Nygaard; Pipper, Charlotte Bressen; Madsen, Robert

    2009-01-01

    A synthesis of the nortropane alkaloid calystegine A(3) is described from D-glucose. The key step employs a zinc-mediated tandem reaction where a benzyl-protected methyl 6-iodo glucoside is fragmented to give an unsaturated aldehyde, which is then transformed into the corresponding benzylimine...... and allylated in the same pot. The functionalized nona-1,8-diene, thus obtained, is converted into the seven-membered carbon skeleton in calystegine A(3) by ring-closing olefin metathesis. Subsequent deoxygenation by the Barton-McCombie protocol, hydroboration and oxidative workup followed by hydrogenolysis...... affords calystegine A(3). The synthesis uses a total of 13 steps from glucose and confirms the absolute configuration of the natural product....

  18. Influence of Nucleating Agent on the Formation of C4A3S

    Institute of Scientific and Technical Information of China (English)

    GUO Huiling; XIE Junlin; ZHANG Shu; XU Qi

    2012-01-01

    The reference test methods are carried out parallelly,by means of chemical analysis,X-ray diffraction,differential scanning calorimetry-thermogravimetry,scanning electron microscopy and polarized optical microscope to study the formation of C4A3S in the presence and absence of nucleating agent.The results show that nucleating agent with high calcium and low heat consumption as tricalcium silicate (C3S) promotes the formation of C4A3S and increases desulfurization degree obviously.During calcining raw meals doped with C3S,the grain sizes of C4A3S are larger compared with that without C3S.And at the same calcining level,the mass loss and the heat consumption belonged to CaCO3 decomposition is reduced.

  19. A 3-D model of superfluid helium suitable for numerical analysis

    CERN Document Server

    Darve, C; Van Sciver, S W

    2009-01-01

    The two-fluid description is a very successful phenomenological representation of the properties of Helium II. A 3-D model suitable for numerical analysis based on the Landau-Khalatnikov description of Helium II is proposed. In this paper we introduce a system of partial differential equations that is both complete and consistent as well as practical, to be used for a 3-D solution of the flow of Helium II. The development of a 3-D numerical model for Helium II is motivated by the need to validate experimental results obtained by observing the normal component velocity distribution in a Helium II thermal counter-flow using the Particle Image Velocimetry (PIV) technique.

  20. Asystole in alternating hemiplegia with de novo ATP1A3 mutation.

    Science.gov (United States)

    Novy, Jan; McWilliams, Eric; Sisodiya, Sanjay M

    2014-01-01

    Alternating hemiplegia is a rare condition presenting with episodes of hemiplegia, epileptic seizures and, at times, dysautonomic attacks. De novo ATP1A3 (Na(+)/K(+) ATPase subunit) mutations were recently found to be the most common cause. We report a patient with alternating hemiplegia with de novo ATP1A3 mutation who experienced new-onset episodes of collapse in early adulthood unrelated to seizures. An implantable cardiac loop recorder documented episodes of asystole up to 5 s long. Subsequently a permanent pacemaker was implanted. ATP1A3 heart expression may be the explanation for the association of alternating hemiplegia and asystole episodes. Alternating hemiplegia has been associated with an increased risk of sudden death and lethal cardiac arrhythmias may be causative. Patients may need referral for appropriate cardiac investigations, especially if there is a change in symptoms. This case highlights the importance of clinical vigilance in patients with alternating hemiplegia.

  1. Atmospheric nonequilibrium mini-plasma jet created by a 3D printer

    Directory of Open Access Journals (Sweden)

    Toshihiro Takamatsu

    2015-07-01

    Full Text Available In this study, a small-sized plasma jet source with a 3.7 mm head diameter was created via a 3D printer. The jet’s emission properties and OH radical concentrations (generated by argon, helium, and nitrogen plasmas were investigated using optical emission spectrometry (OES and electron spin resonance (ESR. As such, for OES, each individual gas plasma propagates emission lines that derive from gases and ambient air inserted into the measurement system. For the case of ESR, a spin adduct of the OH radical is typically observed for all gas plasma treatment scenarios with a 10 s treatment by helium plasma generating the largest amount of OH radicals at 110 μM. Therefore, it was confirmed that a plasma jet source made by a 3D printer can generate stable plasmas using each of the aforementioned three gases.

  2. Isolation and characterization of new onionins A2 and A3 from Allium cepa, and of onionins A1, A2, and A3 from Allium fistulosum.

    Science.gov (United States)

    Nohara, Toshihiro; Fujiwara, Yukio; Kudo, Rino; Yamaguchi, Koki; Ikeda, Tsuyoshi; Murakami, Kotaro; Ono, Masateru; Kajimoto, Tetsuya; Takeya, Motohiro

    2014-01-01

    In this study, the new stable sulfur-containing compounds onionins A2 (1) and A3 (2) were isolated from the acetone extracts of the bulbs of Allium cepa L. and identified as the stereoisomers of onionin A1 discovered in our previous study. Their chemical structures, 3,4-dimethyl-5-(1E-propenyl)-tetrahydrothiophene-2-sulfenic acid-S-oxides, were characterized using various spectroscopic techniques. In addition, 1 and 2 together with onionin A1 were successfully isolated from the leaves of the Welsh onion, Allium fistulosum L. The onion-extracted fractions showed good potential to inhibit the polarization of M2 activated macrophages, indicating their possible ability to inhibit tumor cell proliferation.

  3. Concurrent validity of the GMS-AGECAT (A3) package in a Danish nursing home population

    DEFF Research Database (Denmark)

    Sørensen, Lisbeth; Foldspang, Anders; Gulman, N.C.;

    1998-01-01

    Aim. To validate the Danish version of the GMS–AGECAT (A3), the Standardized Mini Mental State Examination (SMMSE) and the Geriatric Depression Scale-15 (GDS-15) by comparing them to clinical ICD-10 criteria in a Danish nursing home population. Methods. With a participation of 91%, the study...... included 100 residents. All residents were interviewed with the GMS–AGECAT (A3), SMMSE and GDS-15 by an MD and then blindly diagnosed by a consultant geriatric psychiatrist. All residents approached for an interview were included, also those who were not able to communicate (the non-accessibles). Results...

  4. A feasibility study of a 3-D finite element solution scheme for aeroengine duct acoustics

    Science.gov (United States)

    Abrahamson, A. L.

    1980-01-01

    The advantage from development of a 3-D model of aeroengine duct acoustics is the ability to analyze axial and circumferential liner segmentation simultaneously. The feasibility of a 3-D duct acoustics model was investigated using Galerkin or least squares element formulations combined with Gaussian elimination, successive over-relaxation, or conjugate gradient solution algorithms on conventional scalar computers and on a vector machine. A least squares element formulation combined with a conjugate gradient solver on a CDC Star vector computer initially appeared to have great promise, but severe difficulties were encountered with matrix ill-conditioning. These difficulties in conditioning rendered this technique impractical for realistic problems.

  5. Rogue waves and rational solutions of a (3+1)-dimensional nonlinear evolution equation

    Energy Technology Data Exchange (ETDEWEB)

    Zhaqilao,, E-mail: zhaqilao@imnu.edu.cn

    2013-12-06

    A simple symbolic computation approach for finding the rogue waves and rational solutions to the nonlinear evolution equation is proposed. It turns out that many rational solutions with real and complex forms of a (3+1)-dimensional nonlinear evolution equation are obtained. Some features of rogue waves and rational solutions are graphically discussed. -- Highlights: •A simple symbolic computation approach for finding the rational solutions to the NEE is proposed. •Some rogue waves and rational solutions with real and complex forms of a (3+1)-D NEE are obtained. •Some features of rogue waves are graphically discussed.

  6. Development of vacuum underfill technology for a 3D chip stack

    Science.gov (United States)

    Sakuma, Katsuyuki; Kohara, Sayuri; Sueoka, Kuniaki; Orii, Yasumitsu; Kawakami, Mikio; Asai, Kazuo; Hirayama, Yoshikazu; Knickerbocker, John U.

    2011-03-01

    We developed a vacuum underfill technology for 3D chip stacks and for flip chips in high performance system integration. We fabricated a 3D prototype chip stack using the vacuum underfill technology to apply the adhesive. The underfill was injected into each 6 µm gaps in a 3-layer chip stack and no voids were detected in acoustic microscopy images. Electrical tests and thermal reliability tests were used to measure the resistance of the vertical interconnections and the impact of the underfill. The results showed there was minimal difference in the average interconnection resistance of the chip stack with and without underfill.

  7. Regenerative material for aneurysm embolization A 3-dimensional culture system of fibroblasts and calcium alginate gel

    Institute of Scientific and Technical Information of China (English)

    Jingdong Zhang; Kan Xu; Jinlu Yu; Jun Wang; Qi Luo

    2011-01-01

    Calcium alginate gel (CAG) has been shown to successfully model aneurysm embolization within a short period of time. However, gradually degrading CAG potentially results in aneurysm recanalization.In the present study, a regenerative embolic material was designed by seeding rat fibroblasts in a CAG. The study investigated the feasibility of constructing a 3-dimensional culture system. The fibroblasts grew well and firmly attached to the CAG. CAG was conducive for fibroblast growth, and resulted in a 3-dimensional culture system. Results show that CAG can be used theoretically as a vascular, regenerative, embolic material.

  8. Optical conductivity in A3C60 (A=K, Rb)

    NARCIS (Netherlands)

    Brink, J. van den; Gunnarsson, O.; Eyert, V.

    1997-01-01

    Published in: Phys. Rev. B 57 (1998) 2163-2167 Citing articles (CrossRef) citations recorded in [Science Citation Index] Abstract: We study the optical conductivity in A3C60 (A =K, Rb). The effects of the electron-phonon interaction is included to lowest order in the coupling strength lambda. It is

  9. 26 CFR 1.411(a)-3 - Vesting in employer-derived benefits.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Vesting in employer-derived benefits. 1.411(a)-3... in employer-derived benefits. (a) In general—(1) Alternative requirements. A plan is not a qualified... percent of his accrued benefit derived from employer contributions. (c) 5- to 15-year vesting. A...

  10. From Gene to Protein: A 3-Week Intensive Course in Molecular Biology for Physical Scientists

    Science.gov (United States)

    Nadeau, Jay L.

    2009-01-01

    This article describes a 3-week intensive molecular biology methods course based upon fluorescent proteins, which is successfully taught at the McGill University to advanced undergraduates and graduates in physics, chemical engineering, biomedical engineering, and medicine. No previous knowledge of biological terminology or methods is expected, so…

  11. EVALUATION OF CHROMOMYCIN A3 ASSAY IN HUMAN SPERM AFTER SIMULATED OVERNIGHT SHIPMENT

    Science.gov (United States)

    EVALUATION OF CHROMOMYCIN A3ASSAY IN HUMAN SPERM AFTER SIMULATED OVERNIGHT SHIPMENT. SC Jeffay1, R Morris Buus1, LF Strader1, AF Olshan2, DP Evenson3, SD Perreault1. 1US EPA/ORD, RTP, NC;2UNC-CH, Chapel Hill, NC;3SDSU, Brookings, SD.Semen collection kits that allow ...

  12. Learning Cycles and Focus Groups: A Complementary Approach to the A3 Thinking Methodology

    Science.gov (United States)

    Tortorella, Guilherme Luz; Viana, Samanta; Fettermann, Diego

    2015-01-01

    Purpose: This study aims to propose a complementary method to the A3 information collection, data analysis and capturing and sharing knowledge to facilitate problem solving in a general framework. The incorporation of this method minimizes the difficulties identified in the literature focused on continuous improvement of processes. The method…

  13. Practitioner Perceptions of the A3 Method for Process Improvement in Health Care

    Science.gov (United States)

    Visich, John K.; Wicks, Angela M.; Zalila, Faiza

    2010-01-01

    The focus of this article is to present students' perceptions of the recently developed A3 method, a structured problem-solving approach based on lean concepts and tools that have been adapted to the health care environment. The students were all employees of a large health care provider and were enrolled in a customized health care executive MBA…

  14. A 3-year longitudinal analysis of changes in fitness, physical activity, fatness and screen time

    DEFF Research Database (Denmark)

    Aires, L; Andersen, Lars Bo; Mendonça, D

    2010-01-01

    in fitness. METHODS: This is a 3-year longitudinal study of 345 high school students aged 11-19 years. Students performed curl-ups, push-ups and 20-m shuttle run tests from Fitnessgram. PA and ST were evaluated using a standard questionnaire. Standardized scores of fitness tests were summed. Changes over...

  15. Effects of a 3-year intervention: The Copenhagen School Child Intervention Study

    DEFF Research Database (Denmark)

    Bugge, Anna; El-Naaman, Bianca; Dencker, Magnus;

    2012-01-01

    INTRODUCTION: This study assessed short and long term effects of a 3-year controlled school-based physical activity (PA) intervention on fatness, cardiorespiratory fitness (VO2peak) and cardiovascular disease (CVD) risk factors in children. METHODS: The study involved 18 schools (10 intervention...

  16. NACr14: A 3D model for the crustal structure of the North American Continent

    NARCIS (Netherlands)

    Tesauro, Magdala; Kaban, Mikhail; Mooney, Walter; Cloetingh, Sierd

    2014-01-01

    Based on the large number of crustal seismic experiments carried out in the last decadeswe create NACr14, a 3D crustal model of the North American continent at a resolution of 1° × 1°. We present maps of thickness and average velocities of the main layers that comprise the North American crystalline

  17. Experimental results of a 3 k Wh thermochemical heat storage module for space heating application

    NARCIS (Netherlands)

    Finck, C.J.; Henquet, E.M.R.; Soest, C.F.L. van; Oversloot, H.P.; Jong, A.J. de; Cuypers, R.; Spijker, J.C. van 't

    2014-01-01

    A 3 kWh thermochemical heat storage (TCS) module was built as part of an all-in house system implementation focusing on space heating application at a temperature level of 40 ºC and a temperature lift of 20 K. It has been tested and measurements showed a maximum water circuit temperature span (relea

  18. Examining Communicative Behaviors in a 3-Year-Old Boy Who Is Blind.

    Science.gov (United States)

    Perfect, Michelle M.

    2001-01-01

    The communication patterns of a 3-year-old boy who is blind were observed during 35 videotaped classroom sessions to determine if his echolalic responses varied according to school activity and message category. Analysis revealed that, although the child was expressive with adults, he had difficulty communicating with his peers and in producing…

  19. 38 CFR 18a.3 - Delegation to the Chief Medical Director.

    Science.gov (United States)

    2010-07-01

    ... AFFAIRS (CONTINUED) DELEGATION OF RESPONSIBILITY IN CONNECTION WITH TITLE VI, CIVIL RIGHTS ACT OF 1964 § 18a.3 Delegation to the Chief Medical Director. The Chief Medical Director is delegated responsibility for obtaining evidence of voluntary compliance implementing the provisions of Title VI, Civil...

  20. Interactive A3 Architecture Overviews ☆: Intuitive Functionalities for Effective Communication

    NARCIS (Netherlands)

    Brussel, Frank F.; Bonnema, G. Maarten

    2015-01-01

    The A3 Architecture Overviews introduced earlier provide a powerful communication medium in systems engineering and architecting. Intended originally for reverse architecting, they are now also applied for designing system architectures and for systems of systems. With the current development in use

  1. Digital Geological Model (DGM): a 3D raster model of the subsurface of the Netherlands

    NARCIS (Netherlands)

    Gunnink, J.L.; Maljers, D.; Gessel, S.F. van; Menkovic, A.; Hummelman, H.J.

    2013-01-01

    A 3D geological raster model has been constructed of the onshore of the Netherlands. The model displays geological units for the upper 500 m in 3D in an internally consistent way. The units are based on the lithostratigraphical classification of the Netherlands. This classification is used to interp

  2. A 3D multilevel model of damage and strength of wood: Analysis of microstructural effects

    DEFF Research Database (Denmark)

    Qing, Hai; Mishnaevsky, Leon

    2011-01-01

    A 3D hierarchical computational model of damage and strength of wood is developed. The model takes into account the four scale microstructures of wood, including the microfibril reinforced structure at nanoscale, multilayered cell walls at microscale, hexagon-shape-tube cellular structure at meso...

  3. Identification of hepatitis B virus subgenotype A3 in rural Gabon.

    Science.gov (United States)

    Makuwa, Maria; Souquière, Sandrine; Telfer, Paul; Apetrei, Cristian; Vray, Muriel; Bedjabaga, Issa; Mouinga-Ondeme, Augustin; Onanga, Richard; Marx, Preston A; Kazanji, Mirdad; Roques, Pierre; Simon, François

    2006-09-01

    An hepatitis B virus (HBV) molecular survey was conducted in five remote villages in the equatorial forest in Gabon, Central Africa. Two hundred seventy out of 311 inhabitants (86.8%) were HBV-infected or had evidence of past HBV infection. Chronic hepatitis corresponding to hepatitis B surface antigen (HBsAg) positivity was suspected in 27 (8.6%) of the HBV-infected subjects. High HBV viral loads were detected mainly in children aged 4-7 years. The pre-S/S domains were sequenced in 13 cases and 12 strains belonged to HBV-A genotype. In one case we found evidence for recombination between genotypes A and E. Phylogenetic analysis revealed that Gabonese HBV strains were distinct from HBV-A subgenotypes (A1 and A2). These new HBV strains from Gabon clustered with previously reported HBV-A3 subgenotype strains from Cameroon and Democratic Republic of Congo. The analysis of the pre-S2 domain allowed us to determine two amino acid substitutions (N/152/S and N/174/T) specific to the Central African HBV-A3 subgenotype strains and one amino acid substitution (P/155/Q) unique to these new Gabonese HBV-A3 subgenotype isolates. Two full genome sequences of two new Gabonese HBV isolates are also presented and confirm the distinctive HBV-Gab-A3 cluster.

  4. Interplay of Specific Trans- and Juxtamembrane Interfaces in Plexin A3 Dimerization and Signal Transduction.

    Science.gov (United States)

    Barton, Rachael; Khakbaz, Pouyan; Bera, Indrani; Klauda, Jeffery B; Iovine, M Kathryn; Berger, Bryan W

    2016-09-01

    Plexins are transmembrane proteins that serve as guidance receptors during angiogenesis, lymphangiogenesis, neuronal development, and zebrafish fin regeneration, with a putative role in cancer metastasis. Receptor dimerization or clustering, induced by extracellular ligand binding but modulated in part by the plexin transmembrane (TM) and juxtamembrane (JM) domains, is thought to drive plexin activity. Previous studies indicate that isolated plexin TM domains interact through a conserved, small-x3-small packing motif, and the cytosolic JM region interacts through a hydrophobic heptad repeat; however, the roles and interplay of these regions in plexin signal transduction remain unclear. Using an integrated experimental and simulation approach, we find disruption of the small-x3-small motifs in the Danio rerio Plexin A3 TM domain enhances dimerization of the TM-JM domain by enhancing JM-mediated dimerization. Furthermore, mutations of the cytosolic JM heptad repeat that disrupt dimerization do so even in the presence of TM domain mutations. However, mutations to the small-x3-small TM interfaces also disrupt Plexin A3 signaling in a zebrafish axonal guidance assay, indicating the importance of this TM interface in signal transduction. Collectively, our experimental and simulation results demonstrate that multiple TM and JM interfaces exist in the Plexin A3 homodimer, and these interfaces independently regulate dimerization that is important in Plexin A3 signal transduction.

  5. Panel Meeting for A3 Foresight Program 2008 held in Hangzhou

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    @@ Jointly organized by the Bureau of International Cooperation,Department of Engineering & Material Sciences and Department of Mathematical & Physical Sciences of NSFC,the panel evaluation meeting for A3 Foresight Program for the year 2008 was held in Hangzhou from May 28 to 30,2008.

  6. Structural studies on the von Willebrand factor A1 and A3 domains

    NARCIS (Netherlands)

    Romijn, R.A.P.

    2003-01-01

    Von Willebrand factor (VWF), a multimeric plasma glycoprotein, mediates platelet adhesion to sites of vascular damage. In this proces, the VWF-A3 domain binds to collagen in the vessel wall. This is followed by binding of the VWF-A1 domain to platelet receptor glycoprotein (Gp) Ibalpha. The investig

  7. Transcription analysis of the Streptomyces coelicolor A3(2) rrnA operon

    DEFF Research Database (Denmark)

    van Wezel, G P; Krab, I M; Douthwaite, S;

    1994-01-01

    Transcription start sites and processing sites of the Streptomyces coelicolor A3(2) rrnA operon have been investigated by a combination of in vivo and in vitro transcription analyses. The data from these approaches are consistent with the existence of four in vivo transcription sites, corresponding...

  8. 26 CFR 31.3302(a)-3 - Proof of credit under section 3302(a).

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Federal Unemployment Tax Act (Chapter 23, Internal Revenue Code of 1954) § 31.3302(a)-3 Proof of credit under section 3302(a). Credit against the tax for any calendar year for...

  9. Reproducibility of a 3-dimensional gyroscope in measuring shoulder anteflexion and abduction

    NARCIS (Netherlands)

    Penning, L.I.F.; Guldemond, N.A.; De Bie, R.A.; Walenkamp, G.H.I.M.

    2012-01-01

    Background: Few studies have investigated the use of a 3-dimensional gyroscope for measuring the range of motion (ROM) in the impaired shoulder. Reproducibility of digital inclinometer and visual estimation is poor. This study aims to investigate the reproducibility of a tri axial gyroscope in measu

  10. 26 CFR 1.651(a)-3 - Distribution of amounts other than income.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Distribution of amounts other than income. 1.651... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Trusts Which Distribute Current Income Only § 1.651(a)-3 Distribution of amounts other than income. (a) A trust does not qualify for treatment under section 651 for...

  11. Alpha-defensin DEFA1A3 gene copy number elevation in Danish Crohn's disease patients

    DEFF Research Database (Denmark)

    Jespersgaard, Cathrine; Fode, Peder; Dybdahl, Marianne

    2011-01-01

    BACKGROUND AND PURPOSE OF STUDY: Extensive copy number variation is observed for the DEFA1A3 gene encoding alpha-defensins 1-3. The objective of this study was to determine the involvement of alpha-defensins in colonic tissue from Crohn's disease (CD) patients and the possible genetic association...

  12. Influence of NaCl Deposition on Atmospheric Corrosion of A3 Steel

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Regularity of the initial atmospheric corrosion of A3 steel in the presence of NaCl was investigated. The results showed that NaCl can accelerate the corrosion of A3 steel. Dry mass gain of A3 steel in the presence of NaCl deposition increases with the exposure time, which can be correlated by using exponential decay function. The relationship between dry mass gain and amount of NaCl deposition at a certain exposure time follows a quadratic function. More amount of NaCl deposition will slow down the corrosion rate to some extent after exposure for a certain time. SEM/EDAX was used to characterize the corrosion surface and products. The surfaces of the NaCl treated A3 steel were obviously uneven, and some tiny crevices appear in the corrosion products that could help O2 transmit to the inner layer. The amount of oxygen in atomic percentage in the corrosion products increases with the amount of NaCl deposition.

  13. Talk to the Hand: Generating a 3D Print from Photographs

    OpenAIRE

    Aboufadel, Edward; Krawczyk, Sylvanna V.; Sherman-Bennett, Melissa

    2015-01-01

    This manuscript presents a linear algebra-based technique that only requires two unique photographs from a digital camera to mathematically construct a 3D surface representation which can then be 3D printed. Basic computer vision theory and manufacturing principles are also briefly discussed.

  14. On an asymptotic distribution of dependent random variables on a 3-dimensional lattice✩

    Science.gov (United States)

    Harvey, Danielle J.; Weng, Qian; Beckett, Laurel A.

    2010-01-01

    We define conditions under which sums of dependent spatial data will be approximately normally distributed. A theorem on the asymptotic distribution of a sum of dependent random variables defined on a 3-dimensional lattice is presented. Examples are also presented. PMID:20436940

  15. Realizing the quantum baker's map on a 3-qubit NMR quantum computer

    CERN Document Server

    Brun, T A; Brun, Todd A.; Schack, Ruediger

    1999-01-01

    By numerically simulating an implementation of the quantum baker's map on a 3-qubit NMR quantum computer based on the molecule trichloroethylene, we demonstrate the feasibility of quantum chaos experiments on present-day quantum computers. We give detailed descriptions of proposed experiments that investigate (a) the rate of entropy increase due to decoherence and (b) the phenomenon of hypersensitivity to perturbation.

  16. Plasmidic qnrA3 enhances Escherichia coli fitness in absence of antibiotic exposure.

    Directory of Open Access Journals (Sweden)

    Adrien Michon

    Full Text Available The widespread presence of plasmid-mediated quinolone resistance determinants, particularly qnr genes, has become a current issue. By protecting DNA-gyrase from quinolones, Qnr proteins confer a low level quinolone resistance that is not sufficient to explain their emergence. Since Qnr proteins were hypothesized to act as DNA-binding protein regulators, qnr genes could have emerged by providing a selective advantage other than antibiotic resistance. We investigated host fitness of Escherichia coli isogenic strains after acquisition of the qnrA3 gene, inserted either alone onto a small plasmid (pBR322, or harbored on a large conjugative native plasmid, pHe96(qnrA3 found in a clinical isolate. The isogenic strains were derived from the susceptible E. coli CFT073, a virulent B2 group strain known to infect bladder and kidneys in a mouse model of pyelonephritis. In vitro experiments included growth analysis by automatic spectrophotometry and flow cytometry, and competitions with CFU enumeration. In vivo experiments included infection with each strain and pairwise competitions in absence of antimicrobial exposure. As controls for our experiments we used mutations known to reduce fitness (rpsL K42N mutation or to enhance fitness (tetA deletion in pBR322. E. coli CFT073 transformed with pBRAM(PBR322-qnrA3 had significantly higher maximal OD than E. coli CFT073 transformed with pBR322 or pBR322ΔtetA, and in vivo competitions were more often won by the qnrA3 carrying strain (24 victories vs. 9 loss among 42 competitions, p = 0.001. In contrast, when pHe96(qnrA3 was introduced by conjugation in E. coli CFT073, it exerted a fitness cost shown by an impaired growth observed in vitro and in vivo and a majority of lost competitions (33/35, p<0.0001. In conclusion, qnrA3 acquisition enhanced bacterial fitness, which may explain qnr emergence and suggests a regulation role of qnr. However, fitness was reduced when qnrA3 was inserted onto multidrug

  17. The new investigation of the b3Σ- -a3 Π system of AlH

    Science.gov (United States)

    Szajna, Wojciech; Hakalla, Rafał; Kolek, Przemysław; Zachwieja, Mirosław

    2017-01-01

    The b3Σ- -a3 Π visible system of AlH was observed at high resolution by using a high accuracy, dispersive optical spectroscopy technique. The emission spectrum was excited in an aluminum hollow-cathode lamp with two anodes, filled with a static Ne/NH3 gas mixture. In the 25 , 900 - 26 , 500cm-1 spectral region, the rotational structure of the two overlapped 0-0 and 1-1 bands was clearly observed and precisely measured. In total, 260 transition wavenumbers have been assigned with an estimated accuracy of about 0.005 cm-1. The open rotational structure of the Q branches in both bands has been measured for the first time, and the Λ-doubling in the a3 Π , v = 0 , 1 levels has been described by o , p and q parameters. For example, the values for the v = 0 level are p0 = 1.754 (14) ×10-2cm-1, q0 = 3.264 (28) ×10-3cm-1 and o0 = 9.34 (20) ×10-2cm-1. Moreover, the spin-orbit interaction constants for the a3 Π state have been obtained experimentally as follows: A0 = 40.6040 (42)cm-1 and A1 = 40.419 (59)cm-1. The a3 Π , v = 0 , 1 levels are considered as regular, while for the b3Σ- , v = 0 , 1 levels considerable perturbations in the rotational structure have been observed. Consequently, these states have been represented in a different way in our least-squares treatment: a3 Π state by molecular constants and b3Σ- state by term values. The observed irregularities in the b3Σ- state have been graphically described by plotting experimental minus calculated term values versus quantum number N for the v = 0 level, as well as by plotting reduced term values versus N (N + 1) for the v = 1 level.

  18. The reactivity study of peptide A3-capped gold and silver nanoparticles with heavy metal ions

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hongyu [New Energy Research Institute, School of Environment and Energy, South China University of Technology, Guangzhou Higher Education Mega Centre, Guangzhou 510006 (China); Tang, Zhenghua, E-mail: zhht@scut.edu.cn [New Energy Research Institute, School of Environment and Energy, South China University of Technology, Guangzhou Higher Education Mega Centre, Guangzhou 510006 (China); Guangdong Provincial Key Laboratory of Atmospheric Environment and Pollution Control, School of Environment and Energy, South China University of Technology, Guangzhou Higher Education Mega Centre, Guangzhou 510006 (China); Wang, Likai; Zhou, Weijia; Li, Ligui [New Energy Research Institute, School of Environment and Energy, South China University of Technology, Guangzhou Higher Education Mega Centre, Guangzhou 510006 (China); Zhang, Yongqing [Guangdong Provincial Key Laboratory of Atmospheric Environment and Pollution Control, School of Environment and Energy, South China University of Technology, Guangzhou Higher Education Mega Centre, Guangzhou 510006 (China); Chen, Shaowei, E-mail: shaowei@ucsc.edu [New Energy Research Institute, School of Environment and Energy, South China University of Technology, Guangzhou Higher Education Mega Centre, Guangzhou 510006 (China); Department of Chemistry and Biochemistry, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States)

    2016-08-15

    Highlights: • Apparent color change upon the addition of Hg{sup 2+} or As{sup 3+} ions into A3-AuNPs solution. • Distinct color change of A3-AgNPs solution only in the presence of Hg{sup 2+} ions. • The Hg{sup 2+} concentration limit of A3-AgNPs about 40 times lower than A3-AuNPs. • Based on the DLS, TEM and XPS results, two reaction mechanisms have been proposed. - Abstract: Peptide A3-capped gold and silver nanoparticles were prepared by chemical reduction of metal salt precursors. The nanoparticles exhibited apparent but distinctly different color changes upon the addition of selected heavy metal ions. For gold nanoparticles, the solution color was found to change from red to blue in the presence of Hg{sup 2+} or As{sup 3+} ions, accompanied with broadening and a red-shift of the surface plasmon resonance peak. In contrast, silver nanoparticles showed an apparent color change from yellow to colorless only in the presence of Hg{sup 2+}, along with a blue-shift and diminishment of the surface plasmon resonance peak. The Hg{sup 2+} reaction concentration limit of silver nanoparticle was about 40 times lower than that of gold nanoparticle. Based on the dynamic light scattering, transmission electron microscopy and X-ray photoelectron spectroscopic results, the reaction mechanism has been proposed. Such a sensitive variation of the nanoparticle optical properties to selective ions might be exploited for ion detection for potential applications.

  19. Overexpression of Populus trichocarpa CYP85A3 promotes growth and biomass production in transgenic trees.

    Science.gov (United States)

    Jin, Yan-Li; Tang, Ren-Jie; Wang, Hai-Hai; Jiang, Chun-Mei; Bao, Yan; Yang, Yang; Liang, Mei-Xia; Kong, Fanjing; Li, Bei; Zhang, Hong-Xia

    2017-03-04

    Brassinosteroids (BRs) are essential hormones that play crucial roles in plant growth, reproduction and response to abiotic and biotic stress. In Arabidopsis, AtCYP85A2 works as a bifunctional cytochrome P450 monooxygenase to catalyze the conversion of castasterone (CS) to brassinolide (BL), a final rate-limiting step in the BR biosynthetic pathway. Here, we report the functional characterizations of PtCYP85A3, one of the three AtCYP85A2 homologous genes from Populus trichocarpa. PtCYP85A3 shares the highest similarity with AtCYP85A2 and can rescue the retarded-growth phenotype of the Arabidopsis cyp85a2-2 and tomato d(x) mutants. Constitutive expression of PtCYP85A3, driven by the cauliflower mosaic virus 35S promoter, increased the endogenous BR levels and significantly promoted the growth and biomass production in both transgenic tomato and poplar. Compared to the wild type (WT), plant height, shoot fresh weight and fruit yield increased 50%, 56% and 43%, respectively, in transgenic tomato plants. Similarly, plant height and stem diameter increased 15% and 25%, respectively, in transgenic poplar plants. Further study revealed that overexpression of PtCYP85A3 enhanced xylem formation without affecting the composition of cellulose and lignin, as well as the cell wall thickness in transgenic poplar. Our finding suggest that PtCYP85A3 could be used as a potential candidate gene for engineering fast growing trees with improved wood production. This article is protected by copyright. All rights reserved.

  20. Vif Proteins from Diverse Human Immunodeficiency Virus/Simian Immunodeficiency Virus Lineages Have Distinct Binding Sites in A3C.

    Science.gov (United States)

    Zhang, Zeli; Gu, Qinyong; Jaguva Vasudevan, Ananda Ayyappan; Jeyaraj, Manimehalai; Schmidt, Stanislaw; Zielonka, Jörg; Perković, Mario; Heckel, Jens-Ove; Cichutek, Klaus; Häussinger, Dieter; Smits, Sander H J; Münk, Carsten

    2016-11-15

    Lentiviruses have evolved the Vif protein to counteract APOBEC3 (A3) restriction factors by targeting them for proteasomal degradation. Previous studies have identified important residues in the interface of human immunodeficiency virus type 1 (HIV-1) Vif and human APOBEC3C (hA3C) or human APOBEC3F (hA3F). However, the interaction between primate A3C proteins and HIV-1 Vif or natural HIV-1 Vif variants is still poorly understood. Here, we report that HIV-1 Vif is inactive against A3Cs of rhesus macaques (rhA3C), sooty mangabey monkeys (smmA3C), and African green monkeys (agmA3C), while HIV-2, African green monkey simian immunodeficiency virus (SIVagm), and SIVmac Vif proteins efficiently mediate the depletion of all tested A3Cs. We identified that residues N/H130 and Q133 in rhA3C and smmA3C are determinants for this HIV-1 Vif-triggered counteraction. We also found that the HIV-1 Vif interaction sites in helix 4 of hA3C and hA3F differ. Vif alleles from diverse HIV-1 subtypes were tested for degradation activities related to hA3C. The subtype F-1 Vif was identified to be inactive for degradation of hA3C and hA3F. The residues that determined F-1 Vif inactivity in the degradation of A3C/A3F were located in the C-terminal region (K167 and D182). Structural analysis of F-1 Vif revealed that impairing the internal salt bridge of E171-K167 restored reduction capacities to A3C/A3F. Furthermore, we found that D101 could also form an internal interaction with K167. Replacing D101 with glycine and R167 with lysine in NL4-3 Vif impaired its counteractivity to A3F and A3C. This finding indicates that internal interactions outside the A3 binding region in HIV-1 Vif influence the capacity to induce degradation of A3C/A3F.

  1. Voltage-gated potassium channels involved in regulation of physiological function in MrgprA3-specific itch neurons.

    Science.gov (United States)

    Tang, Min; Wu, Guanyi; Wang, Zhongli; Yang, Niuniu; Shi, Hao; He, Qian; Zhu, Chan; Yang, Yan; Yu, Guang; Wang, Changming; Yuan, Xiaolin; Liu, Qin; Guan, Yun; Dong, Xinzhong; Tang, Zongxiang

    2016-04-01

    Itch is described as an unpleasant or irritating skin sensation that elicits the desire or reflex to scratch. MrgprA3, one of members of the Mrgprs family, is specifically expressed in a subpopulation of dorsal root ganglion (DRG) in the peripheral nervous system (PNS). These MrgprA3-expressing DRG neurons have been identified as itch-specific neurons. They can be activated by the compound, chloroquine, which is used as a drug to treat malaria. In the present study, we labeled these itch-specific neurons using the method of molecular genetic markers, and then studied their electrophysiological properties. We also recorded the cutaneous MrgprA3(-) neurons retrogradely labeled by Dil dye (MrgprA3(-)-Dil). We first found that MrgprA3(+) neurons have a lower excitability than MrgprA3(-) neurons (MrgprA3(-)-non-Dil and MrgprA3(-)-Dil). The number of action potential (AP) was reduced more obviously in MrgprA3(+) neurons than that of in MrgprA3(-) neurons. In most cases, MrgprA3(+) neurons only generated single AP; however, in MrgprA3(-) neurons, the same stimulation could induce multiple AP firing due to the greater voltage-gated potassium (Kv) current existence in MrgprA3(+) than in MrgprA3(-) neurons. Thus, Kv current plays an important role in the regulation of excitability in itch-specific neurons.

  2. Enhanced A3 adenosine receptor selectivity of multivalent nucleoside-dendrimer conjugates

    Directory of Open Access Journals (Sweden)

    Shainberg Asher

    2008-10-01

    Full Text Available Abstract Background An approach to use multivalent dendrimer carriers for delivery of nucleoside signaling molecules to their cell surface G protein-coupled receptors (GPCRs was recently introduced. Results A known adenosine receptor (AR agonist was conjugated to polyamidoamine (PAMAM dendrimer carriers for delivery of the intact covalent conjugate to on the cell surface. Depending on the linking moiety, multivalent conjugates of the N6-chain elongated functionalized congener ADAC (N6-[4-[[[4-[[[(2-aminoethylamino]carbonyl]methyl]anilino]carbonyl]methyl]phenyl]-adenosine achieved unanticipated high selectivity in binding to the cytoprotective human A3 AR, a class A GPCR. The key to this selectivity of > 100-fold in both radioreceptor binding (Ki app = 2.4 nM and functional assays (EC50 = 1.6 nM in inhibition of adenylate cyclase was maintaining a free amino group (secondary in an amide-linked chain. Attachment of neutral amide-linked chains or thiourea-containing chains preserved the moderate affinity and efficacy at the A1 AR subtype, but there was no selectivity for the A3 AR. Since residual amino groups on dendrimers are associated with cytotoxicity, the unreacted terminal positions of this A3 AR-selective G2.5 dendrimer were present as carboxylate groups, which had the further benefit of increasing water-solubility. The A3 AR selective G2.5 dendrimer was also visualized binding the membrane of cells expressing the A3 receptor but did not bind cells that did not express the receptor. Conclusion This is the first example showing that it is feasible to modulate and even enhance the pharmacological profile of a ligand of a GPCR based on conjugation to a nanocarrier and the precise structure of the linking group, which was designed to interact with distal extracellular regions of the 7 transmembrane-spanning receptor. This ligand tool can now be used in pharmacological models of tissue rescue from ischemia and to probe the existence of A3 AR

  3. “3D Turtle Graphics” by using a 3D Printer

    Directory of Open Access Journals (Sweden)

    Yasusi Kanada

    2015-04-01

    Full Text Available When creating shapes by using a 3D printer, usually, a static (declarative model designed by using a 3D CAD system is translated to a CAM program and it is sent to the printer. However, widely-used FDM-type 3D printers input a dynamical (procedural program that describes control of motions of the print head and extrusion of the filament. If the program is expressed by using a programming language or a library in a straight manner, solids can be created by a method similar to turtle graphics. An open-source library that enables “turtle 3D printing” method was described by Python and tested. Although this method currently has a problem that it cannot print in the air; however, if this problem is solved by an appropriate method, shapes drawn by 3D turtle graphics freely can be embodied by this method.

  4. A 3/2-Approximation Algorithm for Multiple Depot Multiple Traveling Salesman Problem

    Science.gov (United States)

    Xu, Zhou; Rodrigues, Brian

    As an important extension of the classical traveling salesman problem (TSP), the multiple depot multiple traveling salesman problem (MDMTSP) is to minimize the total length of a collection of tours for multiple vehicles to serve all the customers, where each vehicle must start or stay at its distinct depot. Due to the gap between the existing best approximation ratios for the TSP and for the MDMTSP in literature, which are 3/2 and 2, respectively, it is an open question whether or not a 3/2-approximation algorithm exists for the MDMTSP. We have partially addressed this question by developing a 3/2-approximation algorithm, which runs in polynomial time when the number of depots is a constant.

  5. Kinematic Analysis of a 3-Axis Parallel Manipulator: The P3

    Directory of Open Access Journals (Sweden)

    Qiaohong Chen

    2013-01-01

    Full Text Available This paper presents kinematic analysis of a 3-axis parallel manipulator, called P3. The P3 parallel manipulator is developed based on a 3-PRRU parallel mechanism, where P denotes prismatic pair, R revolute pair, and U universal joint. The P3 parallel manipulator can undergo two rotations and one translation without parasitic motion. First, a brief description of the P3 is presented. Then, forward and inverse kinematic solutions of the P3 are derived. Parasitic motion is discussed. The Jacobian matrix is obtained based on the velocity equations. Further, singular configurations of the P3 are identified. A special configuration where the actuation fails is also detected based on screw theory. The workspace of P3 is investigated.

  6. Neural Network Based Reconstruction of a 3D Object from a 2D Wireframe

    CERN Document Server

    Johnson, Kyle; Lipson, Hod

    2010-01-01

    We propose a new approach for constructing a 3D representation from a 2D wireframe drawing. A drawing is simply a parallel projection of a 3D object onto a 2D surface; humans are able to recreate mental 3D models from 2D representations very easily, yet the process is very difficult to emulate computationally. We hypothesize that our ability to perform this construction relies on the angles in the 2D scene, among other geometric properties. Being able to reproduce this reconstruction process automatically would allow for efficient and robust 3D sketch interfaces. Our research focuses on the relationship between 2D geometry observable in the sketch and 3D geometry derived from a potential 3D construction. We present a fully automated system that constructs 3D representations from 2D wireframes using a neural network in conjunction with a genetic search algorithm.

  7. A 3-D visualization method for image-guided brain surgery.

    Science.gov (United States)

    Bourbakis, N G; Awad, M

    2003-01-01

    This paper deals with a 3D methodology for brain tumor image-guided surgery. The methodology is based on development of a visualization process that mimics the human surgeon behavior and decision-making. In particular, it originally constructs a 3D representation of a tumor by using the segmented version of the 2D MRI images. Then it develops an optimal path for the tumor extraction based on minimizing the surgical effort and penetration area. A cost function, incorporated in this process, minimizes the damage surrounding healthy tissues taking into consideration the constraints of a new snake-like surgical tool proposed here. The tumor extraction method presented in this paper is compared with the ordinary method used on brain surgery, which is based on a straight-line based surgical tool. Illustrative examples based on real simulations present the advantages of the 3D methodology proposed here.

  8. Endocrine response to masturbation-induced orgasm in healthy men following a 3-week sexual abstinence.

    Science.gov (United States)

    Exton, M S; Krüger, T H; Bursch, N; Haake, P; Knapp, W; Schedlowski, M; Hartmann, U

    2001-11-01

    This current study examined the effect of a 3-week period of sexual abstinence on the neuroendocrine response to masturbation-induced orgasm. Hormonal and cardiovascular parameters were examined in ten healthy adult men during sexual arousal and masturbation-induced orgasm. Blood was drawn continuously and cardiovascular parameters were constantly monitored. This procedure was conducted for each participant twice, both before and after a 3-week period of sexual abstinence. Plasma was subsequently analysed for concentrations of adrenaline, noradrenaline, cortisol, prolactin, luteinizing hormone and testosterone concentrations. Orgasm increased blood pressure, heart rate, plasma catecholamines and prolactin. These effects were observed both before and after sexual abstinence. In contrast, although plasma testosterone was unaltered by orgasm, higher testosterone concentrations were observed following the period of abstinence. These data demonstrate that acute abstinence does not change the neuroendocrine response to orgasm but does produce elevated levels of testosterone in males.

  9. Supporting Product Family Design in a 3D CAD/PDM Integrated System

    Institute of Scientific and Technical Information of China (English)

    ZHANG Fen; CHEN Zhuo-ning; YAN Xiao-guang; BIN Hong-zan

    2006-01-01

    This paper addresses some key issues in supporting product family design in a 3D CAD/PDM integrated system and introduces the techniques developed or adopted in building the integrated system. The general architecture of a 3D CAD/PDM integrated system is organized as five tiers. Multi-agent technology is applied with a collaborative design environment. The rule-based product family architecture (PFA) and tabular layouts of article characteristics (TLAC) technique are applied to represent the knowledge for product families. They make the knowledge understandable, simplified and can be exchanged among heterogeneous information systems. A transparently concentric integrated mode is put forward to enable the heterogeneous processes to interact and communicate regardless of the language used to construct each process. With the mode, function calling and information exchanging among different processes are carried out via message translation/parse approach. Currently, the integrated system is implemented in the platform of Windows NT and 2000.

  10. Numerical simulation of the filling stage in injection molding based on a 3D model

    Institute of Scientific and Technical Information of China (English)

    GENG Tie; LI De-qun; ZHOU Hua-min

    2005-01-01

    Most injection molded parts are three-dimensional, with complex geometrical configurations and thick/thin wall sections. The change of the thickness of parts has significant influence on flow during injection molding. This paper presents a 3D finite element model to deal with the three-dimensional flow, which can more accurately predict the filling process than a 2. 5D model. In this model, equal-order velocity-pressure interpolation method is successfully employed and the relation between velocity and pressure is obtained from the discretized momentum equation in order to derive the pressure equation. A 3D control volume scheme is employed to track the flow front. The validity of the model has been tested through the analysis of the flow in a cavity.

  11. H antigen presence in an Ascaris lumbricoides extract Presencia de antígeno H en un extracto de Ascaris lumbricoides

    Directory of Open Access Journals (Sweden)

    Patricia Ponce de León

    2005-06-01

    Full Text Available Previous experiences have demonstrated the same ABO system and P system antigens in A. lumbricoides extracts and in their hosts. The aim was to show the behavior of an A. lumbricoides extract from an O Group patient against monoclonal antibodies of different specificities. Agglutination Inhibition Tests were carried out facing the extract against monoclonal antibodies (anti A 2.23; anti B 2.54; anti B 2.62; anti AB 2.39 and anti H 2.72 in optimal concentrations. Suspensions of O Group fresh red cells were used as revealing system. The extract only inhibited the agglutination of anti H 2.72 with O erythrocytes. The semiquantitative Agglutination Inhibition Test of the extract was made against two series of anti H 2.72 dilutions by using O Group fresh red cells as revealing system. A difference of five dilutions between the titers of both series has been observed and the presence of H Antigen in the extract has been significantly confirmed. The fact that the extract did not inhibit the agglutination against anti A, anti B and anti AB has corroborated our previous observations about absence of A and B epitopes in A. lumbricoides extracts from O Group patients. The results of the preceding studies and this experience have demonstrated the membrane glycoconjugated importance in A. lumbricoides. They could be involved in molecular mimicry for this parasite.Experiencias previas han demostrado los mismos antígenos del Sistema ABO y del Sistema P en extractos de A. lumbricoides y en sus huéspedes. El objetivo fue mostrar el comportamiento de un extracto de A. lumbricoides de un paciente Grupo O frente a anticuerpos monoclonales de diferentes especificidades. Se hicieron pruebas de Inhibición de la Aglutinación enfrentando el extracto contra anticuerpos monoclonales (anti A 2.23; anti B 2.54; anti B 2.62; anti AB 2.39 y anti H 2.72 en dosis óptimas. El sistema revelador fue una suspensión fresca de eritrocitos Grupo O. El extracto sólo inhibió la

  12. [Morgagni-Larrey diaphragmatic hernia in a 3-month-old child affected by Marfan syndrome].

    Science.gov (United States)

    Laumonerie, P; Mouttalib, S; Edouard, T; Galinier, P

    2015-11-01

    The authors report on a case of diaphragmatic hernia occurring in a 3-month-old child affected by Marfan syndrome. Diagnosis was made on a chest X-ray and cardiac ultrasounds, performed because of the association of poor general condition, failure to thrive, and signs of respiratory distress. As a reminder, we emphasize the association between Marfan disease and diaphragmatic hernias as well as the diagnostic approach to reach an appropriate diagnosis.

  13. Establishment and Quantitative Imaging of a 3D Lung Organotypic Model of Mammary Tumor Outgrowth

    OpenAIRE

    Martin, Michelle D.; Fingleton, Barbara; Lynch, Conor C.; Wells, Sam; McIntyre, J. Oliver; Piston, David W.; Matrisian, Lynn M.

    2008-01-01

    The lung is the second most common site of metastatic spread in breast cancer and experimental evidence has been provided in many systems for the importance of an organ-specific microenvironment in the development of metastasis. To better understand the interaction between tumor and host cells in this important secondary site, we have developed a 3D in vitro organotypic model of breast tumor metastatic growth in the lung. In our model, cells isolated from mouse lungs are placed in a collagen ...

  14. ATP1A3 Mutation in Adult Rapid-Onset Ataxia.

    Science.gov (United States)

    Sweadner, Kathleen J; Toro, Camilo; Whitlow, Christopher T; Snively, Beverly M; Cook, Jared F; Ozelius, Laurie J; Markello, Thomas C; Brashear, Allison

    2016-01-01

    A 21-year old male presented with ataxia and dysarthria that had appeared over a period of months. Exome sequencing identified a de novo missense variant in ATP1A3, the gene encoding the α3 subunit of Na,K-ATPase. Several lines of evidence suggest that the variant is causative. ATP1A3 mutations can cause rapid-onset dystonia-parkinsonism (RDP) with a similar age and speed of onset, as well as severe diseases of infancy. The patient's ATP1A3 p.Gly316Ser mutation was validated in the laboratory by the impaired ability of the expressed protein to support the growth of cultured cells. In a crystal structure of Na,K-ATPase, the mutated amino acid was directly apposed to a different amino acid mutated in RDP. Clinical evaluation showed that the patient had many characteristics of RDP, however he had minimal fixed dystonia, a defining symptom of RDP. Successive magnetic resonance imaging (MRI) revealed progressive cerebellar atrophy, explaining the ataxia. The absence of dystonia in the presence of other RDP symptoms corroborates other evidence that the cerebellum contributes importantly to dystonia pathophysiology. We discuss the possibility that a second de novo variant, in ubiquilin 4 (UBQLN4), a ubiquitin pathway component, contributed to the cerebellar neurodegenerative phenotype and differentiated the disease from other manifestations of ATP1A3 mutations. We also show that a homozygous variant in GPRIN1 (G protein-regulated inducer of neurite outgrowth 1) deletes a motif with multiple copies and is unlikely to be causative.

  15. Integrating failure documentation with A3 template to improve product design quality

    OpenAIRE

    ZHU Linjia

    2012-01-01

    Design quality always has great impact on the competitive attribution of companies. Knowledge Management has become an important process which could help companies to accumulate the knowledge created in the past, and use it to solve the current problem and for future use. Failure Mode and Effect Analysis (FMEA) has been widely implemented as a technique for identifying potential problems, whilst A3 Thinking, has been developed by Toyota as a tool to help solve problems. However, no research e...

  16. Air-structured optical fibre drawn from a 3D-printed preform

    CERN Document Server

    Cook, Kevin; Leon-Saval, Sergio; Reid, Zane; Hossain, Md Arafat; Comatti, Jade-Edouard; Luo, Yanhua; Peng, Gang-Ding

    2016-01-01

    A structured optical fibre is drawn from a 3D-printed structured preform. Preforms containing a single ring of holes around the core are fabricated using filament made from a modified butadiene polymer. More broadly, 3D printers capable of processing soft glasses, silica and other materials are likely to come on line in the not-so distant future. 3D printing of optical preforms signals a new milestone in optical fibre manufacture.

  17. Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.

    Science.gov (United States)

    Huether, Robert; Liu, Zhi-Jie; Xu, Hao; Wang, Bi-Cheng; Pletnev, Vladimir Z; Mao, Qilong; Duax, William L; Umland, Timothy C

    2010-02-15

    We have identified a highly conserved fingerprint of 40 residues in the TGYK subfamily of the short-chain oxidoreductase enzymes. The TGYK subfamily is defined by the presence of an N-terminal TGxxxGxG motif and a catalytic YxxxK motif. This subfamily contains more than 12,000 members, with individual members displaying unique substrate specificities. The 40 fingerprint residues are critical to catalysis, cofactor binding, protein folding, and oligomerization but are substrate independent. Their conservation provides critical insight into evolution of the folding and function of TGYK enzymes. Substrate specificity is determined by distinct combinations of residues in three flexible loops that make up the substrate-binding pocket. Here, we report the structure determinations of the TGYK enzyme A3DFK9 from Clostridium thermocellum in its apo form and with bound NAD(+) cofactor. The function of this protein is unknown, but our analysis of the substrate-binding loops putatively identifies A3DFK9 as a carbohydrate or polyalcohol metabolizing enzyme. C. thermocellum has potential commercial applications because of its ability to convert biomaterial into ethanol. A3DFK9 contains 31 of the 40 TGYK subfamily fingerprint residues. The most significant variations are the substitution of a cysteine (Cys84) for a highly conserved glycine within a characteristic VNNAG motif, and the substitution of a glycine (Gly106) for a highly conserved asparagine residue at a helical kink. Both of these variations occur at positions typically participating in the formation of a catalytically important proton transfer network. An alternate means of stabilizing this proton wire was observed in the A3DFK9 crystal structures.

  18. A 3-D Model of Signaling and Transport Pathways in Epithelial Cells

    Energy Technology Data Exchange (ETDEWEB)

    Quong, A A; Westbrook, C K

    2005-04-01

    A 3-dimensional computer model was developed to simulate the spatial and chemical evolution of calcium ions inside an array of human epithelial kidney cells. This is a prototype model, intended to develop a methodology to incorporate much more complex interactions of metabolic and other processes within many types of cells and lead to increased ability to predict cellular responses to disease as well as to chemical and biological warfare situations. Preliminary tests of the model are described.

  19. A 3D Virtual Space for the E-Commerce Strategy Model

    OpenAIRE

    Gong Cheng; Changrui Yu; Kecheng Liu

    2014-01-01

    In recent years, innovative applications of electronic commerce (e-commerce) are facing the challenges of mobile commerce (m-commerce) and ubiquitous commerce (u-commerce). To address these challenges and improve the competitiveness of e-commerce, the three-dimensional e-commerce (3DEC) theory is proposed and a 3DEC business strategy model is built up in this study. The new conceptual 3DEC model incorporates the industrial environment analysis, SWOT analysis, and business model canvas (BMC). ...

  20. Experimental results of a 3 k Wh thermochemical heat storage module for space heating application

    OpenAIRE

    Finck, C.J.; Henquet, E.M.R.; Soest, C.F.L. van; Oversloot, H.P.; de Jong, A. J.; Cuypers, R.; Spijker, J.C. van 't

    2014-01-01

    A 3 kWh thermochemical heat storage (TCS) module was built as part of an all-in house system implementation focusing on space heating application at a temperature level of 40 ºC and a temperature lift of 20 K. It has been tested and measurements showed a maximum water circuit temperature span (released by adsorption) of 20 – 51 K which is by all means suitable for space heating.

  1. ATP1A3 Mutation in Adult Rapid-Onset Ataxia.

    Directory of Open Access Journals (Sweden)

    Kathleen J Sweadner

    Full Text Available A 21-year old male presented with ataxia and dysarthria that had appeared over a period of months. Exome sequencing identified a de novo missense variant in ATP1A3, the gene encoding the α3 subunit of Na,K-ATPase. Several lines of evidence suggest that the variant is causative. ATP1A3 mutations can cause rapid-onset dystonia-parkinsonism (RDP with a similar age and speed of onset, as well as severe diseases of infancy. The patient's ATP1A3 p.Gly316Ser mutation was validated in the laboratory by the impaired ability of the expressed protein to support the growth of cultured cells. In a crystal structure of Na,K-ATPase, the mutated amino acid was directly apposed to a different amino acid mutated in RDP. Clinical evaluation showed that the patient had many characteristics of RDP, however he had minimal fixed dystonia, a defining symptom of RDP. Successive magnetic resonance imaging (MRI revealed progressive cerebellar atrophy, explaining the ataxia. The absence of dystonia in the presence of other RDP symptoms corroborates other evidence that the cerebellum contributes importantly to dystonia pathophysiology. We discuss the possibility that a second de novo variant, in ubiquilin 4 (UBQLN4, a ubiquitin pathway component, contributed to the cerebellar neurodegenerative phenotype and differentiated the disease from other manifestations of ATP1A3 mutations. We also show that a homozygous variant in GPRIN1 (G protein-regulated inducer of neurite outgrowth 1 deletes a motif with multiple copies and is unlikely to be causative.

  2. Bulk density estimation using a 3-dimensional image acquisition and analysis system

    Directory of Open Access Journals (Sweden)

    Heyduk Adam

    2016-01-01

    Full Text Available The paper presents a concept of dynamic bulk density estimation of a particulate matter stream using a 3-d image analysis system and a conveyor belt scale. A method of image acquisition should be adjusted to the type of scale. The paper presents some laboratory results of static bulk density measurements using the MS Kinect time-of-flight camera and OpenCV/Matlab software. Measurements were made for several different size classes.

  3. Human platelets utilize cycloxygenase-1 to generate dioxolane A3, a neutrophil activating eicosanoid

    OpenAIRE

    Hinz, Christine; Aldrovandi, MacEler; Alam, Saydul; Slatter, David; Lauder, Sarah Nicol; Allen-Redpath, Keith; Collins, Peter William; Thomas, Christopher P.; O'Donnell, Valerie Bridget

    2016-01-01

    Eicosanoids are important mediators of fever, pain, and inflammation that modulate cell signaling during acute and chronic disease. We show by using lipidomics that thrombin-activated human platelets generate a new type of eicosanoid that both stimulates and primes human neutrophil integrin (Mac-1) expression, in response to formylmethionylleucylphenylalanine. Detailed characterization proposes a dioxolane structure, 8-hydroxy-9,11-dioxolane eicosatetraenoic acid (dioxolane A3, DXA3). The lip...

  4. New Neumann System Associated with a 3 × 3 Matrix Spectral Problem

    Directory of Open Access Journals (Sweden)

    Fang Li

    2014-01-01

    Full Text Available The nonlinearization approach of Lax pair is applied to the case of the Neumann constraint associated with a 3 × 3 matrix spectral problem, from which a new Neumann system is deduced and proved to be completely integrable in the Liouville sense. As an application, solutions of the first nontrivial equation related to the 3 × 3 matrix spectral problem are decomposed into solving two compatible Hamiltonian systems of ordinary differential equations.

  5. Compliance Modeling and Error Compensation of a 3-Parallelogram Lightweight Robotic Arm

    DEFF Research Database (Denmark)

    Wu, Guanglei; Guo, Sheng; Bai, Shaoping

    2015-01-01

    This paper presents compliance modeling and error compensation for lightweight robotic arms built with parallelogram linkages, i.e., Π joints. The Cartesian stiffness matrix is derived using the virtual joint method. Based on the developed stiffness model, a method to compensate the compliance...... error is introduced, being illustrated with a 3-parallelogram robot in the application of pick-and-place operation. The results show that this compensation method can effectively improve the operation accuracy....

  6. Minor and Minimum Cycle Bases of a 3-connected Planar Graph

    Institute of Scientific and Technical Information of China (English)

    Deng Ju MA; Han REN

    2009-01-01

    In this paper, we prove that if any set of |E(G)| - |V(G)| + 1 facial cycles of a 3-connected planar graph G embedded in the plane doesn't form a minimum cycle base of G, then any minimum cycle base of G contains a separating cycle, and G has a minor isomorphic to T6, where T6 is the graph obtained from the complete graph Kg by deleting a path with four edges.

  7. Depth of field simulation for still digital images using a 3D camera

    Directory of Open Access Journals (Sweden)

    Omar Alejandro Rodríguez Rosas

    2016-11-01

    Full Text Available In a world where digital photography is almost ubiquitous, the size of image capturing devices and their lenses limit their capabilities to achieve shallower depths of field for aesthetic purposes. This work proposes a novel approach to simulate this effect using the color and depth images from a 3D camera. Comparative tests yielded results similar to those of a regular lens.

  8. Acute myeloid leukemia with basophilic differentiation in a 3-year-old Standardbred gelding

    Science.gov (United States)

    Furness, Mary Catherine; Setlakwe, Emile; Sallaway, John; Wood, Darren; Fromstein, Jordan; Arroyo, Luis G.

    2016-01-01

    A 3-year-old Standardbred gelding with a history of pyrexia, persistent hemorrhage from the oral cavity, and a large, soft swelling at the junction of the caudal aspect of the mandibular rami and proximal neck was evaluated. The horse had neutropenia and anemia, with atypical granulated cells in a blood smear. Additional tests confirmed acute myeloid leukemia with basophilic differentiation, which has been reported in humans, cats, dogs, and cattle but not horses. PMID:27708445

  9. Compliance Analysis of a 3-DOF Spindle Head by Considering Gravitational Effects

    Institute of Scientific and Technical Information of China (English)

    LI Qi; WANG Manxin; HUANG Tian; CHETWYND G Derek

    2015-01-01

    The compliance modeling is one of the most significant issues in the stage of preliminary design for parallel kinematic machine(PKM). The gravity ignored in traditional compliance analysis has a significant effect on pose accuracy of tool center point(TCP) when a PKM is horizontally placed. By taking gravity into account, this paper presents a semi-analytical approach for compliance analysis of a 3-DOF spindle head named the A3 head. The architecture behind the A3 head is a 3-RPS parallel mechanism having one translational and two rotational movement capabilities, which can be employed to form the main body of a 5-DOF hybrid kinematic machine especially designed for high-speed machining of large aircraft components. The force analysis is carried out by considering both the externally applied wrench imposed upon the platform as well as gravity of all moving components. Then, the deflection analysis is investigated to establish the relationship between the deflection twist and compliances of all joints and links using semi-analytical method. The merits of this approach lie in that platform deflection twist throughout the entire task workspace can be evaluated in a very efficient manner. The effectiveness of the proposed approach is verified by the FEA and experiment at different configurations and the results show that the discrepancy of the compliances is less than 0.04μm/N-1 and that of the deformations is less than 10μm. The computational and experimental results show that the deflection twist induced by gravity forces of the moving components has significant bearings on pose accuracy of the platform, providing an informative guidance for the improvement of the current design. The proposed approach can be easily applied to the compliance analysis of PKM by considering gravitational effects and to evaluate the deformation caused by gravity throughout the entire workspace.

  10. A customized bolus produced using a 3-dimensional printer for radiotherapy.

    Directory of Open Access Journals (Sweden)

    Shin-Wook Kim

    Full Text Available OBJECTIVE: Boluses are used in high-energy radiotherapy in order to overcome the skin sparing effect. In practice though, commonly used flat boluses fail to make a perfect contact with the irregular surface of the patient's skin, resulting in air gaps. Hence, we fabricated a customized bolus using a 3-dimensional (3D printer and evaluated its feasibility for radiotherapy. METHODS: We designed two kinds of bolus for production on a 3D printer, one of which was the 3D printed flat bolus for the Blue water phantom and the other was a 3D printed customized bolus for the RANDO phantom. The 3D printed flat bolus was fabricated to verify its physical quality. The resulting 3D printed flat bolus was evaluated by assessing dosimetric parameters such as D1.5 cm, D5 cm, and D10 cm. The 3D printed customized bolus was then fabricated, and its quality and clinical feasibility were evaluated by visual inspection and by assessing dosimetric parameters such as Dmax, Dmin, Dmean, D90%, and V90%. RESULTS: The dosimetric parameters of the resulting 3D printed flat bolus showed that it was a useful dose escalating material, equivalent to a commercially available flat bolus. Analysis of the dosimetric parameters of the 3D printed customized bolus demonstrated that it is provided good dose escalation and good contact with the irregular surface of the RANDO phantom. CONCLUSIONS: A customized bolus produced using a 3D printer could potentially replace commercially available flat boluses.

  11. Traumatic posterior dislocation of the hip in a 3-year-old child.

    LENUS (Irish Health Repository)

    Forde, James C

    2012-02-01

    We report the case of a traumatic posterior dislocation of the hip in a 3-year-old boy. After a fall in the garden, the boy was brought to our emergency department where an x-ray confirmed a posterior dislocation of his right hip. A successful prompt reduction was performed in the operating room under general anesthesia. This uncommon injury represents an orthopedic emergency and requires prompt reduction to lessen the risk of complications including avascular necrosis of the femoral head.

  12. Optically Forbidden Transition of A'3△u←X3Σ-g in Oxygen

    Institute of Scientific and Technical Information of China (English)

    ZHU Lin-Fan; XU Wei-Qing; SUN Jian-Min; ZHANG Wen-Yao

    2010-01-01

    @@ The electron energy loss spectra for the valence-shell excitations of oxygen are measured at an incident electron energy of 2500 eV and at scattering angles from 4°to 8.5°.The dipole-forbidden and octupole-allowed transition of the A'3△u←X3Σ-g is observed from the measured spectra,and it is found that the peak profile of the A'3△u←X3Σ-g excitation can be well represented by a Gaussin function.The energy position of 6.007±0.008 eV and Franck-Condon linewidth of 1.312±0.020 eV of the A△u←X3Σ-g,which are independent of the scattering condition,have been determined for the first time.The peak profiles of the A'3△u←X3Σ-g determined in this work provide a possibility to realize the spectral decomposition method of unfolding the Herzberg pseudocontinuum proposed by Campbell et al.[Phys.Rev.A 61 (2000) 022706

  13. The synthesis of a series of adenosine A3 receptor agonists.

    Science.gov (United States)

    Broadley, Kenneth J; Burnell, Erica; Davies, Robin H; Lee, Alan T L; Snee, Stephen; Thomas, Eric J

    2016-04-12

    A series of 1'-(6-aminopurin-9-yl)-1'-deoxy-N-methyl-β-d-ribofuranuronamides that were characterised by 2-dialkylamino-7-methyloxazolo[4,5-b]pyridin-5-ylmethyl substituents on N6 of interest for screening as selective adenosine A3 receptor agonists, have been synthesised. This work involved the synthesis of 2-dialkylamino-5-aminomethyl-7-methyloxazolo[4,5-b]pyridines and analogues that were coupled with the known 1'-(6-chloropurin-9-yl)-1'-deoxy-N-methyl-β-d-ribofuranuronamide. The oxazolo[4,5-b]pyridines were synthesized by regioselective functionalisation of 2,4-dimethylpyridine N-oxides. The regioselectivities of these reactions were found to depend upon the nature of the heterocycle with 2-dimethylamino-5,7-dimethyloxazolo[4,5-b]pyridine-N-oxide undergoing regioselective functionalisation at the 7-methyl group on reaction with trifluoroacetic anhydride in contrast to the reaction of 4,6-dimethyl-3-hydroxypyridine-N-oxide with acetic anhydride that resulted in functionalisation of the 6-methyl group. To optimise selectivity for the A3 receptor, 5-aminomethyl-7-bromo-2-dimethylamino-4-[(3-methylisoxazol-5-yl)methoxy]benzo[d]oxazole was synthesised and coupled with the 1'-(6-chloropurin-9-yl)-1'-deoxy-N-methyl-β-d-ribofuranuronamide. The products were active as selective adenosine A3 agonists.

  14. A3R Phage and Staphylococcus aureus Lysate Do Not Induce Neutrophil Degranulation

    Directory of Open Access Journals (Sweden)

    Jan Borysowski

    2017-02-01

    Full Text Available The objective of this study was to evaluate the effects of A3R phage and Staphylococcus aureus lysate obtained after phage infection on neutrophil degranulation. The exocytosis of primary and secondary granules from neutrophils was investigated in vitro in whole blood specimens by flow cytometry based on the expression of specific markers of exocytosis (CD63 for primary granules and CD66b for secondary granules. We found that both A3R and S. aureus lysate had no significant effect on the exocytosis of primary and secondary granules. These data suggest that neither A3R virions nor any products of phage-induced lysis of S. aureus are likely to induce neutrophil degranulation in patients who are treated with phage preparations. Since neutrophil granules contain some potentially toxic proteins, our results provide an important argument for the safety of phage therapy. Moreover, these data indicate that the induction of neutrophil degranulation is not likely to contribute to antibacterial effects of phages.

  15. Research conference summary from the 2014 International Task Force on ATP1A3-Related Disorders

    Science.gov (United States)

    Rosewich, Hendrik; DeBrosse, Suzanne; Ess, Kevin; Ozelius, Laurie; Andermann, Eva; Andermann, Frederick; Andrasco, Gene; Belgrade, Alice; Brashear, Allison; Ciccodicola, Sharon; Egan, Lynn; George, Alfred L.; Lewelt, Aga; Magelby, Joshua; Merida, Mario; Newcomb, Tara; Platt, Vicky; Poncelin, Dominic; Reyna, Sandra; Sasaki, Masayuki; Sotero de Menezes, Marcio; Sweadner, Kathleen; Viollet, Louis; Zupanc, Mary; Silver, Kenneth; Swoboda, Kathryn

    2017-01-01

    Objective: ATP1A3-related neurologic disorders encompass a broad range of phenotypes that extend well beyond initial phenotypic criteria associated with alternating hemiplegia of childhood (AHC) and rapid-onset dystonia parkinsonism. Methods: In 2014, the Alternating Hemiplegia of Childhood Foundation hosted a multidisciplinary workshop intended to address fundamental challenges surrounding the diagnosis and management of individuals with ATP1A3-related disorders. Results: Workshop attendees were charged with the following: (1) to achieve consensus on expanded diagnostic criteria to facilitate the identification of additional patients, intended to supplement existing syndrome-specific diagnostic paradigms; (2) to standardize definitions for the broad range of paroxysmal manifestations associated with AHC to disseminate to families; (3) to create clinical recommendations for common recurrent issues facing families and medical care providers; (4) to review data related to the death of individuals in the Alternating Hemiplegia of Childhood Foundation database to guide future efforts in identifying at-risk subjects and potential preventative measures; and (5) to identify critical gaps where we most need to focus national and international research efforts. Conclusions: This report summarizes recommendations of the workshop committee, highlighting the key phenotypic features to facilitate the diagnosis of possible ATP1A3 mutations, providing recommendations for genetic testing, and outlining initial acute management for common recurrent clinical conditions, including epilepsy. PMID:28293679

  16. Development of temporomandibular disorder symptoms: a 3-year cohort study of university students.

    Science.gov (United States)

    Akhter, R; Morita, M; Esaki, M; Nakamura, K; Kanehira, T

    2011-06-01

    The aims of this study were to examine the incidence of temporomandibular disorders (TMDs) over a 3-year period and to evaluate the risk of self-reported TMDs among university students in Japan. The study population comprised 2374 university students examined at the start of their undergraduate course and 492 students re-examined after 3 years using questionnaires on symptoms of TMD and experiences of jaw injury, stress, orthodontic treatment and parafunctional habits. Cumulative incidence (%) and relative risks were calculated overall. Odds ratios (ORs) and 95% confidence intervals (CIs) were calculated to determine the degree of risks of these variables for symptoms of TMDs using logistic regression. Results of logistic regression analysis showed that male subjects with experience of jaw injury had a 3·54 (CI=1·45-8·68, Pstress and bruxism had 10·56 (CI=1·28-87·54, Pstress or bruxism. The results indicated that experiences of jaw injury, stress and bruxism were significantly associated with increased risks of development of TMJ disorders in a 3-year cohort.

  17. DRD2 and SLC6A3 moderate impact of maternal depressive symptoms on infant cortisol.

    Science.gov (United States)

    Ludmer, Jaclyn A; Levitan, Robert; Gonzalez, Andrea; Kennedy, James; Villani, Vanessa; Masellis, Mario; Basile, Vincenzo S; Atkinson, Leslie

    2015-12-01

    Both maternal depressive symptoms and infants' dopamine-related genetic characteristics have been linked to infants' hypothalamic-pituitary-adrenal (HPA) functioning. This study investigated the interactive influence of maternal depressive symptoms and infant DRD2 and SLC6A3 genotypes on infant cortisol reactivity; whether this interaction reflects diathesis-stress or differential susceptibility; and whether this interaction influences the flexibility of the infant cortisol response across challenges known to exert differential effects on infant cortisol reactivity. A community sample of 314 mother-infant dyads participated in toy frustration (age 16 months) and maternal separation (age 17 months) challenges, and salivary cortisol was collected at baseline, +20, and +40min. Maternal depressive symptoms were assessed with the Beck Depression Inventory-II at infant age 16 months. Infant buccal cells were collected at both time points for genotyping. DRD2 and SLC6A3 genotypes moderated the relation between maternal depressive symptomatology and infant cortisol reactivity in a diathesis-stress manner in the context of toy frustration, and in a differential susceptibility manner in the context of maternal separation. Higher levels of maternal depressive symptoms predicted reduced cortisol flexibility across challenges for infants with at least one A1 allele of DRD2 and infants with the 10/10 genotype of SLC6A3. Results suggest that maternal depressive symptomatology is related to infants' cortisol reactivity and to the flexibility of that reactivity across psychosocial challenges, but this relation is dependent on the infant's genetic characteristics.

  18. Mathematical modeling and reliability analysis of a 3D Li-ion battery

    Directory of Open Access Journals (Sweden)

    RICHARD HONG PENG LIANG

    2014-02-01

    Full Text Available The three-dimensional (3D Li-ion battery presents an effective solution to issues affecting its two-dimensional counterparts, as it is able to attain high energy capacities for the same areal footprint without sacrificing power density. A 3D battery has key structural features extending in and fully utilizing 3D space, allowing it to achieve greater reliability and longevity. This study applies an electrochemical-thermal coupled model to a checkerboard array of alternating positive and negative electrodes in a 3D architecture with either square or circular electrodes. The mathematical model comprises the transient conservation of charge, species, and energy together with electroneutrality, constitutive relations and relevant initial and boundary conditions. A reliability analysis carried out to simulate malfunctioning of either a positive or negative electrode reveals that although there are deviations in electrochemical and thermal behavior for electrodes adjacent to the malfunctioning electrode as compared to that in a fully-functioning array, there is little effect on electrodes further away, demonstrating the redundancy that a 3D electrode array provides. The results demonstrate that implementation of 3D batteries allow it to reliably and safely deliver power even if a component malfunctions, a strong advantage over conventional 2D batteries.

  19. Ephrin-A3 promotes and maintains slow muscle fiber identity during postnatal development and reinnervation.

    Science.gov (United States)

    Stark, Danny A; Coffey, Nathan J; Pancoast, Hannah R; Arnold, Laura L; Walker, J Peyton D; Vallée, Joanne; Robitaille, Richard; Garcia, Michael L; Cornelison, D D W

    2015-12-07

    Each adult mammalian skeletal muscle has a unique complement of fast and slow myofibers, reflecting patterns established during development and reinforced via their innervation by fast and slow motor neurons. Existing data support a model of postnatal "matching" whereby predetermined myofiber type identity promotes pruning of inappropriate motor axons, but no molecular mechanism has yet been identified. We present evidence that fiber type-specific repulsive interactions inhibit innervation of slow myofibers by fast motor axons during both postnatal maturation of the neuromuscular junction and myofiber reinnervation after injury. The repulsive guidance ligand ephrin-A3 is expressed only on slow myofibers, whereas its candidate receptor, EphA8, localizes exclusively to fast motor endplates. Adult mice lacking ephrin-A3 have dramatically fewer slow myofibers in fast and mixed muscles, and misexpression of ephrin-A3 on fast myofibers followed by denervation/reinnervation promotes their respecification to a slow phenotype. We therefore conclude that Eph/ephrin interactions guide the fiber type specificity of neuromuscular interactions during development and adult life.

  20. A3R Phage and Staphylococcus aureus Lysate Do Not Induce Neutrophil Degranulation

    Science.gov (United States)

    Borysowski, Jan; Międzybrodzki, Ryszard; Wierzbicki, Piotr; Kłosowska, Danuta; Korczak-Kowalska, Grażyna; Weber-Dąbrowska, Beata; Górski, Andrzej

    2017-01-01

    The objective of this study was to evaluate the effects of A3R phage and Staphylococcus aureus lysate obtained after phage infection on neutrophil degranulation. The exocytosis of primary and secondary granules from neutrophils was investigated in vitro in whole blood specimens by flow cytometry based on the expression of specific markers of exocytosis (CD63 for primary granules and CD66b for secondary granules). We found that both A3R and S. aureus lysate had no significant effect on the exocytosis of primary and secondary granules. These data suggest that neither A3R virions nor any products of phage-induced lysis of S. aureus are likely to induce neutrophil degranulation in patients who are treated with phage preparations. Since neutrophil granules contain some potentially toxic proteins, our results provide an important argument for the safety of phage therapy. Moreover, these data indicate that the induction of neutrophil degranulation is not likely to contribute to antibacterial effects of phages. PMID:28230780

  1. Mapping the Vif-A3G interaction using peptide arrays: a basis for anti-HIV lead peptides.

    Science.gov (United States)

    Reingewertz, Tali H; Britan-Rosich, Elena; Rotem-Bamberger, Shahar; Viard, Mathias; Jacobs, Amy; Miller, Abigail; Lee, Ji Youn; Hwang, Jeeseong; Blumenthal, Robert; Kotler, Moshe; Friedler, Assaf

    2013-06-15

    Human apolipoprotein-B mRNA-editing catalytic polypeptide-like 3G (A3G) is a cytidine deaminase that restricts retroviruses, endogenous retro-elements and DNA viruses. A3G plays a key role in the anti-HIV-1 innate cellular immunity. The HIV-1 Vif protein counteracts A3G mainly by leading A3G towards the proteosomal machinery and by direct inhibition of its enzymatic activity. Both activities involve direct interaction between Vif and A3G. Disrupting the interaction between A3G and Vif may rescue A3G antiviral activity and inhibit HIV-1 propagation. Here, mapping the interaction sites between A3G and Vif by peptide array screening revealed distinct regions in Vif important for A3G binding, including the N-terminal domain (NTD), C-terminal domain (CTD) and residues 83-99. The Vif-binding sites in A3G included 12 different peptides that showed strong binding to either full-length Vif, Vif CTD or both. Sequence similarity was found between Vif-binding peptides from the A3G CTD and NTD. A3G peptides were synthesized and tested for their ability to counteract Vif action. A3G 211-225 inhibited HIV-1 replication in cell culture and impaired Vif dependent A3G degradation. In vivo co-localization of full-length Vif with A3G 211-225 was demonstrated by use of FRET. This peptide has the potential to serve as an anti-HIV-1 lead compound. Our results suggest a complex interaction between Vif and A3G that is mediated by discontinuous binding regions with different affinities.

  2. 75 FR 8981 - Prospective Grant of Exclusive License: Treatment of Glaucoma by Administration of Adenosine A3...

    Science.gov (United States)

    2010-02-26

    ... Glaucoma by Administration of Adenosine A3 Antagonists AGENCY: National Institutes of Health, Public Health.../092,292, entitled ``A3 Adenosine Receptor Antagonists,'' filed July 10, 1998 , PCT Application PCT/US99/ 15562, entitled''A3 Adenosine Receptor Antagonists,'' filed July 2, 1999 , U.S. Patent...

  3. 47 CFR 80.1091 - Ship radio equipment-Sea areas A1, A2, and A3.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Ship radio equipment-Sea areas A1, A2, and A3...) Equipment Requirements for Ship Stations § 80.1091 Ship radio equipment—Sea areas A1, A2, and A3. This... A3 at all times. Ships fitting in accordance with this section satisfy the requirements denoted...

  4. File list: Oth.ALL.10.C16A3PERIOD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.10.C16A3PERIOD4.AllCell ce10 TFs and others C16A3.4 All cell types SRX22263...8,SRX222639 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.10.C16A3PERIOD4.AllCell.bed ...

  5. File list: Oth.ALL.50.C16A3PERIOD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.C16A3PERIOD4.AllCell ce10 TFs and others C16A3.4 All cell types SRX22263...9,SRX222638 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.50.C16A3PERIOD4.AllCell.bed ...

  6. File list: Oth.ALL.20.C16A3PERIOD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.C16A3PERIOD4.AllCell ce10 TFs and others C16A3.4 All cell types SRX22263...9,SRX222638 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.20.C16A3PERIOD4.AllCell.bed ...

  7. File list: Oth.ALL.05.C16A3PERIOD4.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.05.C16A3PERIOD4.AllCell ce10 TFs and others C16A3.4 All cell types SRX22263...8,SRX222639 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/assembled/Oth.ALL.05.C16A3PERIOD4.AllCell.bed ...

  8. Avances biotecnológicos en el diagnóstico de enfermedades infecciosas Biotechnological advances in infectious diseases diagnosis

    Directory of Open Access Journals (Sweden)

    Fidel de la Cruz Hernández-Hernández

    2009-01-01

    Full Text Available La detección de moléculas de patógenos (antígenos y material genético y moléculas de respuesta de los hospederos ante la infección (anticuerpos es el principio básico de las pruebas diagnósticas moleculares. Estas pruebas han hecho innecesaria la detección directa del microorganismo patógeno agresor. Los nuevos avances en biología molecular y el desarrollo de tecnología robótica y secuenciación genómica y proteica han permitido el desarrollo de nuevas pruebas diagnósticas altamente específicas y de gran rendimiento. La genómica y proteómica contribuyen a la identificación de biomarcadores y la biotecnología aporta métodos para producir reactivos de alta pureza. La identificación de genes codificantes de antígenos específicos, su clonación y producción recombinante y la producción de anticuerpos monoclonales, fragmentos de éstos y anticuerpos de una sola cadena han hecho posible el desarrollo de nuevas técnicas inmunológicas más seguras y de sensibilidad y especificidad elevadas. Nuevas moléculas de reconocimiento, incluidos los aptámeros, podrán pronto superar la necesidad de producir anticuerpos mediante inmunización. Para la detección de material genético se han desarrollado nuevas medidas metodológicas basadas en la hibridación y amplificación (PCR, de punto final y en tiempo real en formatos multiplex y en microarreglos y para su detección se han diseñado moléculas reporteras que permiten su cuantificación. Aunque estos métodos requieren instrumentación compleja, puede ya anticiparse que pronto serán accesibles para su aplicación en salud pública.The detection of molecules of pathogens (antigens and genetic material and host molecules in response to infections (antibodies is the basic principle involved in molecular diagnostic tests. These tests have avoided the need to detect the attacking pathogen. New advances in molecular biology and the development of robotic technology and genomic and

  9. [CD200 protein, bad prognostic in patients with multiple myeloma].

    Science.gov (United States)

    Vela-Ojeda, Jorge; García-Ruiz Esparza, M A; Padilla-González, Y; Pérez-Retiguin, F; Reyes-Maldonado, E; Maillet, D; Montiel-Cervantes, L A

    2015-01-01

    Introducción: el mieloma múltiple (MM) es una gammopatía monoclonal caracterizada por la proliferación anormal de células plasmáticas malignas. La proteína CD200 se ha descrito como una proteína con funciones inmunosupresoras y que es un factor de mal pronóstico en algunas enfermedades malignas, incluyendo al MM. El objetivo de este artículo es determinar la cantidad de proteína CD200 en células plasmáticas de pacientes con MM de reciente diagnóstico y en linfocitos CD3+ de donadores sanos. Métodos: se estudiaron 35 pacientes con diagnóstico reciente de MM y 25 individuos sanos. Se usaron los anticuerpos monoclonales para CD38 (PeCyC5), CD138 (APC), y CD200 (PE). El análisis estadístico fue realizado con el programa SPSS 19v. Se utilizaron las pruebas estadísticas U de Mann Whitney, curvas de supervivencia de Kaplan y Meier y la prueba de log-rank. Resultados: las frecuencias de anemia, hipercalcemia, elevación de DHL, creatinina sérica y beta-2 microglobulina fueron de 68%, 34%, 20%, 22% y 45% respectivamente. El tratamiento administrado fue MPT 20, Tal-Dex 8, y VAD 7. Cinco pacientes lograron respuesta completa, 17 respuesta parcial, y 13 respuesta menor o falla al tratamiento. Conclusiones: el CD200 es un factor de mal pronóstico para supervivencia global en pacientes con mieloma múltiple. Los linfocitos CD3+ de medula ósea de pacientes con MM expresan en mayor proporción CD200 en comparación con sujetos sanos.

  10. Caracterización de aislamientos clínicos de Leptospira para su uso en vacunas veterinarias

    Directory of Open Access Journals (Sweden)

    Yaritza Cuba-Romero

    2016-04-01

    Full Text Available Uno de los criterios más importantes para el desarrollo de inmunógenos de Leptospira es contar con cepas bien caracterizadas por su virulencia y representativa de los serogrupos circulantes desde el punto de vista clínico y veterinario. Todo lo cual permite garantizar inmunógenos capaces de proteger contra los serovares presente en la formulación y que afectan a los animales en riesgo. Este trabajo se realizó a partir de aislamientos del agente causal de cinco casos clínicos autóctonos de Leptospira en la provincia de Holguín, Cuba, mediante métodos convencionales: crecimiento a 13ºC, medio suplementado con 8-azaguanina y en presencia de cloruro de sodio. Además, los aislamientos se clasificaron hasta nivel de serogrupo mediante la técnica de microaglutinación. A partir de estos aislamientos fue seleccionada y caracterizada una cepa del serogrupo Ballum como candidato vacunal. Los aislamientos no mostraron crecimiento a 13ºC, ni cuando se le añadió al medio 8-azaguanina (2,25 mg/mL, mientras que todas las cepas mostraron conversión a forma esférica en presencia de cloruro de sodio (1M. La clasificación de los aislamientos permitió disponer de dos cepas pertenecientes al serogrupo Ballum y dos a Pomona. La cepa seleccionada mostró alta virulencia y patogenicidad en el biomodelo Hámster Sirio, además de buena estabilidad en los medios de cultivos. Su clasificación hasta el nivel de serovar mediante el uso de anticuerpos monoclonales determinó su pertenencia al serovar Ballum. El presente trabajo, por primera vez, sienta las bases para formulaciones vacunales novedosas en animales, conteniendo el serogrupo Ballum.

  11. Definición de una estrategia de transición de la arquitectura empresarial en un entorno industrial-biotecnológico

    Directory of Open Access Journals (Sweden)

    Raimundo Llerena Ferrer

    2015-07-01

    Full Text Available El cambio es una condición no solo presente, sino necesaria a niveles estratégicos y operacionales. Sin embargo, transformar una organización es una tarea compleja. Tomar decisiones que garanticen una satisfactoria evolución tecnológica y organizacional sin una estrategia que guíe el desarrollo de la arquitectura empresarial, resulta una tarea ardua y con pocas probabilidades de éxito. El sector industrial-biotecnológico cubano no escapa a esta realidad y se enfrenta a grandes retos en su empeño de aumentar la productividad y la eficiencia a partir del descubrimiento de conocimiento proveniente del análisis de la data de sus procesos. Este trabajo propone un modelo que guía la ejecución de proyectos para la definición de una estrategia de transición de la arquitectura empresarial y muestra los resultados de su validación mediante un método de expertos, así como los de su aplicación con altos niveles de satisfacción en una planta de producción de anticuerpos monoclonales. Hecho que posibilitó la obtención de una estrategia concreta y bien detallada para la implementación de una plataforma organizacional y tecnológica capaz de registrar, integrar y analizar con un alto nivel de detalle la información de sus procesos productivos medulares.

  12. Procedimientos para la obtención de reactivos biológicos de los estuches DAVIH Ag P24 y DAVIH Ac P24

    Directory of Open Access Journals (Sweden)

    Nancy M. Ruiz

    2003-09-01

    Full Text Available La pandemia de SIDA es uno de los problemas actuales más graves que afectan a la humanidad. Como todavía no se cuenta con una vacuna efectiva a pesar de los esfuerzos realizados por científicos en todo el mundo, la utilización de drogas antirretrovirales para mejorar la calidad de vida de los pacientes es lo que ha resultado más exitoso, de ahí la importancia de poseer medios para realizar un diagnóstico temprano de la infección y para monitorear su progresión con el objetivo de poder actuar sobre ella. El presente trabajo describe la obtención de los componentes biológicos que se requieren para la producción de dos estuches que se utilizan en nuestro país en todos los estudios que tienen relación con la infección VIH-SIDA. Para ello se realizó un protocolo que incluyó varias etapas de purificación e inmovilización de diferentes moléculas. Como resultado se obtuvieron la proteína de 24 Kd del VIH-1 y anticuerpos monoclonales y policlonales humanos contra esta proteína, con adecuados grados de pureza y actividad biológica. La combinación de etapas en este protocolo, permitió ir obteniendo productos que además de utilizarse en la etapa siguiente también por sí mismos, algunos de ellos, constituyeron reactivos de los estuches.

  13. Trombocitopenia de difícil manejo en niño preescolar con LES: Reporte de un caso

    Directory of Open Access Journals (Sweden)

    Mario Nicolás Albani Pérez

    2009-01-01

    Full Text Available El lupus eritematoso sistémico (LES es una enfermedad autoinmune del tejido conectivo, infrecuente en el sexo masculino y durante la infancia. La trombocitopenia se presenta en 15% de los casos de LES, y como forma de inicio es poco común. Se reporta el caso de preescolar masculino de 3 años de edad con inicio de enfermedad a los 18 meses de edad que presentó diarrea, rash cutáneo, equimosis y trombocitopenia, ameritando transfusión de concentrado plaquetario obteniendo mejoría parcial y en control con hematólogo. A los 2 años de edad reaparece equimosis y se diagnostica Púrpura Trombocitopénica Idiopática, tratado con inmunoglobulinas y esteroides sin respuesta satisfactoria. Es referido a Inmunología donde solicitan estudios y los resultados son compatibles con LES, por lo cual recibió prednisona sin respuesta satisfactoria. En Febrero de 2009, presenta epistaxis requiriendo hospitalización y tratamiento con inmunoglobulinas. En Mayo de 2009, presenta otorragia derecha ameritando nuevamente hospitalización y tratamiento con inmunoglobulinas. Se emplea Danazol con buena respuesta. En caso que en el futuro no ofrezca mejoría, se plantea el uso alternativo de ciclosporinas o anticuerpos monoclonales Anti- CD20 (Rituximab dejando como último recurso la esplenectomía. Se presenta el caso clínico considerando la importancia con respecto a la edad de presentación y el manejo no convencional que se debió adoptar para tratar al paciente.

  14. Trombocitopenia de difícil manejo en niño preescolar con LES: Reporte de un caso

    Directory of Open Access Journals (Sweden)

    Mario Nicolás Albani Pérez

    2010-08-01

    Full Text Available El lupus eritematoso sistémico (LES es una enfermedad autoinmune del tejido conectivo, infrecuente en el sexo masculino y durante la infancia. La trombocitopenia se presenta en 15% de los casos de LES, y como forma de inicio es poco común. Se reporta el caso de preescolar masculino de 3 años de edad con inicio de enfermedad a los 18 meses de edad que presentó diarrea, rash cutáneo, equimosis y trombocitopenia; ameritando transfusión de concentrado plaquetario obteniendo mejoría parcial y en control con hematólogo. A los  2 años de edad reaparece equimosis y se diagnostica Púrpura Trombocitopénica Idiopática, tratado con inmunoglobulinas y esteroides sin respuesta satisfactoria. Es referido a Inmunología donde solicitan estudios y los resultados son compatibles con LES, por lo cual recibió prednisona sin respuesta satisfactoria. En Febrero de 2009, presenta epistaxis requiriendo hospitalización y tratamiento con inmunoglobulinas. En Mayo de 2009, presenta otorragia derecha ameritando nuevamente hospitalización y tratamiento con inmunoglobulinas. Se emplea Danazol con buena respuesta. En caso que en el futuro no ofrezca mejoría, se plantea el uso alternativo de ciclosporinas o anticuerpos monoclonales Anti-CD20 (Rituximab dejando como último recurso la esplenectomía. Se presenta el caso clínico considerando la importancia con respecto a la edad de presentación y el manejo no convencional que se debió adoptar para tratar al paciente.

  15. Leishmania mexicana: aspectos taxonómicos y rareza de la infección humana en Três Braços, Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    César Augusto Cuba Cuba

    1984-09-01

    Full Text Available Del estúdio de 51 stocks de Leishmania aislados de pacientes humanos de leishmaniasis cutaneomucosa en Três Braços, Bahia, Brasil, los autores describen, en detalle, el análisis de los dos únicos stocks de L. mexicana, identificando uno de ellos como L. mexicana amazonensis. El otro aislado permanece en posición taxonómica no definida pues considerándosele como un miembro de L. mexicana, encuéntranse dificultades para su identificación subespecífica. Evaluan también los parâmetros biológicos e isoenzimáticos y discuten el papel de los anticuerpos monoclonales en la tipificación de éstos stocks. Los autores remarcan la rareza de la transmisión de parásitos del complejo L. mexicana en esta región, aun cuando estudien epidemiológicamente por mais de 8 anos la infección humana.In a study of 51 stocks of Leishmania isolated from patients with cutaneous leishmaniasis in Três Braços, Bahia, Brazil 49 were characterized as L. braziliensis braziliensis. Only two L. mexicana stocks were identified. One was subspeciated as L. mexicana amazonensis. The other differed from this species and to date remains unspeciated. The biological parameters, isoenzyme analysis and monoclonal antibody findings relating to these two strains are discussed. Transmission of parasites of the mexicana complex to man have been rare in this region during the 8 years of study of the human infection.

  16. Descripción inmunohistoquímica de la encefalitis en bovinos brasileños naturalmente infectados con el herpesvirus bovino tipo 5 (HVB-5 Immunohistochemical description of encephalitis in Brazilian cattle naturally infected with bovine herpes virus type 5 (BoHV-5

    Directory of Open Access Journals (Sweden)

    FJ Pedraza

    2008-01-01

    Full Text Available Doce casos de meningoencefalitis viral en ganado bovino brasilero fueron sometidos a un análisis inmunohistoquímico para describir la respuesta inflamatoria. Todos los casos mostraron severos signos neurológicos seguidos por la muerte. Histológicamente los cambios inflamatorios en el cerebro y el cerebelo que caracterizaron la infección neurológica muestran meningitis, manguitos perivasculares mononucleares, gliosis, hemorragias y macrófagos (células gitter acompañando grandes áreas de malacia. Ninguno de los casos mostró cuerpos de inclusión intranucleares; sin embargo, en cinco de ellos fue posible el aislamiento del HVB-5. Con el fin de recolectar datos que permitan describir la respuesta inflamatoria en estos casos, muestras de cerebro de todos los casos se analizaron por inmunohistoquímica usando anticuerpos policlonales contra CD3 para detectar linfocitos T y contra GFAP para detectar astrocitos. Por otro lado, se usaron anticuerpos monoclonales contra BLA para detectar células B y MAC 387 para detectar macrófagos. Los resultados indican que la respuesta inflamatoria se caracterizó por linfocitos T en los infiltrados perivasculares y por los astrocitos en otras partes del órgano. Los macrófagos (células gitter estuvieron siempre asociados a grandes áreas de malacia y los linfocitos B tuvieron una discreta participación sobre todo en los infiltrados celulares perivasculares. Estos hallazgos facilitarán futuras investigaciones tendientes al entendimiento de la patogénesis de este tipo de encefalitisTwelve cases of viral meningoencephalitis in Brazilian cattle were submitted to immunohistochemical analysis for inflammatory response description. All the cases showed severe neurological signs followed by death. Mild to moderate histological inflammatory changes in the brain and cerebellum characterized the neurological infection showing meningitis, mononuclear perivascular cuffing, gliosis, haemorrhage, and macrophages

  17. Patogénesis de la enfermedad pélvica inflamatoria. Modelo animal con la biovariedad murina de Chlamydia trachomatis

    Directory of Open Access Journals (Sweden)

    Fabio Carmona Velásquez

    2009-10-01

    Full Text Available Se inocularon hembras de ratones blancos suizo (Balb/c, entre 4 y 6 semanas con la serovariedad MoPn de Chlamydia trachomatis para producirles una salpingitis clamidial experimental. Directamente en la rama uterina izquierda se inyectaron 30 µl equivalente a 6 x 104 UFI. La misma cantidad se inyectó en la bursa del ovario del mismo lado, a través del tejido graso que se encuentra en este sitio. Se sacrificaron grupos de hembras a los 7 y 14 días después de la inoculación para buscar inflamación, hidrosálpinx y respuesta de anticuerpos tipo IgG e IgM. Otras hembras inoculadas se aparearon para observar la tasa de infertilidad bilateral que ocasionaba la infección. Un tercer grupo de animales se trató con tetraciclina, ibuprofén y prostaglandina E1. El tratamiento temprano, hacia el segundo día después de la inoculación, impidió la inflamación, la formación de hidrosálpinx y la infertilidad normal bilateral. Los agentes antiinflamatorios, usados solos, no tuvieron ningún efecto para prevenir la inflamación, ni aun en combinación con tetraciclina. Un cuarto grupo se trató con anticuerpos monoclonales dirigidos contra la subpoblación linfocítica L3T4 (equivalente en seres humanos a CD4. En los ratones con L3T4 se observó un agotamiento (depleción total de la población linfocítica L3T4 hacia el segundo día después de la inoculación. El agotamiento persistió por lo menos hasta el día 20, pero no alteró significativamente los porcentajes de células expresadas por Thy 1.2 (célula de antígeno T o Lyt2 (célula de antígeno T supresor/citotóxico, que equivale a los CD8 en el hombre. Se concluye que los continuos inóculos con Chlamydia, generan una respuesta inmune que termina con daño del tejido y conduce a la infertilidad.

  18. Design Evolution and Verification of the A-3 Chemical Steam Generator

    Science.gov (United States)

    Kirchner, Casey K.

    2009-01-01

    Following is an overview of the Chemical Steam Generator system selected to provide vacuum conditions for a new altitude test facility, the A-3 Test Stand at Stennis Space Center (SSC) in Bay St. Louis, MS. A-3 will serve as NASA s primary facility for altitude testing of the J-2X rocket engine, to be used as the primary propulsion device for the upper stages of the Ares launch vehicles. The Chemical Steam Generators (CSGs) will produce vacuum conditions in the test cell through the production and subsequent supersonic ejection of steam into a diffuser downstream of the J-2X engine nozzle exit. The Chemical Steam Generators chosen have a rich heritage of operation at rocket engine altitude test facilities since the days of the Apollo program and are still in use at NASA White Sands Test Facility (WSTF) in New Mexico. The generators at WSTF have been modified to a degree, but are still very close to the heritage design. The intent for the A-3 implementation is to maintain this heritage design as much as possible, making minimal updates only where necessary to substitute for obsolete parts and to increase reliability. Reliability improvements are especially desired because the proposed system will require 27 generators, which is nine times the largest system installed in the 1960s. Improvements were suggested by the original design firm, Reaction Motors, by NASA SSC and NASA WSTF engineers, and by the A-3 test stand design contractor, Jacobs Technology, Inc. (JTI). This paper describes the range of improvements made to the design to date, starting with the heritage generator and the minor modifications made over time at WSTF, to the modernized configuration which will be used at A-3. The paper will discuss NASA s investment in modifications to SSC s E-2 test facility fire a full-scale Chemical Steam Generator in advance of the larger steam system installation at A-3. Risk mitigation testing will be performed in early 2009 at this test facility to verify that the CSGs

  19. Going Virtual… or Not: Development and Testing of a 3D Virtual Astronomy Environment

    Science.gov (United States)

    Ruzhitskaya, L.; Speck, A.; Ding, N.; Baldridge, S.; Witzig, S.; Laffey, J.

    2013-04-01

    We present our preliminary results of a pilot study of students' knowledge transfer of an astronomy concept into a new environment. We also share our discoveries on what aspects of a 3D environment students consider being motivational and discouraging for their learning. This study was conducted among 64 non-science major students enrolled in an astronomy laboratory course. During the course, students learned the concept and applications of Kepler's laws using a 2D interactive environment. Later in the semester, the students were placed in a 3D environment in which they were asked to conduct observations and to answers a set of questions pertaining to the Kepler's laws of planetary motion. In this study, we were interested in observing scrutinizing and assessing students' behavior: from choices that they made while creating their avatars (virtual representations) to tools they choose to use, to their navigational patterns, to their levels of discourse in the environment. These helped us to identify what features of the 3D environment our participants found to be helpful and interesting and what tools created unnecessary clutter and distraction. The students' social behavior patterns in the virtual environment together with their answers to the questions helped us to determine how well they understood Kepler's laws, how well they could transfer the concepts to a new situation, and at what point a motivational tool such as a 3D environment becomes a disruption to the constructive learning. Our founding confirmed that students construct deeper knowledge of a concept when they are fully immersed in the environment.

  20. Plexin A3 and turnout regulate motor axonal branch morphogenesis in zebrafish.

    Directory of Open Access Journals (Sweden)

    Rajiv Sainath

    Full Text Available During embryogenesis motor axons navigate to their target muscles, where individual motor axons develop complex branch morphologies. The mechanisms that control axonal branching morphogenesis have been studied intensively, yet it still remains unclear when branches begin to form or how branch locations are determined. Live cell imaging of individual zebrafish motor axons reveals that the first axonal branches are generated at the ventral extent of the myotome via bifurcation of the growth cone. Subsequent branches are generated by collateral branching restricted to their synaptic target field along the distal portion of the axon. This precisely timed and spatially restricted branching process is disrupted in turnout mutants we identified in a forward genetic screen. Molecular genetic mapping positioned the turnout mutation within a 300 kb region encompassing eight annotated genes, however sequence analysis of all eight open reading frames failed to unambiguously identify the turnout mutation. Chimeric analysis and single cell labeling reveal that turnout function is required cell non-autonomously for intraspinal motor axon guidance and peripheral branch formation. turnout mutant motor axons form the first branch on time via growth cone bifurcation, but unlike wild-type they form collateral branches precociously, when the growth cone is still navigating towards the ventral myotome. These precocious collateral branches emerge along the proximal region of the axon shaft typically devoid of branches, and they develop into stable, permanent branches. Furthermore, we find that null mutants of the guidance receptor plexin A3 display identical motor axon branching defects, and time lapse analysis reveals that precocious branch formation in turnout and plexin A3 mutants is due to increased stability of otherwise short-lived axonal protrusions. Thus, plexin A3 dependent intrinsic and turnout dependent extrinsic mechanisms suppress collateral branch

  1. Treatment of AO/OTA 31-A3 intertrochanteric femoral fractures with a percutaneous compression plate

    Directory of Open Access Journals (Sweden)

    Fei Luo

    2014-01-01

    Full Text Available OBJECTIVE: AO/OTA 31-A3 intertrochanteric femoral fractures have completely different fracture line directions and biomechanical characteristics compared with other types of intertrochanteric fractures. The choice of the fixation method has been a focus of dispute among orthopedic trauma surgeons. The purpose of this study was to review the outcomes of these fractures treated with a percutaneous compression plate at our institute. METHOD: Seventeen patients with AO/OTA 31-A3 intertrochanteric femoral fractures were treated with a percutaneous compression plate at our institute from January 2010 to December 2011. The clinical data and imaging results were retrospectively analyzed. RESULTS: The medical complication of popliteal vein thrombosis occurred in one patient. Sixteen patients were followed up for 12 to 21 months. Two patients had malunion and mild pain. Fracture collapse occurred in two patients, with one having head penetration. These two patients had moderate pain. There were no occurrences of nonunion or reoperation. The mean Harris hip score obtained during the last follow-up was 84.1 (61-97. Patients with a poor quality of reduction were more likely to have pain results (p = 0.001. A trend existed toward the presence of a poor quality of reduction (p = 0.05 in patients with a collapse of fracture. Patients with poor preoperative mobility were more likely to have a lower Harris hip score (p = 0.000. CONCLUSION: The percutaneous compression plate is an alternative device for the treatment of AO/OTA 31-A3 intertrochanteric femoral fractures. Good fracture reduction and an ideal placement position of the neck screw are important in the success of the device.

  2. Identification of two metallothioneins as novel inhalative coffee allergens cof a 2 and cof a 3.

    Directory of Open Access Journals (Sweden)

    Ulrike Peters

    Full Text Available Dust of green coffee beans is known to be a relevant cause for occupational allergic disorders in coffee industry workers. Recently, we described the first coffee allergen (Cof a 1 establishing an allergenic potential of green coffee dust.Our aim was to identify allergenic components of green coffee in order to enhance inhalative coffee allergy diagnosis.A Coffea arabica pJuFo cDNA phage display library was created and screened for IgE binding with sera from allergic coffee workers. Two further coffee allergens were identified by sequence analysis, expressed in E. coli, and evaluated by Western blots. The prevalence of sensitization to recombinant Cof a 1, Cof a 2, and Cof a 3 and to commercially available extract was investigated by ELISA (enzyme-linked immunosorbent assay respectively CAP (capacity test screening in 18 sera of symptomatic coffee workers.In addition to the previously described chitinase Cof a 1, two Coffea arabica cysteine-rich metallothioneins of 9 and 7 kDa were identified and included in the IUIS Allergen Nomenclature as Cof a 2 and Cof a 3. Serum IgE antibodies to at least one of the recombinant allergens were found in 8 out of 18 symptomatic coffee workers (44%. Only 2 of the analysed sera (11% had reacted previously to the commercial allergy test.In addition to the previously described Cof a 1 we have identified two further coffee proteins to be type I coffee allergens (Cof a 2 and Cof a 3 which may have a relevant potential for the specific diagnosis and/or therapy of coffee allergy.

  3. Optimizing illumination in the greenhouse using a 3D model of tomato and a ray tracer

    Directory of Open Access Journals (Sweden)

    Pieter Huibert Bram De Visser

    2014-02-01

    Full Text Available Reduction of energy use for assimilation lighting is one of the most urgent goals of current greenhouse horticulture in the Netherlands. In recent years numerous lighting systems have been tested in greenhouses, yet their efficiency has been very difficult to measure in practice. This simulation study evaluated a number of lighting strategies using a 3D light model for natural and artificial light in combination with a 3D model of tomato. The modeling platform GroIMP was used for the simulation study. The crop was represented by 3D virtual plants of tomato with fixed architecture. Detailed data on greenhouse architecture and lamp emission patterns of different light sources were incorporated in the model. A number of illumination strategies were modeled with the calibrated model. Results were compared to the standard configuration. Moreover, adaptation of leaf angles was incorporated for testing their effect on light use efficiency. A Farquhar photosynthesis model was used to translate the absorbed light for each leaf into a produced amount of carbohydrates. The carbohydrates produced by the crop per unit emitted light from sun or HPS lamps was the highest for horizontal leaf angles or slightly downward pointing leaves, and was less for more upward leaf orientations. The simulated leaf angles did not affect light absorption from inter-lighting LED modules, but the scenario with LEDs shining slightly upward (20° increased light absorption and light use efficiency relative to default horizontal beaming LEDs. Furthermore, the model showed that leaf orientation more perpendicular to the string of LEDs increased LED light interception.The combination of a ray tracer and a 3D crop model could compute optimal lighting of leaves by quantification of light fluxes and illustration by rendered lighting patterns. Results indicate that illumination efficiency increases when the lamp light is directed at most to leaves that have a high photosynthetic

  4. Alternating hemiplegia of childhood in Denmark: clinical manifestations and ATP1A3 mutation status.

    Science.gov (United States)

    Hoei-Hansen, Christina E; Dali, Christine Í; Lyngbye, Troels J B; Duno, Morten; Uldall, Peter

    2014-01-01

    Alternating hemiplegia of childhood (AHC) is a rare neurodevelopmental disorder characterized by early-onset recurrent distinctive hemiplegic episodes commonly accompanied by other paroxysmal features and developmental impairment. De novo mutations in ATP1A3 were recently identified as a genetic cause of AHC. To describe the entire Danish cohort of paediatric AHC patients we approached neuropaediatricians nationwide. All currently acknowledged Danish patients ≤16 years with AHC were genetically tested and seen by the same child neurologist (PU). Ten patients; seven girls and three boys were identified. Mean present age was 10.0 years (range 1-16). Mean age at presentation was 7.4 months (range 1-18 months). Sequencing of ATP1A3 in all ten patients revealed a pathogenic mutation in seven. Two females with moderate psychomotor impairment were heterozygous for the known p.G947R mutation, whereas one severely retarded boy was heterozygous for the common p.E815K mutation. The prevalent p.D801N mutation was identified in two moderate to severely retarded children. Interestingly, in a set of monochorionic male twins a novel p.D801E mutation was identified, underscoring that the asparagine at position 801 is a mutation hotspot. Three girls aged 5-13 years did not reveal any ATP1A3 mutations. They were rather mildly clinically affected and displayed a normal or near-normal psychomotor development. This is the first study of AHC in the Danish paediatric population. The patients harboured a wide range of psychomotor difficulties. Patients with no mutation detected tended to be less severely affected. Prevalence was approximately 1 per 100,000 children.

  5. Conjunctival Splendore-Hoeppli phenomenon in a 3-year-old child.

    Science.gov (United States)

    Orhan, Diclehan; Kiratli, Hayyam; Kocabeyoğlu, Sibel

    2006-01-01

    A case of benign granulomas of the conjunctiva in a 3-year-old girl is reported. Histologic features of the excised conjunctival lesions were consistent with Splendore-Hoeppli phenomenon. This phenomenon is thought to be a granulomatous reaction to an antigen-antibody precipitate related to parasites or fungi. No causative agent is identified in our patient. Immunohistochemical analysis showed no immunoreactivity for immunoglobulin G (IgG), IgM, IgA, or the C3 component of the complement. We propose that the presence of small amelanotic nodular conjunctival tumors should arouse suspicion related to the Splendore-Hoeppli phenomenon even in early childhood.

  6. ROBUST ATTITUDE CONTROL OF A 3DOF HELICOPTER WITH MULTI-OPERATION POINTS

    Institute of Scientific and Technical Information of China (English)

    Yao YU; Yisheng ZHONG

    2009-01-01

    A 3DOF (three degrees of freedom) helicopter attitude control system with multi-operation points is described as a MIMO time-varying uncertain nonlinear system with unknown constant param-eters, bounded disturbance and nonlinear uncertainty, and a robust output feedback control method based on signal compensation is proposed. A controller designed by this method consists of a nominal controller and a robust compensator. The controller is linear time-invariant and can be realized easily. Robust attitude tracking property of closed-loop system is proven and experimental results show that the designed control system can guarantee high precision robust attitude control under multi-operation points.

  7. Incorporating a 3-dimensional printer into the management of early-stage cervical cancer.

    Science.gov (United States)

    Baek, Min-Hyun; Kim, Dae-Yeon; Kim, Namkug; Rhim, Chae Chun; Kim, Jong-Hyeok; Nam, Joo-Hyun

    2016-08-01

    We used a 3-dimensional (3D) printer to create anatomical replicas of real lesions and tested its application in cervical cancer. Our study patient decided to undergo radical hysterectomy after seeing her 3D model which was then used to plan and simulate this surgery. Using 3D printers to create patient-specific 3D tumor models may aid cervical cancer patients make treatment decisions. This technology will lead to better surgical and oncological outcomes for cervical cancer patients. J. Surg. Oncol. 2016;114:150-152. © 2016 Wiley Periodicals, Inc.

  8. 3DTS: A 3D tolerancing system based on mathematical definition

    Institute of Scientific and Technical Information of China (English)

    CAO Yan-long; LIU Yu-sheng; MAO Jian; YANG Jiang-xin

    2006-01-01

    Tolerance is almost ubiquitous during the whole product lift cycle and is imperative for seamless integration of CAD and CAM. Based on the mathematical definition of tolerance, a 3D tolerancing system, 3DTS, is presented with its design principle, system architecture and key functions. The following functional modules, tolerance modeling, semantics interpretation, 3D tolerance analysis, are described in detail. To make the tolerancing system robust and efficient, many techniques such as hierarchical tolerance representation, rule-based evaluation and non-intersection determination of tolerance zone have been devised.Tested by many samples, this system shows good robustness and practicability.

  9. Catastrophic antiphospholipid syndrome and pulmonary embolism in a 3-year-old child

    Energy Technology Data Exchange (ETDEWEB)

    Olivier, Carine; Blondiaux, Eleonore; Dacher, Jean-Nicolas [University Hospital of Rouen, Department of Radiology, Rouen (France); Blanc, Thierry [University Hospital of Rouen, Department of Neonatal Medicine, Rouen (France); Borg, Jeanne-Yvonne [University Hospital of Rouen, Haematology Laboratory, Rouen (France)

    2006-08-15

    We report a rare example of catastrophic antiphospholipid syndrome (CAPS) in a young child. A 3-year-old girl with no previous medical history presented with extensive and recurrent thromboses. The diagnosis of CAPS was based on the occurrence of cardiopulmonary embolism in the child with a high titre of autoantibodies directed against phospholipids and beta-2-glycoprotein 1. In spite of a relatively rapid diagnosis and multiple treatments, the outcome was unfavourable. Multimodality imaging, including both ultrasonography and spiral CT, allowed close follow-up of the thromboses. (orig.)

  10. A 3D DEM-LBM approach for the assessment of the quick condition for sands

    Science.gov (United States)

    Mansouri, M.; Delenne, J.-Y.; El Youssoufi, M. S.; Seridi, A.

    2009-09-01

    We present a 3D numerical model to assess the quick condition (the onset of the boiling phenomenon) in a saturated polydisperse granular material. We use the Discrete Element Method (DEM) to study the evolution of the vertical intergranular stress in a granular sample subjected to an increasing hydraulic gradient. The hydrodynamic forces on the grains of the sample are computed using the Lattice Boltzmann Method (LBM). The principal assumption used is that grains remain at rest until the boiling onset. We show that the obtained critical hydraulic gradient is close to that defined in classical soil mechanics. To cite this article: M. Mansouri et al., C. R. Mecanique 337 (2009).

  11. It’s all in the Game: A 3D Learning Model for Business Ethics

    OpenAIRE

    Jagger, Suzy; Siala, Haytham; Sloan, Diane

    2016-01-01

    How can we improve business ethics education for the twenty first century? This study evaluates the effectiveness of a visual case exercise in the form of a 3D immersive game given to undergraduate students at two UK Universities as part of a mandatory business ethics module. We propose that due to evolving learning styles, the immersive nature of interactive games lends itself as a vehicle to make the learning of ethics more ‘concrete’ and ‘personal’ and therefore more engaging. To achieve t...

  12. Receptores A3 da adenosina: uma nova abordagem terapêutica no câncer

    Directory of Open Access Journals (Sweden)

    Alexandra Gaspar

    2011-01-01

    Full Text Available Cancer is a multi-factorial disease linked with different initiating causes, cofactors and promoters, and several types of cellular damage. Advancing knowledge on the cellular and molecular biology of the processes that regulate cell proliferation, cell differentiation and cellular responses to external signals, has provided a wealth of information about the cancer cell and how it differs from a normal one. These findings make available a number of potential targets for new therapeutic approaches. The Medicinal Chemistry artwork performed so far in the development of selective and potent adenosine receptor A3 ligands, a current cancer target, will be highlighted in this work.

  13. Synthetic Promoter Library for Modulation of Actinorhodin Production in Streptomyces coelicolor A3(2)

    DEFF Research Database (Denmark)

    Sohoni, Sujata Vijay; Fazio, Alessandro; Workman, Christopher

    2014-01-01

    The objective of this study was the application of the synthetic promoter library (SPL) technology for modulation of actinorhodin production in Streptomyces coelicolor A3(2). The SPL technology was used to optimize the expression of a pathway specific positive transcriptional regulator Actll orf4...... constitutive promoter. ScoSPL20 demonstrated exceptional productivity despite having a comparatively weak expression from the promoter. Interestingly, the ScoSPL20 promoter was activated at a much earlier stage of growth compared to the wild type, demonstrating the advantage of fine-tuning and temporal tuning...... metabolite production in filamentous bacteria....

  14. 3D Genome Tuner: Compare Multiple Circular Genomes in a 3D Context

    Institute of Scientific and Technical Information of China (English)

    Qi Wang; Qun Liang; Xiuqing Zhang

    2009-01-01

    Circular genomes, being the largest proportion of sequenced genomes, play an important role in genome analysis. However, traditional 2D circular map only provides an overview and annotations of genome but does not offer feature-based comparison. For remedying these shortcomings, we developed 3D Genome Tuner, a hybrid of circular map and comparative map tools. Its capability of viewing comparisons between multiple circular maps in a 3D space offers great benefits to the study of comparative genomics. The program is freely available(under an LGPL licence)at http://sourceforge.net/projects/dgenometuner.

  15. Fabrication of a 3D electrically small antenna using holographic photolithography

    Science.gov (United States)

    Toriz-Garcia, J. J.; Cowling, J. J.; Williams, G. L.; Bai, Q.; Seed, N. L.; Tennant, A.; McWilliam, R.; Purvis, A.; Soulard, F. B.; Ivey, P. A.

    2013-05-01

    We describe the novel fabrication of a 3D electrical small antenna and its subsequent characterization. The patterning of meander lines conformed onto a hemispherical substrate is achieved by 3D holographic photolithography, which uses time-division multiplexing of a series of iteratively optimized computer-generated holograms. The meander lines have a line width of 100 µm and line separation of 400 µm, with a line pitch of 500 µm and a total meander length of 145 mm. The working frequency is found to be 2.06 GHz, with an efficiency of 46%. This work demonstrates a new method for the fabrication of 3D conformal antennas.

  16. Retrieval and Clustering from a 3D Human Database based on Body and Head Shape

    CERN Document Server

    Godil, Afzal

    2011-01-01

    In this paper, we describe a framework for similarity based retrieval and clustering from a 3D human database. Our technique is based on both body and head shape representation and the retrieval is based on similarity of both of them. The 3D human database used in our study is the CAESAR anthropometric database which contains approximately 5000 bodies. We have developed a web-based interface for specifying the queries to interact with the retrieval system. Our approach performs the similarity based retrieval in a reasonable amount of time and is a practical approach.

  17. A 3D measurement method based on multi-view fringe projection by using a turntable

    Science.gov (United States)

    Song, Li-mei; Gao, Yan-yan; Zhu, Xin-jun; Guo, Qing-hua; Xi, Jiang-tao

    2016-09-01

    In order to get the entire data in the optical measurement, a multi-view three-dimensional (3D) measurement method based on turntable is proposed. In the method, a turntable is used to rotate the object and obtain multi-view point cloud data, and then multi-view point cloud data are registered and integrated into a 3D model. The measurement results are compared with that of the sticking marked point method. Experimental results show that the measurement process of the proposed method is simpler, and the scanning speed and accuracy are improved.

  18. Development of a 3D CZT detector prototype for Laue Lens telescope

    OpenAIRE

    Caroli, Ezio; Auricchio, Natalia; Del Sordo, Stefano; Abbene, Leonardo; Budtz-JøRgensen, Carl; Casini, Fabio; Curado da Silva, Rui M.; Kuvvetli, Irfan; Milano, Luciano; Natalucci, Lorenzo; Quadrini, Egidio M.; Stephen, John B.; Ubertini, Pietro; Zanichelli, Massimiliano; Zappettini, Andrea

    2010-01-01

    We report on the development of a 3D position sensitive prototype suitable as focal plane detector for Laue lens telescope. The basic sensitive unit is a drift strip detector based on a CZT crystal, (~19×8 mm2 area, 2.4 mm thick), irradiated transversally to the electric field direction. The anode side is segmented in 64 strips, that divide the crystal in 8 independent sensor (pixel), each composed by one collecting strip and 7 (one in common) adjacent drift strips. The drift strips are biase...

  19. Study of two grafting methods for obtaining a 3-aminopropyltriethoxysilane monolayer on silica surface.

    Science.gov (United States)

    Simon, A; Cohen-Bouhacina, T; Porté, M C; Aimé, J P; Baquey, C

    2002-07-15

    In order to establish a 3-aminopropyltriethoxysilane (APTES) grafting procedure with limited number of APTESs noncovalently linked to the silica surface, two different methods of grafting (in acid-aqueous solution and in anhydrous solution) were compared. The grafted surface state was investigated by atomic force microscopy (AFM). The stability of the grafting was checked at different temperatures by AFM. Continuous and plane APTES grafted surfaces were successfully prepared using both grafting preparations. The grafting in an anhydrous solution behaves homogeneously and stably compared to the grafting in an acid-aqueous solution. Moreover, with anhydrous solution, results showed that a unique monolayer of APTES was grafted.

  20. Lenguaje en la etapa de 0 a 3 años

    OpenAIRE

    Arconada Martínez, Cristina

    2012-01-01

    En el trabajo de fin de grado "La adquisición del lenguaje en la etapa de 0 a 3 años" abordo la relevancia que la adquisición del lenguaje posee en el primer ciclo de Educación infantil. Por este motivo, hemos considerado preponderante conferir especial importancia a las teorías que estudian dicho proceso, sin olvidarnos de la importancia que ha tenido este tema a lo largo de la historia. Asimismo, hemos de resaltar las distintas etapas de la adquisición del lenguaje, con sus respectivas sube...

  1. Odontogenic myxoma involving the orbit in a 3-year-old boy

    DEFF Research Database (Denmark)

    Hansen, Teis Schjals; Danielsson, Lina Isabella; Fast, Søren;

    2016-01-01

    We present a rare case of a 3-year-old boy with an odontogenic myxoma (OM) involving the orbita. Including our case, only nine cases of OM have been reported to involve the eye in children.There is no gold standard for treatment of OM in children with orbital involvement. The recurrence rate of OM...... in children seems low, which advocates for less invasive surgery. A gentle resection of the OM was carried out. The floor and medial wall of the orbit was reconstructed immediately using a non-resorbable Medpor implant with passive adaptation. Reconstruction with a Medpor implant in children has rarely been...

  2. A 3-D discontinuous Galerkin Method for jet engine buzz-saw noise propagation

    Energy Technology Data Exchange (ETDEWEB)

    Remaki, M.; Habashi, W.G. [McGill Univ., Computational Fluid Dynamics Laboratory, Montreal, Quebec (Canada)]. E-mail: remaki@cfdlab.mcgill.ca; wagdi.habashi@mcgill.ca; Ait-Ali-Yahia, D. [Pratt and Whitney Canada, CFD Group, Longueuil, Quebec (Canada)]. E-mail: djaffar.Ait-Ali-Yahia@pwc.ca; Jay, A. [Pratt and Whitney Canada, Dept. of Acoustics and Installation, Longueuil, Quebec (Canada)]. E-mail: alexandre.jay@pwc.ca

    2002-07-01

    This paper presents a 3-D methodology for solving jet engine aero-acoustics problems in the presence of strong shocks and rarefactions. For example, turbofan engines suffer from Multiple Pure Tone noise, also called Buzz-saw noise, generated by the fan when the blade rotational tip speed is supersonic. These waves are composed of a series of shocks and rarefactions produced by a coalescence of shocks due to non-uniformities in the blade spacing and in the blade stagger angles, arising from manufacturing tolerances.

  3. Hamiltonian Systems and Darboux Transformation Associated with a 3 × 3 Matrix Spectral Problem

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Starting from a 3 × 3 matrix spectral problem, we derive a hierarchy of nonlinear equations. It is shown that the hierarchy possesses bi-Hamiltonian structure. Under the symmetry constraints between the potentials and the eigenfunctions, Lax pair and adjoint Lax pairs including partial part and temporal part are nonlinearied into two finitedimensional Hamiltonian systems (FDHS) in Liouville sense. Moreover, an explicit N-fold Darboux transformation for CDNS equation is constructed with the help of a gauge transformation of the spectral problem.

  4. A 3-input all magnetic full adder with misalignment-free clocking mechanism

    Science.gov (United States)

    Li, Zheng; Krishnan, Kannan M.

    2017-01-01

    The clocking field misalignment is a critical issue for the application of Magnetic Quantum-dot Cellular Automata (MQCA). Recent work demonstrates a novel architecture to address this issue—by progressively tuning the shape anisotropy, we could enforce a misalignment-free signal propagation and logic operation. In this paper, we propose a novel architecture of a 3-input full adder based on the 45°-clocking field mechanism. The effectiveness of this design is confirmed through both simulation and experiments. Our work paves the way for the application of MQCA logic.

  5. A 3-Component Approach Incorporating Focus Groups in Strategic Planning for Sexual Violence Prevention.

    Science.gov (United States)

    Cruz, Theresa H; Hess, Julia Meredith; Woelk, Leona; Bear, Samantha

    2016-01-01

    Sexual violence is of special concern in New Mexico because of the presence of large priority populations in which its prevalence is high. This article describes a 3-component approach to developing a strategic plan to prevent sexual violence in the state that consisted of an advisory group, subject matter experts, and focus groups from geographically and demographically diverse communities. Both common and community-specific themes emerged from the focus groups and were included in the strategic plan. By incorporating community needs and experiences, this approach fosters increased investment in plan implementation.

  6. 外观像平板电脑的LynxA3D相机

    Institute of Scientific and Technical Information of China (English)

    2013-01-01

    Kickstarter推出的这款LynxA3D相机,有别于传统的相机,但学习过程就像一部普通相机那样简单。该公司很看重这件产品的易用性,并称其为世上第一部rpoint—and—shootj的3D相机,其外观毫不像一部相机,反而像一部平板电脑。

  7. Global asymptotic stability of positive equilibrium in a 3-species cooperating model with time delay

    Institute of Scientific and Technical Information of China (English)

    WANG Chang-you

    2007-01-01

    The asymptotic behavior of the time-dependent solution for a 3-species cooperating model was investigated with the effects of both diffusion and time delay taken into consideration. We proved the global asymptotic stability of a positive steady-state solution to the model problem by using coupled upper and lower solutions for a more general reaction-diffusion system that gives a common framework for 3-species cooperating model problems. The result of global asymptotic stability implies that the model system coexistence is permanent. Some global asymptotic stability results for 2-species cooperating reaction-diffusion systems are included in the discussion, and some known results are extended.

  8. Psychotherapy with a 3-Year-Old Child: The Role of Play in the Unfolding Process

    Science.gov (United States)

    Salcuni, Silvia; Di Riso, Daniela; Mabilia, Diana; Lis, Adriana

    2017-01-01

    Few studies have investigated the outcomes and process of psychodynamic psychotherapies with children. Among the limited number of studies, some only paid attention to play and verbal production, as they are fundamental aspects in assessing the psychotherapy process. This paper focuses on an empirical investigation of a 3-year, once-a-week psychodynamic psychotherapy carried out with a 3-year-old girl. A process-outcome design was implemented to evaluate play and verbal discourse in in the initial, middle, and final parts of 30 psychotherapy sessions. Repeated measurements of standardized play categories (the Play Category System and the Affect in Play Scale—Preschool version) and verbal discourse (Verbal Production) were analyzed. To increase the clinical validity of the study, data from the assessment phase and vignettes from the sessions were reported to deepen the patient’s picture during the unfolding therapy process. Parent reports before and after the therapy were also included. Empirically measured changes in play and verbal production were fundamental in evaluating the young patient’s psychotherapy process. Verbal production and discourse ability progressively increased and took the place of play, which instead became more symbolic. Developmental issues as well as psychotherapy’s influence on the patient’s change, were discussed in relation to the role of play in enhancing the development of verbal dialog and the expression of the child’s emotions, needs, and desires. PMID:28101070

  9. Race-track coils for a 3 MW HTS ship motor

    Energy Technology Data Exchange (ETDEWEB)

    Ueno, E., E-mail: ueno-eisaku@sei.co.jp; Kato, T.; Hayashi, K.

    2014-09-15

    Highlights: • Sumitomo Electric manufactured the HTS field coils for a 3 MW HTS ship motor. • The motor was developed and successfully passed the loading test by Kawasaki Heavy. • We tested and obtained the basic data to evaluate the 20-year durability of coils. - Abstract: Since the discovery of high-temperature superconductivity (HTS), Sumitomo Electric has been developing silver-sheathed Bi2223 superconducting wire and products. Ship propulsion motors are one of the most promising applications of HTS. Sumitomo Electric Industries, Ltd. (SEI) has recently manufactured 24 large racetrack coils, using 70 km long DI-BSCCO wires, for use in a 3 MW HTS motor developed by Kawasaki Heavy Industries, Ltd. (KHI). The 3 MW HTS motor, using our newly developed racetrack coils, has successfully passed the loading test. It is particularly important that the HTS field coils used in ship propulsion motors can withstand the expansive forces repeatedly applied to them. As racetrack type coils have straight sections, the support mechanism they require to withstand expansive forces is very different from that of circular coils. Therefore, we ran tests and obtained the basic data to evaluate the 20-year durability of racetrack coils against the repeatedly applied expansive forces expected in domestic ship propulsion motors.

  10. Neural evidence for a 3-state model of visual short-term memory.

    Science.gov (United States)

    Nee, Derek Evan; Jonides, John

    2013-07-01

    Recent research has suggested that short-term memory (STM) can be partitioned into three distinct states. By this model, a single item is held in the focus of attention making it available for immediate processing (focus of attention), a capacity-limited set of additional items is actively maintained for future processing (direct access region), and other recently presented information is passively active, but can nevertheless influence ongoing cognition (activated portion of long-term memory). While there is both behavioral and neural support for this 3-state model in verbal STM, it is unclear whether the model generalizes to non-verbal STM. Here, we tested a 3-state model of visual STM using fMRI. We found a triple dissociation of regions involved in the access of each hypothesized state. The inferior parietal cortex mediated access to the focus of attention, the medial temporal lobe (MTL) including the hippocampus mediated access to the direct access region, and the left ventrolateral prefrontal cortex (VLPFC) mediated access to the activated portion of long-term memory. Direct comparison with previously collected verbal STM data revealed overlapping neural activations involved in the access of each state across different forms of content suggesting that mechanisms of access are domain general. These data support a 3-state model of STM.

  11. Human brain diffusion tensor imaging at submillimeter isotropic resolution on a 3Tesla clinical MRI scanner.

    Science.gov (United States)

    Chang, Hing-Chiu; Sundman, Mark; Petit, Laurent; Guhaniyogi, Shayan; Chu, Mei-Lan; Petty, Christopher; Song, Allen W; Chen, Nan-kuei

    2015-09-01

    The advantages of high-resolution diffusion tensor imaging (DTI) have been demonstrated in a recent post-mortem human brain study (Miller et al., NeuroImage 2011;57(1):167-181), showing that white matter fiber tracts can be much more accurately detected in data at a submillimeter isotropic resolution. To our knowledge, in vivo human brain DTI at a submillimeter isotropic resolution has not been routinely achieved yet because of the difficulty in simultaneously achieving high resolution and high signal-to-noise ratio (SNR) in DTI scans. Here we report a 3D multi-slab interleaved EPI acquisition integrated with multiplexed sensitivity encoded (MUSE) reconstruction, to achieve high-quality, high-SNR and submillimeter isotropic resolution (0.85×0.85×0.85mm(3)) in vivo human brain DTI on a 3Tesla clinical MRI scanner. In agreement with the previously reported post-mortem human brain DTI study, our in vivo data show that the structural connectivity networks of human brains can be mapped more accurately and completely with high-resolution DTI as compared with conventional DTI (e.g., 2×2×2mm(3)).

  12. Triazoloquinazolines as Human A3 Adenosine Receptor Antagonists: A QSAR Study

    Directory of Open Access Journals (Sweden)

    Dae-Sil Lee

    2006-11-01

    Full Text Available Multiple linear regression analysis was performed on the quantitative structure-activity relationships (QSAR of the triazoloquinazoline adenosine antagonists for human A3receptors. The data set used for the QSAR analysis encompassed the activities of 33triazoloquinazoline derivatives and 72 physicochemical descriptors. A template moleculewas derived using the known molecular structure for one of the compounds when bound tothe human A2B receptor, in which the amide bond was in a cis-conformation. All the testcompounds were aligned to the template molecule. In order to identify a reasonable QSARequation to describe the data set, we developed a multiple linear regression program thatexamined every possible combination of descriptors. The QSAR equation derived from thisanalysis indicates that the spatial and electronic effects is greater than that of hydrophobiceffects in binding of the antagonists to the human A3 receptor. It also predicts that a largesterimol length parameter is advantageous to activity, whereas large sterimol widthparameters and fractional positive partial surface areas are nonadvatageous.

  13. Acceleration tests of a 3 GHz proton linear accelerator (LIBO) for hadrontherapy

    Science.gov (United States)

    De Martinis, C.; Giove, D.; Amaldi, U.; Berra, P.; Crandall, K.; Mauri, M.; Weiss, M.; Zennaro, R.; Rosso, E.; Szeless, B.; Vretenar, M.; Masullo, M. R.; Vaccaro, V.; Calabretta, L.; Rovelli, A.

    2012-07-01

    This paper describes the acceleration tests performed at the Catania LNS Laboratory on a 3 GHz linac module of the side coupled type, which boosts the proton energy of a beam extracted from a cyclotron from 62 to 72 MeV. The output proton energy was measured with two devices: a NaI(Tl) crystal and a bending magnet. The experimental spectra are in good agreement with the calculated ones. From their shape it is obtained that (18±3.0)% of the transmitted protons fall in a ±2 MeV interval centered around 72 MeV. This result is in good agreement with the 20% value derived from the simulation of the acceleration process. The measured energy of the accelerated protons was used to check that the shunt impedance of the structure is equal to the computed one within 3%. This was the first time that a 3 GHz structure has been used to accelerate protons, and the results of the tests have demonstrated that a high frequency linac can be used as a cyclotron booster.

  14. Acceleration tests of a 3 GHz proton linear accelerator (LIBO) for hadrontherapy

    Energy Technology Data Exchange (ETDEWEB)

    De Martinis, C., E-mail: carlo.demartinis@mi.infn.it [University of Milan and INFN, Milan (Italy); Giove, D. [University of Milan and INFN, Milan (Italy); Amaldi, U.; Berra, P.; Crandall, K.; Mauri, M.; Weiss, M.; Zennaro, R. [TERA Foundation, Novara (Italy); Rosso, E.; Szeless, B.; Vretenar, M. [CERN, Geneva (Switzerland); Masullo, M.R.; Vaccaro, V. [University and INFN of Naples (Italy); Calabretta, L.; Rovelli, A. [INFN-LNS Catania (Italy)

    2012-07-21

    This paper describes the acceleration tests performed at the Catania LNS Laboratory on a 3 GHz linac module of the side coupled type, which boosts the proton energy of a beam extracted from a cyclotron from 62 to 72 MeV. The output proton energy was measured with two devices: a NaI(Tl) crystal and a bending magnet. The experimental spectra are in good agreement with the calculated ones. From their shape it is obtained that (18{+-}3.0)% of the transmitted protons fall in a {+-}2 MeV interval centered around 72 MeV. This result is in good agreement with the 20% value derived from the simulation of the acceleration process. The measured energy of the accelerated protons was used to check that the shunt impedance of the structure is equal to the computed one within 3%. This was the first time that a 3 GHz structure has been used to accelerate protons, and the results of the tests have demonstrated that a high frequency linac can be used as a cyclotron booster.

  15. Fabrication of Dye-Sensitized Solar Cells with a 3D Nanostructured Electrode

    Directory of Open Access Journals (Sweden)

    Guo-Yang Chen

    2010-01-01

    Full Text Available A novel Dye-Sensitized Solar Cell (DSSC scheme for better solar conversion efficiency is proposed. The distinctive characteristic of this novel scheme is that the conventional thin film electrode is replaced by a 3D nanostructured indium tin oxide (ITO electrode, which was fabricated using RF magnetron sputtering with an anodic aluminum oxide (AAO template. The template was prepared by immersing the barrier-layer side of an AAO film into a 30 wt% phosphoric acid solution to produce a contrasting surface. RF magnetron sputtering was then used to deposit a 3D nanostructured ITO thin film on the template. The crystallinity and conductivity of the 3D ITO films were further enhanced by annealing. Titanium dioxide nanoparticles were electrophoretically deposited on the 3D ITO film after which the proposed DSSC was formed by filling vacant spaces in the 3D nanostructured ITO electrode with dye. The measured solar conversion efficiency of the device was 0.125%. It presents a 5-fold improvement over that of conventional spin-coated TiO2 film electrode DSSCs.

  16. Inclusion of high resolution MODIS maps on a 3D tropospheric water vapor GPS tomography model

    Science.gov (United States)

    Benevides, Pedro; Catalao, Joao; Nico, Giovanni; Miranda, Pedro M. A.

    2015-10-01

    Observing the water vapor distribution on the troposphere remains a challenge for the weather forecast. Radiosondes provide precise water vapor profiles of the troposphere, but lack geographical and temporal coverage, while satellite meteorological maps have good spatial resolution but even poorer temporal resolution. GPS has proved its capacity to measure the integrated water vapor in all weather conditions with high temporal sampling frequency. However these measurements lack a vertical water vapor discretization. Reconstruction of the slant path GPS observation to the satellite allows oblique water vapor measurements. Implementation of a 3D grid of voxels along the troposphere over an area where GPS stations are available enables the observation ray tracing. A relation between the water vapor density and the distanced traveled inside the voxels is established, defining GPS tomography. An inverse problem formulation is needed to obtain a water vapor solution. The combination of precipitable water vapor (PWV) maps obtained from MODIS satellite data with the GPS tomography is performed in this work. The MODIS PWV maps can have 1 or 5 km pixel resolution, being obtained 2 times per day in the same location at most. The inclusion of MODIS PWV maps provides an enhanced horizontal resolution for the tomographic solution and benefits the stability of the inversion problem. A 3D tomographic grid was adjusted over a regional area covering Lisbon, Portugal, where a GNSS network of 9 receivers is available. Radiosonde measurements in the area are used to evaluate the 3D water vapor tomography maps.

  17. Microrheology and ROCK signaling of human endothelial cells embedded in a 3D matrix.

    Science.gov (United States)

    Panorchan, Porntula; Lee, Jerry S H; Kole, Thomas P; Tseng, Yiider; Wirtz, Denis

    2006-11-01

    Cell function is profoundly affected by the geometry of the extracellular environment confining the cell. Whether and how cells plated on a two-dimensional matrix or embedded in a three-dimensional (3D) matrix mechanically sense the dimensionality of their environment is mostly unknown, partly because individual cells in an extended matrix are inaccessible to conventional cell-mechanics probes. Here we develop a functional assay based on multiple particle tracking microrheology coupled with ballistic injection of nanoparticles to measure the local intracellular micromechanical properties of individual cells embedded inside a matrix. With our novel assay, we probe the mechanical properties of the cytoplasm of individual human umbilical vein endothelial cells (HUVECs) embedded in a 3D peptide hydrogel in the presence or absence of vascular endothelial growth factor (VEGF). We found that VEGF treatment, which enhances endothelial migration, increases the compliance and reduces the elasticity of the cytoplasm of HUVECs in a matrix. This VEGF-induced softening response of the cytoplasm is abrogated by specific Rho-kinase (ROCK) inhibition. These results establish combined particle-tracking microrheology and ballistic injection as the first method able to probe the micromechanical properties and mechanical response to agonists and/or drug treatments of individual cells inside a matrix. These results suggest that ROCK plays an essential role in the regulation of the intracellular mechanical response to VEGF of endothelial cells in a 3D matrix.

  18. MBE - growth of capped, strained HgTe, a 3D topological insulator

    Energy Technology Data Exchange (ETDEWEB)

    Ames, Christopher; Leubner, Philipp; Bruene, Christoph; Buhmann, Hartmut; Molenkamp, Laurens [Universitaet Wuerzburg, D-97074 Wuerzburg (Germany)

    2013-07-01

    The discovery of two (2D) and three dimensional (3D) topological insulator (TI) behavior in HgTe - systems opens a large field for studying magneto transport properties of both. We grow HgTe as a 3D topological insulator by molecular beam epitaxy. Unstrained bulk HgTe is a semimetal but opens a gap of roughly 22 meV when grown fully strained on <001> CdTe substrate due to 0.3 % lattice mismatch and shows magnetotransport properties of a 3D TI. Hall measurements show electron mobilities of around 50.000 cm{sup 2}(V s){sup -1}. To increase electron mobilities, various growth optimizations have been carried out. Firstly we grew an HgCdTe buffer layer between the substrate and bulk HgTe. Different buffer thicknesses were analyzed ex-situ by HRXRD, AFM and standard Hall measurements. Secondly, we added a cap-layer of HgCdTe on top of the bulk HgTe. Doing so, we were able to raise the electron mobility of the bulk HgTe up to one order of magnitude. Time-dependent XPS measurements allowed us to hold the suppressed oxidization of the surface responsible for this effect. Through the advanced material quality we have now more prospects for better understanding of the transport properties in strained HgTe.

  19. A 3-D constitutive model for pressure-dependent phase transformation of porous shape memory alloys.

    Science.gov (United States)

    Ashrafi, M J; Arghavani, J; Naghdabadi, R; Sohrabpour, S

    2015-02-01

    Porous shape memory alloys (SMAs) exhibit the interesting characteristics of porous metals together with shape memory effect and pseudo-elasticity of SMAs that make them appropriate for biomedical applications. In this paper, a 3-D phenomenological constitutive model for the pseudo-elastic behavior and shape memory effect of porous SMAs is developed within the framework of irreversible thermodynamics. Comparing to micromechanical and computational models, the proposed model is computationally cost effective and predicts the behavior of porous SMAs under proportional and non-proportional multiaxial loadings. Considering the pressure dependency of phase transformation in porous SMAs, proper internal variables, free energy and limit functions are introduced. With the aim of numerical implementation, time discretization and solution algorithm for the proposed model are also presented. Due to lack of enough experimental data on multiaxial loadings of porous SMAs, we employ a computational simulation method (CSM) together with available experimental data to validate the proposed constitutive model. The method is based on a 3-D finite element model of a representative volume element (RVE) with random pores pattern. Good agreement between the numerical predictions of the model and CSM results is observed for elastic and phase transformation behaviors in various thermomechanical loadings.

  20. A 3' Poly(A) Tract Is Required for LINE-1 Retrotransposition.

    Science.gov (United States)

    Doucet, Aurélien J; Wilusz, Jeremy E; Miyoshi, Tomoichiro; Liu, Ying; Moran, John V

    2015-12-01

    L1 retrotransposons express proteins (ORF1p and ORF2p) that preferentially mobilize their encoding RNA in cis, but they also can mobilize Alu RNA and, more rarely, cellular mRNAs in trans. Although these RNAs differ in sequence, each ends in a 3' polyadenosine (poly(A)) tract. Here, we replace the L1 polyadenylation signal with sequences derived from a non-polyadenylated long non-coding RNA (MALAT1), which can form a stabilizing triple helix at the 3' end of an RNA. L1/MALAT RNAs accumulate in cells, lack poly(A) tails, and are translated; however, they cannot retrotranspose in cis. Remarkably, the addition of a 16 or 40 base poly(A) tract downstream of the L1/MALAT triple helix restores retrotransposition in cis. The presence of a poly(A) tract also allows ORF2p to bind and mobilize RNAs in trans. Thus, a 3' poly(A) tract is critical for the retrotransposition of sequences that comprise approximately one billion base pairs of human DNA.

  1. A 3-Step Algorithm Using Region-Based Active Contours for Video Objects Detection

    Directory of Open Access Journals (Sweden)

    Stéphanie Jehan-Besson

    2002-06-01

    Full Text Available We propose a 3-step algorithm for the automatic detection of moving objects in video sequences using region-based active contours. First, we introduce a very full general framework for region-based active contours with a new Eulerian method to compute the evolution equation of the active contour from a criterion including both region-based and boundary-based terms. This framework can be easily adapted to various applications, thanks to the introduction of functions named descriptors of the different regions. With this new Eulerian method based on shape optimization principles, we can easily take into account the case of descriptors depending upon features globally attached to the regions. Second, we propose a 3-step algorithm for detection of moving objects, with a static or a mobile camera, using region-based active contours. The basic idea is to hierarchically associate temporal and spatial information. The active contour evolves with successively three sets of descriptors: a temporal one, and then two spatial ones. The third spatial descriptor takes advantage of the segmentation of the image in intensity homogeneous regions. User interaction is reduced to the choice of a few parameters at the beginning of the process. Some experimental results are supplied.

  2. Reliability Analysis of a 3-Machine Power Station Using State Space Approach

    Directory of Open Access Journals (Sweden)

    WasiuAkande Ahmed

    2014-07-01

    Full Text Available With the advent of high-integrity fault-tolerant systems, the ability to account for repairs of partially failed (but still operational systems become increasingly important. This paper presents a systemic method of determining the reliability of a 3-machine electric power station, taking into consideration the failure rates and repair rates of the individual component (machine that make up the system. A state-space transition process for a 3-machine with 23 states was developed and consequently, steady state equations were generated based on Markov mathematical modeling of the power station. Important reliability components were deduced from this analysis. This research simulation was achieved with codes written in Excel® -VBA programming environment. System reliability using state space approach proofs to be a viable and efficient technique of reliability prediction as it is able to predict the state of the system under consideration. For the purpose of neatness and easy entry of data, Graphic User Interface (GUI was designed.

  3. A 3D Visual Interface for Critiquing-based Recommenders: Architecture and Interaction

    Directory of Open Access Journals (Sweden)

    David Contreras

    2015-06-01

    Full Text Available Nowadays e-commerce websites offer users such a huge amount of products, which far from facilitating the buying process, actually make it more difficult. Hence, recommenders, which learn from users’ preferences, are consolidating as valuable instruments to enhance the buying process in the 2D Web. Indeed, 3D virtual environments are an alternative interface for recommenders. They provide the user with an immersive 3D social experience, enabling a richer visualisation and increasing the interaction possibilities with other users and with the recommender. In this paper, we focus on a novel framework to tightly integrate interactive recommendation systems in a 3D virtual environment. Specifically, we propose to integrate a Collaborative Conversational Recommender (CCR in a 3D social virtual world. Our CCR Framework defines three layers: the user interaction layer (3D Collaborative Space Client, the communication layer (3D Collaborative Space Server, and the recommendation layer (Collaborative Conversational Recommender. Additionally, we evaluate the framework based on several usability criteria such as learnability, perceived efficiency and effectiveness. Results demonstrate that users positively valued the experience

  4. Rational design of sulfonated A3 adenosine receptor-selective nucleosides as pharmacological tools to study chronic neuropathic pain.

    Science.gov (United States)

    Paoletta, Silvia; Tosh, Dilip K; Finley, Amanda; Gizewski, Elizabeth T; Moss, Steven M; Gao, Zhan-Guo; Auchampach, John A; Salvemini, Daniela; Jacobson, Kenneth A

    2013-07-25

    (N)-Methanocarba(bicyclo[3.1.0]hexane)adenosine derivatives were probed for sites of charged sulfonate substitution, which precludes diffusion across biological membranes, e.g., blood-brain barrier. Molecular modeling predicted that sulfonate groups on C2-phenylethynyl substituents would provide high affinity at both mouse (m) and human (h) A3 adenosine receptors (ARs), while a N(6)-p-sulfophenylethyl substituent would determine higher hA3AR vs mA3AR affinity. These modeling predictions, based on steric fitting of the binding cavity and crucial interactions with key residues, were confirmed by binding/efficacy studies of synthesized sulfonates. N(6)-3-Chlorobenzyl-2-(3-sulfophenylethynyl) derivative 7 (MRS5841) bound selectively to h/m A3ARs (Ki(hA3AR) = 1.9 nM) as agonist, while corresponding p-sulfo isomer 6 (MRS5701) displayed mixed A1/A3AR agonism. Both nucleosides administered ip reduced mouse chronic neuropathic pain that was ascribed to either A3AR or A1/A3AR using A3AR genetic deletion. Thus, rational design methods based on A3AR homology models successfully predicted sites for sulfonate incorporation, for delineating adenosine's CNS vs peripheral actions.

  5. Impairment of adenosine A3 receptor activity disrupts neutrophil migratory capacity and impacts innate immune function in vivo.

    Science.gov (United States)

    Butler, Matt; Sanmugalingam, Devika; Burton, Victoria J; Wilson, Tammy; Pearson, Ruth; Watson, Robert P; Smith, Philip; Parkinson, Scott J

    2012-12-01

    Adenosine possesses potent anti-inflammatory properties which are partly mediated by G(i) -coupled adenosine A3 receptors (A3Rs). A3R agonists have shown clinical benefit in a number of inflammatory conditions although some studies in A3R-deficient mice suggest a pro-inflammatory role. We hypothesised that, in addition to cell signalling effects, A3R compounds might inhibit neutrophil chemotaxis by disrupting the purinergic feedback loop controlling leukocyte migration. Human neutrophil activation triggered rapid upregulation of surface A3R expression which was disrupted by pre-treatment with either agonist (Cl-IB-MECA) or antagonist (MRS1220). Both compounds reduced migration velocity and neutrophil transmigration capacity without impacting the response to chemokines per se. Similar effects were observed in murine neutrophils, while cells from A3R-deficient mice displayed a constitutively impaired migratory phenotype indicating compound-induced desensitisation and genetic ablation had the same functional outcome. In a dextran sodium sulphate-induced colitis model, A3R-deficient mice exhibited reduced colon pathology and decreased tissue myeloperoxidase levels at day 8 - consistent with reduced neutrophil recruitment. However, A3R-deficient mice were unable to resolve the dextran sodium sulphate-induced inflammation and had elevated numbers of tissue-associated bacteria by day 21. Our data indicate that A3Rs play a role in neutrophil migration and disrupting this function has the potential to adversely affect innate immune responses.

  6. Assessing the waddle: An evaluation of a 3-point gait score system for ducks.

    Science.gov (United States)

    Makagon, Maja M; Woolley, Rebecca; Karcher, Darrin M

    2015-08-01

    Impaired walking ability is an economically important welfare problem that affects poultry raised for meat production, including Pekin ducks. To gain a better understanding of the impacts of walking impairments on duck production, and to identify contributing variables and plausible remedies, an accurate measure of walking ability must first be defined. The viability of a 3-point gait score system for characterizing the walking abilities of Pekin ducks was evaluated. Specifically, we examined whether the qualitative gait score categories corresponded to quantitative gait parameter measures, and evaluated the inter- and intra-rater reliabilities of the gait score system. Commercial Pekin ducks aged 13 to 14 d (14 d; 248 ducks), 20 to 21 d (21 d; 350 ducks), and 30 to 32 d (31 d; 368 ducks), were video recorded and gait scored using a 3-point system (GS0 = best gait; GS2 = poor gait) as they crossed a Tekscan(®) gait analysis system. Gait structure parameters were calculated based on 4 steps made by each duck. The most prominent differences were observed at 21 d and 31 d of age between the ducks with GS0 and GS2, with GS2 scoring ducks walking a shorter total distance, having greater differences in the amount of pressure applied to the right versus left leg, and the amount of time spent standing on 2 feet between steps. Gait score reliabilities were calculated separately for observers who received minimal training (M, N = 10) and those who viewed and discussed the sample cases (V, N = 13). Both groups assessed the gait of ducks from video footage. Inter-rater reliability (Fleiss kappa) was lowest for 14 d old ducks (M: k = 0.47, T: k = 0.62), and best for the 32 d old ducks (V: k = 0.75; T: k = 0.8). Overall, intra-rater reliabilities (Pearson's correlation) were high and were unaffected by the scorer's level of training (M: r = 0.87; V: r = 0.87; t21 = 0.43). The results indicate that a 3-point gait score system is a promising tool for assessing the walking ability

  7. Investigation of the accuracy of close-range photogrammetry – a 3D printing case study

    Directory of Open Access Journals (Sweden)

    Ognjan Lužanin

    2015-12-01

    Full Text Available 3D scanning of physical objects is one of the frequently used methods for generating input data for 3D printing process. Close-range photogrammetry represents a cost-efficient alternative to conventional 3D scanning. However, one of the basic problems in application of this method is accuracy, especially in the case of small objects with complex geometry. In this case study, a 3D-printed object of small dimensions was used to test the accuracy and precision of close-range photogrammetry. CAD Inspection was used to obtain measurements of the scanned model and compare it with the original CAD model, while the results were statistically analyzed. The results of statistical analysis showed that the scanning accuracy in this experiment did not depend on the particular cross-section of the model, while the precision of 3D scanning depended on the selection of cross-sectional profile curve.

  8. Towards Development of a 3-State Self-Paced Brain-Computer Interface

    Directory of Open Access Journals (Sweden)

    Ali Bashashati

    2007-01-01

    the presence of a right- or a left-hand movement and the second classifies the detected movement as a right or a left one. In an offline analysis of the EEG data collected from four able-bodied individuals, the 3-state brain-computer interface shows a comparable performance with a 2-state system and significant performance improvement if used as a 2-state BCI, that is, in detecting the presence of a right- or a left-hand movement (regardless of the type of movement. It has an average true positive rate of 37.5% and 42.8% (at false positives rate of 1% in detecting right- and left-hand extensions, respectively, in the context of a 3-state self-paced BCI and average detection rate of 58.1% (at false positive rate of 1% in the context of a 2-state self-paced BCI.

  9. A 3D-Printed Oxygen Control Insert for a 24-Well Plate.

    Directory of Open Access Journals (Sweden)

    Martin D Brennan

    Full Text Available 3D printing has emerged as a method for directly printing complete microfluidic devices, although printing materials have been limited to oxygen-impermeable materials. We demonstrate the addition of gas permeable PDMS (Polydimethylsiloxane membranes to 3D-printed microfluidic devices as a means to enable oxygen control cell culture studies. The incorporation of a 3D-printed device and gas-permeable membranes was demonstrated on a 24-well oxygen control device for standard multiwell plates. The direct printing allows integrated distribution channels and device geometries not possible with traditional planar lithography. With this device, four different oxygen conditions were able to be controlled, and six wells were maintained under each oxygen condition. We demonstrate enhanced transcription of the gene VEGFA (vascular endothelial growth factor A with decreasing oxygen levels in human lung adenocarcinoma cells. This is the first 3D-printed device incorporating gas permeable membranes to facilitate oxygen control in cell culture.

  10. Charge collection characterization of a 3D silicon radiation detector by using 3D simulations

    CERN Document Server

    Kalliopuska, J; Orava, R

    2007-01-01

    In 3D detectors, the electrodes are processed within the bulk of the sensor material. Therefore, the signal charge is collected independently of the wafer thickness and the collection process is faster due to shorter distances between the charge collection electrodes as compared to a planar detector structure. In this paper, 3D simulations are used to assess the performance of a 3D detector structure in terms of charge sharing, efficiency and speed of charge collection, surface charge, location of the primary interaction and the bias voltage. The measured current pulse is proposed to be delayed due to the resistance–capacitance (RC) product induced by the variation of the serial resistance of the pixel electrode depending on the depth of the primary interaction. Extensive simulations are carried out to characterize the 3D detector structures and to verify the proposed explanation for the delay of the current pulse. A method for testing the hypothesis experimentally is suggested.

  11. Rehand: Realistic electric prosthetic hand created with a 3D printer.

    Science.gov (United States)

    Yoshikawa, Masahiro; Sato, Ryo; Higashihara, Takanori; Ogasawara, Tsukasa; Kawashima, Noritaka

    2015-01-01

    Myoelectric prosthetic hands provide an appearance with five fingers and a grasping function to forearm amputees. However, they have problems in weight, appearance, and cost. This paper reports on the Rehand, a realistic electric prosthetic hand created with a 3D printer. It provides a realistic appearance that is same as the cosmetic prosthetic hand and a grasping function. A simple link mechanism with one linear actuator for grasping and 3D printed parts achieve low cost, light weight, and ease of maintenance. An operating system based on a distance sensor provides a natural operability equivalent to the myoelectric control system. A supporter socket allows them to wear the prosthetic hand easily. An evaluation using the Southampton Hand Assessment Procedure (SHAP) demonstrated that an amputee was able to operate various objects and do everyday activities with the Rehand.

  12. Mobilities and dislocation energies of planar faults in an ordered A3B (D019) structure

    Indian Academy of Sciences (India)

    A K Singh; R Sankarasubramanian; T K Nandy

    2013-08-01

    Present work describes the stability of possible planar faults of the A3B (D019) phase with an axial ratio less than the ideal. Mobilities and dislocation energies of various planar faults viz. antiphase boundaries (APBs), superlattice intrinsic stacking faults (SISFs) and complex stacking faults (CSFs) have been computed using complex fourth-order tensor transformations and hard sphere model. Displacements normal to the slip planes for various slip systems (vertical shift) have been used to calculate mobility of dislocations. The energy of the planar faults in Ti3Al intermetallic is calculated using some simplifying assumptions. Based on the mobility and energy, stability of planar faults has been explained. These results are compared with single crystal ordered Ti3Al alloy having D019 structure.

  13. Calculation of residual stresses by means of a 3D numerical weld simulation

    Energy Technology Data Exchange (ETDEWEB)

    Nicak, Tomas; Huemmer, Matthias [AREVA NP GmbH, Postfach 1109 (Germany)

    2008-07-01

    The numerical weld simulation has developed very fast in recent years. The problem complexity has increased from simple 2D models to full 3D models, which can describe the entire welding process more realistically. As recent research projects indicate, a quantitative assessment of the residual stresses by means of a 3D analysis is possible. The structure integrity can be assessed based on the weld simulation results superimposed with the operating load. Moreover, to support the qualification of welded components parametric studies for optimization of the residual stress distribution in the weld region can be performed. In this paper a full 3D numerical weld simulation for a man-hole drainage nozzle in a steam generator will be presented. The residual stresses are calculated by means of an uncoupled transient thermal and mechanical FE analysis. The paper will present a robust procedure allowing reasonable predictions of the residual stresses for complex structures in industrial practice. (authors)

  14. "Intelligent design" of a 3D reflection survey for the SAFOD drill-hole site

    Science.gov (United States)

    Alvarez, G.; Hole, J. A.; Klemperer, S. L.; Biondi, B.; Imhof, M.

    2003-12-01

    SAFOD seeks to better understand the earthquake process by drilling though the San Andreas fault (SAF) to sample an earthquake in situ. To capitalize fully on the opportunities presented by the 1D drill-hole into a complex fault zone we must characterize the surrounding 3D geology at a scale commensurate with the drilling observations, to provide the structural context to extrapolate 1D drilling results along the fault plane and into the surrounding 3D volume. Excellent active-2D and passive-3D seismic observations completed and underway lack the detailed 3D resolution required. Only an industry-quality 3D reflection survey can provide c. 25 m subsurface sample-spacing horizontally and vertically. A 3D reflection survey will provide subsurface structural and stratigraphic control at the 100-m level, mapping major geologic units, structural boundaries, and subsurface relationships between the many faults that make up the SAF fault system. A principal objective should be a reflection-image (horizon-slice through the 3D volume) of the near-vertical fault plane(s) to show variations in physical properties around the drill-hole. Without a 3D reflection image of the fault zone, we risk interpreting drilled anomalies as ubiquitous properties of the fault, or risk missing important anomalies altogether. Such a survey cannot be properly costed or technically designed without major planning. "Intelligent survey design" can minimize source and receiver effort without compromising data-quality at the fault target. Such optimization can in principal reduce the cost of a 3D seismic survey by a factor of two or three, utilizing the known surface logistic constraints, partially-known sub-surface velocity field, and the suite of scientific targets at SAFOD. Our methodology poses the selection of the survey parameters as an optimization process that allows the parameters to vary spatially in response to changes in the subsurface. The acquisition geometry is locally optimized for

  15. The establishment of a 3D breast photography service in medical illustration.

    Science.gov (United States)

    Winder, R J; Ruddock, A; Hendren, K; O'Neill, P; Boyd, L A; McCaughan, E; McIntosh, S A

    2014-05-01

    This paper aims to describe the development of a 3D breast photography service managed by the Medical Illustration Department, in the Belfast Health and Social Care Trust, Northern Ireland. Dedicated 3D breast photography equipment was installed in Medical Illustration for 18 months. Women were referred for a variety of indications including pre- and post-surgical assessment. A dedicated 3D breast photography protocol was developed locally and this requires further refinement to allow reproducibility in other centres. There are image/data artefacts associated with this technology and special techniques are required to reduce these. Specialist software is necessary for clinicians and scientists to use 3D breast photography data in surgical planning and measurement of surgical outcome.

  16. Antibiotic Overproduction in Steptomyces coelicolor A3(2) Mediated by Phosphofructokinase Deletion

    DEFF Research Database (Denmark)

    Borodina, Irina; Siebring, Jeroen; Zhang, Jie

    2008-01-01

    . Through genome-scale metabolic model simulations, we predicted that decreased phosphofructokinase activity leads to an increase in pentose phosphate pathway flux and in flux to pigmented antibiotics and pyruvate. Integrated analysis of gene expression data using a genome-scale metabolic model further...... of pfkA2 (SCO5426), one of three annotated pfkA homologues in S. coelicolor A3(2), resulted in a higher production of the pigmented antibiotics actinorhodin and undecylprodigiosin. The pfkA2 deletion strain had an increased carbon flux through the pentose phosphate pathway, as measured by C-13 metabolic...... flux analysis, establishing the ATP-dependent PfkA2 as a key player in determining the carbon flux distribution. The increased pentose phosphate pathway flux appeared largely because of accumulation of glucose 6-phosphate and fructose 6-phosphate, as experimentally observed in the mutant strain...

  17. A 3He Cryostat for Scientific Measurements in Pulsed High Magnetic Fields

    Science.gov (United States)

    Wang, Shaoliang; Li, Liang; Liu, Mengyu; Zuo, Huakun; Peng, Tao

    A top loading 3He cryostat has been developed for scientific experiments with a 60 T pulsed magnetic field facility at Wuhan National High Magnetic Field Center. The cryostat consists of a 4He bath cryostat, a 3He insert and a closed circulation system for 3He gas handling. To eliminate the eddy current heating during the pulse, the tail of the 3He insert with a vacuum space at the bottom is made from fiberglass tubing coated with epoxy. The 3He bath is separated from the 4He bath with the vacuum space. The 4He bath cryostat provides cooling power to condense 3He gas by a neck tube on top of the tail. Experimental results have shown that the sample can be cooled down to 385 mK and kept cold for more than 150 second by one-shot cooling, which is sufficiently long for an experiment in a pulsed high magnetic field.

  18. A 3D City Model Used as User-interface for an Energy-system

    DEFF Research Database (Denmark)

    Kjems, Erik

    2011-01-01

    of combinations of the energy-consumption and energy-production for an entire city. The interface was supposed to help especially nonprofessionals, among them politicians, to better perceive the numbers and graphs adjoining the 3D model in a combined view. Only very few systems have been developed for this kind...... of interaction, why the design guide lines for this development was a mix of believe and trial and error. To minimize the developing time and induce a steeper learning curve, it was obvious to use similar techniques for the different inputs and controls. Though the energy model, behind the visualization, could......At CUPUM 2009 the project “Object Oriented Visualization of Urban Energy Consumption” was presented, explaining the technology behind the visualization of an energy-model connected to a 3D city model. This paper presents the subsequent work involving the final design, the user involvement...

  19. A 3D City Model Used as User-interface for an Energy-System

    DEFF Research Database (Denmark)

    Kjems, Erik; Wen, Wan

    of combinations of the energy-consumption and energy-production for an entire city. The interface was supposed to help especially nonprofessionals, among them politicians, to better perceive the numbers and graphs adjoining the 3D model in a combined view. Only very few systems have been developed for this kind...... of interaction, why the design guide lines for this development was a mix of believe and trial and error. To minimize the developing time and induce a steeper learning curve, it was obvious to use similar techniques for the different inputs and controls. Though the energy model, behind the visualization, could......At CUPUM 2009 the project “Object Oriented Visualization of Urban Energy Consumption” was presented, explaining the technology behind the visualization of an energy-model connected to a 3D city model. This paper presents the subsequent work involving the final design, the user involvement...

  20. Epidermoid Cyst in the Floor of the Mouth of a 3-Year-Old

    Directory of Open Access Journals (Sweden)

    Rossana Pascual Dabán

    2015-01-01

    Full Text Available Epidermoid cysts are a rare entity in the oral cavity and are even less frequent in the floor of the mouth, representing less than 0.01% of all the cases. We present the case of a 3-year-old girl with a growth in the floor of the mouth with 2 months of evolution and without changes since it was discovered by her parents. The lesion was asymptomatic; it did not cause dysphagia, dyspnea, or any other alteration. A CT scan with contrast was done which revealed the location and exact size of the lesion, allowing an intraoral approach for its excision. The histological examination confirmed the clinical speculation of an epidermoid cyst.

  1. Acute vertigo in an anesthesia provider during exposure to a 3T MRI scanner.

    Science.gov (United States)

    Gorlin, Andrew; Hoxworth, Joseph M; Pavlicek, William; Thunberg, Christopher A; Seamans, David

    2015-01-01

    Vertigo induced by exposure to the magnetic field of a magnetic resonance imaging (MRI) scanner is a well-known phenomenon within the radiology community but is not widely appreciated by other clinical specialists. Here, we describe a case of an anesthetist experiencing acute vertigo while providing sedation to a patient undergoing a 3 Tesla MRI scan. After discussing previous reports, and the evidence surrounding MRI-induced vertigo, we review potential etiologies that include the effects of both static and time-varying magnetic fields on the vestibular apparatus. We conclude our review by discussing the occupational standards that exist for MRI exposure and methods to minimize the risks of MRI-induced vertigo for clinicians working in the MRI environment.

  2. A 3D discrete model of the diaphragm and human trunk

    CERN Document Server

    Promayon, Emmanuel

    2008-01-01

    In this paper, a 3D discrete model is presented to model the movements of the trunk during breathing. In this model, objects are represented by physical particles on their contours. A simple notion of force generated by a linear actuator allows the model to create forces on each particle by way of a geometrical attractor. Tissue elasticity and contractility are modeled by local shape memory and muscular fibers attractors. A specific dynamic MRI study was used to build a simple trunk model comprised of by three compartments: lungs, diaphragm and abdomen. This model was registered on the real geometry. Simulation results were compared qualitatively as well as quantitatively to the experimental data, in terms of volume and geometry. A good correlation was obtained between the model and the real data. Thanks to this model, pathology such as hemidiaphragm paralysis can also be simulated.

  3. Computational Finite Element Software Assisted Development of a 3D Inductively Coupled Power Transfer System

    Directory of Open Access Journals (Sweden)

    Pratik Raval

    2014-02-01

    Full Text Available To date inductively coupled power transfer (ICPT systems have already found many practical applications including battery charging pads. In fact, current charging platforms tend to largely support only one- or two-dimensional planar movement in load. This paper proposes a new concept of extending the aspect ratios of the operating power transfer volume of ICPT systems to support arbitrary three dimensional load movements with respect to the primary coils. This is done by use of modern finite element method analysis software to propose the primary and secondary magnetic structures of such an ICPT system. Firstly, two primary magnetic structures are proposed based on contrasting modes of operation and different field directions. This includes a single-phase and multi-phase current model. Next, a secondary magnetic structure is customized to be compatible with both primary structures. The resulting system is shown to produce a 3D power transfer volume for battery cell charging applications.

  4. Low molecular weight protein tyrosine phosphatases control antibiotic production in Streptomyces coelicolor A3(2)

    DEFF Research Database (Denmark)

    Sohoni, Sujata Vijay; Lieder, Sarah; Bapat, Prashant Madhusudhan

    2014-01-01

    of ACT in the ptpA over expression strain. Furthermore, a significantly earlier onset of ACT productionwas observed when ptpA was over expressed. Sco3700 overexpression had a pleiotropic effect on the cell, and thestrain exhibited lower productivities and final concentrations of antibiotics. We conclude...... that Sco3700 is indeed atyrosine phosphatase, and it contributes to regulation of antibiotic production in S. coelicolor affecting the timing ofonset of the antibiotic production......Streptomyces coelicolor A3(2) possesses a low molecular weight protein tyrosine phosphatase (LMW-PTP),PtpA, that affects the production of undecylprodigionsin (RED) and actinorhodin (ACT). In this study we identifiedanother LMW-PTP called sco3700. Tyrosine phosphatase activity of the purified Sco...

  5. Dynamics and Stability of Blind Grasping of a 3-Dimensional Object under Non-holonomic Constraints

    Institute of Scientific and Technical Information of China (English)

    Suguru Arimoto; Morio Yoshida; Ji-Hun Bae

    2006-01-01

    A mathematical model expressing the motion of a pair of multi-DOF robot fingers with hemi-spherical ends,grasping a 3-D rigid object with parallel flat surfaces, is derived, together with non-holonomic constraints. By referring to the fact that humans grasp an object in the form of precision prehension, dynamically and stably by opposable forces, between the thumb and another finger (index or middle finger), a simple control signal constructed from finger-thumb opposition is proposed, and shown to realize stable grasping in a dynamic sense without using object information or external sensing (this is called "blind grasp" in this paper). The stability of grasping with force/torque balance under non-holonomic constraints is analyzed on the basis of a new concept named "stability on a manifold". Preliminary simulation results are shown to verify the validity of the theoretical results.

  6. Development of generic key performance indicators for PMBOK® using a 3D project integration model

    Directory of Open Access Journals (Sweden)

    Craig Langston

    2013-12-01

    Full Text Available Since Martin Barnes’ so-called ‘iron triangle’ circa 1969, much debate has occurred over how best to describe the fundamental constraints that underpin project success. This paper develops a 3D project integration model for PMBOK® comprising core constraints of scope, cost, time and risk as a basis to propose six generic key performance indicators (KPIs that articulate successful project delivery. These KPIs are defined as value, efficiency, speed, innovation, complexity and impact and can each be measured objectively as ratios of the core constraints. An overall KPI (denoted as s3/ctr is also derived. The aim in this paper is to set out the case for such a model and to demonstrate how it can be employed to assess the performance of project teams in delivering successful outcomes at various stages in the project life cycle. As part of the model’s development, a new PMBOK® knowledge area concerning environmental management is advanced.

  7. Survival of patients identified as candidates for intestinal transplantation: a 3-year prospective follow-up

    DEFF Research Database (Denmark)

    Pironi, L.; Forbes, A.; Joly, F.

    2008-01-01

    BACKGROUND & AIMS: The US Medicare indications for intestinal transplantation are based on failure of home parenteral nutrition. The American Society of Transplantation also includes patients at high risk of death from their primary disease or with high morbidity intestinal failure. A 3-year...... prospective study evaluated the appropriateness of these indications. METHODS: Survival on home parenteral nutrition or after transplantation was analyzed in 153 (97 adult, 56 pediatric) candidates for transplantation and 320 (262 adult, 58 pediatric) noncandidates, enrolled through a European multicenter......%-100%), and 100% in parenteral nutrition failure, high-risk primary disease, and high-morbidity intestinal failure, respectively (P = .034). Fifteen candidates underwent transplantation. Six died, including all 3 of those who were in hospital, and 25% of those who were at home at time of transplantation (P = .086...

  8. Synthesis and Crystal Structure of a 3-Arylamino-3-Deoxy Sugar Derivative

    Institute of Scientific and Technical Information of China (English)

    JI Xiao-Ming; SUN He-Ping; MO Juan; LIU Hong-Min

    2006-01-01

    3-Deoxy-3-(p-fluorine-phenylamino)-l,2-O-isopropylidene-α-D-ribofuranose 3 was synthesized and characterized by IR, NMR and HRMS, and its crystal structure was determined by X-ray diffraction analysis. Crystal data for 3: monoclinic, space group P21, a = 7.0403(14), b =6.7780(4), c = 14.932(3) (A), β = 94.74(3)°, C14H18FNO4, Mr = 283.29, V= 710.1(2)(A)3, Z = 2, Dc =1.325 g/cm3, μ=0.105 mm-1, F(000)=300, the final R=0.0468 and wR=0.0926 for 1969observed reflections (I> 2σ(I)). Two intermolecular hydrogen bonds are observed. The absolute configuration of this molecule was confirmed by comparison with that of the original material.

  9. Construction of a $^3$He magnetic force microscope with a vector magnet

    CERN Document Server

    Yang, Jinho; Kim, Yun Won; Shin, Dongwoo; Jeong, Juyoung; Wulferding, Dirk; Yeom, Han Woong; Kim, Jeehoon

    2016-01-01

    We constructed a $^3$He magnetic force microscope operating at the base temperature of 300 mK under a vector magnetic field of 2-2-9 T in the $x-y-z$ direction. Fiber optic interferometry as a detection scheme is employed in which two home-built fiber walkers are used for the alignment between the cantilever and the optical fiber. The noise level of the laser interferometer is close to its thermodynamic limit. The capabilities of the sub-Kelvin and vector field are demonstrated by imaging the coexistence of magnetism and superconductivity in a ferromagnetic superconductor (ErNi$_2$B$_2$C) at $T$=500 mK and by probing a dipole shape of a single Abrikosov vortex with an in-plane tip magnetization.

  10. Nanoimprint of a 3D structure on an optical fiber for light wavefront manipulation

    Science.gov (United States)

    Calafiore, Giuseppe; Koshelev, Alexander; Allen, Frances I.; Dhuey, Scott; Sassolini, Simone; Wong, Edward; Lum, Paul; Munechika, Keiko; Cabrini, Stefano

    2016-09-01

    Integration of complex photonic structures onto optical fiber facets enables powerful platforms with unprecedented optical functionalities. Conventional nanofabrication technologies, however, do not permit viable integration of complex photonic devices onto optical fibers owing to their low throughput and high cost. In this paper we report the fabrication of a three-dimensional structure achieved by direct nanoimprint lithography on the facet of an optical fiber. Nanoimprint processes and tools were specifically developed to enable a high lithographic accuracy and coaxial alignment of the optical device with respect to the fiber core. To demonstrate the capability of this new approach, a 3D beam splitter has been designed, imprinted and optically characterized. Scanning electron microscopy and optical measurements confirmed the good lithographic capabilities of the proposed approach as well as the desired optical performance of the imprinted structure. The inexpensive solution presented here should enable advancements in areas such as integrated optics and sensing, achieving enhanced portability and versatility of fiber optic components.

  11. Development of a 3D CZT detector prototype for Laue Lens telescope

    DEFF Research Database (Denmark)

    Caroli, Ezio; Auricchio, Natalia; Del Sordo, Stefano

    2010-01-01

    in 4 horizontal strips for the reconstruction of the third interaction position coordinate. The 3D prototype will be made by packing 8 linear modules, each composed by one basic sensitive unit, bonded on a ceramic layer. The linear modules readout is provided by a custom front end electronics...... implementing a set of three RENA-3 for a total of 128 channels. The front-end electronics and the operating logics (in particular coincidence logics for polarisation measurements) are handled by a versatile and modular multi-parametric back end electronics developed using FPGA technology.......We report on the development of a 3D position sensitive prototype suitable as focal plane detector for Laue lens telescope. The basic sensitive unit is a drift strip detector based on a CZT crystal, (~19×8 mm2 area, 2.4 mm thick), irradiated transversally to the electric field direction. The anode...

  12. Muscle Contraction Induces Acute Hydroxymethylation of the Exercise-Responsive Gene Nr4a3

    DEFF Research Database (Denmark)

    Pattamaprapanont, Pattarawan; Garde, Christian; Fabre, Odile

    2016-01-01

    promoters. Exercise induces dynamic DNA demethylation at gene promoters; however, the contribution of the demethylation precursor hydroxymethylcytosine is unknown. Given the evanescent nature of hydroxymethylcytosine, a muscle contraction model that allows for the collection of samples that are repeatedly...... stimulated over time is required to determine whether contraction-induced demethylation is preceded by changes in the hydroxymethylcytosine level. Here, we established an acute skeletal muscle contraction model to mimic the effects of acute exercise on gene expression. We used this model to investigate...... the effect of muscle contraction on DNA demethylation and hydroxymethylation. First, we performed an acute exercise study in healthy humans to identify an exercise-responsive gene that we could study in culture. We identified the nuclear receptor subfamily 4 group A member 3 (Nr4a3) gene with the highest...

  13. Hemiconvulsion-hemiplegia-epilepsy syndrome. Magnetic resonance findings in a 3-year-old boy.

    Science.gov (United States)

    Salafia, Stefania; Praticò, Andrea D; Pizzo, Enza; Greco, Filippo; Di Bella, Domenico

    2013-01-01

    The term 'hemiconvulsion-hemiplegia-epilepsy syndrome' (HHE) was first used by Gastaut et al. to describe the se-quential combination of unilateral or predominantly unilateral clonic seizures (hemiconvulsion), occurring during the first 2 years of life, immediately followed by an ipsilateral flaccid hemiplegia lasting 7 or more days. In the following phase partial epileptic seizures occur. We report a case of HHE syndrome in a 3-year-old boy with partial seizures (hemiconvulsion lasting 15-30 minutes) followed by left hemiplegia and hyporeflexia. Magnetic resonance imaging showed diffuse and high signal hyperintensity of the whole right cerebral hemisphere. Diffusion-weighted images showed a reduction of the apparent diffusion coefficient in the subcortical region. Magnetic resonance arterio-graphy showed a narrow flow signal in the distal territory of the right middle cerebral artery. The authors emphasize the importance of neuroradiological findings in early diagnosis and in the follow-up of HHE syndrome.

  14. Phase variation in the phage growth limitation system of Streptomyces coelicolor A3(2).

    Science.gov (United States)

    Sumby, Paul; Smith, Margaret C M

    2003-08-01

    The phase-variable phage growth limitation (Pgl) system of Streptomyces coelicolor A3(2) is an unusual bacteriophage resistance mechanism that confers protection against the temperate phage phiC31 and homoimmune relatives. Pgl is subject to phase variation, and data presented here show that this is at least partially due to expansion and contraction of a polyguanine tract present within the putative adenine-specific DNA methyltransferase gene, pglX. Furthermore, the pglX paralogue SC6G9.02, here renamed pglS, was shown to be able to interfere with the Pgl phenotype, suggesting that PglS could provide an alternative activity to that conferred by PglX.

  15. KINEMATICS FEATURE ANALYSIS OF A 3-DOF COMPLIANT MECHANISM FOR MICRO MANIPULATION

    Institute of Scientific and Technical Information of China (English)

    Yu Jingjun; Hu Yida; Bi Shusheng; Zong Guanghua; Zhao Wei

    2004-01-01

    Kinematics and its related issues of a 3-DOF in-parallel compliant mechanism are focused on.The micro manipulation application that requires high accuracy is developed.Design of the developed micromanipulator is based on the modified Delta mechanism.The main advantages of this manipulator are the use of only revolute flexure hinges and the capability to produce pure translation theoretically.The aim is to develop an efficient kinematic model used for positioning control.For this purpose, the Jacobian matrix relating the end effector position with the actuator displacements is obtained by both theoretical derivation and experiment.Aiming at the abnormality in the motion capabilities of the micromanipulator found in calibration experiment, the mobility of the compliant mechanism on a theoretical level is analyzed by using the matrix method and screw theory.Both the experimental and theoretical results have verified that the compliant mechanism does have rotational motion.

  16. Stabilization of a (3,0) mobile robot by means of an event-triggered control.

    Science.gov (United States)

    Villarreal-Cervantes, Miguel G; Guerrero-Castellanos, J Fermi; Ramírez-Martínez, Soledad; Sánchez-Santana, J Pedro

    2015-09-01

    Event-triggered control (ETC) is a sampling strategy that updates the control value only when some events related to the state of the system occurs. It therefore relaxes the periodicity of control updates without deteriorating the closed-loop performance. This paper develops a nonlinear ETC for the stabilization of a (3,0) mobile robot. The construction of an event function and a feedback function is carried out based on the existence of a stabilizing control law and a Control Lyapunov Function (CLF). The event function is dependent on the time derivative of the CLF and the feedback function results from the extension of Sontag's formula, which ensures asymptotic stability, smoothness everywhere and continuity at the equilibrium. Experimental results, compared with a computed torque control, validate the theoretical analysis.

  17. A 3-month age difference profoundly alters the primary rat stromal vascular fraction phenotype

    DEFF Research Database (Denmark)

    Quaade, Marlene Louise; Jensen, Charlotte Harken; Andersen, Ditte Caroline;

    2016-01-01

    The stromal vascular fraction (SVF) is a heterogeneous population obtained from collagenase digestion of adipose tissue. When cultured the population becomes more homogeneous and the cells are then termed adipose stromal/stem cells (ASCs). Both the freshly isolated primary SVF population...... and the cultured ASC population possess regenerative abilities suggested to be mediated by paracrine mechanisms mainly. The use of ASCs and SVF cells, both in animal studies and human clinical studies, has dramatically increased during recent years. However, more knowledge regarding optimal donor characteristics...... such as age is demanded. Here we report that even a short age difference has an impact on the phenotype of primary SVF cells. We observed that a 3-month difference in relatively young adult rats affects the expression pattern of several mesenchymal stem cell markers in their primary SVF. The younger animals...

  18. Have you seen an A3 white artists folder containing an original storyboard?

    CERN Multimedia

    Ariane Koek

    2013-01-01

    Last seen in Room C, Main Building 61, first floor on  Tuesday 5 March 2013 at CERN at 12.00 a.m. on the Meyrin site - one A3 sized Artists porfolio - white ribbed transparent plastic. Contents include an original storyboard,  which is laid out like a cartoon series, depicting the adventures of a  dynamic girl wearing a breathing apparatus on the hunt for the Higgs at CERN. Please contact ariane.koek@cern.ch direct line +41 22  76 75246 with any information you might have regarding this portfolio - whether  you have seen it and/or most of all, found it or know where it is. The storyboard is original creative work and means a great deal to the artist.

  19. A 3-D Global History from a Glober Identity ina Noncentric and Holistic Perspective

    Institute of Scientific and Technical Information of China (English)

    2014-01-01

    In modern times, global and world history has been understood, writtenand taught from either a national perspective or a regional/cultural/ideological one in the light of centrism such as West/Eurocentrism eversince it was created. The author argues, in a noncentric and holisticperspective, that nationalized global or world histories are nothingbut distorting mirrors full of pride and prejudice. It is argued that bothobjective global history and subjective global history are contingentresultants in a certain special and temporal context. In the early 21stcentury, the author heralds a globalization of global history and "GlobalHistorians of All Countries Unite!" He also suggests that it is necessaryfor a global historian to develop a glober identity beyond her/hisnational identity and that a reasonable and intelligible global historywhich is closer to the objective global history should be a 3-D globalhistory of the glober, by the glober, for the glober.

  20. The relation between personality and anxiety: findings from a 3-year prospective study.

    Science.gov (United States)

    Gershuny, B S; Sher, K J

    1998-05-01

    The authors tested the extent to which the personality dimensions of neuroticism, extraversion, and psychoticism (H. J. Eysenck & S. B. G. Eysenck, 1975) prospectively predicted global anxiety (assessed by items from the Brief Symptom Inventory: L. R. Derogatis & M. S. Spencer, 1982). The authors also examined prospective relations among these personality dimensions and depression to evaluate the specificity of findings. Participants were 466 young adults, primarily undergraduate students, assessed twice over a 3-year interval. An interaction between neuroticism and extraversion predicted both global anxiety and depression 3 years later. Findings indicated that personality, in particular the combination of high neuroticism and low extraversion, may play an important predisposing, etiological role in anxiety. Interpretations and implications of the predictive importance of the Neuroticism x Extraversion interaction in anxiety are discussed, and further speculations about the relation between anxiety and depression are put forth.