WorldWideScience

Sample records for anticoagulantes disolventes aines

  1. Anticoagulantes e bloqueios espinhais

    OpenAIRE

    Chaves, Itagyba Martins Miranda; Chaves, Leandro Fellet Miranda

    2001-01-01

    JUSTIFICATIVA E OBJETIVOS: Com o uso de anticoagulantes para tromboprofilaxia, a incidência de hematomas em anestesias espinhais aumentou. O objetivo desta revisão é verificar a ocorrência de casos de hematomas espinhais e sua correlação com o uso de drogas utilizadas na tromboprofilaxia. CONTEÚDO: São feitas algumas considerações clínicas e farmacológicas sobre as drogas utilizadas em tromboprofilaxia (cumarínicos, aspirina e heparina). São ressaltados os fatores de risco, particularmente ao...

  2. Anticoagulantes e bloqueios espinhais

    Directory of Open Access Journals (Sweden)

    Itagyba Martins Miranda Chaves

    2001-06-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Com o uso de anticoagulantes para tromboprofilaxia, a incidência de hematomas em anestesias espinhais aumentou. O objetivo desta revisão é verificar a ocorrência de casos de hematomas espinhais e sua correlação com o uso de drogas utilizadas na tromboprofilaxia. CONTEÚDO: São feitas algumas considerações clínicas e farmacológicas sobre as drogas utilizadas em tromboprofilaxia (cumarínicos, aspirina e heparina. São ressaltados os fatores de risco, particularmente aos relatos de casos de pacientes que desenvolveram hematoma peridural decorrente do uso simultâneo de heparina de baixo peso molecular e anestesia peridural. CONCLUSÕES: Existe importante associação entre hematoma peridural e distúrbios hemorrágicos, principalmente em pacientes em tratamento com anticoagulantes. O reconhecimento do aumento do risco da associação da anestesia peridural, da anestesia subaracnóidea, a continuada vigilância e a educação são fundamentais para evitar futuros casos.

  3. VALORES DO RNI DE PACIENTES SUBMETIDOS AO TRATAMENTO COM ANTICOAGULANTES

    Directory of Open Access Journals (Sweden)

    Simone Aparecida Matos de SOUZA

    2015-12-01

    Full Text Available Uma pesquisa exploratória de natureza qualitativa e quantitativa foi realizada durante o período de maio a agosto de 2013 no Laboratório de Análises Clínicas do Hospital das Clínicas localizado no município de Itaperuna, RJ. O objetivo foi analisar o perfil dos pacientes sob tratamento com anticoagulantes, demonstrando as potenciais variações nos valores da Relação Normalizada Internacional (RNI em comparação aos valores de referência bem como a frequência de realização de tais exames. Um questionário foi aplicado pouco antes da coleta do sangue, estabelecendo-se como critério de inclusão o uso de medicamentos anticoagulantes. Os resultados indicaram um total de 45 pacientes sob tratamento com anticoagulantes, sendo 32 do sexo feminino e 13 do sexo masculino. A maioria dos pacientes encontrava-se sob tratamento com o anticoagulante de uso oral varfarina e se encontrava com idade superior a 50 anos. O valor médio do RNI apresentou-se dentro dos limites considerados seguros, porém mais da metade dos pacientes apresentou RNI < 2,0 e a maioria dos pacientes sob tratamento com anticoagulantes não realiza a avaliação do RNI com frequência.

  4. Extraccion de aceite de coco a partir de la copra por medio de disolventes quimicos

    OpenAIRE

    J. Rosario Rivera Hernández; Juana María Lomelí Soto; Lorena Román Salinas; Francisco Vera Figueroa

    2001-01-01

    Acetato de Etilo, alcohol Isopropílico, Hexano, Tetracloruro de carbono y xileno, fueron usados como disolventes para extraer de la copra aceite de coco. Se aplicaron dos procedimientos de extracción sólido-líquido a la temperatura de ebullición de los disolventes, así mismo se efectuaron tres corridas de extracción a tiempos de 1.0, 1.5 y 2.0 hrs. los resultados de las extracciones aparecen en las tablas 1 y 2.

  5. Indicaciones y control de la medicación anticoagulante

    Directory of Open Access Journals (Sweden)

    Armando Solano Puerto

    1954-09-01

    Full Text Available Considero importante el tratar de hacer un balance de nuestros conocimientos actuales en materia de medicación anticoagulante. En primer lugar, porque los avances realizados en estos últimos años, debidos en buena parte a la labor de investigadores canadienses y franceses, han llevado a un alto grado de perfeccionamiento la terapéutica, tanto preveritiva como curativa, de trombosis arteriales y venosas.

  6. Propiedades oxido-reductoras del agua y dependencia de los potenciales redox de este disolvente frente al valor del pH

    OpenAIRE

    Milla González, Miguel

    2017-01-01

    El agua se comporta como anfótero en equilibrios redox. Se estudian los procesos redox de este disolvente y se representan los valores de los potenciales en función del pH. Los límites de estabilidad del agua determinan la estabilidad de las especies oxidantes y reductoras en el seno de este disolvente.

  7. Pautas de conducta frente a los pacientes bajo tratamiento anticoagulante en la clínica dental.

    OpenAIRE

    Bueno Lafuente, Susana; Berini Aytés, Leonardo; Gay Escoda, Cosme

    1996-01-01

    Nuestro trabajo pretende dar unas ideas básicas para el manejo de pacientes sometidos a tratamiento anticoagulante dando a conocer las posibles pautas a seguir respecto a su medicación: mantener intacta la terapia anticoagulante, modificar la terapia anticoagulante o realizar tratamiento combinado de heparina con anticoagulantes orales. La decisión deberá tomarse conjuntamente con el hematólogo responsable del paciente valorando cada caso según la morbilidad intrínseca de la intervención, el ...

  8. Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar

  9. NUEVOS ANTICOAGULANTES ORALES EN FIBRILACIÓN AURICULAR

    Directory of Open Access Journals (Sweden)

    Dra. E. Marianella Seguel R.

    2015-03-01

    Full Text Available La fibrilación auricular es la arritmia más frecuente y se relaciona con una alta tasa de accidente cerebrovascular y embolia sistécmica. La terapia establecida tanto para prevención primaria como secundaria es la anticoagulación con warfarina, antagonista de la vitamina K. Existen escalas que predicen el riesgo tromboembólico y la probabilidad de beneficiarse de terapia antitrombótica. El CHADS2 ha sido la más simple y ampliamente utilizada, pero actualmente el CHA2DS2-VASc ha incorporado otros factores de riesgo, otorgando una mejor estratificación. El estrecho margen terapécutico de la warfarina y la interacción con fármacos y alimentos requiere controles seriados de la intensidad de la anticoagulación, limitando su uso clínico. Han aparecido nuevos anticoagulantes que ofrecen ventajas sobre los antagonistas de vitamina K. Estos actúan en dos sitios distintos de la cascada de la coagulación: inhibiendo directamente la trombina como el dabigatran, o el factor X activado como el rivaroxaban, apixaban, edoxaban y betrixaban. Estos nuevos fármacos han ido reemplazando a la warfarina y ya están incluidos en las guías de manejo de fibrilación auricular no valvular.

  10. Terapia anticoagulante en fibrilación auricular

    Directory of Open Access Journals (Sweden)

    Sebastián Prieto

    2011-06-01

    Full Text Available La fibrilación auricular es la taquiarritmia cardíaca más frecuente. Su incidencia aumenta con la edad, presentándose en un 1.5% entre los 50 a 59 años, y en un 8-10% entre los 80 a 89 años. Esta arritmia incrementa en cinco veces el riesgo de sufrir un evento cerebrovascular isquémico cardioembólico y causa el 15% de todos los accidentes cerebrovasculares isquémicos. Su manejo se enfoca en la prevención de los fenómenos tromboembólicos y el control de la frecuencia y ritmo cardíaco. El tratamiento anticoagulante ha demostrado ser la principal herramienta en la prevención de eventos cardioembólicos. Aunque las complicaciones hemorrágicas por el tratamiento son esperables y aumentan con la edad, el beneficio de usar anticoagulación sobrepasa por mucho al riesgo de sangrado. Precisamente debido a la heterogeneidad clínica de esta arritmia y a la dificultad de establecer un tratamiento adecuado para cada caso en particular, el American College of Cardiology, la American Heart Association, la European Society of Cardiology y el American College of Chest Physicians han establecido guías para mejorar el tratamiento de estos pacientes. La revisión de esta enfermedad y de las directrices propuestas puede facilitar y mejorar notablemente el tratamiento de los pacientes con fibrilación auricular.

  11. Uso de los anticoagulantes orales directos en la práctica clínica

    Directory of Open Access Journals (Sweden)

    Rubén Guillermo Jaramillo Salamanca

    2016-04-01

    Full Text Available Los anticoagulantes orales directos surgieron en respuesta a la búsqueda de un anticoagulante ideal después de que la warfarina fuera por mucho tiempo el único disponible. Los inhibidores del factor X activado —rivaroxabán y apixabán— y el inhibidor de trombina —dabigatrán etexilato— ya están aprobados en Colombia. Estos grupos farmacológicos están indicados en la tromboprofilaxis luego de artroplastia de rodilla y cadera, en la prevención del accidente cerebrovascular y el embolismo sistémico en pacientes con fibrilación auricular no valvular y en el tratamiento del tromboembolismo venoso. La aprobación de los inhibidores se dio luego de mostrar eficacia y seguridad al compararse con warfarina y enoxaparina. Entre las ventajas que estos presentan figuran las siguientes: inicio rápido de acción, efecto predecible, poca variabilidad interindividual que elimina la necesidad de la monitorización frecuente y menos interacciones medicamentosas; pero, al igual que en la warfarina, el sangrado es el principal evento adverso.   El objetivo de esta revisión es conocer la farmacología de los anticoagulantes orales directos aprobados en Colombia, los resultados de los ensayos clínicos que respaldan su uso, la dosificación, el uso perioperatorio y el cambio entre anticoagulantes; situaciones que plantean particularidades para cada uno.

  12. Comparación de disolventes para la extracción de materias grasas en hígado

    Directory of Open Access Journals (Sweden)

    Carril González-Barros, S. T.

    1996-10-01

    Full Text Available The efficiency of different organic solvents for extraction the fat of pork and veal liver were compared. Soxhlet extraction for 8 hours with n-Hexane: dichloromethane (1:1 was selected. Cv% was 1.9%.

    Se compara la eficacia de extracción de la materia grasa con diferentes disolventes en hígado de cerdo y de ternera. Los resultados más satisfactorios se obtuvieron utilizando un soxhlet con una mezcla de hexano: diclorometano (50:50 durante 8 horas. Se obtuvo un Cv% de 1.9%.

  13. Degradación de disolventes orgánicos de uso industrial en un reactor anaerobio de lecho expandido

    OpenAIRE

    Lafita Lopez, Carlos

    2016-01-01

    La contaminación atmosférica constituye actualmente una seria amenaza para el medio ambiente y la salud. En este sentido, las emisiones de compuestos orgánicos volátiles (COV) pueden contribuir de forma importante a la contaminación atmosférica. Una gran parte de estos compuestos se emiten en procesos productivos en los que se utilizan disolventes, de forma que las industrias que realizan estas actividades han de reducir su emisión hasta los límites establecidos en la legislación mediante cam...

  14. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  15. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2004-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  16. Overexploitation and cumulative drought trend effect on Ras El Ain ...

    Indian Academy of Sciences (India)

    Boulos Abou Zakhem

    2017-10-06

    Oct 6, 2017 ... The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring ...

  17. Nuevos anticoagulantes orales en pacientes con enfermedad renal crónica

    Directory of Open Access Journals (Sweden)

    Lara Belmar Vega

    2017-05-01

    Full Text Available Los pacientes con enfermedad renal crónica (ERC tienen tendencias hemorrágicas y trombóticas, por lo que la indicación de anticoagulación ante la aparición de fibrilación auricular (FA es compleja. La FA es la arritmia cardíaca crónica más frecuente, siendo el tromboembolismo y el ictus isquémico en particular las complicaciones más importantes. En los últimos años se han desarrollado nuevos fármacos anticoagulantes orales que han mostrado superioridad respecto a los clásicos antagonistas de la vitamina K (AVK en la prevención de ictus, embolismo sistémico y riesgo de sangrado, constituyendo una alternativa eficaz a ellos.

  18. Consideraciones prácticas para el uso de los nuevos anticoagulantes orales

    Directory of Open Access Journals (Sweden)

    Julián M. Aristizábal, MD

    2012-05-01

    Full Text Available A pesar de la eficacia comprobada acerca del uso de warfarina como terapia anticoagulante, las múltiples interacciones, el estrecho margen terapéutico y la necesidad de monitorización seriada han planteado el escenario para el desarrollo de nuevos medicamentos como dabigatran, rivaroxaban y apixaban que ofrecen nuevas alternativas para el tratamiento del paciente anticoagulado. El conocimiento de las características farmacológicas y farmacocinéticas así como el contexto específico en el cual pueden usarse se convierten en una necesidad para los médicos que se enfrentan a este tipo de pacientes.

  19. Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk

    Index Scriptorium Estoniae

    Kaalep, Heiki-Jaan, 1962-

    2008-01-01

    Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel

  20. Baudelaire Eestis : märkmeid. II / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orasest eesti luuletõlkekultuuri arendamisel. Ka Baudelaire'i luuletuse Bénédiction ("Õnnistus") kahe esimese stroofi kolm tõlget eesti keelde: Johannes Semperi, Indrek Hirve ja Ain Kaalepi versioonid

  1. Baudelaire Eestis : märkmeid. II / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2002-01-01

    Ants Orase aleksandriini tõlkepõhimõtetest. Ch. Baudelaire'i luuletuse Bénédiction ("Õnnistus") kahe esimese stroofi kolm tõlget eesti keelde - Johannes Semperi, Indrek Hirve ja Ain Kaalepi eestindused

  2. Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina

    Index Scriptorium Estoniae

    Seppik, Ain, 1952-

    2007-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku

  3. Hemodiálisis para remover el anticoagulante dabigatrán en situaciones de urgencia

    Directory of Open Access Journals (Sweden)

    Aldo Carrizo

    2014-04-01

    Full Text Available El dabigatrán es un nuevo inhibidor directo de la trombina, de administración oral, empleado para la prevención de eventos tromboembólicos en pacientes con fibrilación auricular no valvular. A diferencia de la warfarina, no se dispone de un antídoto conocido. La hemodiálisis ha sido sugerida como un método para remover el dabigatrán y reducir el efecto anticoagulante. Se presenta el caso de un paciente con antecedente de fibrilación auricular y medicado con dabigatrán, que fue admitido en el hospital para una cirugía abdominal de urgencia. A las seis horas de la última dosis recibida, los estudios de coagulación mostraban alteración. Ante la falta de antídoto para revertir los efectos, se decidió realizar hemodiálisis. Luego de tres horas de diálisis los parámetros de coagulación tendieron a normalizarse y el paciente fue operado sin presentar hemorragias anormales durante la cirugía o en el postoperatorio.

  4. Extracción de cromo con disolventes orgánicos. I parte. Extracción con DEHPA

    Directory of Open Access Journals (Sweden)

    de Juan, D.

    1998-06-01

    Full Text Available Chromium and its compounds give toxic and/or hazardous characteristics to all those industrial wastes, solids or liquids, that contain them. Organic solvent extraction is a technique that allows the recovery of chromium contained in these residues. In this work the extraction of Cr(III from aqueous solutions with solutions of a cationic reactive (DEHPA in kerosene is studied. In the same way the stripping process was studied. It has been found that Cr(III and DEHPA react in a 1/1 molar ratio, being the extraction kinetics very fast. Final aqueous phase final pH influence extraction yield, so that it is necessary to work with pH values between 3 and 4. It must be added a modifier (isodecanol to the organic phase to avoid the formation of a third phase in the stripping process. The concentration of isodecanol has to be higher than 15 %, so the organic phase used was a solution of 12.5 % v/v DEHPA in kerosene and 20 % v/v isodecanol. The stripping process is slow and must be carried out in an oxidant alkalyne medium, thus an aqueous solution of NaOH and H2O2 was used. An increase in the concentration of NaOH and H2O2 leads to an increase in the stripping yield initially, and becomes stable when concentrations of NaOH and H2O2 used are higher than 0.45 N and 4 % v/v respectively.

    El cromo y sus compuestos confieren un carácter tóxico y/o peligroso a los residuos industriales, sólidos o líquidos, que los contienen. Una técnica que permite recuperar el cromo existente en estas sustancias es la extracción con disolventes orgánicos. En el presente trabajo se estudia la extracción del Cr(III presente en disoluciones acuosas con disoluciones de un reactivo de carácter catiónico (DEHPA en queroseno. Igualmente se estudia el proceso de reextracción. Se ha encontrado que el Cr(III y el DEHPA reaccionan mol a mol, siendo la cinética de extracción muy rápida. El pH final de

  5. Novos anticoagulantes orais no tromboembolismo venoso e fibrilhação auricular New oral anticoagulants in the treatment of venous thromboembolism and atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Luís Silvestre

    2012-03-01

    Full Text Available Os antagonistas da vitamina K foram, durante mais de 50 anos, os únicos anticoagulantes orais disponiveis. A imprevisibilidade da farmacocinética e farmacodinâmica desta classe de fármacos, responsável pela dificuldade na sua utilização, conduziu à necessidade do desenvolvimento de novas moléculas anticoagulantes. Estão actualmente diponíveis os resultados dos estudos de novos anticoagulantes orais no tromboembolismo venoso e na fibrilhação auricular, que se revêem neste trabalho.For more than 50 years, vitamin K antagonists were the only oral anticoagulants available. The unpredictability of its pharmacokinetics and pharmacodynamics, responsible for its difficult clinical management, has raised the need of new anticoagulants. Results of trials involving the new anticoagulants in venous thromboembolism and atrial fibrillation are now available and reviewed in this paper.

  6. Novos anticoagulantes em cuidados intensivos New anticoagulants in critical care settings

    Directory of Open Access Journals (Sweden)

    Uri Adrian Prync Flato

    2011-03-01

    Full Text Available Eventos tromboembólicos são complicações comuns em pacientes críticos. Podem apresentar sinais e sintomas pouco específicos e estão associados a um substancial aumento na morbimortalidade dos pacientes internados em unidades de terapia intensiva. Os agentes antitrombóticos são o pilar no tratamento e prevenção do tromboembolismo. Esta classe é também utilizada na prevenção do acidente vascular encefálico, na fibrilação atrial, na prevenção de eventos embólicos da insuficiência cardíaca, em pacientes com próteses valvares e têm sido associados a antiplaquetários na prevenção secundária da síndrome coronária aguda. Agentes antitrombóticos, como aspirina, clopidogrel, antagonistas da vitamina K e foundaparinux (inibidor indireto do fator Xa já foram incorporados na prática clínica rotineira dos serviços de terapia intensiva. Recentemente, tem-se demonstrado grande interesse nos agentes que inibem seletivamente o fator Xa e a trombina. Estes apresentam estrutura molecular pequena e inibem simultaneamente o fator da coagulação livre no plasma e ligado ao trombo. Entre os novos anticoagulantes orais, dabigatran, rivaroxaban e apixaban são os que apresentam estudos clínicos em fases mais avançadas e uso na prática clínica já licenciado em alguns países. O objetivo desta revisão é salientar os principais estudos da literatura sobre novos anticoagulantes no cenário das unidades de terapia intensivaThromboembolic events commonly occur in critically ill patients, and although they do not consistently present with specific signs and symptoms, they are associated with high morbity and mortality. Antithrombotic agents are the mainstay of the prevention and treatment of venous thromboembolism, and they are also used for stroke prevention in atrial fibrillation, embolism prevention in heart failure, and anticoagulation of prosthetic valves. These drugs have been combined with antiplatelet therapy for the

  7. Profilaxis de la úlcera gastrointestinal producida por AINES

    Directory of Open Access Journals (Sweden)

    Carlos Bustamante Rojas

    1998-04-01

    Full Text Available Como grupo, los AINES son los fármacos más frecuentemente  relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por  prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.

  8. Nuevos anticoagulantes orales en fibrilación auricular no valvular

    Directory of Open Access Journals (Sweden)

    Andrés F. Buitrago, MD

    2012-07-01

    Full Text Available La fibrilación auricular es la arritmia cardiaca sostenida más común y su prevalencia se duplica cada decenio por encima de los cincuenta años. Entretanto, las condiciones clínicas que más se asocian con ésta son la hipertensión arterial, la insuficiencia cardíaca, la enfermedad valvular cardíaca y la diabetes mellitus. Como complicaciones está la falla cardiaca, pero tal vez una de las peores son los eventos cardioembólicos, que ocurren aproximadamente en 4,5% de los pacientes no anticoagulados. El tratamiento antitrombótico con antagonistas de la vitamina K fue, durante más de cincuenta años, la única alternativa disponible, a pesar de sus múltiples limitaciones, las mismas que llevaron al desarrollo de nuevos fármacos anticoagulantes que disminuyen muchos de los problemas de los antagonistas de la vitamina K. Pueden agruparse en dos clases: inhibidores orales directos de la trombina e inhibidores orales del factor X activado. Tanto dabigatrán, rivaroxabán como apixabán, cuentan ya con estudios clínicos controlados aleatorizados que apoyan su uso en el tratamiento antitrombótico de la fibrilación auricular y recientemente se incluyeron en las guías basadas en la evidencia como alternativa (ACC e incluso con un grado de recomendación superior (CCS, CHEST al de los antagonistas de la vitamina K.

  9. Prevalence of vancomycin-resistant entercocci at Ain Shams ...

    African Journals Online (AJOL)

    Prevalence of vancomycin-resistant entercocci at Ain Shams University Hospital. ATA Rahman, SMI Zaki, AGEA Ghany, AM Aboul-Fotouh. Abstract. No Abstract. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/ejmls.v9i2.46810 · AJOL African ...

  10. Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

    Index Scriptorium Estoniae

    Padrik, Ain, 1947-

    2001-01-01

    Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

  11. Overexploitation and cumulative drought trend effect on Ras El Ain ...

    Indian Academy of Sciences (India)

    The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. ... Accordingly, it requires the development of sustainable water resources management program to reduce long-term drought risks, restore the groundwater reservoir and minimize the overexploitation effects on ...

  12. Efecto de inclusión de anticoagulantes durante el beneficio de Hevea brasiliensis (Willd. ex A.Juss. Müll.Arg.

    Directory of Open Access Journals (Sweden)

    Lina Paola Mendoza Vargas

    2018-01-01

    Full Text Available Se evaluó el efecto de un agente anticoagulante del látex en el árbol de caucho (Hevea brasiliensis. Se caracterizó el contenido de solidos totales (TSC y contenido de caucho seco (DRC del látex, se evaluaron cuatro tratamientos de anticoagulantes en campo: (T1 amoniaco, (T2 bórax, (T3 amoniaco-bórax y (T0 sin anticoagulante. En las láminas se evaluaron cinco diluciones (v/v de látex en agua D1 (100 %, D2 (75 %, D3 (50 %, D4 (25 % y D5 (0 %, a estas se hicieron pruebas de tensión, compresión y espesor. El látex caracterizado obtuvo TSC (37.1 %+0.27, DRC (34.3 %+0.19. Encontrándose en T3D1 mayor resistencia de tensión hasta punto de ruptura de 13.37 KgF, compresión de 5 KgF, y menor espesor de 1.52 mm, sin diferencia significativa entre los tratamientos T3 y T2 y las diluciones D1 a D2, posibilitando reducir el consumo de agua (25 %, y la producción de ripio (38 % con anticoagulantes, sin afectar negativamente sus propiedades mecánicas.

  13. Hemorragia por dicumarínicos: Incidencia, factores de riesgo y comparación con los nuevos anticoagulantes orales

    Directory of Open Access Journals (Sweden)

    Jorge Korin

    2012-10-01

    Full Text Available La hemorragia es la complicación principal de los anticoagulantes orales, dicumarínicos o los nuevos agentes anti-Factor Xa y antitrombínicos. Se analizan los distintos factores de riesgo asociados a sangrado con los agentes clásicos y su vinculación probable con los nuevos fármacos. Se compara la incidencia de sangrado mayor en fibrilación auricular y en tromboembolismo venoso por ambos grupos de antitrombóticos. Además de las propiedades intrínsecas de los agentes clásicos y de los nuevos, serán las características de los pacientes y el correcto empleo terapéutico, los factores que impacten en la incidencia de sangrado en su uso diario, más allá de los datos publicados en los estudios clínicos.

  14. Turism on/ei ole eksport?! / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2008-01-01

    Autor tõdeb, et riik ei soovi tunnistada turismi kui eksportiva sektori olulisust Eesti majanduses. Turismisektori konkurentsivõimele mõjuks pärssivalt majutusteenuste käibemaksu määra tõstmine, mida märkis oma kirjas Riigikogule ja valitsusele ka Eesti Hotellide ja Restoranide Liit. Vt. ka: Ain Hinsberg. Tunnustuseta kuuendik Eesti majandusest riigiga ümarlaua taga. Ärielu (2000) juuli, nr. 7-8, lk. 77-79

  15. Variabilidad en los controles de la terapia anticoagulante oral entre atención primaria y hospital en Albacete (2009

    Directory of Open Access Journals (Sweden)

    Juan Miguel Armero Simarro

    2011-01-01

    Full Text Available Fundamento, Tras asumir el control de la terapia anticoagulante oral en nuestro centro de salud surgió la necesidad de detectar posibles diferencias con respecto al seguimiento hospitalario. El objetivo de nuestro trabajo fue conocer la variabilidad en los valores del Cociente Normalizado Internacional (INR de los pacientes en tratamiento anticoagulante oral (TAO, y su posible relación con el control en centro de salud u hospital. Métodos, Se analizaron los 6 últimos controles de 291 pacientes de un centro de salud urbano en control rutinario por TAO. A fin de analizar su variabilidad, se ha calculado la desviación estándar (DE de los logaritmos neperianos (ln de los valores de INR, comparando por medio del test t de Student la media de las mismas entre aquellos pacientes cuyo tratamiento había sido pautado por profesionales del centro de salud y aquellos pautados en unas ocasiones por éstos y en otras en hospital. Se comparó asimismo la proporción de controles dentro de rango en cada grupo (chi2. Resultados, Eran mujeres 153 (52,6% de los pacientes, y la media de edad era 73,8 años (DE, 11,3. Se han analizado un total de 1.710 controles de INR, de los que 1.412 han sido validados por médicos de familia y 298 por hematólogos, sin que existieran diferencias significativas en los valores de INR analizados por unos y otros. Los pacientes cuyo tratamiento había sido pautado siempre por profesionales del centro de salud presentaron unos valores medios de DE de los ln de los INR de los 6 controles analizados significativamente inferior (p<0,0001 al de aquellos que habían llevado un control mixto. Asimismo, presentaban una mayor proporción de controles dentro de rango (un 68,0% vs 38,6%, p<0,0001. Conclusiones, Los pacientes que son seguidos exclusivamente por los profesionales del centro de salud presentan una menor variabilidad y más adecuados controles de INR que aquellos con un control mixto centro de salud/hospital.

  16. Compuestos orgánicos volátiles (COVs) en la industria de pinturas y sus disolventes en Perú – análisis de caso y estrategias de gestión ambiental y salud ocupacional

    OpenAIRE

    Riveros Alcedo, Renato Gonzalo

    2017-01-01

    Los compuestos orgánicos volátiles (COVs) son sustancias suficientemente volátiles para existir en forma de vapores en la atmósfera en condiciones normales de temperatura y presión. Sustancias con estas características son utilizadas como insumos en industrias manufactureras y, en particular, para la fabricación de diversos tipos de pinturas, barnices y disolventes industriales. Está demostrado que estas sustancias causan smog fotoquímico, al ser precursores del ozono troposfér...

  17. La recuperación de cobre mediante lixiviación-extracción con disolventes-electrólisis: hacia el siglo XXI

    Directory of Open Access Journals (Sweden)

    Alguacil, F. J.

    1998-12-01

    Full Text Available The obtaining of copper from primary resources by solvent extraction has been developed continuously over the past 25-30 years, entailing a continuous effort both of research and development and being one of the biggest successes in the industrial development of a given metal. The success of this operation was not possible without the corresponding developments, at the same time, of the two accompanying operations (leaching and electrowinning, which perfectly coupled in the operational sequence. The recovery of copper by means of these hydrometallurgical processes is firmly established and being reflecting in the growing number of operational plants under construction and/or commisioned until the beginning of the XXI century. This work presents data on the succesfully application of the sequence of operations on the recovery of a metal: copper.

    La obtención de cobre de recursos primarios mediante extracción con disolventes se ha venido desarrollando de forma continua durante los últimos 25-30 años, lo que ha supuesto un esfuerzo continuado, tanto de investigación como de puesta en práctica de los resultados obtenidos de esta investigación básica, y siendo uno de los mayores éxitos en el desarrollo de la industria de un metal. El éxito de esta operación no hubiera sido posible sin que a su vez las dos operaciones que la acompañan (lixiviación y electrólisis, con sus propias innovaciones, permitiesen su perfecto acoplamiento en la secuencia operacional. La recuperación de cobre mediante estos procesos hidrometalúrgicos está firmemente establecida y el hecho de su importancia es el número creciente de plantas construidas o que se van a construir hasta el comienzo del siglo XXI. En el presente trabajo se presentan datos sobre la aplicación de esta secuencia de operaciones en la recuperación de un metal: el cobre.

  18. NiAl-Base Composite Containing High Volume Fraction of AIN Particulate for Advanced Engines

    Science.gov (United States)

    Hebsur, Mohan G.; Whittenberger, J. D.; Lowell, C. E.; Garg, A.

    1995-01-01

    Cryomilling of prealloyed NiAl containing 53 at. % AJ was carried out to achieve high nitrogen levels. The consolidation of cryomilled powder by extrusion or hot pressing/ hot isostatic pressing resulted in a fully dense NiAl-base composite containing 30 vol. % of inhomogeneously distributed, nanosized AIN particulate. The NiAl-30AIN composite exhibited the highest compression yield strengths at all temperatures between 300 and 1300 K as compared with other compositions of NiAl-AIN composite. The NiAl-30AIN specimens tested under compressive creep loading between 1300 and 1500 K also exhibited the highest creep resistance with very little surface oxidation indicating also their superior elevated temperature oxidation resistance. In the high stress exponent regime, the strength is proportional to the square root of the AIN content and in the low stress exponent regime, the influence of AIN content on strength appears to be less dramatic. The specific creep strength of this material at 1300 K is superior to a first generation Ni-base single crystal superalloy. The improvements in elevated temperature creep strength and oxidation resistance have been achieved without sacrificing the room temperature fracture toughness of the NiAl-base material. Based on its attractive combination of properties, the NiAl-30AIN composite is a potential candidate for advanced engine applications,

  19. Pancreatite aguda devida a hematoma intramural do duodeno por uso de anticoagulante Acute pancreatitis due to intramural hematoma of the duodenum by use of anticoagulant therapy

    Directory of Open Access Journals (Sweden)

    Samer FARHOUD

    2001-01-01

    Full Text Available Racional - A hemorragia intramural espontânea do duodeno causada por complicações da terapêutica anticoagulante é rara e seu tratamento controverso. Objetivo -- Apresentar a experiência advinda do tratamento de doente com essa condição clínica. Relato do caso - Expõe-se o caso de uma mulher de 71 anos de idade, que há 3 meses fazia uso de anticoagulante oral para tratamento de trombose venosa profunda dos membros inferiores. Apresentou-se com cefaléia e dores abdominais intensas no andar superior do abdome, associadas a náuseas e vômitos. Os exames laboratoriais e de imagem comprovaram o diagnóstico de surto agudo de pancreatite, decorrente de hematoma intramural de duodeno. Os valores de protrombina (49,7 s e o sangramento de tecidos moles cervicais e urinário, sugeriam complicação da terapêutica anticoagulante. Resultados - A terapêutica conservadora foi efetiva, tendo a doente recebido alta, assintomática, no 10º dia de internação. Conclusão - É recomendado o emprego do anticoagulante em doses menores nos doentes de risco e adequado controle dos parâmetros da coagulação. Acredita-se ser ideal a conduta conservadora e recomenda-se a cirurgia somente nos casos que evoluem com complicações.Background - Spontaneous intramural hemorrhage of the duodenum due to anticoagulant therapy is rare and the treatment is controversial. Objective - To present the acquired knowledge with the treatment of these disease. Case report - A 71-year-old women receiving for a 3 month period an anticoagulant therapy presented cervical bleeding of soft tissues and symptoms of acute pancreatitis and high small bowel obstruction. Early noninvasive diagnosis by computed tomographic scan was possible and conservative therapy proved successful in complete resolution of the pancreatitis and obstructive symptoms, with resumption of oral intake in the fourth day of treatment. The frequency of bleeding in high risk patients during warfarin therapy

  20. Características clínicas, manejo y pronóstico de las hemorragias cerebrales asociadas al tratamiento con anticoagulantes orales

    OpenAIRE

    Huertas González, Nuria

    2014-01-01

    Las hemorragias intracraneales (HIC) son una complicación grave del tratamiento anticoagulante con antagonistas de la vitamina K (AVK). Las guías terapéuticas recomiendan la administración de fármacos que reviertan el grado de anticoagulación medido por el valor de INR (International Normalized Ratio), en un intento de evitar el crecimiento del hematoma, favorecido por la alteración de la coagulación. Sin embargo, no existen datos sólidos en la literatura que confirmen que este tratamiento me...

  1. Hemorragias intracraneales de carácter evitable asociadas a anticoagulantes orales en pacientes con fibrilación auricular Avoidable intracranial hemorrhages associated with oral anticoagulants in patients with atrial fibrillation

    OpenAIRE

    A. García Luque; J. Torello Iserte; J.R. Castillo Ferrando

    2011-01-01

    Introducción y objetivo: El aumento de la prescripción de anticoagulantes orales ha provocado un aumento de hemorragias intracraneales, la reacción adversa más grave asociada a este grupo farmacológico. El objetivo del estudio es evaluar el carácter evitable de hemorragias intracraneales asociada a anticoagulantes orales que causan ingreso hospitalario en pacientes con fibrilación auricular. Método: Supervisión de las historias clínicas de los pacientes que ingresaron en los Hospitales Univer...

  2. Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

    Index Scriptorium Estoniae

    Pukk, Tiia

    2011-01-01

    1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

  3. Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2007-01-01

    Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

  4. Läti firma seljatas esimeses astmes Gildi / Anne Oja ; kommenteerinud Ain Kalme

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2009-01-01

    Harju maakohtu otsusest, millega kohustati Gild Financial Advisory Servicest võimaldama Latvias Naftas Tranzitsit tutvuda 15 miljoni dollarilise ülekande aluseks olnud dokumentidega. Kommenteerib advokaadibüroo LEXTAL vandeadvokaat Ain Kalme

  5. Nuevos anticoagulantes orales en la prevención de fenómenos tromboembólicos en la fibrilación auricular no valvular

    Directory of Open Access Journals (Sweden)

    José Manuel Sosa Rosado

    2013-04-01

    Full Text Available La fibrilación auricular es la arritmia cardiaca más frecuente en la práctica clínica. El valor de la anticoagulación con antagonistas de la vitamina K -como la warfarina-en la prevención de los fenómenos embólicos está ampliamente demostrada, pero también su difícil manejo por las conocidas interacciones con otros fármacos e incluso los alimentos. En la búsqueda del anticoagulante ideal, en los últimos años han aparecido nuevos agentes antitrombóticos y otros se encuentran en fases avanzadas de investigación. En la presente revisión, se describe los resultados del desarrollo de los nuevos agentes anticoagulantes y sus expectativas, oportunidades y desafíos, que enfrentarán estos nuevos agentes, los inhibidores directos de la trombina y del factor Xa.

  6. Nuevos anticoagulantes orales en fibrilación auricular no valvular New oral ant icoagulants in nonvalvular atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Andrés F Buitrago

    2012-08-01

    Full Text Available La fibrilación auricular es la arritmia cardiaca sostenida más común y su prevalencia se duplica cada decenio por encima de los cincuenta años. Entretanto, las condiciones clínicas que más se asocian con ésta son la hipertensión arterial, la insuficiencia cardíaca, la enfermedad valvular cardíaca y la diabetes mellitus. Como complicaciones está la falla cardiaca, pero tal vez una de las peores son los eventos cardioembólicos, que ocurren aproximadamente en 4,5% de los pacientes no anticoagulados. El tratamiento antitrombótico con antagonistas de la vitamina K fue, durante más de cincuenta años, la única alternativa disponible, a pesar de sus múltiples limitaciones, las mismas que llevaron al desarrollo de nuevos fármacos anticoagulantes que disminuyen muchos de los problemas de los antagonistas de la vitamina K. Pueden agruparse en dos clases: inhibidores orales directos de la trombina e inhibidores orales del factor X activado. Tanto dabigatrán, rivaroxabán como apixabán, cuentan ya con estudios clínicos controlados aleatorizados que apoyan su uso en el tratamiento antitrombótico de la fibrilación auricular y recientemente se incluyeron en las guías basadas en la evidencia como alternativa (ACC e incluso con un grado de recomendación superior (CCS, CHEST al de los antagonistas de la vitamina K.Atrial fibrillation is the most common sustained cardiac arrhythmia and its prevalence doubles every decade for people older than fifty years. Meanwhile, the clinical conditions most associated with it are hypertension, heart failure, valvular heart disease and diabetes mellitus. Complications include heart failure, but perhaps one of the worst ones are the stroke events, which occur in approximately 4.5% of not anticoagulated patients. Antithrombotic therapy with vitamin K antagonists was for over fifty years the only alternative available, despite its many limitations. These limitations led to the development of new

  7. Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.

    Science.gov (United States)

    Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H

    2011-10-01

    In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.

  8. Vitamina K: metabolismo, fontes e interação com o anticoagulante varfarina Vitamin K: metabolism, sources and interaction with the anticoagulant warfarin

    Directory of Open Access Journals (Sweden)

    Karin Klack

    2006-12-01

    Full Text Available A vitamina K é lipossolúvel, principalmente, na coagulação sanguínea. Se apresenta sob as formas de filoquinona (K1-predominante, dihidrofiloquinona (dK, menaquinona (K2 e menadiona (K3. Os fatores que interferem em sua absorção são: má absorção gastrintestinal, secreção biliar, ingestão insuficiente e uso de anticoagulantes, entre outros. As principais fontes de vitamina K são os vegetais e óleos, sendo esses os responsáveis pelo aumento da absorção da filoquinona. Os alimentos folhosos verde escuro, os preparados à base de óleo, oleaginosas e frutas como o kiwi, abacate, uva, ameixa e figo contêm teores significantes de vitamina K, enquanto que os cereais, grãos, pães e laticínios possuem teores discretos. A ingestão diária de aproximadamente 1µg por quilo de peso é considerada a mais segura, inclusive para a utilização de anticoagulantes orais, em que a concentração estável da vitamina proporciona a eficácia no tratamento. A droga anticoagulante oral geralmente utilizada é a varfarina, administrada como profilática e para tratamento de fenômenos tromboembólicos. Essa intervenção medicamentosa é monitorada pelo tempo de protrombina expresso pela razão normalizada internacional, tendo como objetivo estabelecer a faixa terapêutica entre 2 e 3, minimizando o risco de hemorragias. O efeito anticoagulante pode ser reduzido por fatores como ganho de peso, diarréia, vômito, idade menor que 40 anos e consumo excessivo de vitamina K na dieta alimentar.Vitamin K is a fat-soluble substance, mainly involved in the blood coagulation. It is presented as Phylloquinone (K1-predominant, Dihydrophyloquinone (dK, Menaquinone (K2, and Menadione (K3. The factors that interfere with its absorption are: gastrointestinal malabsorption, biliary secretion, inadequate ingestion and anticoagulant use, among others. The main vitamin K sources are vegetables and organic lipids, that are involved in the increased absorption of

  9. Aine y riesgo cardiovascular: los menos posibles, a la menor dosis posible y durante el menor tiempo posible

    Directory of Open Access Journals (Sweden)

    Ferrán Catalá-López

    2014-09-01

    Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.

  10. Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

  11. Efectos adversos asociados con los fármacos antiinflamatorios no esteroides (AINES)

    OpenAIRE

    Lahoud Salem, Victor

    2014-01-01

    La toxicidad gastrointestinal inducida por los antinflamatorios no esteroides (AINES) se encuentra entre los acontecimientos medicamentosos adversos graves más frecuentes entre los países industrializados Fries J, Williams C5. La exploración endoscópica alta muestra una prevalencia del 15% - 30% de úlceras en el estómago o el duodeno de los pacientes que toman regularmente AINE, Paulus H13 y la incidencia anual de complicaciones gastrointestinales clínicamente importantes puede aproximarse al...

  12. Hematoma intramural duodenal como complicação de terapia anticoagulante com Warfarin: relato de caso e revisão da literatura Intramural duodenal hematoma as a complication of therapy with Warfarin: a case report and literature review

    Directory of Open Access Journals (Sweden)

    Juliano Faria

    2004-12-01

    Full Text Available Relatamos o caso de uma paciente em terapia anticoagulante oral com Warfarin, apresentando obstrução intestinal aguda. A tomografia computadorizada revelou hematoma intramural duodenal. O tratamento baseou-se na correção das provas de coagulação e medidas expectantes. Este caso ilustra o valor da tomografia computadorizada e da abordagem conservadora nos pacientes em terapia anticoagulante com obstrução aguda do intestino delgado.We report a case of a patient receiving chronic oral anticoagulant therapy with Warfarin who presented with acute intestinal obstruction. Computed tomography showed intramural duodenal hematoma. Treatment was conservative with correction of the coagulation parameters and observation. This case exemplifies the usefulness of conservative therapy and computed tomography in patients with acute small bowel obstruction receiving anticoagulant therapy.

  13. GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

  14. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...

  15. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...

  16. ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

  17. The Scientific Method Ain't What It Used to Be

    Science.gov (United States)

    Herreid, Clyde Freeman

    2010-01-01

    Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…

  18. Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.

    Index Scriptorium Estoniae

    2004-01-01

    Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend

  19. Isolamento, fracionamento e atividade anticoagulante de iota-carragenanas da Solieria filiformis Isolation, fractionation and anticoagulant activity of iota-carrageenans from Solieria filiformis

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2010-11-01

    Full Text Available Este estudo teve como objetivo isolar, fracionar e avaliar o potencial anticoagulante de iota-carragenanas (i-CARs da rodofícea Solieria filiformis, quando obtidas por dois métodos de extração (M I e M II. As i-CARs foram isoladas com papaína bruta em tampão acetato de sódio 0,1M (pH 5,0, contendo cisteína 5mM e EDTA 5mM (M I ou água (80°C (M II e, em seguida, determinada sua composição química de carboidratos totais, sulfato livre (SL e proteínas contaminantes. As i-CARs foram submetidas à cromatografia de troca iônica (DEAE-celulose usando um gradiente de cloreto de sódio, sendo avaliado o tempo de tromboplastina parcial ativada (TTPA e tempo de protrombina das frações obtidas e comparadas à heparina (193UI mg-1. Uma fração anticoagulante também foi submetida ao procedimento de eletroforese em gel de agarose a 0,5%. A diferença no rendimento de i-CARs entre os métodos foi 10,14%. A composição química de SL (29,40% e o fracionamento, por DEAE-celulose, indicaram o M I mais eficiente na obtenção de i-CARs, comparado ao M II. O TTPA também foi somente alterado para as i-CARs do M I. Contudo, a atividade anticoagulante in vitro de uma fração rica (8,52UI mg-1 foi inferior à da heparina.This study aimed to isolate, fractionate and evaluate the anticoagulant potential of iota-carrageenans (i-CARs from Solieria filiformis when two extraction methods (M I and M II were used. i-CARs were isolated with papain in 0.1M sodium acetate (pH 5.0 containing 5mM cystein and 5mM EDTA (M I or water (80°C (M II, and then their chemical composition of total carbohydrates, free sulfate (FS and contaminant proteins were determined. i-CARs were submitted to anion-exchange chromatography (DEAE-cellulose using a sodium chloride gradient,being evaluated the activated partial thromboplastin time (APTT and prothrombin time of obtained fractions and compared to heparin (193IU mg-1. A rich fraction of anticoagulant was also submitted to 0

  20. Consideraciones prácticas para el uso de los nuevos anticoagulantes orales Practical considerations for the use of new oral anticoagulants

    Directory of Open Access Journals (Sweden)

    Julián M Aristizábal

    2012-06-01

    Full Text Available A pesar de la eficacia comprobada acerca del uso de warfarina como terapia anticoagulante, las múltiples interacciones, el estrecho margen terapéutico y la necesidad de monitorización seriada han planteado el escenario para el desarrollo de nuevos medicamentos como dabigatran, rivaroxaban y apixaban que ofrecen nuevas alternativas para el tratamiento del paciente anticoagulado. El conocimiento de las características farmacológicas y farmacocinéticas así como el contexto específico en el cual pueden usarse se convierten en una necesidad para los médicos que se enfrentan a este tipo de pacientes.Despite the proven efficacy on the use of warfarin as anticoagulant therapy, the multiple interactions, narrow therapeutic index and the need for serial monitoring have raised the need for the development of new drugs such as dabigatran, rivaroxaban and apixaban, that offer new alternatives for treating the anticoagulated patient. Knowledge of the pharmacologic and pharmacokinetic characteristics and the specific context in which they can be used become a necessity for physicians faced with these patients.

  1. Expérience béninoise de la prise en charge des hernies de l'aine ...

    African Journals Online (AJOL)

    La cure des hernies de l'aine est fréquente dans notre pratique. Notre but était de rapporter les aspects épidémiologiques, diagnostiques et thérapeutiques des hernies de l'aine dans notre milieu. Une étude rétrospective en chirurgie viscérale au Centre National Hospitalier et Universitaire-Hubert Koutoukou Maga de ...

  2. Tshelovek metshtõ i dela / Ain Järve ; interv. Lev Livshits

    Index Scriptorium Estoniae

    Järve, Ain

    2005-01-01

    Kadrioru pargi direktori Ain Järvega tema aednikuks saamisest, 1990. aastal Kadriorus tööle asumisest ja viimase 15 aasta jooksul pargis tehtud töödest. Kadrioru ajaloost. Barokkaia rajas Niccolo Michetti projekti järgi vene aednik Ilja Surmin. 19. saj. lõpus täiendati parki Riia arhitekti G. Kuphaldti plaanide alusel. 1930-ndatel heakorrastati parki A. Kotli ja A. Soansi projekti järgi

  3. Burkhardti avaldus paneb oravad tänaseni vassima / Ain Seppik, Rein Lang

    Index Scriptorium Estoniae

    Seppik, Ain, 1952-

    2009-01-01

    Baltic Rail Servic'i (BRS) üks omanikest ja nõukogu esimees Edward Burkhardt kinnitas avalikkuse ees, et Reformierakonna esindajad nõudsid BRS-lt raudtee aktsiate tagasiostmise eest pistist 1 miljon eurot. Prokuratuur ja kaitsepolitsei keelduvad pistiseküsimise kahtlust uurimast. Lisa: Riigikogu liikme Ain Seppiku küsimused, justiitsministri Rein Langi vastused ja Kesknädala kommentaarid

  4. T his article is m ainly about using sim ple trigonom etric identities ...

    Indian Academy of Sciences (India)

    T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...

  5. Avaliação do desempenho dos reagentes do tempo de tromboplastina parcial ativada utilizados para detectar o anticoagulante lúpico Assessment of the performance of reagents of activated partial thromboplastin time used to detect the lupus anticoagulant

    Directory of Open Access Journals (Sweden)

    Fernanda Chiuso

    2005-06-01

    Full Text Available INTRODUÇÃO: O anticoagulante lúpico é uma imunoglobulina pertencente à família dos anticorpos antifosfolípides. A sua ação in vitro é interferir nos testes de coagulação dependentes de fosfolípides. O tempo de tromboplastina parcial ativada (TTPA é um teste utilizado como screening na pesquisa do anticoagulante lúpico. Os reagentes utilizados neste teste apresentam grandes variações quanto à sensibilidade. OBJETIVO: Avaliar o desempenho dos reagentes do TTPA e detectar a presença do anticoagulante lúpico através de diferentes testes da coagulação. MATERIAL E MÉTODO: A pesquisa do anticoagulante lúpico foi realizada em 50 amostras plasmáticas de pacientes do sexo feminino através dos testes do TTPA, do tempo de coagulação do caulim (TCC, do tempo de tromboplastina parcial ativada diluída (TTPAd e do tempo do veneno da víbora de Russel diluído (TVVRd. Três cefalinas comerciais foram avaliadas pelos testes do TTPA e do TTPAd. Na comparação entre os reagentes estudados foi aplicado o cálculo do intervalo de confiança (95%. RESULTADOS: Os três reagentes avaliados apresentaram boa concordância e os métodos utilizados responderam bem à pesquisa do anticoagulante lúpico. DISCUSSÃO E CONCLUSÃO: As três cefalinas comerciais avaliadas podem ser utilizadas na rotina laboratorial para a pesquisa do anticoagulante lúpico.INTRODUCTION: The lupus anticoagulant is an immunoglobin which belongs to the antiphospholid antibodies family. Its in vitro function is to interfere with coagulation tests that are dependent on phospholipids. The activated partial thromboplastin time (APTT is a test used as screening on lupus anticoagulant research. Reagents used in this test demonstrate wide sensitivity ranges. OBJECTIVE: To assess the performance of APTT reagents and detect the presence of lupus anticoagulant through various coagulation tests. MATERIAL AND METHOD: The lupus anticoagulant research was performed in plasma from 50

  6. Conhecimento sobre anticoagulantes orais e seu manejo por médicos de pronto atendimento Emergency-room doctors' knowledge about oral anticoagulants and its management

    Directory of Open Access Journals (Sweden)

    Larissa Periotto Borlina

    2010-06-01

    Full Text Available Contexto: Desde sua descoberta, os anticoagulantes orais (AO têm sido cada vez mais estudados e aplicados em diferentes doenças. No entanto, eles apresentam reações medicamentosas com fármacos que trazem riscos ao paciente. Objetivo: Identificar o nível de conhecimento dos médicos plantonistas de pronto atendimento sobre os AO e suas interações, medicamentosas ou não, e verificar se o médico frentista está preparado para integrar o conteúdo teórico com a rotina de urgências. Método: Aplicou-se um questionário a 100 médicos atuantes em pronto atendimentos de dois hospitais públicos e três privados em Curitiba. Visou-se saber se o médico frentista questiona ao paciente sobre o uso de AO. Também, avaliou-se o conhecimento do profissional e seu interesse em saber mais sobre: AO (quais deles conhecia; exames para controle; sinergismo com AO; e manejo das complicações. Resultados: Dos 100 entrevistados, 60% declararam perguntar ao paciente sobre o uso de AO, 81% tinham conhecimento insuficiente a respeito do sinergismo de algumas substâncias apresentadas e os AO, 15% desconheciam qual exame é utilizado para acompanhamento dos pacientes anticoagulados, 50,7% não sabiam os nomes comercias dos AO, 4% desconheciam seu antídoto, e 92% manifestaram interesse em melhorar seus conhecimentos sobre os AO. Conclusão: É BAIXo o número de médicos que atende em pronto atendimentos que conhece sobre os AO e que sabe manejar pacientes anticoagulados. É alta a porcentagem de médicos que não perguntam aos pacientes sobre o uso de AO e que desconhecem princípios do sinergismo medicamentoso, sendo que a maioria se interessou em melhorar seus conhecimentos sobre os anticoagulantes.Background: Since its discovery, oral anticoagulants (OA have been increasingly studied and used to treat different diseases. However, OA may cause adverse drug interactions that bring risks for patients. Objective: To identify the emergency room doctors

  7. Novos anticoagulantes para a profilaxia do tromboembolismo venoso em cirurgias ortopédicas de grande porte New anticoagulants for the prophylaxis of venous thromboembolism

    Directory of Open Access Journals (Sweden)

    Ricardo de Alvarenga Yoshida

    2011-06-01

    Full Text Available Após cerca de 50 anos de experiência com a heparina e antagonistas da vitamina K (AVK, pesquisas e estudos com novos anticoagulantes vêm evoluindo de forma crescente nos últimos anos. Embora consagrados pelo uso, os anticoagulantes tradicionais têm limitações importantes em termos de controle laboratorial, complicações, efeitos colaterais, interações com medicamentos e dieta. A heparina não fracionada (HNF tem interação com proteínas plasmáticas e parede vascular, pode desencadear trombocitopenia induzida pela heparina (TIH, só pode ser administrada por via parenteral, exige controle laboratorial pelo teste da tromboplastina parcial ativada (TTPa, pode provocar osteoporose e alopecia quando usada por períodos prolongados e sua produção tem origem biológica. A AVK tem a vantagem de poder ser ministrada por via oral, mas o controle (feito pela razão normatizada internacional pode ser difícil em alguns casos, já que tem início de ação demorado, janela terapêutica estreita, interação com dieta e grande número de medicamentos, pode provocar necrose de pele em portadores de deficiência de antitrombina e de proteínas C e S, e pode induzir alterações fetais quando usada na gravidez. Na década de 1980, surgiram as heparinas de baixo peso molecular, que foram uma evolução da heparina não fracionada, pois apresentaram maior biodisponibilidade, dosagem por peso corporal, sem necessidade de controle laboratorial, administração por via subcutânea, menor risco de trombocitopenia induzida pela heparina, e eficácia e segurança similares à heparina não fracionada. Na última década surgiram, então, uma série de novos anticoagulantes no mercado, os quais têm apresentado resultados promissores em várias situações de profilaxia e tratamento do tromboembolismo venoso. Nesta revisão, são apresentados as novas heparinas de baixo peso molecular, as heparinas de ultrabaixo peso molecular, os pentassacarídeos, os

  8. β-glucanas de isolados fúngicos do gênero Botryosphaeria: produção, caracterização química e atividade anticoagulante

    OpenAIRE

    Vasconcelos, Ana Flora Dalberto [UNESP

    2009-01-01

    Exopolissacarídeos do tipo β-glucanas são polímeros produzidos por uma grande variedade de microrganismos e podem possuir diferentes propriedades físicas, químicas e aspectos estruturais. Esses biopolímeros apresentam atividades biológicas interessantes (antitumor, antiviral, anticoagulante) e aplicações comerciais como produtos em alimentos, cosméticos e farmacêuticos. Entretanto, para a aplicação dessas moléculas, é necessário primeiramente o conhecimento de suas estruturas químicas. Assim,...

  9. Aislamiento y caracterización bioquímica de compuestos fenólicos con actividad anticoagulante del extracto alcohólico de las hojas de Oenothera rosea Aiton “chupasangre”

    OpenAIRE

    Yarlequé Chocas, Mirtha Marieta

    2016-01-01

    Aísla los principios activos fenólicos con actividad anticoagulante sobre el plasma humano y desarrolla su caracterización bioquímica Oenothera rosea, para lo cual se realiza el extracto alcohólico y se detecta la presencia de fenoles, flavonoides, saponinas, glicósidos y tanino. A partir del extracto alcohólico se obtiene la fase acuosa y se realiza una CCF sobre celulosa obteniéndose 9 fracciones, 5 de las cuales resultan positivas para fenoles y flavonoides, y dos de éstas muestran activid...

  10. Diagnósticos e Intervenções de Enfermagem aos pacientes em terapia anticoagulante Diagnóstico e intervenciones de enfermería a los pacientes en terapia anticoagulante Nursing Diagnoses and Interventions for Patients under Anticoagulant Therapy

    Directory of Open Access Journals (Sweden)

    Maria Shirley Barbosa

    2004-10-01

    Full Text Available Os pacientes que fazem uso de anticoagulante orais apresentam necessidades especificas, para as quais, o atendimento de enfermagem tem um importante papel, principalmente, no sentido de prevenir complicações. A presente revisão foi realizada visando discutir os diagnósticos de enfermagem para esses pacientes, utilizando-se do sistema North American Nursing Diagnoses Association - NANDA. Os diagnósticos para esses pacientes retratam o risco de sangramento e retrombose quase sempre devido ao controle ineficaz do regime terapêutico e o déficit de volume de líquidos quando ocorre perda ativa de sangue. Propõem-se ainda as intervenções de enfermagem e os critérios de avaliações para tais condições. Os autores consideram relevante, no sucesso da assistência o preparo da equipe para lidar com essa terapia.Los pacientes que utilizan anticoagulante orales presentan necesidades específicas, para las cuales la atención de enfermería tiene un papel muy importante, principalmente en el sentido de prevenir complicaciones. La presente revisión se realizó; buscando discutir los diagnósticos de enfermería para esos pacientes, con el uso del sistema Noth American Nursing Diagnoses Association - NANDA. Los diagnósticos para tales pacientes retratan el riesgo de sangría y retrombosis, casi siempre debido al el control ineficaz del régimen terapéutico y el déficit del volumen de líquidos cuando ocurre una pérdida activa de sangre. También se proponen las intervenciones de enfermería y criterios de evaluaciones para tales condiciones. Los autores consideran relevantes en el éxito de la asistencia, la preparación del equipo para lidiar con esta terapia.Patients under treatment with oral anticoagulants present specific needs for which nursing care plays an important role, especially to prevent complications. The present review was carried out aiming at discussing nursing diagnoses for these patients by using the system of the North

  11. Pamidronato endovenoso en espondilitis anquilosante refractaria a antiinflamatorios no esteroideos (AINES y sulfasalazina

    Directory of Open Access Journals (Sweden)

    Augusto García-Poma

    2007-03-01

    Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.

  12. Monsieur Philippe Galli Préfet de l’Ain France

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.

  13. Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS

    Science.gov (United States)

    Issa, S.; Al Shuwaihi, A.

    2009-12-01

    The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.

  14. Determinants of Diabetes and Hypertension Control in Ambulatory Healthcare in Al Ain, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Latifa M. Baynouna

    2014-05-01

    Full Text Available bjectives: This study aims to study determinants for the control of diabetes and hypertension in Al Ain Ambulatory Healthcare patients. Method: This is a cross sectional observational study of patients attending ambulatory healthcare centers in Al Ain, United Arab Emirates in 2009. From a yearly audit evaluating the care of patients with diabetes and hypertension, the determinants for improved diabetes and hypertension outcomes were identified from a total of 512 patients and its association with glycemic and blood pressure control were studied. Results: From all variables studied, only the clinic where the patient was treated helped predict both improved blood sugar and blood pressure control. For patients with diabetes, poor control the year before (p<0.001, the number of chronic disease clinic visits (p=0.042 and triglyceride levels (p=0.007 predicted worse control of diabetes. A predictor of poor control of blood pressure (p<0.001 for patients with hypertension was poor control of blood pressure in the year before. Conclusion: In this population, the healthcare system and the team played major roles as determinants in the control of patient’s diabetes and blood pressure more than any of the other factors examined.

  15. Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    2012-01-01

    Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

  16. An activity-based cost analysis of the Honduras community-based, integrated child care (AIN-C) programme.

    Science.gov (United States)

    Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C

    2008-11-01

    The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.

  17. Knowledge of periconceptional folic acid use among pregnant women at Ain Shams University Hospital, Cairo, Egypt.

    Science.gov (United States)

    Al-Darzi, W; Al-Mudares, F; Farah, A; Ali, A; Marzouk, D

    2014-10-12

    Egypt has a high incidence of neural tube defects. Folic acid supplementation in the periconceptional period is known to lower the risk of such defects. This cross-sectional study aimed to measure the level of knowledge about periconceptional folic acid use among pregnant women attending for antenatal care at Ain Shams University Hospital, Cairo, Egypt in 2012. Questionnaires were filled through personal interviews with 660 pregnant women. Of the respondents, 62.4% had heard of folic acid and 39.2% knew about the role of folic acid supplementation in prevention of congenital anomalies. Knowledge about using folic acid before and in the first trimester of pregnancy was highest among university-educated women and those working in professional occupations. Only 18.8% of women reported taking folic acid, and 8.8% had used it before conception. Awareness campaigns are suggested to improve knowledge about folic acid among women in the childbearing period in Egypt.

  18. Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.

    Science.gov (United States)

    Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad

    2017-07-01

    Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.

  19. Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico

    Directory of Open Access Journals (Sweden)

    Andrés A. Pérez Ruiz

    2002-08-01

    Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of

  20. Qualité de la source Ain Hamma et effet du déversement de ses ...

    African Journals Online (AJOL)

    Les eaux de l'Oued Khoumane ont été prélevées mensuellement, entre août 2010 et mars 2011, au niveau de deux stations (amont et aval de sa confluence avec les eaux de la source thermale Ain Hamma Moulay Idriss) afin d'effectuer des analyses physico-chimiques et bactériologiques. L'analyse descriptive a montré ...

  1. Purificação, caracterização físico-química e atividade anticoagulante de glicosaminoglicanos isolados da pele de tilápia do Nilo (Oreochromis niloticus - doi: 10.4025/actascitechnol.v33i3.9400

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2011-07-01

    Full Text Available Os glicosaminoglicanos (GAGs constituem a matriz extracelular de tecidos animais e os resíduos do processamento de peixes comercialmente cultivados podem oferecer novos agentes anticoagulantes em substituição à heparina (HEP nas ciências médicas. Objetivou-se purificar, caracterizar físico-quimicamente e avaliar a atividade anticoagulante dos GAGs isolados da pele da tilápia do Nilo, Oreochromis niloticus. Os GAGs foram extraídos com papaína em tampão acetato de sódio 100 mM (pH 5,0 contendo cisteína e EDTA (5 mM, seguido por cromatografia de troca iônica em coluna de DEAE-celulose, utilizando um gradiente de NaCl. As frações obtidas foram liofilizadas e submetidas à eletroforese em gel de agarose a 0,5%. A atividade anticoagulante foi avaliada por meio do tempo de tromboplastina parcial ativada (TTPA, usando-se plasma humano normal e HEP padrão (193 UI mg-1. O perfil cromatográfico mostrou a separação de duas diferentes frações de GAGs (F I e F II, eluídas com 0,50 e 0,75 M de NaCl, respectivamente, revelando, por eletroforese, frações distintas em densidade de cargas, porém ambas mostrando GAGs com mobilidades semelhantes ao dermatam sulfato (DS padrão, sugerindo-se a identificação preliminar desse GAG. Os GAGs modificaram o TTPA, cujas atividades perfizeram, respectivamente, 4,72 (F I e 23,80 (F II UI mg-1, e expressaram-se dose-dependente. Portanto, o DS anticoagulante da pele de O. niloticus sugere uma fonte interessante para estudos posteriores de atividade antitrombótica.

  2. Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates

    Science.gov (United States)

    2013-01-01

    Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702

  3. Climate change and their consequences on coastal zone of Ain el Turck in Oran

    Directory of Open Access Journals (Sweden)

    Mohammed Tewfik Bouroumi

    2017-12-01

    Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.

  4. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Directory of Open Access Journals (Sweden)

    Michal Grivna

    Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  5. Incidence of emergency peripartum hysterectomy in Ain-shams University Maternity Hospital, Egypt: a retrospective study.

    Science.gov (United States)

    Allam, Ihab Serag; Gomaa, Ihab Adel; Fathi, Hisham Mohamed; Sukkar, Ghada Fathi Mahmoud

    2014-11-01

    To estimate the incidence of emergency peripartum hysterectomy over 6 years in Ain-shams University Maternity Hospital. Detailed chart review of all cases of emergency peripartum hysterectomy, 2003-2008, including previous obstetric history, details of the index pregnancy, indications for emergency peripartum hysterectomy, outcome of the hysterectomy and infant morbidity. The overall rate of emergency peripartum hysterectomy was 149 of 66,306 or 2.24 per 1,000 deliveries. The primary indications for hysterectomies were placenta accreta/increta 59 (39.6 %), uterine atony 37 (24.8 %), uterine rupture 35 (23.5 %) and placenta previa without accreta 18 (12.1 %). After hysterectomy, 115 (77 %) women were admitted to the intensive care unit. Women were discharged home after a mean 11.2 day length of stay. Using multifactorial logistic regression analysis, we found that woman's age, atonic uterus, placenta accreta/increta, previous cesarian section and ruptured uterus were independent predictors for peripartum hysterectomy Abnormal placentation was the main indication for peripartum hysterectomy. The risk factors for peripartum hysterectomy were morbid adherence of placentae in scared uteri, uterine atony and uterine rupture. The most important step in prevention of major postpartum hemorrhage is recognizing and assessing women's risk. The risk of peripartum hysterectomy seems to be significantly decreased by limiting the number of cesarean section deliveries, thus reducing the occurrence of abnormal placentation in the form of placenta accreta, increta or percreta.

  6. Knowledge, attitude and practice of medical students towards self medication at Ain Shams University, Egypt.

    Science.gov (United States)

    El Ezz, N F A; Ez-Elarab, H S

    2011-12-01

    Self medication is usually defined as intake of any type of drugs for treating oneself without professional supervision to relieve an illness or a condition. Self medication is an issue with serious global implications. In this study it was aimed to determine the knowledge, attitudes and behavior of self medication by the near coming physicians. A cross-sectional study was conducted on a sample of randomly selected medical students from Ain Shams University. Data was collected using self administered questionnaire. Verbal consent was ensured before applying the questionnaire. The Chi square was performed using SPSS 16 to identify associations and differences. The sample consisted of 300 students 67% females and 33% male students. Prevalence of self medication was 55%. Out of which 58.8%, 54.4%, 87.2%, 12%, 28% took antibiotic, vitamins, analgesics, sedatives, herbal products respectively without physician prescription. As regards the personal behavior towards following any prescription 14.4% always followed properly the prescription compared to 63.3% always discontinued the drug on feeling improvement, and 13.6% always repeated the prescription without seeking medical advice. Also 60% said that they increased the dose without medical advice. As regards the reported side effects 4.8%, 1.6%, 12% as a result of interaction between drugs, increase dose without medical advice and early stopping of treatment respectively. Self medication by medical students is an important issue to be avoided and need to be added to the curriculum of undergraduate students and raise the community awareness about these hazards and drawbacks.

  7. BACTERIOLOGICAL ANALYSIS AND PUBLIC PERCEPTION ABOUT DRINKING WATER OF BOREHOLES IN ARIB (AIN DEFLA, ALGERIA

    Directory of Open Access Journals (Sweden)

    F. C. Hamaidi

    2016-05-01

    Full Text Available Water from boreholes in Arib (Ain Defla, south-west of Algeria was investigated to ascertain its quality status and suitability for drinking and domestic uses. Fifty six water samples were collected from four boreholes. The analyses of the Coliform counts obtained from various boreholes samples ranged between 0 and 200 CFU/ 100 ml with regard to total Coliforms and between 0 and 8 CFU/ 100 ml with regard to fecal Coliforms. Three of the boreholes samples showed contamination by Streptococcus sp. Pathogens like Salmonella were not identified but some low levels of sulfite-reducing bacteria was found. The interviews were done to assess perceptions on water taste problems, odour, colour, and turbidity and health problems. The respondents were taken from people in the community using random sampling technique. Sixty people were sampled at each area surrounding the boreholes. It was found out that 43.3% of the respondents rated their drinking water safe for consumption as well as absence of illness after drinking as indicators for judging the quality of the water. The others respondents (56.7% reported having at least some concerns with safety of their water.  More  than 20% of the households reported at least one household member having suffered some water related illness in the past two years. Respondents were asked to judge the quality of the water, based on four sensory characteristics of drinking water. Many respondents rated the smell (33.3%, taste (20%, colour (23.3% and turbidity (23.3%. These results showed that all the samples did not satisfy the WHO requirements for bacteriological characteristics in human consumption.

  8. Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES

    Directory of Open Access Journals (Sweden)

    Margarita Restrepo

    2000-02-01

    Full Text Available

    Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.

    Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.

    El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo

  9. Extraction and anticoagulant activity of sulfated polysaccharides from Caulerpa cupressoides var. lycopodium (Vahl C. Agardh (Chlorophyceae = Extração e atividade anticoagulante dos polissacarídeos sulfatados da clorofícea Caulerpa cupressoides var. lycopodium (Vahl C. Agardh = Extração e atividade anticoagulante dos polissacarídeos sulfatados da clorofícea Caulerpa cupressoides var. lycopodium (Vahl C. Agardh.

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2011-04-01

    Full Text Available The reportedly low standard quality of heparin (HEP for use in cardiac surgeries has led to concern in the Brazilian and international markets. Sulfated polysaccharides (SPs from seaweeds have been regarded as promising substitutes for HEP. The aim of this study was to sequentially extract total SPs (TSPs from Caulerpa cupressoides (Chlorophyceae with papain in 100 mM sodium acetate buffer (pH 5.0 containing 5 mM cysteine and 5 mM EDTA, followed byfractionation by ion-exchange chromatography (DEAE-cellulose, and then evaluate the anticoagulant potential of SP fractions by activated partial thromboplastin time (APTT using normal human plasma and compare it to standard HEP (193 IU mg-1. The obtained fractions were chemically characterized by chemical composition and agarose gel electrophoresis. The yield was 4.61%, and three fractions of SP (F I, F II and F III eluted with 0.50, 0.75 and 1.00 M of NaCl,respectively, were observed on chromatography profiles; however, differences in charge densities patterns and degree of resolution among them were revealed by electrophoresis. SPs were capable of modifying APTT only in fractions eluted with 0.75 M of NaCl, whose activities were 23.37 and 25.76 IU mg-1, respectively, and the charge density was prerequisite to activity. Therefore, C. cupressoides is a source of SPs possessing low anticoagulant potential compared to HEP.O baixo padrão de qualidade outrora declarado da heparina (HEP para o uso em cirurgias cardíacas tem levado preocupação nos mercados nacional e internacional. Os polissacarídeos sulfatados (PSs de algasmarinhas têm sido considerados como promissores substitutos para HEP. Objetivou-se a extrair sequencialmente PSs totais (PSTs da clorofícea Caulerpa cupressoides com papaína em tampão acetato de sódio 100 mM (pH 5,0 contendo cisteína 5 mM e EDTA 5 mM, fracionar por cromatografia de troca iônica (DEAE-celulose e avaliar o potencial anticoagulante das frações de PS por meio do

  10. Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

    Index Scriptorium Estoniae

    2007-01-01

    Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

  11. Fracaso renal agudo secundario a combinación de inhibidores del sistema renina-angiotensina, diuréticos y AINES. “La Triple Whammy”1

    Directory of Open Access Journals (Sweden)

    Rosa Maria Garcia Camin

    2015-03-01

    Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.

  12. Overexploitation and cumulative drought trend effect on Ras El Ain karstic spring discharge (Khabour Sub-basin, Syria)

    Science.gov (United States)

    Abou Zakhem, Boulos; Kattaa, Bassam

    2017-10-01

    The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as

  13. Hepatitis C virus infection and risk factors in health-care workers at Ain Shams University Hospitals, Cairo, Egypt.

    Science.gov (United States)

    Okasha, O; Munier, A; Delarocque-Astagneau, E; El Houssinie, M; Rafik, M; Bassim, H; Hamid, M Abdel; Mohamed, M K; Fontanet, A

    2015-05-19

    The objectives of this study were to document the background prevalence and incidence of HCV infection among HCWs in Ain Shams University Hospitals in Cairo and analyse the risk factors for HCV infection. A cross-sectional survey was conducted in 2008 among 1770 HCWs. Anti-HCV prevalence was age-standardized using the Cairo population. A prospective cohort was followed for a period of 18 months to estimate HCV incidence. The crude anti-HCV prevalence was 8.0% and the age-standardized seroprevalence was 8.1%. Risk factors independently associated with HCV seropositivity were: age, manual worker, history of blood transfusions and history of parenteral anti-schistosomiasis treatment. The estimated incidence of HCV infection was 7.3 per 1000 person-years. HCWs in this setting had a similar high HCV seroprevalence as the general population of greater Cairo.

  14. Haematology and biochemistry values of captive sand cats (Felis margarita in Al Ain Wildlife Park and Resort, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Stephen Chege

    2013-09-01

    Full Text Available Objective: To investigate the haematology and biochemistry values of apparently healthy captive sand cats kept in Al Ain Wildlife Park and Resort, United Arab Emirates, with a view to establishing baseline values. Methods: Blood was collected from the femoral vein using aseptic techniques, kept in a cool box and sent to laboratory for analysis. The blood was analysed for haematological and biochemical values using veterinary hematology and chemistry analysers (ABX ABC Vet, Horiba ABX SAS ® Montpellier, France. Results: Haematological values were within the normal ranges recorded in domestic cats and there was no statistical difference between values found in males and females. Aspartate aminotransferase values were higher (P0.05 between males and females values. Conclusions: Our results present reference ranges for haematology and biochemistry parameters in captive sand cats. These values will be important for diagnosis of various diseases and monitoring of treatments.

  15. Polissacarídeos sulfatados isolados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides – extração, fracionamento e atividade anticoagulante =Sulfated polysaccharides isolated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes – extraction, fractionation and anticoagulant activity

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2010-04-01

    Full Text Available A incidência de doenças cardiovasculares e os efeitos adversos da heparinoterapia têm motivado a busca por novos agentes terapêuticos e os polissacarídeos sulfatados (PS de algas marinhas têm sido reportados como fontes alternativas para tal. Objetivou-se avaliar o potencial anticoagulante dos PS totais (PST isolados e fracionados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides. Inicialmente, os PST foram extraídos com papaína em tampão acetato desódio 0,1 M (pH 5,0 contendo cisteína 5 mM e EDTA 5 mM, seguidos de fracionamento em coluna de troca iônica de DEAE-celulose com gradiente de NaCl. As frações obtidas foram analisadas por eletroforese em gel de agarose a 0,5% e a atividade anticoagulante, mensurada pelo tempo de tromboplastina parcial ativada (TTPA, usando-se plasma humano normal e comparada a uma curva-padrão de heparina (193 UI mg-1. Verificaram-se semelhantes perfiscromatográficos entre os PS de ambas as espécies, porém com padrões de mobilidades distintas quando as frações foram comparadas por eletroforese. Os PS modificaram o TTPA, cujas atividades anticoagulantes foram de apenas 21,23 e 24,36 UI mg-1, quando eluídos com 0,75 M de sal para C. racemosa e C. cupressoides, respectivamente. Portanto, PS anticoagulantes isolados dasclorofíceas C. racemosa e C. cupressoides resultaram em efeitos anticoagulantes inferiores aos da heparina. Estudos comparativos dessas moléculas também são sugeridos como ferramentas auxiliares na identificação de algas do mesmo gênero.The incidence of cardiovascular diseases and adverse effects from heparintherapy have led to a search for new therapeutic agents, and the sulfated polysaccharides (SP of seaweeds have been reported as alternative sources. The aim of this work was to evaluate the anticoagulant potential of total SP (TSP isolated and fractionated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes. Initially, the TSP were extracted with papain

  16. Contribution to the hydrogeological, geochemical and isotopic study of Ain El Beidha and Merguellil (Kairouan plain) aquifers: Implication for the dam-aquifer relationship

    International Nuclear Information System (INIS)

    Ben Ammar, Safouan

    2007-01-01

    In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the

  17. Infartos cerebrais em pacientes jovens relacionados a deficiência de anticoagulantes naturais proteína C e proteína S Protein C and S deficiencies related stroke in young patients

    Directory of Open Access Journals (Sweden)

    José Ibiapina Siqueira Neto

    1996-12-01

    Full Text Available Infartos cerebrais (IC em jovens apresentam múltiplas etiologias que diferem do padrão observado nos indivíduos idosos. Deficiências de anticoagulantes naturais têm sido descritas nos últimos anos como causa de IC, principalmente em pacientes com menos de 40 anos. Existe tendência atual de se pesquisar essas deficiências em todos os pacientes jovens com infarto cerebral de causa indeterminada e naqueles com manifestações trombóticas de múltiplos sistemas. Realizamos pesquisa dos níveis de proteína C, proteína S e antitrombina III em pacientes entre 15 e 40 anos com ICs classificados como indeterminados após conclusão de protocolo básico de investigação. Diagnosticamos dois casos de deficiência de proteína C e um caso de deficiência de proteína S. Concluímos que a investigação sistemática de causas hematológicas proporciona decréscimo no número de infartos indeterminados, além de possibilitar a adoção de condutas específicas que diminuem a incidência de novos eventos nos casos diagnosticados.The possible etiologies of cerebral infarcts (CI in young patients differ from those in the older stroke population. Recently, deficiencies of fibrinolytic factors emerged as an important etiology of stroke in the young population. The literature has emphasized the diagnosis of such conditions especially in stroke cases of undetermined etiology and with history of recurrent thrombosis. We carried out a research on the serum level of protein C, protein S, and antithrombin III in young patients, between 15 and 40 years, with CI of undetermined cause after application of a standard protocol. Three patients had low levels of these proteins; two had protein C deficiency, and one protein S deficiency. None of them had antithrombin III deficiency. We conclude that systematic investigation of such causes of cerebral infarct will reduce the group of undetermined strokes, and will open the possibility of prophylactic treatment in a

  18. Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

    Index Scriptorium Estoniae

    Lellep, Kaili

    2010-01-01

    Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

  19. Use of tritium for estimation of groundwater mean residence time, a case study of the Ain Al-Samak Karst springs (Central Syria)

    International Nuclear Information System (INIS)

    Kattan, Z.

    2003-01-01

    This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size

  20. Consumption of the total Western diet differentially affects the response to green tea in rodent models of chronic disease compared to the AIN93G diet.

    Science.gov (United States)

    Ward, Robert E; Benninghoff, Abby D; Healy, Brett J; Li, Minghao; Vagu, Bharath; Hintze, Korry J

    2017-04-01

    In pre-clinical studies investigating bioactive components, the efficacy of the bioactive is likely influenced by the basal diet provided to rodents. In this study, we hypothesized that a model bioactive, green tea extract (GTE), would have different effects on colon carcinogenesis, body composition, and lipid metabolism in mice fed a basal diet formulated to promote animal health and growth (AIN93G) as compared to a Western diet that emulates typical American intakes of micro- and macronutrients, the total Western diet (TWD). Mice were fed either AIN93G or TWD, with or without GTE added to drinking water for 18 weeks. Aberrant crypt foci (ACF) in azoxymethane-initiated mice was nearly three times greater in mice fed TWD compared to AIN93G. Consumption of GTE suppressed ACF development only in mice fed the TWD. Similarly, supplementation with GTE suppressed weight gain and fasted glucose only in mice fed TWD, while GTE suppressed fat mass in mice fed either diet. Irrespective of diet, GTE supplementation increased cecum weight and decreased cecal SCFA concentration. Collectively, these observations indicate that the TWD influences the bioactivity of GTE in rodent models of obesity, metabolism, and carcinogenesis. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. EXIGENCES TECHNIQUES DANS LA CONSTRUCTION ET REGLEMENTATION : ETUDE D’UN EXEMPLE DE LOGEMENT COLLECTIF A AIN-SMARA (ALGERIE

    Directory of Open Access Journals (Sweden)

    B BENRACHI

    2002-12-01

    Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est   obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur.  Une étude détaillée sur les  exigences techniques et le respect de la réglementation  d’un logement en collectif  nouvellement construit et inhabité à Ain-Smara, nous a montré  qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.

  2. Concentração de anticoagulante, tempo e temperatura de armazenagem sobre os parâmetros hematológicos no hemograma automatizado Anticoagulant concentration, time and storage temperature on hematological parameters in automated blood count

    Directory of Open Access Journals (Sweden)

    Aécio Carlos de Oliveira

    2010-12-01

    Full Text Available O estudo teve como objetivo identificar os efeitos do tempo de estocagem, da temperatura de armazenamento e da quantidade de anticoagulante sobre parâmetros hematológicos de cães. Foram utilizadas amostras do sangue de dez cães de raças variadas, clinicamente hígidos. As alíquotas foram colhidas com 1,8mg; 3,6mg; 7,2mg e 14,4mg de ácido etilenodiaminotetracético (EDTA por mL de sangue, distribuídas em dois grupos: de 2°C a 8°C e temperatura ambiente. Após a coleta, foram avaliadas em quatro tempos: 0, 12, 24 e 48 horas. Usando um contador automático de células, foram avaliados leucócitos, eritrócitos, hemoglobina, hematócrito, volume corpuscular médio (VCM, índice de anisocitose eritrocitária (RDW, plaquetas e plaquetócrito (PCT. O valor do VCM diminuiu nas maiores concentrações de EDTA (7,2mg mL-1 e 14,4mg mL-1, com decréscimo de 2,36% na maior concentração. A temperatura e o tempo de armazenagem também ocasionaram alteração nesse parâmetro, ou seja, houve decréscimo no tempo 12 horas à temperatura de 2 a 8°C e aumento nos tempos 24 e 48 horas à temperatura ambiente (PThe study aimed to identify the effects of time, temperature of storage and excess of anticoagulant on hematological parameters of dogs. Blood samples of ten, clinically healthy dogs, of different breeds were utilized. Aliquots were stored with 1.8mg, 3.6mg, 7.2mg and 14.4mg of ethylenediaminetetraacetic acid (EDTA per mL of blood, divided into two groups: 2°C to 8°C and room temperature. Right after collection, they were evaluated in four times: 0h, 12h, 24h and 48h. White blood cells, red blood cells, hemoglobin, packed cell volume (PCV, mean corpuscular volume (MCV, red cell distribution width (RDW, platelet and thrombocrit (PCT were evaluated in the automatic cell counter. In the automatic cell counter analysis, the MCV increased significantly with higher concentrations of EDTA (7.2mg mL-1 and 14.4mg mL-1 peaking at 2.36%, in the highest

  3. Simultaneous antibacterial and anticoagulant properties of polypropylene non-woven textiles Elaboration d'un textile polypropylène non-tissé présentant simultanément des propriétés antibactériennes et anticoagulantes

    Directory of Open Access Journals (Sweden)

    Jimenez Maude

    2013-11-01

    Full Text Available The aim of this work was to prepare a non-woven Polypropylene (PP textile functionalized with bioactive molecules to improve simultaneously its anticoagulation and antibacterial properties. The immobilization of either heparin (anticoagulation agent or gentamicin (aminoglycoside antibiotic was already proven to be effective on non-woven PP textiles. This work details how we managed to immobilize both gentamicin and heparin on the textile [1]. The immobilization times were studied in order to determine the best compromise between cytocompatibility, anticoagulant effect and antimicrobial activity. Cetté étude décrit le procédé de fonctionnalisation d'un textile polypropylène (PP non-tissé afin d'améliorer à la fois ses propriétés antibactériennes et anticoagulantes. Dans des précédents travaux, l'immobilisation soit de l'héparine (agent anticoagulant, soit de la gentamicine (agent antibiotique aminoglycoside a déjà été reportée. Des effets respectivement anticoagulants et antibactériens ont été obtenus. Cette étude décrit la faç on d'immobiliser ces deux principes actifs sur un même textile. L'effet des temps d'imprégnation sur les propriétés antibactériennes et anticoagulantes a été étudié afin d'obtenir le meilleur compromis possible en termes de cytocompatibilité, effet anticoagulant et activité antimicrobienne.

  4. The impact of weathering on the uranium-bearing phosphates of Ain Laylon in the Syrian coast, using radon and gamma ray surveys

    International Nuclear Information System (INIS)

    Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.

    1998-06-01

    A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of

  5. Time Management and Its Relation To Students’ Stress, Gender and Academic Achievement Among Sample of Students at Al Ain University of Science and Technology, UAE

    OpenAIRE

    Ahmad Saleh Al Khatib

    2014-01-01

    The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Tim...

  6. Analyse des techniques de conservation de l’eau et du sol dans la zone aride cas bassin versant d’AIN SEFRA

    OpenAIRE

    MELALIH, Ahmed

    2011-01-01

    Malgré les lourds investissements que l’état Algérien a consentis pour la protection des bassins versants contre l’érosion hydrique dans les zones arides, les sols continuent de se dégrader. L’étude et l’analyse des techniques de conservation des eaux et du sol s dans la zone aride d’Ain sefra basé essentiellement sur les aménagements mécaniques (seuils en gabion et en pierre sèche et retenus collinaires) et des aménagements biologiques (reboisement, plantation rustique et fixation des ...

  7. Avaliação de anticoagulantes naturais e de fatores da coagulação em pacientes com distúrbios congênitos de glicosilação (DCG tipo I An evaluation of natural anticoagulants and coagulation factors in patients with congenital disorders of glycosylation type I

    Directory of Open Access Journals (Sweden)

    Anna Letícia Soares

    2010-01-01

    Full Text Available Defeitos na incorporação de N-glicanos nas proteínas humanas ocasionam um grupo de doenças multissistêmicas denominadas coletivamente distúrbios congênitos de glicosilação (DCG. Os DCG manifestam-se na infância com sintomas neurológicos que incluem principalmente atraso psicomotor, ataxia, hipotonia e episódios de acidente vascular cerebral. Várias proteínas do sistema hemostático somente tornam-se biologicamente ativas após a glicosilação. O objetivo deste estudo foi avaliar os anticoagulantes naturais (proteína S livre, proteína C e antitrombina e os fatores da coagulação (VIII, IX e XI em pacientes com DCG tipo I. Foram avaliados 11 pacientes com diagnóstico positivo para DCG tipo I (três do gênero masculino e oito do gênero feminino, idade média de 5,6 anos; e oito pacientes com diagnóstico negativo para DCG(quatro do gênero masculino e quatro do gênero feminino, idade média de 4,5 anos (grupo-controle. O diagnóstico de DCG tipo I foi realizado pela identificação do padrão de hipoglicosilação da transferrina plasmática. Na avaliação dos anticoagulantes naturais pode-se observar redução dos valores de PS livre e PC e uma redução marcante de AT, quando comparados com o grupo controle. Em relação aos fatores de coagulação não houve diferença significativa para os fatores VIII e IX e houve redução marcante do fator XI. Os resultados do presente estudo sugerem que a deficiência combinada de anticoagulantes naturais é responsável pelo estado pró-trombótico observado em pacientes com DCG. Sugerimos também que a análise dos parâmetros hemostáticos seja realizada para pacientes com DCG quando apresentarem sintomas clínicos de alteração do sistema hemostático e antes de procedimentos invasivos.Defects in the biosynthesis of N-linked human protein glycosylation leads to a group of multisystem disorders collectively called congenital disorders of glycosylation (CDG. CDG present in infancy

  8. Keelatud ained / Ave Oit

    Index Scriptorium Estoniae

    Oit, Ave

    2012-01-01

    Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

  9. Turundusteenistus / Ain Kaljurand

    Index Scriptorium Estoniae

    Kaljurand, Ain, 1965-

    2004-01-01

    Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

  10. Eeslid / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2003-01-01

    Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'

  11. Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

    Index Scriptorium Estoniae

    2007-01-01

    Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

  12. Toidutööstus panustab detsembris jõulutoodetele. Pühad toovad käibelisa / Ain Alvela, Ketlin Rauk ; kommenteerinud Ruth Roht, Marek Viilol, Simmo Kruustük, Imre Sokk

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare

  13. Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Lepik, Kerli, 1989-

    2013-01-01

    Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

  14. Madame Olga Givernet, Députée de la 3ème circonscription de l’Ain, République française, vendredi 16 février 2018

    CERN Multimedia

    Caraban Gonzalez, Noemi

    2018-01-01

    Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale

  15. Evaluation of the impact of water harvesting techniques on the evolution of piezometric head of Ain El Bidha groundwater in Kairouan at the Central part of Tunisia

    Science.gov (United States)

    Mechergui, M. Mohamed; Henda Saoudi, Mme

    2016-04-01

    This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values

  16. Regulació del metabolisme de l'àcid araquidònic i senyalització cel·lular en un model d'asma i intolerància als AINEs

    OpenAIRE

    García García, Francesc J.

    2013-01-01

    [cat] L'aspirina i els fàrmacs antiinflamatoris no esteroïdals (AINEs ) es troben entre els fàrmacs més utilitzats en el món. En general són ben tolerats per la majoria dels individus, però hi ha una excepció en un subgrup particular de pacients asmàtics. Aquests pacients pateixen asma induïda per aspirina (AIA), una síndrome clínica caracteritzada per atacs d'asma provocats després de la ingestió d'AINEs. A més, aquests pacients sovint pateixen de rinosinusitis crònica acompanyada de poli...

  17. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9; Aplicacion de un recubrimiento de TiAIN para el incremento de la resistencia al desgaste de una compuerta de paso fabricada en acero T9

    Energy Technology Data Exchange (ETDEWEB)

    Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx

    2009-07-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  18. Women's knowledge, attitude and practice towards menopause and hormone replacement therapy: a facility based study in Al-Ain, United Arab Emirates.

    Science.gov (United States)

    Hamid, Saima; Al-Ghufli, Fatma Rashid; Raeesi, Hanan Ali; Al-Dliufairi, Khawla Mohammed; Al-Dhaheri, Noura Salem; Al-Maskari, Fatma; Blair, Iain; Shah, Syed Mahboob

    2014-01-01

    Hormone replacement therapy (HRT) is an effective treatment for menopausal symptoms like vasomotor symptoms, sleep disturbances, mood alteration, depression, urinary tract infection, vaginal atrophy and increased health risks for osteoporosis, cardiovascular diseases and loss of cognitive function. This study was conducted to determine knowledge, attitude and practice toward menopause among women in UAE. A clinic-based cross-sectional study was carried out among women of age 40 and above. Study subjects were recruited from four Primary Health Care centres in Al Ain city. The participants were administered a questionnaire in Arabic and English, which included 33 items; socio-demographic variables, and questions related to knowledge, attitude and practices regarding menopause and HRT. Out of 177 study subjected selected, 150 (85%) completed the survey. Almost half of the participants (51%) had already experienced menopause. A substantial number of women had poor know knowledge about menopause (67%) and HRT (73%). Sixty percent of women had positive attitude towards menopause. Of the fifty three percent of women with symptoms, 35% of them did not use anything to relieve their symptoms. Knowledge about menopause varied significantly (pmenopause and HRT was found to be statistically significant. Women with reported symptoms that were bothersome had positive attitude towards HRT uptake. The study indicated that there is poor knowledge about menopause and HRT among the participants. Level of knowledge was associated with the level of education. There was a positive attitude towards menopause, with women suffering the most from menopausal symptoms showing positive attitude towards HRT.

  19. [Economic impact of etanercept and adalimumab biosimilars on hospitals scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products].

    Science.gov (United States)

    Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P

    2018-01-01

    To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.

  20. Time Management and Its Relation To Students’ Stress, Gender and Academic Achievement Among Sample of Students at Al Ain University of Science and Technology, UAE

    Directory of Open Access Journals (Sweden)

    Ahmad Saleh Al Khatib

    2014-05-01

    Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research.   Keywords: Time management, perceived stress, academic achievement, college students.

  1. Jebel Hafit and the Al Ain oases (Eastern Abu Dhabi, United Arab Emirates): an integrative approach of a cultural landscape through the scope of geodiversity

    Science.gov (United States)

    Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine

    2015-04-01

    human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.

  2. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009–2013

    Science.gov (United States)

    Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953

  3. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009-2013.

    Science.gov (United States)

    Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.

  4. What You Need to Know When Taking Anticoagulantion Medication

    Science.gov (United States)

    ... low there is increased risk of blood clot formation. If the INR is high there is increased risk of bleeding. The Anticoagulation Team will also track your INR results over multiple visits to follow trends in your results. They will look at all ...

  5. Fantaasia killapeod : [rets.] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Looming 1968, nr. 10, lk. 1592-1595 . Rets. rmt.: Alliksaar, Artur. Nimetu saar. Tallinn : Perioodika, 1966. 80 lk. (Loomingu Raamatukogu; 1966, 7); Alliksaar, Artur. Olematus võiks ju ka olemata olla. Tallinn ; Perioodika, 1968. 80 lk. (Loomingu Raamatukogu; 1968, 9/10).

  6. Consent ain't anything

    DEFF Research Database (Denmark)

    Di Nucci, Ezio

    2016-01-01

    I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...

  7. Endasse kapseldunud aine / Edgar Krull

    Index Scriptorium Estoniae

    Krull, Edgar, 1948-

    2002-01-01

    IEA (International Association for Evaluation of Educational Achievement = Rahvusvaheline Assotsiatsioon Haridussaavutuste Hindamiseks) kodanikuõpetuse uurimusest 28 riigis. Kodanikuõpetuse teadmiste, sellest arusaamise tasemest Euroopas, postsotsialistlikes riikides, Eestis

  8. Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

    Directory of Open Access Journals (Sweden)

    Katre Talviste

    2013-12-01

    Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked

  9. APPORT DES S.I.G. DANS LA CARACTERISATION HYDRODYNAMIQUE ET HYDROCHIMIQUE DE LA NAPPE DU CRETACE INFERIEUR DE LA REGION D'AIN-SEFRA (ATLAS SAHARIEN OCCIDENTAL —ALGERIE—)

    OpenAIRE

    Abderrahmane, RAHMANI

    2014-01-01

    RESUME L'étude a porté sur la reconnaissance des eaux souterraines de la nappe des grés du Crétacé inférieur, principale ressource de l'alimentation en eau potable et l'irrigation de la région d'Ain Sefra. Les débits des forages d'une profondeur allant de 150 m à 250 m, varie entre 05 l/s et 851/s. Des analyses physico-chimiques effectuées à travers les forages, puits et sources captant les grés du Crétacé inférieur de la région, ont permis d'identifier des faciès chimiques ...

  10. Syntheses, structural variants and characterization of AInM′S4 (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS4 and KInSnS4 compounds

    International Nuclear Information System (INIS)

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru

    2016-01-01

    Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.

  11. The first evidence of cut marks and usewear traces from the Plio-Pleistocene locality of El-Kherba (Ain Hanech), Algeria: implications for early hominin subsistence activities circa 1.8 Ma.

    Science.gov (United States)

    Sahnouni, Mohamed; Rosell, Jordi; van der Made, Jan; Vergès, Josep María; Ollé, Andreu; Kandi, Nadia; Harichane, Zoheir; Derradji, Abdelkader; Medig, Mohamed

    2013-02-01

    The current archaeological data on early hominin subsistence activities in Africa are derived chiefly from Sub-Saharan Plio-Pleistocene sites. The recent studies at El-Kherba (Ain Hanech) in northeastern Algeria expand the geographic range of evidence of hominin subsistence patterns to include the earliest known archaeological sites documented in North Africa. Dated to 1.78 million years ago (Ma), excavations from El-Kherba yielded an Oldowan industry associated with a savanna-like fauna contained in floodplain deposits. The faunal assemblage is dominated by large and medium-sized animals (mainly adults), especially equids, which are represented by at least 11 individuals. The mammalian archaeofauna preserves numerous cut-marked and hammerstone-percussed bones. Made of primarily limestone and flint, the stone assemblage consists of core forms, débitage, and retouched pieces. Evidence of usewear traces is found on several of the flint artifacts, indicating meat processing by early hominins. Overall, our subsistence analysis indicates that early hominins were largely responsible for bone modification at the site, which is also corroborated by other relevant taphonomic evidence. Moreover, at 1.78 Ma, the cutmarked bones recovered from El-Kherba represent the earliest known evidence for ancestral hominin butchery activities and large animal foraging capabilities in northern Africa. Copyright © 2012 Elsevier Ltd. All rights reserved.

  12. Concilier développement agricole et usage pérenne des eaux souterraines : un dialogue multi-acteurs dans la zone d’Ain Timguenay (province de Séfrou

    Directory of Open Access Journals (Sweden)

    Issam Sellika

    2016-10-01

    Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d

  13. Solvent-extraction methods applied to the chemical analysis of uranium. III. Study of the extraction with inert solvents; Metodos de extraccion con disolventes aplicados al analisis quimico del uranio. III. Estudio de la extraccion con disolvente inertes

    Energy Technology Data Exchange (ETDEWEB)

    Vera Palomino, J.; Palomares Delgado, F.; Petrement Eguiluz, J. C.

    1964-07-01

    The extraction of uranium on the trace level is studied by using tributylphosphate as active agent under conditions aiming the attainment of quantitative extraction by means of a single step process using a number of salting-out agents and keeping inside the general lines as reported in two precedent papers. Two inert solvents were investigated, benzene and cyclohexane, which allowed to derive the corresponding empirical equations describing the extraction process and the results obtained were compared with those previously reported for solvents which, like ethyl acetate and methylisobuthylketone, favour to a more or less extend the extraction of uranium. (Author) 4 refs.

  14. Miks on kutseharidus oluline / Ain Karjus

    Index Scriptorium Estoniae

    Karjus, Ain

    2006-01-01

    Kiire majanduskasvu jätkumise üheks oluliseks eelduseks on eelkõige kõrge produktiivsusega töö, milline nõuab inimestelt üheaegselt nii häid teoreetilisi teadmisi kui ka praktilisi oskusi, väidab autor

  15. Investorid on dilemma ees / Ain Kivisaar

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe

  16. Makita kalmistu antropoloogiline aines / Luule Heapost

    Index Scriptorium Estoniae

    Heapost, Luule

    1993-01-01

    Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed

  17. Lahesõjas viik / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2001-01-01

    Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

  18. Norma Maja astub kindlalt tulevikku / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2000-01-01

    AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

  19. Euroopa abiraha igatseb taotlejaid / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen

  20. Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

  1. Tratamento da superdosagem de anticoagulantes orais Reversal of excessive oral anticoagulation

    Directory of Open Access Journals (Sweden)

    Dayse Maria Lourenço

    1998-01-01

    Full Text Available OBJETIVO: Verificar a resposta de 73 pacientes com superdosagem de droga anti-vitamina K (AVK a 3 esquemas de tratamento. MÉTODOS: Os 73 pacientes foram avaliados em 94 ocasiões e divididos em 3 grupos: grupo A (N=32 , suspensão do AVK por 2 dias e introdução de dose menor; grupo B (N=37, suspensão do AVK e reavaliação em 4 dias; grupo C (N=25, vitamina K por via oral. A razão normalizada internacional (RNI final foi considerada adequada quando entre 2,0 e 4,0. RESULTADOS: Não houve diferença entre os tratamentos (chi²=2,352, p=0,671 para 61 pacientes com RNI inicial 8. Cinco dos 7 pacientes do grupo B que continuaram com superdosagem tinham RNI PURPOSE: To evaluate the response of 73 patients with antivitamin K (AVK overdose to 3 different therapeutic regimens. METHODS: Seventy three patients were evaluated in 94 occasions: group A (N=32, consisted of drug withdrawal for 2 days followed by reduced dosage; group B (N=37, drug withdrawal and reassessment within 4 days; group C (N=25, oral administration of vitamin K. Therapeutic range was set between INR-values of 2 and 4. RESULTS: Reversal regimens did not result in differences among 61 patients who had initial INR 4, but 5 of them were bellow 4.5, without increased bleeding risk. There were 10 patients in group C bellow therapeutic range, 6 of them with INR < 1.6, with risk of thromboembolism. Thirteen patients bled, but none required transfusion. CONCLUSION: Reversal of excessive oral anticoagulation can be safely performed by initial withdrawal of the drug, followed by lower doses. Vitamin K administration may lead to INR bellow the therapeutic range. This should be reserved for patients with high INR or in the presence of bleeding.

  2. Syntheses, structural variants and characterization of AInM′S{sub 4} (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS{sub 4} and KInSnS{sub 4} compounds

    Energy Technology Data Exchange (ETDEWEB)

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in

    2016-06-15

    Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.

  3. EFFETS D’UN ALIMENT EXTRUDE SUR LES PERFORMANCES DE CROISSANCE DE LA TRUITE ARC-EN-CIEL (ONCORHYNCHUS MYKISS WALBAUM, 1792 ET SUR LA QUALITE DE L’EAU DE L’OUED OUM ER-RBIA (STATION AIN AGHBAL, AZROU-MAROC

    Directory of Open Access Journals (Sweden)

    Khadija OUAISSA

    2017-05-01

    Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.

  4. Modelado del proceso de extracción de ácido acético con recuperación del disolvente orgánico

    OpenAIRE

    Sánchez Levoso, Ana

    2016-01-01

    El ácido acético es uno de los ácidos carboxílicos más utilizados tanto en la industria química como en la alimentaria, siendo sus principales aplicaciones la producción de acetato de vinilo monómero, empleado en la fabricación de pinturas, adhesivos y papel, y la producción de ácido terftálico purificado, precursor del poliéster PET. Además, es el ingrediente clave en el vinagre. Entre las formas de obtención del ácido acético se distinguen la fermentación bacteriana y las vías sintéti...

  5. Extracción de cromo con disolventes orgánicos. III parte. Aplicación al tratamiento de residuos polimetálicos industriales

    Directory of Open Access Journals (Sweden)

    de Juan, D.

    1998-10-01

    Full Text Available The use of Primene 81R as extraction agent of chromium present in solid wastes containing nickel, iron and copper has been studied. The waste was leached with a sulphuric acid solution up to pH 3 and oxidation of Cr(III to Cr(VI with Caro acid was also studied. Because of the negative result of oxidation, the treatment was applied on Cr(III directly. Extraction/scrubbing/stripping process was studied in the leach. The composition of organic phase used in the extraction step was 10 % v/v Primene 81R, 10 % isodecanol and kerosene. All the iron, 91 % Cr, 10 % Ni and large part of the copper contained in the initial leach solution are recovered in the organic phase. In the scrubbing stage (with a sulphuric acid solution at pH 1,4, all the copper and nickel and 30 % Cr go to the washing liquor, while all the iron and 70 % Cr remained in the organic phase. In the stripping stage (with a 2N NH4OH or 2N NaOH solution all the iron and chromium are recovered as a precipitate of highly absorbent hydroxides. After the treatment mentioned, 63 % Cr and 100 % Fe are recovered as a mixture of hydroxides, and 28 % of the initial chromium, all the nickel and the copper are found in the washing liquor.

    Se estudia la aplicación del Primene 81R como agente de extracción del cromo presente en residuos sólidos que poseen níquel, hierro y cobre. El residuo se lixivió con disolución de ácido sulfúrico hasta pH 3 y se investigó la oxidación del Cr(III a Cr(VI con ácido de Caro. Ante el nulo resultado en la oxidación, se actuó directamente sobre el Cr(III. Se estudió el proceso de extracción/lavado/reextracción sobre la lejía de lixiviación. La fase orgánica empleada en la extracción estaba constituida por 10 % v/v de Primene 81R, 10 % de isodecanol y queroseno. En la fase orgánica se recupera todo el hierro, el 91 % Cr, el 10 % Ni y gran parte del cobre contenidos en la lejía de partida. En la etapa de lavado (con disolución de ácido sulfúrico de pH 1,4, todo el cobre y el níquel y el 30 % Cr pasan a las aguas de lavado, quedando en la fase orgánica todo el hierro y el 70 % Cr. En la reextracción (con NH4OH 2 N o con NaOH 2 N se recupera todo el hierro y el cromo como un precipitado de hidróxidos altamente absorbente. Después del tratamiento indicado se consigue recuperar el 63 % Cr y el 100 % Fe como una mezcla de hidróxidos, y en el agua de lavado se encuentra el 28 % Cr inicial, así como todo el níquel y el cobre.

  6. Poliitiline areng / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  7. Political development / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  8. Kibuvits üllatab ja pakub leevendust / Ain Raal

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2005-01-01

    Taani teadlased avastasid-eraldasid kibuvitsaseemnetest ja viljakestadest uue põletikuvastase toimeaine galaktolipiidi (GOPO). Seda lipiidi sisaldub kõige enam koer-kibuvitsa alamliigis Hyben Vital Litos. Nüüdseks on GOPO saamisviis ja nimi patenteeritud nii Euroopas kui ka USAs

  9. Natura 2000 sai tuule tiibadesse Raplamaal / Ain Aivela

    Index Scriptorium Estoniae

    Aivela, Ain

    2004-01-01

    Natura 2000 idee jõudis Eestisse 2000. aastal, mil pilootprojekti raames ning Taani riigi rahalisel toel alustati Natura-võrgustiku eelvalikualade mahamärkimist Lääne- ja Raplamaal. Kommenteerinud Aleksei Lotman

  10. Overexploitation and cumulative drought trend effect on Ras El Ain ...

    Indian Academy of Sciences (India)

    Boulos Abou Zakhem

    2017-10-06

    Oct 6, 2017 ... UNDP-FAO 1966 Etudes des Ressources en Eaux Souter- raines (République Arabe Syrienne); Rapport Final,. FAO/SF: 17/SYR, p. 267. UN-ESCWA and BGR 2013 (United Nations Economic and Social Commission for Western Asia; Bundesanstalt für Geowissenschaften und Rohstoffe) 2013 Inventory of.

  11. Saaremaa taotleb LIFE programmist 50 miljonit krooni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2001-01-01

    Vilsandi Rahvuspark ja Pärandkoosluste Kaitse Ühing esitasid EL Komisjonile LIFE programmi raames projektitaotlused. Ajalehe küsimustele vastab Vilsandi rahvuspargi kaitsekorralduskava spetsialist Enn Kaljo

  12. Toodangu maht sõltub impordist / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2002-01-01

    Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid

  13. Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit

    Index Scriptorium Estoniae

    Kull, Ain, 1973-

    2005-01-01

    Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel

  14. Jõupaberi tootmine tagab Kehra vabriku kasumi / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Kehra paberivabrik on kodumaa metsaomaniku jaoks oluline okaspuu paberipuidu tarnija, kasutades umbes viiendiku sellise sortimendi aastasest raiemahust. Vabriku toodangust lõviosa moodustab pakendipaber. Selle tootmine tagab ka kasumi

  15. Lubatakse raha, higi ja hambaravi / Maris Jesse, Ain Aaviksoo

    Index Scriptorium Estoniae

    Jesse, Maris

    2007-01-01

    Ilmunud ka: Infopress 2. märts nr. 9 lk. 161. Autorid analüüsivad erakondade valimislubadusi tervishoiu valdkonnas. Nad jõuavad seisukohale, et kuna ükski partei terviknägemust ei paku, sõltub tervishoiu tulevik ennekõike ametnike tarkusest, tulevase sotsiaalministri poliitilisest kogemusest ja valitsusenamuse otsustustahtest

  16. Meie esimese luuletõlke-antoloogia puhul : [rets.] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Ilm.: Kirjandus kriitiku pilguga : artikleid, arvustusi ja aastaülevaateid 1975-1976. Tallinn : Eesti Raamat, 1978, lk. 25-31 ; Keel ja Kirjandus 1975, nr. 5, lk. 309-311 . Rets. rmt.: Sang, August. Laenatud laulud I: luuletõlkeid. Tallinn : Eesti Raamat, 1973. 336 lk.; Sang, August. Laenatud laulud II: luuletõlkeid. Tallinn : Eesti Raamat, 1974. 392 lk.

  17. Terve mõistusega ahnuse vastu / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2005-01-01

    Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

  18. PEPTIC ULCER FREQUENCY DIFFERENCES RELATED TO H. PYLORI OR AINES

    Directory of Open Access Journals (Sweden)

    Diego Michelon de CARLI

    Full Text Available Background Peptic ulcer etiology has been changing because of H. pylori decline. Objectives To estimate peptic ulcer prevalence in 10 years-interval and compare the association with H. pylori and use of non-steroidal anti-inflammatory drugs. Methods Records assessment in two periods: A (1997-2000 and B (2007-2010, searching for peptic ulcer, H. pylori infection and non-steroidal anti-inflammatory drugs use. Results Peptic ulcer occurred in 30.35% in A and in 20.19% in B. H. pylori infection occurred in 73.3% cases in A and in 46.4% in B. Non-steroidal anti-inflammatory drugs use was 3.5% in A and 13.3% in B. Neither condition occurred in 10.4% and 20.5% in A and B respectively. Comparing both periods, we observed reduction of peptic ulcer associated to H. pylori (P=0.000, increase of peptic ulcer related to non-steroidal anti-inflammatory drugs (P=0.000 and idiopathic peptic ulcer (P=0.002. The concurrent association of H. pylori and non-steroidal anti-inflammatory drugs was also higher in B (P=0.002. Rates of gastric ulcer were higher and duodenal ulcer lower in the second period. Conclusions After 10 years, the prevalence of peptic ulcer decreased, as well as ulcers related to H. pylori whereas ulcers associated to non-steroidal anti-inflammatory drugs increased. There was an inversion in the pattern of gastric and duodenal ulcer and a rise of idiopathic peptic ulcer.

  19. Peptic ulcer frequency differences related to h. Pylori or aines.

    Science.gov (United States)

    Carli, Diego Michelon de; Pires, Rafael Cardoso; Rohde, Sofia Laura; Kavalco, Caroline Mayara; Fagundes, Renato Borges

    2015-01-01

    Peptic ulcer etiology has been changing because of H. pylori decline. To estimate peptic ulcer prevalence in 10 years-interval and compare the association with H. pylori and use of non-steroidal anti-inflammatory drugs. Methods Records assessment in two periods: A (1997-2000) and B (2007-2010), searching for peptic ulcer, H. pylori infection and non-steroidal anti-inflammatory drugs use. Peptic ulcer occurred in 30.35% in A and in 20.19% in B. H. pylori infection occurred in 73.3% cases in A and in 46.4% in B. Non-steroidal anti-inflammatory drugs use was 3.5% in A and 13.3% in B. Neither condition occurred in 10.4% and 20.5% in A and B respectively. Comparing both periods, we observed reduction of peptic ulcer associated to H. pylori (P=0.000), increase of peptic ulcer related to non-steroidal anti-inflammatory drugs (P=0.000) and idiopathic peptic ulcer (P=0.002). The concurrent association of H. pylori and non-steroidal anti-inflammatory drugs was also higher in B (P=0.002). Rates of gastric ulcer were higher and duodenal ulcer lower in the second period. After 10 years, the prevalence of peptic ulcer decreased, as well as ulcers related to H. pylori whereas ulcers associated to non-steroidal anti-inflammatory drugs increased. There was an inversion in the pattern of gastric and duodenal ulcer and a rise of idiopathic peptic ulcer.

  20. Võib ja saab ka nii / Ariane Ain, Luule Niinesalu

    Index Scriptorium Estoniae

    Ain, Ariane

    2002-01-01

    11.-14. veebr.̀2002 toimus Audentese Erakoolis aktiivõppenädal 1.-7. kl. õpilastele ja õpetajatele. Sel nädalal ei toimunud ainetunde. Erinevate tegevuste ja õppemeetodite kaudu pakuti õpilastele uusi teadmisi, kogemusi ja elamusi

  1. Advokaadi kutse-eetika reason d’etre / Ain Alvin

    Index Scriptorium Estoniae

    Alvin, Ain, 1959-

    2014-01-01

    Advokaadi kohustus on kutsetegevuses järgida lisaks seadusele kutse-eetika nõudeid, häid kombeid ja südametunnistust. Mida sellised kohustused sisuliselt tähendavad, millest tuleneb vajadus kutse-eetika kutseühendusesisese reguleerimise järele ja milline on kutse-eetika normide sisu?

  2. Bassilaulja Ain Anger lummas Viini publiku / Talvi Nurgamaa

    Index Scriptorium Estoniae

    Nurgamaa, Talvi

    2008-01-01

    1. aprillil Musikvereini klaassaalis Viinis toimunud laulja soolokontserdist sarjast "Lied. Bühne", klaveril Jendrik Springer. Samal ajal kudses saalis toimunud Tonkünstler Orchester kontserdist, dirigent Kristjan Järvi

  3. Department of Pediatrics, Faculty of Medicine, Ain Shams University ...

    African Journals Online (AJOL)

    Egyptian Journal of Pediatric Allergy and Immunology (The). Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 1, No 2 (2003) >. Log in or Register to get access to full text downloads.

  4. Kevadelaul : [luuletused] / Federico Garcia Lorca ; tlk. Ain Kaalep

    Index Scriptorium Estoniae

    García Lorca, Federico, 1898-1936

    2006-01-01

    Sisu: Kevadelaul ; Uued laulud ; Unenägu ; Uus süda ; Rõske siseõu ; Risttee : "Oh valu: mu värsid võtnud..." ; Ballaad mereveest ; Huile ; Vaikus ; Risttee : "Tuul puhub läänest..." ; Sevilla ; Kuus keelt ; Memento ; Kolm linna : Malaguena ; Cordoba agul ; Tants ; Kitarrimõistatus ; Poolkuu ; Neli kollast ballaadi ; Aadam ; Tasakaal ; Friis ; Maha raiuti kolm puud ; Teokarp ; Rumal laul ; Õhtu ; Ratsaniku laul ; Debussy ; Kuu tõuseb ; Kaks õhtust kuud ; Serenaad ; Laul lahkuvast päevast ; Kuuba neegrilaul ; Itk Ignacio Sanchez Mejiase surma puhul ; Madrigal Santiago linnale ; Hällilaul surnud Rosalia Castrole ; Kuu tants Santiagos ; Gaseel kohutavast lähedusest ; Gaseel tumedast surmast ; Gaseel põgenemisest ; Gaseel saja-aastasest armastusest ; Kassiida okstest ; Kassiida selili lebavast naisest ; Kassiida unenäost vabas õhus ; Kassiida tumedaist tuvidest ; Vee süit ; Herbaariumid ; Omega ; Ood Salvador Dalile ; "Ma kardan, kas su imet ma ei kaota..." . Eluloolisi andmeid autori kohta lk. 879

  5. Puti povõshenija effektivnosti proizvodstva / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

  6. The cytometric future: it ain't necessarily flow!

    Science.gov (United States)

    Shapiro, Howard M

    2011-01-01

    Initial approaches to cytometry for classifying and characterizing cells were based on microscopy; it was necessary to collect relatively high-resolution images of cells because only a few specific reagents usable for cell identification were available. Although flow cytometry, now the dominant cytometric technology, typically utilizes lenses similar to microscope lenses for light collection, improved, more quantitative reagents allow the necessary information to be acquired in the form of whole-cell measurements of the intensities of light transmission, scattering, and/or fluorescence.Much of the cost and complexity of both automated microscopes and flow cytometers arises from the necessity for them to measure one cell at a time. Recent developments in digital camera technology now offer an alternative in which one or more low-magnification, low-resolution images are made of a wide field containing many cells, using inexpensive light-emitting diodes (LEDs) for illumination. Minimalist widefield imaging cytometers can provide a smaller, less complex, and substantially less expensive alternative to flow cytometry, critical in systems intended for in resource-poor areas. Minimalism is, likewise, a good philosophy in developing instrumentation and methodology for both clinical and large-scale research use; it simplifies quality assurance and compliance with regulatory requirements, as well as reduces capital outlays, material costs, and personnel training requirements. Also, importantly, it yields "greener" technology.

  7. Kaubandusettevõtetel madalad logistikakulud / Ain Kiisler, Tomi Solakivi

    Index Scriptorium Estoniae

    Kiisler, Ain, 1965-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Logistika i Transport 28. nov. lk. 8. Uuringu järgi on Eesti kaubandusettevõtted logistikakuludelt teiste Läänemere-äärsete regioonide kaubandusettevõtetega võrreldes kõige konkurentsivõimelisemad, kuid Eesti tootmisfirmade logistikakulud on aga suurimaid. Diagrammid: Logistikakulude uuring. Vt. sams: Uuring tõstab Läänemere regiooni logistikakompetentsi

  8. Euroopa Liit kasvatas transpordikulusid / Ain Kiisler, Tomi Solakivi

    Index Scriptorium Estoniae

    Kiisler, Ain, 1965-

    2007-01-01

    2007. aasta alguses rahvusvahelise uurimisprojekti raames Eesti firmade hulgas läbi viidud logistikauuringu tulemustest. Lisa: Mis on mis; Number. Tabel: Eesti ettevõtted suudavad kõige vähem täita perfektselt tellimusi

  9. Geniaalne aines, hämmastav film / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2006-01-01

    Oktoobri algul Kuressaares peetud Saaremaalt pärit ameerika arhitekti Louis Kahni konverentsi raames Kuressaare Linnateatris näidatud dokumentaalfilmist "Minu arhitekt" ("My Architect") : režissöör Nathaniel Kahn : Ameerika Ühendriigid 2003

  10. Saaremaa rahvaliitlased on liitumise osas ettevaatlikud / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2009-01-01

    Keskerakonna poolt Rahvaliidule tehtud ühinemisettepanekut arutanud ERL Saaremaa maakonnaühendus ei poolda liitumist seni väljapakutud tingimustel. SDE juhatus moodustas töörühma, kes hakkab pidama konsultatsioone ERL-i ja EER-iga võimaliku liitumise üle

  11. The Hollow Men: Ain't It Awful?

    Science.gov (United States)

    Kendall, Martha E.

    1991-01-01

    Charles Sykes' book "The Hollow Men: Politics and Corruption in Higher Education" is criticized as overreacting to trends in higher education and the college curriculum but also seen as potentially prompting educators to ask questions about the dominant politics on their campuses. (MSE)

  12. Gynaecologists and industry: ain't no sunshine.

    Science.gov (United States)

    Farquhar, Cynthia M; Vercellini, Paolo; Marjoribanks, Jane

    2017-08-01

    The field of reproductive medicine is known for its innovations, and where there is innovation there is marketing and engagement with the doctors who are potential prescribers and users of those innovations. Financial connections between drug and device manufacturers with doctors have been extensively debated over the past decade. On one hand, relationships between doctors and industry could be considered synergistic by allowing the development of improved treatments. On the other hand, payment (and other benefits) from industry to doctors may subtly shift the main objective of the collaboration from patients' health to mutual benefits for both doctors and industry. Fertility patients can be considered 'vulnerable' as they face the multiple challenges of seeking to be parents, understanding complex and expensive fertility treatments that are by no means universally successful, and at the same time are under pressure because of their ever-increasing age. They are entitled to receive the most cost-effective treatments. We suggest that specialists in the field of reproductive medicine should be transparent about the receipt of financial benefits, including funding from industry, as it may be influencing both research outcomes and treatments that patients are offered. We also recommend that payments arising from industry-sponsored research should be centralized in institutional funds and not paid directly to researchers. And there should be transparency about the source and the purpose of the payment. Industry sponsorship of medical societies and their educational events should be kept to a minimum and declared quantitatively in societies' websites and scientific programme brochures. Industry sponsorship of scientific meetings should not include the right to host educational symposia or speakers within the programme. All speakers should declare their conflicts of interest (COIs) at their meetings. Guideline groups should require all members to declare their financial COIs before meeting and exclude or limit those members with COI. Governmental authorities should not allow continuing medical education credits to those educational events not complying with the above policies. The crucial role of medical journals as 'gatekeepers' for identifying 'science' must be reaffirmed. © The Author 2017. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  13. Soomlane propageerib Saaremaale ülikooli asutamist / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2007-01-01

    Saaremaa peaks tõsiselt mõtlema rahvusvahelise kõrgkooli asutamisele, leiab Turu Ülikooli täienduskoolituskeskuse projektijuht ja Sihtasutuse Ülikoolide Keskus Saaremaal juhatuse liige Antti Karlin

  14. AIN thin film unimorph piezoelectric actuators on polysilicon microbridges

    NARCIS (Netherlands)

    Saravanan, S.; Dijkstra, Mindert; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    We present a surface micromachining process to fabricate AlN piezoelectric microstructures. The fabrication process utilizes Si02 sacrificial layer etching with Polysilicon as a structural layer. The significance of the process is that the polysilicon layer is used as a structural as weIl as a

  15. What We Expect Ain't Always What We Get.

    Science.gov (United States)

    Gellen, M. I.; Hoffman, R. A.

    1984-01-01

    Discusses the use of the chi-square statistic in educational evaluation based on the assumption that the availability of calculators and computers does not absolve educators from the responsibility of understanding this statistically evaluative technique. Illustrates applicability to an action research study in a middle school setting. (NEC)

  16. Eestis käis ilmataadi maapealne asemik / Ain Kallis

    Index Scriptorium Estoniae

    Kallis, Ain, 1942-

    2005-01-01

    Tänavu täitub 200 aastat pidevate instrumentaalsete ilmamõõtmiste algusest Eestis. Keskkonnaminister Villu Reiljan ja Euroopa Keskpika Ilmaennustuse Keskuse (European Centre for Medium-Range Weather Forecasts, ECMWF) direktor Dominique Marbouty kirjutasid alla koostöölepingule

  17. Tootjad karastusid kriisis. Rahapaigutused siiski veel vaka all / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Majanduskriisi mõjude üle ettevõtetele arutlevad ASi Tallegg juhatuse esimees Teet Soorm, ASi Haapsalu Uksetehas juhataja Ago Soomre, ASi Fazer Eesti juhatuse esimees Kristjan Kongo. Arvamust avaldab AS-i E-Betoonelement juhataja Valdo Leosk

  18. Hematoma subdural de medula espinhal associada ao uso de anticoagulante oral Hematoma subdural de la médula espinal asociado al uso de anticoagulante oral Spine subdural hematoma: a rare complication associated with vitamin K antagonist (VKA

    Directory of Open Access Journals (Sweden)

    Uri Adrian Prync Flato

    2009-01-01

    Full Text Available O hematoma subdural de medula espinhal (HSDME é uma complicação rara decorrente do uso de antagonistas de vitamina K (AVK e de diagnostico difícil. Este artigo apresenta um caso com complicação ameaçadora à vida: um paciente octogenário portador de fibrilação atrial de início recente em uso de AVK. A história e o exame físico inicialmente se apresentavam normais, associados com a elevação dos valores de coagulograma supraterapêuticos (INR > 10. Após 24 horas da admissão hospitalar, o paciente apresentou tetraparesia progressiva, evidenciando na ressonância nuclear magnética (RNM de medula espinhal um HSDME (Figura 1. Após reversão completa da hipocoagulação e intervenção neurocirúrgica o paciente obteve melhora do quadro neurológico.El hematoma subdural espinal (HSE es una complicación rara proveniente del uso de antagonistas de vitamina K (AVK y de diagnostico difícil. Este artículo presenta un caso con complicación amenazadora para la vida: un paciente octogenario portador de fibrilación auricular de inicio reciente, en uso de AVK. Inicialmente, la historia y el examen físico se presentaban normales, asociados a la elevación de los valores de coagulograma supra terapéuticos (INR > 10. Tras 24 horas del ingreso hospitalario, el paciente presentó tetraparesia progresiva. Al realizarse una resonancia nuclear magnética (RNM de médula espinal, se evidenció un HSE (Figura 1. Tras reversión completa de la hipocoagulación e intervención neuroquirúrgica el paciente obtuvo mejora del cuadro neurológico.Spinal subdural hematoma (SSDH is a rare condition, which is difficult to diagnose, related to Vitamin K Antagonist. This a case report of a life-threatening situation in a octogenarian patient with a history of recent atrial fibrillation that received K-Vitamin Antagonist (KVA therapy. The history and the clinical assessment were normal at the admission, associated with increase in the coagulation parameters (INR >10. Twenty-four hours after the admission, the patient developed progressive tetraparesis and a Magnetic Resonance Imaging (MRI was performed, disclosing the evidence of a SSDH (Figure 1. An emergency neurosurgical intervention was performed associated with normalization of the coagulation parameters. After the procedure, the patient presented improvement of the neurological symptoms.

  19. 18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz, Secrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

  20. Solvent. I. Extraction systems applied to uranium analysis. I. Extraction studies with Tributyl phosphate-Methyl-isobutyl-ketone; Metodos de extraccion don disolventes aplicados al analisis quimico del uranio. I. Estudio de la extraccion con fosfato de tributilo-metilisobutilcetano

    Energy Technology Data Exchange (ETDEWEB)

    Vera Palomino, J.; Palomares Delgado, F.; Petrement Eguiluz, J. C.

    1964-07-01

    A factorial study of the selective extraction of uranium with a mixture of TBP-MIC was carried out using 0,8 N nitric acid and different salting agents. We use the most suitable salting agent to develop new factorial experiments in order to get an equation involving the percent of extracted uranium, E, the concentration of the extraction agent in the organic phase, c, and the concentration of the slating agent in the aqueous phase, n. (Author) 3 refs.

  1. Deposition and characterization of TaAIN thin films by reactive magnetron sputtering; Deposicao e caracterizacao de filmes finos de TaAIN depositados por magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, G.B.; Fernandez, D.R.; Fontes Junior, A.S.; Felix, L.C.; Tentardini, E.K. [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Ciencia e Engenharia de Materiais; Hubler, R. [Pontificia Universidade Catolica do Rio Grande do Sul (PUC-RS), RS (Brazil); Silva Junior, A.H. da, E-mail: brito-g@hotmail.com [Universidade Federal do Rio Grande do Sul (UFRGS), RS (Brazil)

    2016-07-01

    Phase stability, oxidation resistance and great mechanical properties are the main objectives when synthesizing protective coatings. The tantalum nitride (TaN) has aroused interest because of its high temperature stability, chemical inertness and thermal conductivity. However, it has a low hardness value when compared to other coatings. Researches has shown that one way to improvements in the properties of a thin film is by adding other elements in the deposition process. Therefore, the objective of this study was to deposit thin films of TaAlN by magnetron sputtering, changing the aluminum concentration of 2, 5, 7, to 14%. Then the coatings were characterized by EDS, RBS, GIXRD and nanohardness. In this study was found that the aluminum deposited did not change the oxidation resistance of the coating, and the highest value of hardness was 28 GPa for the sample with 14 at.%. (author)

  2. Deposition and characterization of NbAIN thin films by reactive magnetron sputtering; Deposicao e caracterizacao de filmes finos de NbAIN por magnetron sputtering reativo

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, R.G.; Felix, L.C.; Fernandez, D.A.R.; Fontes Junior, A.S.; Oliveira, G.B.; Tentardini, E.K., E-mail: renatacarvalho.rc@gmail.com [Universidade Federal de Sergipe (UFS), SE (Brazil)

    2016-07-01

    The objective of this work was to study NbAlN thin films and the influence of variation in the concentration of aluminum in the crystal structure and oxidation resistance of these coatings. The thin films were deposited by reactive magnetron sputtering and characterized by Grazing Incidence X-ray Diffraction (GIXRD), Energy Dispersive Spectroscopy (EDS) and oxidation tests at high temperatures. NbAlN thin films were deposited and present at concentration of 10, 20 and 42 at% Al. The NbAlN crystalline phase obtained was the δ-NbN, however it was observed a shift of the peaks in the patterns obtained GIXRD of regions for larger angles for these samples, indicating the formation of a solid solution. The higher oxidation resistance temperature was 700° C for the sample with 42 in at% Al. From the SEM analysis it was possible to observe the surface of the film after oxidation, all films showed defects, however the amount of such defects was lower in samples with higher aluminum concentrations. (author)

  3. Complicaciones del tratamiento con anticoagulantes orales en mayores de 65 años, a propósito de un caso

    OpenAIRE

    María de las Nieves Perejón Díaz; María Jesús Rodríguez López; Isabel Moreno Ruiz; Javier Benítez Rivero

    2014-01-01

    Descripción del caso: Mujer de 79 años con antecedentes de hipertensión arterial, fibrilación auricular (FA) permanente anticoagulada (acenocumarol) e insuficiencia mitral. Barthel 90, Lowton-Brody: 2. Acude a urgencias por dolor costal (osteomuscular) de dos semanas de evolución, sin otros síntomas, siendo dada de alta y acudiendo nuevamente por epistaxis y disnea. Exploración y pruebas complementarias: destacar en la auscultación cardio-pulmonar: tonos arrítmicos con soplo sistólico en rebo...

  4. Atividade anticoagulante de extratos de glândulas salivares de thyrsopelma guianense (diptera: simuliidae), principal vetor de onchocerca volvulus (nematoda: onchocercidae) no Brasil

    OpenAIRE

    Chagas , Andrezza Campos

    2005-01-01

    Thyrsopelma guianense (Diptera:Simuliidae) é o principal vetor da Oncocercose no único foco brasileiro (índios Yanomami e Ye’Kuana). Entretanto, já existem indícios da introdução da oncocercose na área indígena Waimiri-Atroari/ Presidente Figueiredo/AM. Essa doença está entre as principais doenças tropicais de impacto social com cerca de 18 milhões de pessoas infectadas no mundo, e como a segunda causa de cegueira depois da catarata. A doença é causada através da picada do simulídeo caso este...

  5. Complicaciones del tratamiento con anticoagulantes orales en mayores de 65 años, a propósito de un caso

    Directory of Open Access Journals (Sweden)

    María de las Nieves Perejón Díaz

    2014-08-01

    Full Text Available Descripción del caso: Mujer de 79 años con antecedentes de hipertensión arterial, fibrilación auricular (FA permanente anticoagulada (acenocumarol e insuficiencia mitral. Barthel 90, Lowton-Brody: 2. Acude a urgencias por dolor costal (osteomuscular de dos semanas de evolución, sin otros síntomas, siendo dada de alta y acudiendo nuevamente por epistaxis y disnea. Exploración y pruebas complementarias: destacar en la auscultación cardio-pulmonar: tonos arrítmicos con soplo sistólico en reborde esternal izquierdo, crepitantes hasta campos medios, con murmullo vesicular disminuido. Radiografía de tórax: masa hiliar derecha con engrosamiento pleural derecho, e infiltrado bilateral. Hemograma: hemoglobina 7.9 g/dl (previa 11.6 g/dl, leucocitos 11.57x10l. Bioquímica: PCR 72.90mg/l, urea 85 mg/l. Coagulación: INR indeterminado, actividad protrombina 4 aumenta el riesgo de sangrado. Se trata de un paciente pluripatológico, dependiente moderada, con mal cumplimiento tratamiento y de control de anticoagulación. Ante estos datos (anemización, ausencia de signos de infección o insuficiencia cardiaca, y los resultados de las pruebas, nos decantamos por la hemorragia alveolar como primera posibilidad diagnostica.

  6. Pentazocine pain relief in adult patients with acute abdominal ain: A ...

    African Journals Online (AJOL)

    Background: Reported studies in the African population, on early pain relief in patients with acute abdominal pain are few. The objective of the study was to evaluate the effect of pentazocine (PZ) on pain relief, diagnostic accuracy and treatment decisions in patients with acute abdominal pain. Methods: This was a ...

  7. T his article is m ainly about using sim ple trigonom etric identities ...

    Indian Academy of Sciences (India)

    RESONANCE. June 2007. E quation (7) can be rew ritten as,for exam ple, cos. 2. (x ) = exp(¡. 1. X n = 1 n. X r= 0 n C r. (¡ 1) r n cos. 2 r. (x )); (8) and hence ln (cos2 x ) = ¡. 1. X n = 1 n. X r= 0 n C r. (¡ 1) r n cos. 2 r. (x ):. (9). Integrating both sides of equation (9) between 0 and. ¼ /2, w e get. Z ¼ = 2. 0 ln (cos2 x )dx = ¡. 1. X n = 1.

  8. Enha utiliz de anceme ation b erived f ent of by stra from s bioma ain ...

    African Journals Online (AJOL)

    SAM

    en-Han Ch y, No. 1018, S an (R.O.C.). 12 January, 2015 ays could be e derived stra how that an ization. Char tion were obs. CW)/L) and v. L and 1.61 x ces was sign al subcultur ilization or im us; hsp60 gen ealth benefit. gh fed-batch esses for cos esses for pro as medium tion rate, tem ten the via. 6215829. Fax: + he terms ...

  9. COxSwAIN COmpressive Sensing for Advanced Imaging and Navigation

    Data.gov (United States)

    National Aeronautics and Space Administration — A new imaging architecture that incorporates elements of compressive sensing and computational imaging in order to reevaluate the design space of imaging systems...

  10. Füüsikud maailma päästmas / Ain Ainsaar

    Index Scriptorium Estoniae

    Ainsaar, Ain

    2003-01-01

    9.-11. oktoobrini Tallinna Pedagoogikaülikoolis aset leidnud rahvusvahelisest seminarist "Tiheda plasma ja materjalide interaktsioon", kus käsitleti termotuumareaktorite mudelite ehitamisel ette tulnud tehnilisi raskusi

  11. Sõjageograafia aine ja Eestimaa sõjageograafia 1920. aastatel / Kersti Vennik

    Index Scriptorium Estoniae

    Vennik, Kersti, 1975-

    2003-01-01

    Autori arvates puudub praeguses ohvitseride väljaõppes kursus, kus selgitataks täpsemalt Eesti maastike omadusi, erinevate maastiku-komponentide omavahelist koosmõju ning maastiku mõju kaitsejõudude tegevusele. Polkovnik Nikolai Reegi (1890-1942) panusest Eesti geograafiateaduse ajalukku

  12. Everyday Engineering: Ain't She Sweet--Bats, Rackets, Golf Clubs, and All

    Science.gov (United States)

    Moyer, Richard; Everett, Susan

    2011-01-01

    The pitcher throws the ball and the batter takes a mighty swing. Crack! The ball is hit on the sweet spot and soars to the outfield. Or, you hear a thud! This time, the ball dribbles along the infield ground and the batter's hands sting. Everyone who has played baseball or softball has probably experienced both of these outcomes. This may not seem…

  13. If Momma Ain't Happy: Explaining Declines in Marital Satisfaction among New Mothers

    Science.gov (United States)

    Dew, Jeffrey; Wilcox, W. Bradford

    2011-01-01

    This study tests competing explanations for the link between the transition to motherhood and declines in wives' marital satisfaction. Using data from the first and second waves of the National Survey of Families and Households (N = 569), we found that new mothers' marital satisfaction declines could be attributed to reductions in wives' quality…

  14. Laevade erinevate soetamisviiside kommertstingimuste võrdlev analüüs / Ain Eidast, Allan Kivi

    Index Scriptorium Estoniae

    Eidast, Ain, 1939-2013

    2005-01-01

    Laevade erinevate soetamisviiside analüüs näitab, et ühtse, kõikidele osapooltele vastuvõetavate tingimuste väljatöötamine ja rakendamine ei ole tehniliselt võimalik ning majanduslikult õigustatud. Tabelid. Diagrammid

  15. Pattern of community acquired pneumonia in pregnant ladies in Ain Shams University hospitals

    Directory of Open Access Journals (Sweden)

    Aya M. Abdel Dayem

    2012-10-01

    Conclusion: Morbidity and mortality in pregnant patients with pneumonia continue to present a significant challenge. Early recognition of the diseases process and prompt treatment are required to ascertain an optimal outcome. The treatments in the gravid patients generally follow standard guide lines for the treatment of pneumonia in adults. Concern for fetal outcome should not delay treatment as improvement in maternal oxygenation and status is the best way to ensure fetal protection.

  16. Living with the Sermon of the Mount : an uncomfortable presence of transcendence / Ain Riistan

    Index Scriptorium Estoniae

    Riistan, Ain, 1965-

    2003-01-01

    Ettekanne sümpoosionilt: Gemeinsames Symposium der Evangelisch-Theologischen Fakultät der Universität Tartu, der Estnischen Studiengesellschaft für Morgenlandkunde und der Deutschen Religionsgeschichtlichen Studiengesellschaft. Tartu, 2001

  17. Otepää piiskoplinnuse hävimisdaatumist / Ain Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Ülevaade, miks autor hakkas 1980. aastate keskel toetama hüpoteesi Otepää keskaegse linnuse hävimisest 1396. aastal. Samas on kriitiliselt vaetud sama ajakirja numbris mõningaid Jaak Mälli seisukohti

  18. ... ain pild erheben, als das zu perln gehoret... - Relief- und Perlstickerei des Spätmittelalters

    Czech Academy of Sciences Publication Activity Database

    Wetter, Evelin

    -, č. 70 (2014), s. 112-125 ISSN 0231-5793 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : textile works of art from the treasuries * liturgical robes * embroidery * serial production * made-to-order production Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. Metallifirmade prioriteediks sai tootearendus / Ain Alvela ; kommenteerinud Jüri Riives

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Metallitöötlemisega tegelevate firmade juhid on valdavalt arvamusel, et praegu pole aeg paigutada raha ettevõtte laienemise ja tootmismahu suurendamise hüvanguks, vaid tegelda tuleks tootearenduse ja kogu ettevõtte struktuuri korrastamisega. Sobiv on aeg ka mõne ettevõtte ülesostmiseks

  20. Teaduspargist võrsub eriti agar gasell / Ain Alvela ; kommenteerinud Seren Eilmann

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Tallinna tehnoloogiapargi Tehnopol ja Tartu teaduspargi ettevõtlusinkubaatorid pakuvad ettevõtluskeskkonda kiiret arengut taotlevatele ettevõtetele. Tehnopolis on gaselli staatuse saanud 22 firmat, Tartu teaduspargis 13 firmat. AS-ist Proekspert, OÜ-st Interfire. Tabel

  1. Pemberian Obat-Obatan Anti Inflamasi Non Steroid (AINS pada Anak

    Directory of Open Access Journals (Sweden)

    Fajriani Fajriani

    2012-10-01

    Full Text Available We know that non-steroid anti-inflammatory drugs (NSAIDs analgetic, antipirettan and anti-inflammatory effect. This drugs can decrease pain simptomaticly, the most widely prescribed drugs worldwide and being the drugs of first choice other inflammatory pain. There is many kind NSAIDs that we knaw, like aspirin, parasetamol, ibuprofen, mefenamic acid, endometasin, diklofenak, piroksikan and nemosulide. Every kind of NSAIDs has its advantage and dis advantage for that beneficial actions and side effects. That beneficial actions and harmful side effects of NSAID can be associated with its mechanism of action. Using NSAID for children must in attention. This article is expented to give information and to help the collegnes in the selecting drugs NSAID for child.DOI: 10.14693/jdi.v15i3.27

  2. Water Ser - areng läbi torude ja üle kraavide / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    1992. aastal asutatud vee- ja kanalisatsioonitorustike paigaldamisele spetsialiseerunud perefirma AS Water Ser on kasvanud rahvusvaheliselt mainekaks kontserniks. Vt. samas: Perefirma arengu kronoloogia; Amet sai alguse teismelise eas kraavikaevamisest. Kommenteerivad Andrus Piir ja Toomas Kapp

  3. A successful chronic care program in Al Ain-United Arab Emirates.

    Science.gov (United States)

    Baynouna, Latifa M; Shamsan, Amal I; Ali, Tahira A; Al Mukini, Lolowa A; Al Kuwiti, Moza H; Al Ameri, Thuraya A; Nagelkerke, Nico J D; Abusamak, Ahmad M; Ahmed, Nader M; Al Deen, Sanaa M Zein; Jaber, Tariq M; Elkhalid, Abdulkarim M; Revel, Anthony D; Al Husaini, Alhusini I; Nour, Fouad A; Ahmad, Hayat O; Nazirudeen, Mohammad K; Al Dhahiri, Rowaya; Al Abdeen, Yahya O Zain; Omar, Aziza O

    2010-02-22

    The cost effective provision of quality care for chronic diseases is a major challenge for health care systems. We describe a project to improve the care of patients with the highly prevalent disorders of diabetes and hypertension, conducted in one of the major cities of the United Arab Emirates. The project, using the principles of quality assurance cycles, was conducted in 4 stages.The assessment stage consisted of a community survey and an audit of the health care system, with particular emphasis on chronic disease care. The information gleaned from this stage provided feedback to the staff of participating health centers. In the second stage, deficiencies in health care were identified and interventions were developed for improvements, including topics for continuing professional development.In the third stage, these strategies were piloted in a single health centre for one year and the outcomes evaluated. In the still ongoing fourth stage, the project was rolled out to all the health centers in the area, with continuing evaluation. The intervention consisted of changes to establish a structured care model based on the predicted needs of this group of patients utilizing dedicated chronic disease clinics inside the existing primary health care system. These clinics incorporated decision-making tools, including evidence-based guidelines, patient education and ongoing professional education. The intervention was successfully implemented in all the health centers. The health care quality indicators that showed the greatest improvement were the documentation of patient history (e.g. smoking status and physical activity); improvement in recording physical signs (e.g. body mass index (BMI)); and an improvement in the requesting of appropriate investigations, such as HbA1c and microalbuminurea. There was also improvement in those parameters reflecting outcomes of care, which included HbA1c, blood pressure and lipid profiles. Indicators related to lifestyle changes, such as smoking cessation and BMI, failed to improve. Chronic disease care is a joint commitment by health care providers and patients. This combined approach proved successful in most areas of the project, but the area of patient self management requires further improvement.

  4. Fabrication of surface micromachined ain piezoelectric microstructures and its potential apllication to rf resonators

    NARCIS (Netherlands)

    Saravanan, S.; Saravanan, S.; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    2005-01-01

    We report on a novel microfabrication method to fabricate aluminum nitride (AlN) piezoelectric microstructures down to 2 microns size by a surface micromachining process. Highly c-axis oriented AlN thin films are deposited between thin Cr electrodes on polysilicon structural layers by rf reactive

  5. Surface micromachined fabrication of piezoelectric ain unimorph suspension devices for rf resonator applications

    NARCIS (Netherlands)

    Saravanan, S.; Saravanan, S.; Berenschot, Johan W.; Krijnen, Gijsbertus J.M.; Elwenspoek, Michael Curt

    We report a surface micromachining process for aluminum nitride (AlN) thin films to fabricate piezoelectric unimorph suspension devices for actuator applications. Polysilicon is used as a structural layer. Highly c-axis oriented AlN thin films 1 /spl mu/m thick are deposited by rf reactive

  6. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  7. Kodumaine allhange jõuab ka siinsete tootjateni / Ain Alvela ; kommenteerinud Ardo Kalda

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Metallitööfirma OÜ Haapsalu Metal on Rootsi kapitalile kuuluv allhanketellimustele spetsialiseerunud ettevõte, mille tootevalikusse kuuluvad näiteks ka Eesti ettevõtete tellimusel valminud saetööstusseadmed, kalatööstuse automatiseeritud tootmisliinid, metsatraktorite keskliigendid, turbakaevandamiseks mõeldud masinate ümberseadistamine ning võistlusautode detailid

  8. Odnim blazhennõm dnjom : [luuletused] / Uku Masing ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Masing, Uku, 1909-1985

    1999-01-01

    Sisu: Odnim blazhennõm dnjom ; Veter tshelnok bõl ; Pesn soldat, otstupajushishih pod natiskom netshistoi silõ / tlk. Svetlan Semenenko ; "Tõ groznaja gora..." ; "Ne mozhet ditja bez ottsa naroditsja..." ; K predelam ; Vestnik iz "Magellanovõh oblakov" : katkend ; Postigaja i verja ; V kazhdom strannike - nadezhda / tlk. A. Zorin. Orig.: Ühel kaunil päeval ; Süstik on tuul ; Tontide eest taganejate sõdurite laul ; "Sa oled mägi, mida kardavad me karjad..." ; "Välja südamest visata..." ; Piiridele püüdes ; Saadik Magellani pilvest : katkend ; Mõistu saades ja uskudes ; Iga rändur on lootus

  9. Rannakalanduse tulevik sõltub varust / Ain Soome ; interv. Agnes Jürgens

    Index Scriptorium Estoniae

    Soome, Ain

    2008-01-01

    Kalapüügiseaduse muudatustest. Lisatud: kalastajad. Ilmunud ka Hiiu Leht 2. mai 2008, lk. 4 ; Oma Saar 6. mai 2008, lk. 4 ; Vooremaa 13. mai 2008, lk. 2 ; Lääne Elu 20. mai 2008, lk. 4, lisatud: taustainfo ; Harju Elu 3. juuni 2008, lk. 2 ; Peipsi Rannik = Tshudskoje Poberezhje mai 2008, lk.4, lisatud: taustinfo

  10. Saaremaa sadamate majanduslik-regionaalpoliitiline tähtsus ja arenguperspektiivid / Taavo Asuja, Ain Eidast

    Index Scriptorium Estoniae

    Asuja, Taavo

    2005-01-01

    Et puudub selgus püsiühenduse rajamise ning selle tegevuse suhtes, on raskendatud sadamate arengu pikaajaline prognoosimine ja suunamine. Autorite hinnangul oleks vaja koostada Saaremaa sadamate arengu kontseptsioon. Tabelid. Diagrammid

  11. Sulev Keedus : "Jonathan" on film esti indiaanlastest / Sulev Keedus ; interv. Ain Lember

    Index Scriptorium Estoniae

    Keedus, Sulev, 1957-

    2007-01-01

    Dokumentaalfilm "Jonathan Austraaliast" : režissöör ja operaator Sulev Keedus : F-Seitse 2007. Režissöör filmist, kaitstes end kohaliku rahva süüdistuste vastu filmis kujutatu ebaeetilisuse üle

  12. Maailmas süveneb nõudlus lehtmetallist toodete järele / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Promõshlennost 2. mai lk. 13. AS Favor on oma 17 tegevusaasta vältel teostanud allhankeid, mis on kujunenud tulusaks ja perspektiivseks äriks. Vt. samas: Tooraine tuleb hajutatud kanaleid mööda; Favori neli ärisuunda

  13. Prise en charge des hernies etranglees de l'aine en milieu ...

    African Journals Online (AJOL)

    Le délai moyen de consultation était de 2,5 jours et la nécrose intestinale était notée dans 39 cas. Un pincement latéral était observé dans 8 cas et un étranglement rétrograde en «W» dans 1 cas. La résection intestinale a été pratiquée chez les 39 patients qui avaient une nécrose. Les hernies inguinales ont été traitées par ...

  14. It Don't Mean a Thing If It Ain't Got That Swing.

    Science.gov (United States)

    Stainburn, Samantha

    2002-01-01

    Trumpeter Wynton Marsalis created a curriculum that focuses on jazz music, which he asserts can cure what ails today's students, because its unique musical characteristics (collective improvisation, call and response, solos, and unexpected rhythms) demand respect and patience as musicians listen to one another and collaborate. The article suggests…

  15. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic ...

    Indian Academy of Sciences (India)

    More than 1800 CFTR (cystic fibrosis transmembrane con- ductance regulator gene) sequence variations have been identified in the cystic fibrosis (CF) mutation database. (http://www.genet.sickkids.on.ca/cftr/). For North African populations, however, the nature and frequency of the major. CFTR mutations remain unclear, ...

  16. Kadriorg pakkus suviti tsaaritaridele glamuuri : Vene impeeriumi esimene merekuurort rajati Kadriorgu / Tiit Kask, Ain Hinsberg

    Index Scriptorium Estoniae

    Kask, Tiit

    2013-01-01

    Esimesed kümblusasutused alustasid Tallinna ümbruses tegevust 18. sajandi lõpus. 1813. a avas Georg Witte Tallinna lähistel Kadriorus oma Wittenhofi (Wittenau) suvemõisas lõbustus- ja kümblusasutuse. 1830-ndad ja 1840-ndad kujunesid Tallinna kuurortide kuldajastuks

  17. Lindora 11.-12. sajandi kääbaskalmistuantropoloogiline aines / Leiu Heapost

    Index Scriptorium Estoniae

    Heapost, Leiu, 1936-

    2006-01-01

    Kagu-Eesti seni kõige varasem laibahaudadest saadud atropoloogiline materjal pärineb Lindora kääbaskalmetest. Lindora ümarkääbastesse maetud olid morfoloogiliselt võrdlemisi sarnased, kõrge ja kitsa koljuga, pikakasvulised ja graatsiliste jäsemeluudega

  18. Tõnu Virve: filmi aines puudutas mu enda mälestusi / Tõnu Virve ; intervjueerinud Andres Laasik

    Index Scriptorium Estoniae

    Virve, Tõnu, 1946-

    2009-01-01

    Intervjuu 22. septembril Kumu auditooriumis esilinastunud dokumentaalfilmi "Monument" (Freyja Film, 2009) režissööri Tõnu Virvega. Kesksel kohal on filmis Tallinna Tõnismäe monument (skulptor Enn Roos, arhitekt Arnold Alas)

  19. 500 tudengiga aines kontrollib eksamitöid õppejõu eest arvuti / Anu Mõistlik

    Index Scriptorium Estoniae

    Mõistlik, Anu

    2003-01-01

    Tartu Ülikooli selle semestri rahvarohkeima, 500 kuulajaga sotsiaalkultuurilise psühholoogia loengukursuse lõpus kirjutasid tudengid eksamitööks valikvastustega testi, mida hakkavad kontrollima arvutid

  20. Saaremaa maaelu ja põllumajandus said mullu ligi 140 miljonit toetust / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2005-01-01

    Saare maakond sai 2004. aastal enam kui 138 miljoni krooni eest maaelu- ja põllumajandustoetusi, mis teeb iga maal elava inimese kohta 6760 krooni. Tabelid: Toetussumma maakonna lõikes; Toetussumma iga maal elava inimese kohta (kroonides)

  1. 'If it ain't broke, don't fix it': Challenges facing institutional ...

    African Journals Online (AJOL)

    The paper is based on interviews with 18 black lecturers who entered the academic workforce through the university's ADP. Employing Pierre Bourdieu's theoretical framework of social and cultural reproduction, we discuss how difficult it is to interrupt the naturalised norms and values that form part of the existing institutional ...

  2. A successful chronic care program in Al Ain-United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Al Husaini Alhusini I

    2010-02-01

    Full Text Available Abstract Background The cost effective provision of quality care for chronic diseases is a major challenge for health care systems. We describe a project to improve the care of patients with the highly prevalent disorders of diabetes and hypertension, conducted in one of the major cities of the United Arab Emirates. Settings and Methods The project, using the principles of quality assurance cycles, was conducted in 4 stages. The assessment stage consisted of a community survey and an audit of the health care system, with particular emphasis on chronic disease care. The information gleaned from this stage provided feedback to the staff of participating health centers. In the second stage, deficiencies in health care were identified and interventions were developed for improvements, including topics for continuing professional development. In the third stage, these strategies were piloted in a single health centre for one year and the outcomes evaluated. In the still ongoing fourth stage, the project was rolled out to all the health centers in the area, with continuing evaluation. The intervention consisted of changes to establish a structured care model based on the predicted needs of this group of patients utilizing dedicated chronic disease clinics inside the existing primary health care system. These clinics incorporated decision-making tools, including evidence-based guidelines, patient education and ongoing professional education. Results The intervention was successfully implemented in all the health centers. The health care quality indicators that showed the greatest improvement were the documentation of patient history (e.g. smoking status and physical activity; improvement in recording physical signs (e.g. body mass index (BMI; and an improvement in the requesting of appropriate investigations, such as HbA1c and microalbuminurea. There was also improvement in those parameters reflecting outcomes of care, which included HbA1c, blood pressure and lipid profiles. Indicators related to lifestyle changes, such as smoking cessation and BMI, failed to improve. Conclusion Chronic disease care is a joint commitment by health care providers and patients. This combined approach proved successful in most areas of the project, but the area of patient self management requires further improvement.

  3. Ain't no mountain high enough: plant invasions reaching new elevations

    Science.gov (United States)

    An& iacute Pauchard; bal; Christoph Kueffer; Hansj& ouml Dietz; rg; Curtis C. Daehler; Jake Alexander; Peter J. Edwards; Ar& eacute; Jos& eacute valo; Ram& oacute; n; Lohengrin A. Cavieres; Antoine Guisan; Sylvia Haider; Gabi Jakobs; Keith McDougall; Constance I. Millar; Bridgett J. Naylor; Catherine G. Parks; Lisa J. Rew; Tim Seipel

    2009-01-01

    Most studies of invasive species have been in highly modified, lowland environments, with comparatively little attention directed to less disturbed, high-elevation environments. However, increasing evidence indicates that plant invasions do occur in these environments, which often have high conservation value and provide important ecosystem services. Over a thousand...

  4. MTZ trügib maailma mõjukate traktoritootjate sekka : [Minski traktoritehas] / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    2016. a oma asutamise 70. aastapäeva tähistav Minski traktoritehas (MTZ) panustab viimse kümnendi jooksul jõuliselt Euroopa tingimustele ja nõuetele vastavate traktorite välja töötamisele ning tootmisele

  5. Veiko Õunpuu pälvis Euroopa Talendi auhinna / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2008-01-01

    Cannes'i filmifestivali raames toimuval Euroopa päeval antakse filmirežissöör Veiko Õunpuule üle Euroopa Talendi auhind (European Talent Prize) mängufilmiprojekti "Püha Tõnu Kiusamine" eest (produtsent Katrin Kissa). MEDIA Desk Eesti juht Anu Ernits peab seda suureks võiduks kogu Eesti filmile

  6. Ühiskondliku Leppe Sihtasutus tahab GMO üle otsustamise anda elanikele / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2005-01-01

    Ühiskondliku Leppe Sihtasutus peab mõttekaks ühineda üle-euroopalise algatusega muuta EL seadusandlust selliselt, et GMO-vabade piirkondade kehtestamiseks õigus jääb maaomanike ja ametnike asemel elanikele

  7. Ester Tuiksoo : Saksamaa on Eestile biomassi ja GMO vallas eeskujuks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Põllumajandusminister Ester Tuiksoo ja abiminister Rain Vändre kohtusid Kielis Schleswig-Holsteini liidumaa ministri dr. Christian von Boetticheriga, peateemadeks abi biomassi ja geneetiliselt muundatud kultuurtaimede kooseksisteerimise vallas

  8. 2018 : tööstust veavad keskkond ja tervis / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Arengufondi foorumil "Tööstusvedurid 2018" tõdeti, et kümne aasta pärast peab Eesti majandus olulises osas toetuma töötlevale tööstusele. Kommenteerivad: Arvo Kivikas, Heikki Mäki ja Jaanus Purga

  9. Applying of whole-tree harvesting method; Kokopuujuontomenetelmaen soveltaminen aines- ja energiapuun hankintaan

    Energy Technology Data Exchange (ETDEWEB)

    Vesisenaho, T. [VTT Energy, Jyvaeskylae (Finland); Liukkonen, S. [VTT Manufacturing Technology, Espoo (Finland)

    1997-12-01

    The objective of this project is to apply whole-tree harvesting method to Finnish timber harvesting conditions in order to lower the harvesting costs of energy wood and timber in spruce-dominant final cuttings. In Finnish conditions timber harvesting is normally based on the log-length method. Because of small landings and the high level of thinning cuttings, whole-tree skidding methods cannot be utilised extensively. The share of stands which could be harvested with whole-tree skidding method showed up to be about 10 % of the total harvesting amount of 50 mill. m{sup 3}. The corresponding harvesting potential of energy wood is 0,25 Mtoe. The aim of the structural measurements made in this project was to get information about the effect of different hauling methods into the structural response of the tractor, and thus reveal the possible special requirements that the new whole-tree skidding places forest tractor design. Altogether 7 strain gauge based sensors were mounted into the rear frame structures and drive shafts of the forest tractor. Five strain gauges measured local strains in some critical details and two sensors measured the torque moments of the front and rear bogie drive shafts. Also the revolution speed of the rear drive shaft was recorded. Signal time histories, maximum peaks, Time at Level distributions and Rainflow distributions were gathered in different hauling modes. From these, maximum values, average stress levels and fatigue life estimates were calculated for each mode, and a comparison of the different methods from the structural point of view was performed

  10. Sõjanuiad, võimusümbolid ja margapuud / Ain Mäesalu, Jüri Peets

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Artiklis käsitletakse muinas- ja keskaegsete sõjanuiade problemaatikat arheoloogiliste leidude, kirjalike allikate ja omaaegsete kunstiteoste põhjal. Eestist leitud sõjanuiapeadest, mida kasutati 12.-13. sajandil relvadena, kuid need võisid sümboliseerida ka selle omaniku kõrget staatust. 19.-20. sajandil kasutati samasuguseid metalltahukaid margapuu otsaraskusena

  11. Metsateede kasutamine eeldab naabri austamist / Ain Alvela, Ketlin Rauk ; kommenteerinud Uno Luht

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Oma seisukohti väljendavad RMK Metsaparandustalituse juhataja Margus Reimann, OÜ Iriscorp Transport juhataja Kaido Sikk, AS Karo Trans juhatuse liige Meelis Lippe, Kohila vallavanem Heiki Hepner, Hiiumaa metsaseltsi juht Aira Toss

  12. Konkurentide ees annab eelise disainiga tegelemine / Peter L. Phillips ; intervjueerinud Ain Alvela

    Index Scriptorium Estoniae

    Phillips, Peter L.

    2010-01-01

    Intervjuu rahvusvaheliselt tunnustatud disainieksperdiga tootmisettevõtete ja disainerite koostöö tähtsusest, disaineri rollist. Eksperdi sõnul on äärmiselt oluline kasutada toodete eristumiseks ja nende turustamiseks disaini, kui Eesti tootjatel on soov müüa tooteid Eestist välja

  13. "I Know There Ain't No Pigs with Wigs": Challenges of Tier 2 Intervention

    Science.gov (United States)

    Stephens, Diane; Cox, Robin; Downs, Anne; Goforth, Jennie; Jaeger, Lisa; Matheny, Ashley; Plyler, Kristi; Ray, Sandra; Riser, Lee; Sawyer, Beth; Thompson, Tara; Vickio, Kathy; Wilcox, Cindy

    2012-01-01

    As a part of Response to Intervention, for three years, ten reading interventionists provided supplemental support to readers. They formed a learning community, took an inquiry-based approach to assessment and developed a theory of what students needed to know and be able to do as readers. They addressed and learned from several other challenges:…

  14. prevalence of hepatitis B and C viruses among health care workers in Ain Shams university hospitals

    International Nuclear Information System (INIS)

    El-fouly, A.H.A.

    2005-01-01

    exposure to blood borne pathogens poses a serious risk to health care workers (HCW), since the transmission of viral hepatitis B and C to health care workers has became of worldwide concern. hepatitis B and C viruses are the most frequent occupational disease in health care service workers, HCW are defined as persons (doctors, nurses, employees, students, contractors, attending clinicians, public-safety workers, or volunteers) whose activities involve contact with patients or with blood or other body fluids from patients in a health - care, laboratory, or public-safety setting . the potential exists for blood and body fluid exposure to other workers, and the same principle of exposure management could be applied to other setting.in the united states, the prevalence of HBV and HCV among HCWs range between (6-30%) and (2.7-10%) respectively . in spain HBV prevalence is 11.6% and HCV is 28.8%. while in taiwan 16.7% of HCWs were seropositive to HBsAG and 12.7% were seropositive for HCV. In Egypt, screening of 1485 HCWs in the Ministry of health hospitals, 35% were exposed to needle sticks

  15. Detoxification Of Ochratoxin AIN Green Coffee Beans By Physical Methods With Studying Genotoxicity Of Treated Samples

    International Nuclear Information System (INIS)

    FARAG, S.A.; SHAMS EL DIEEN, N.M.M.; EL-SIDEEK, L

    2010-01-01

    Ochratoxin A (OTA) is potently nephrotoxic, teratogenic and carcinogenic, and the potency was varied markedly between species and sexes. Unfortunately, OTA are present due to mold contamination in different food stuffs such as coffee bean, therefore, the present study was carried out on collected imported coffee samples from super markets in Egypt. The isolation and identification proved presence of Penicilli sp. and Aspergillus sp. whereas the last one was dominant in two samples as A. niger and A. ochoruses. Determination of OTA by using HPLC analysis showed presence of high levels than the allowance levels in green coffee beans (more than 5 μg/kg; ppb). In addition, another group of collected samples as roasted coffee beans indicated the presence of high toxic concentrations of OTA. The study was then conducted on samples contain the highest OTA content by using some physical methods as gamma irradiation (5 and 10 kGy), charcoal (powder, granules), roasting (at 200 0 C for 7-10 min and 20 min). The results showed that proposed physical methods, mainly gamma irradiation and charcoal, could be efficient to decrease OTA in green beans coffee without produce toxic substance as well as non-significant changes in its properties. In addition, safety of resulted coffee beans after treatments were checked by ESR and genotoxicity test, which raise the preferability of gamma irradiation (10 kGy) treatment before using medium roasting to get coffee beans free from OTA

  16. Trial excavations of the northern part of the Lehmja settlement site / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain

    2004-01-01

    Hilisrauaajal on pinnaveetaseme tõus sundinud Lehmja asukaid ümber asuma Tuuleveskimäe lõuna- ja edelajalamile. 2003. aasta kaevamiste põhjal näib, et Tuuleveskimäe edelanõlvale tekkis asustus keskajal

  17. Recubrimientos protectores de TiN y AIN: comportamiento frente a temperatura

    Directory of Open Access Journals (Sweden)

    Auger, M. A.

    2006-04-01

    Full Text Available The use of ceramic materials like titanium and aluminium nitrides have experienced a great improvement in the last years due to the variety of applications they show. The use as protective coatings on industrial tools is one important application with very favorable results for the moment, as it is the use as coating molds used for different elements fabrication. One of the mostly often used techniques to deposit protective coatings is the sputtering technique, which has been used in this work. In the present study we have analysed structural and mechanical properties of TiN and AlN thin films, using X-Ray diffraction, scanning electron microscopy, nanoindentation and pin-on-disk techniques. Thermal treatments have been applied on the mentioned films, applying three different temperature values: 750oC, 850oC y 950oC. Changes in their properties before and after the treatments have been observed. TiN layers show a thermal resistance around 750oC. The thermal resistance for AlN layers is around 850oC, being also observed an improvement in their properties when applying 850ºC of thermal treatment.

    La utilización de materiales cerámicos como el nitruro de titanio o de aluminio ha experimentado una gran popularización en los últimos años gracias a su gran variedad de aplicaciones. Una importante aplicación que cuenta hasta el momento con resultados muy favorables es la de su uso como recubrimientos protectores de herramientas industriales, así como de moldes empleados en la fabricación de diferentes elementos. Una de las técnicas más utilizadas en la obtención de recubrimientos protectores es la técnica de sputtering, utilizada en este trabajo. En el presente estudio se han analizado las propiedades estructurales y mecánicas de láminas delgadas de TiN y AlN mediante las técnicas de difracción de rayos X, microscopía electrónica de barrido, nanoindentación y pin-on-disk. Dichas capas han sido sometidas a un tratamiento térmico en el que se han aplicado tres temperaturas: 750oC, 850oC y 950oC, y se han observado variaciones en sus propiedades antes y después del tratamiento. Las capas de TiN presentan una resistencia térmica en torno a 750oC. Las capas de AlN resisten hasta una temperatura en torno a 850oC, observándose además una mejoría en sus propiedades al ser sometidas a dicha temperatura de 850oC.

  18. 'If it ain't broke, don't fix it': Challenges facing institutional ...

    African Journals Online (AJOL)

    and women South Africans to develop the research skills and teaching qualifications .... of school etc. For instance, the networks established by families through social class are intergenerationally transmitted and when these children enter university, they ... In contrast, it is a 'social risk' to form social relations and networks.

  19. Katrin Pudersell kaitses farmaatsiadoktori väitekirja / Ain Raal, Elmar Arak

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2006-01-01

    3. mail 2006 kaitses farmaatsiamagister Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Tropaanalkaloidide ja riboflaviini produktsioon koera-pöörirohu (Hyoscyamus niger L.) põllu- ja koekultuurides

  20. "If It Ain't Broke, Don't Fix It"

    DEFF Research Database (Denmark)

    Blasco, Maribel; Tackney, Charles

    2013-01-01

    embedded in the hidden curriculum, which made Danish higher education effective at producing graduates with analytical and personal abilities and dispositions, such as reflexivity, curiosity, collaboration and trust that are particularly suitable for today's globalised, knowledge–based economies. We...... illustrate this by drawing on examples of changes to an education programme at a Danish business school....

  1. A Completely New Type of Actuator -or- This Ain't Your Grandfather's Internal Combustion Engine

    Science.gov (United States)

    Gore, Brian W.; Hawkins, Gary F.; Hess, Peter A.; Moore, Teresa A.; Fournier, Eric W.

    2010-01-01

    A completely new type of actuator - one that is proposed for use in a variety of environments from sea to land to air to space - has been designed, patented, built, and tested. The actuator is loosely based on the principle of the internal combustion engine, except that it is a completely closed system, only requiring electrical input, and the working fuel is water. This paper outlines the theory behind the electrolysis- and ignition-based cycle upon which the actuator operates and describes the performance capability test apparatus and results for the actuator. A mechanism application that harnessed the unit s power to twist a scaled rotor blade is also highlighted.

  2. "Ain't no one here but us social forces": constructing the professional responsibility of engineers.

    Science.gov (United States)

    Davis, Michael

    2012-03-01

    There are many ways to avoid responsibility, for example, explaining what happens as the work of the gods, fate, society, or the system. For engineers, "technology" or "the organization" will serve this purpose quite well. We may distinguish at least nine (related) senses of "responsibility", the most important of which are: (a) responsibility-as-causation (the storm is responsible for flooding), (b) responsibility-as-liability (he is the person responsible and will have to pay), (c) responsibility-as-competency (he's a responsible person, that is, he's rational), (d) responsibility-as-office (he's the responsible person, that is, the person in charge), and (e) a responsibility-as-domain-of-tasks (these are her responsibilities, that is, the things she is supposed to do). For all but the causal sense of responsibility, responsibility may be taken (in a relatively straightforward sense)-and generally is. Why then would anyone want to claim that certain technologies make it impossible to attribute responsibility to engineers (or anyone else)? In this paper, I identify seven arguments for that claim and explain why each is fallacious. The most important are: (1) the argument from "many hands", (2) the argument from individual ignorance, and (3) the argument from blind forces. Each of these arguments makes the same fundamental mistake, the assumption that a certain factual situation, being fixed, settles responsibility, that is, that individuals, either individually or by some group decision, cannot take responsibility. I conclude by pointing out the sort of decisions (and consequences) engineers have explicitly taken responsibility for and why taking responsibility for them is rational, all things considered. There is no technological bar to such responsibility. © Springer Science+Business Media B.V. 2010

  3. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic ...

    Indian Academy of Sciences (India)

    fibrosis patient. SONDESS HADJ FREDJ1, MONIA BOUDAYA1, SABRINE OUESLATI1, SAFA SAHNOUN1, CHAIMA SAHLI1,. HAJER SIALA1, KHEDIJA BOUSSETTA2, AMINA BIBI1 and TAIEB MESSAOUD1∗. 1Biochemistry Laboratory and 2Department of Pediatrics, Children's Hospital, Bab Saadoun Square 1007 Tunis, ...

  4. Kohtuotsus on õige : ['Siioni tarkade protokolli' eesti tõlke hävitamine] / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1995-01-01

    Vastukaja : Tärni, Aulis. Tuleriit kohalikust punasest kütusest // Postimees. - 1995. - 24.nov. - Lk.6; Kalmre, Vahur. Raamatute kaitseks // Postimees. - 1995. - 27.nov. - Lk. 6; Langemets, Andres. Eesti ja juudi // Postimees. - 1995. - 30.nov. - Lk.8

  5. Eesti tootjad eiravad teadlikult CE-märgistust / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 2. nov. lk. 27. Euroopa Liit nõuab ehitusmaterjalide märgistamist CE-märgistusega, kuid kontrolli puudumise tõttu ei kiirusta tootjad nõude täitmisega. Kommenteerivad Urmas Leitmäe ja Hanno Egipt. Vt. samas: CE-märgistus annab tootele garantii; Märk teavitab klienti

  6. Preliminary investigations of the southeastern section of the settlement site of Lehmja / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain, 1951-

    2007-01-01

    Seoses Tallinn-Tartu maantee rekonstrueerimisega toimusid 1985.-1986. aastal Lehmja asula lõunapoolsel alal mahukad päästekaevamised. Selgus, et tegemist on I aastatuhandest pärit asulakohaga, milliseid teatakse Eestis vähe. 2006. aasta kaevamismetoodikast ja uurimistulemustest

  7. Summertime, and the Choosin' Ain't Easy: An Ice Cream Counting Problem.

    Science.gov (United States)

    Kreith, Kurt

    1992-01-01

    Utilizes the problem of determining the number of different ice cream cones and cups that can be made from a choice of 31 flavors to investigate the concepts of combinations and permutations. Provides a set of six related problems with their answers. (MDH)

  8. Ain't I Black Too: Counterstories of Black Atheists in College

    Science.gov (United States)

    Snipes, Jeremy T.

    2017-01-01

    Increasingly Black college students are identifying as atheist, however few empirical studies in higher education and student affairs are exploring the phenomenon. This dissertation examines the question, "How do Black atheist understand their identity in college?" Using Higginbotham's Politics of Respectability and tenants of Critical…

  9. Complicações da terapia anticoagulante com warfarina em pacientes com doença vascular periférica: estudo coorte prospectivo Complications of anticoagulant therapy with warfarin in patients with peripheral vascular disease: a cohort prospective study

    Directory of Open Access Journals (Sweden)

    Fernada Cardoso Santos

    2006-09-01

    Full Text Available OBJETIVO: Estudar prospectivamente a freqüência de complicações em pacientes tratados com warfarina e acompanhados no Ambulatório de Anticoagulação da Faculdade de Medicina de Botucatu da Universidade Estadual Paulista. MÉTODOS: Pacientes sorteados entre os agendados para consulta de junho de 2002 a fevereiro de 2004. Na primeira consulta, foi preenchida ficha com dados de identificação e clínicos. A cada retorno, ou quando o paciente procurou o hospital por intercorrência, foi preenchida ficha com a razão normatizada internacional, existência e tipo de intercorrência e condições de uso dos antagonistas da vitamina K. RESULTADOS: Foram acompanhados 136 pacientes (61 homens e 75 mulheres, 99 com tromboembolismo venoso e 37 com doença arterial; 59 pacientes eram de Botucatu, e 77, de outros municípios. Foram registradas 30 intercorrências: nove não relacionadas ao uso da warfarina e 21 complicações hemorrágicas (38,8 por 100 pacientes/ano. Uma hematêmese foi considerada grave (1,9 por 100 pacientes/ano. As demais foram consideradas moderadas ou leves. Não houve óbitos, hemorragia intracraniana ou necrose cutânea. A única associação significante foi da freqüência de hemorragia com nível médio de razão normatizada internacional. CONCLUSÃO: Nossos resultados mostram a viabilidade desse tratamento em pacientes vasculares em nosso meio, mesmo em população de baixo nível socioeconômico, quando tratados em ambulatório especializado.OBJECTIVE: To prospectively study the frequency of complications in patients treated with warfarin followed at Botucatu Medical School. METHODS: Patients randomly selected among those with appointments scheduled from June 2002 to February 2004. At the first appointment, a protocol was filled with identification and clinical data. At every return or when the patient went to the hospital due to clinical events, another form was filled with the international normalized ratio, existence and type of clinical event and the conditions of use of vitamin K antagonists. RESULTS: A total of 136 patients (61 men and 75 women, were followed; 99 patients with venous thromboembolism and 37 with arterial disease; 59 were from Botucatu and 77 were from other municipalities. Thirty clinical events were registered: nine of them were not related to the use of warfarin and 21 were hemorrhagic complications (38.8 per 100 patients-year. One hematemesis was considered severe (1.9 per 100 patients-year. The others were considered moderate or mild. There were no deaths, intracranial hemorrhage or cutaneous necrosis. The only significant association was frequency of hemorrhage and average international normalized ratio level. CONCLUSION: Our results demonstrate the feasibility of this treatment in vascular patients in our country, even in socially and economically poor populations, when treated in specialized clinics.

  10. Intramural duodenal hematoma as a complication of therapy with Warfarin: a case report and literature review; Hematoma intramural duodenal como complicacao de terapia anticoagulante com Warfarin: relato de caso e revisao da literatura

    Energy Technology Data Exchange (ETDEWEB)

    Faria, Juliano [Universidade Federal de Sao Paulo (UNIFESP/EPM), SP (Brazil). Dept. de Diagnostico por Imagem]. E-mail: drjuliano@uol.com.br; Pessoa, Roberta; Hudson, Marcelo; Vitoi, Silvio; Villela, Ovidio; Torres, Jose; Paula, Mara Delgado [Hospital Marcio Cunha, Ipatinga, MG (Brazil). Servico de Diagnostico por Imagem; Bemvindo, Aloisio [Hospital Marcio Cunha, Ipatinga, MG (Brazil). Servico de Terapia Intensiva

    2004-12-01

    We report a case of a patient receiving chronic oral anticoagulant therapy with Warfarin who presented with acute intestinal obstruction. Computed tomography showed intramural duodenal hematoma. Treatment was conservative with correction of the coagulation parameters and observation. This case exemplifies the usefulness of conservative therapy and computed tomography in patients with acute small bowel obstruction receiving anticoagulant therapy. (author)

  11. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope X-ray fluorescence method

    International Nuclear Information System (INIS)

    Bakraji, E.H.; Othman, I.; Karajou, J.

    2001-01-01

    The radioisotope X-ray fluorescence method was applied to studies of the provenance of the ceramics fragments originated from the Mar-Takla site in Syria. The samples were irradiated 1000s by a 109 Cd radioisotope source and 13 elements (Ca, Ti, Mn, Fe, Zn, Ga, As, Rb, Sr, Y, Zr and Pb) were determined in 35 samples. The data were subjected to two multivariate statistical methods, cluster and principal components analysis (PCA). It was shown from the combination of the statistical techniques and the determination of elemental composition of the samples that 94% of the ceramic samples analyzed can be considered to be manufactured using two sources of raw materials

  12. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope x-ray fluorescence method

    International Nuclear Information System (INIS)

    Bakraji, E. H.; Karajou, J.; Othman, I.

    2002-01-01

    The radioisotope x-ray fluorescence method was applied to provenance studies of ceramics fragments originated from the Mar-Takla site in Syria. 35 samples were analyzed, where each sample was irradiated 1000 s by sup 1 sup 0 sup 9 Cd radioisotope source and the elements (As, Ca, fe, Ga, Nb, Mn, Pb, Rb, Sr, Ti, Y, Zn, and Zr) were determined. The data were subjected to two multivariate statistical methods, cluster and principal component analysis (PCA). The study show that 94% of the samples can be considered to be manufactured using two sources of raw materials. (Authors)

  13. Incidence, etiology, and patterns of maxillofacial fractures in ain-shams university, cairo, egypt: a 4-year retrospective study.

    Science.gov (United States)

    Mabrouk, Amr; Helal, Hesham; Mohamed, Abdel Rahman; Mahmoud, Nada

    2014-09-01

    Although there is a worldwide increase in maxillofacial trauma incidence; the pattern and etiology of these injuries varies from one country to another depending on socioeconomic, cultural, and environmental factors. This study aims to realize the epidemiological characteristics of maxillofacial fractures in our department. A retrospective cross-sectional study of all facial trauma patients admitted to our department during 2009 to 2012. Patients' data including gender, age, etiology of trauma, the pattern and demographic distribution of fractures of maxillofacial skeleton, and associated injuries were analyzed and compared with previously published data. The chi-square test was used with a p value of less than 0.05, which was considered statistically significant. There is a significant increase in maxillofacial fractures incidence in the past 2 years than former ones. There is a male predominance with highest incidence in the age group of 20 to 40 years. Road traffic accident is the most common etiological factor followed by violence. There is increase in mandibular fracture incidence compared with midface. The significant increased incidence of maxillofacial fracture due to motor car accidents and assaults in the past 2 years reflects a behavioral change within the community.

  14. "Sa, haavapuu, kesköösel valendad..." : [luuletused] / Paul Celan ; saksa k. tlk. [ja saatesõna]: Ain Kaalep

    Index Scriptorium Estoniae

    Celan, Paul, pseud., 1920-1970

    2001-01-01

    Autorist lk. 49-50. Sisu: "Sa, haavapuu, kesköösel valendad..." ; Mälestus Prantsusmaast ; Aastad sinust minuni ; Surmafuuga ; Aja silm ; Kõnevõre ; Silm, lahtine ; Zürich, "Toonekure" kohvik : Nelly Sachsile ; Psalm ; "Niitpäikesed..." ; "Maovankris, mööda..." ; "Maastik urnidega..." ; Prahas ; "Kõmin: see on..." ; "Üks hambajälg eikuskilpool..." ; "Kahinais, otsekui meie alguses..." ; Teine ; "Teie oma..." ; "See, mis meid..." ; "Lõika palvekäsi..." ; "Ma kuulen, et kirves lõi õitsema..." ; "Leht, mille puu küljest..."

  15. Tallinna Merepäevade turismikonverents käsitles mere ja linna kohtumispaiga arenguid ja arendamist / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2013-01-01

    Tallinna Sadama, linnavalitsuse, Viking Line ja EHTE poolt 12. juulil Admiraliteedi basseiniääres Merepäevade paviljonis korraldatud konverentsist "Mere ja linna kohtumispaik kui linnaruum ja sihtkoht", kus esinesid Allan Kiil, Tiit Kask, Duncan Frazer Inglismaalt, Satu Lehtonen Soomest, Anu Hallik-Jürgenstein, Peeter Pere, Heikki Mäki, Evelyn Sepp ja Ahto Ader

  16. 115 Qualité de la source Ain Hamma et effet du déversement de ses ...

    African Journals Online (AJOL)

    AKA BOKO

    Revue des Énergies. RenouvelablesCER'07 Oujda (2007) 81-84. [22] - Y. ZARHLOULE, A. RIMI, M. BOUGHRIBA, M. VERDOYA, A. CORREIA, J. CARNEIRO et A. LAHRACH. La province géothermique du Maroc Nord Oriental. Revue des Énergies Renouvelables CER'07 Oujda. (2007) 89-94. [23] - A. FEKRAOUI.

  17. Formation, structure and magnetism of the metastable defect fluorite phases AVO3.5+x (A=In, Sc)

    International Nuclear Information System (INIS)

    Shafi, Shahid P.; Lundgren, Rylan J.; Cranswick, Lachlan M.D.; Bieringer, Mario

    2007-01-01

    We report the preparation and stability of ScVO 3.5+x and the novel phase InVO 3.5+x . AVO 3.5+x (A=Sc, In) defect fluorite structures are formed as metastable intermediates during the topotactic oxidation of AVO 3 bixbyites. The oxidation pathway has been studied in detail by means of thermogravimetric/differential thermal analysis and in-situ powder X-ray diffraction. The oxidation of the bixbyite phase follows a topotactic pathway at temperatures between 300 and 400 deg. C in air/carbon dioxide. The range of accessible oxygen stoichiometries for the AVO 3.5+x structures following this pathway are 0.00≤x≤0.22. Rietveld refinements against powder X-ray and neutron data revealed that InVO 3.54 and ScVO 3.70 crystallize in the defect fluorite structure in space group Fm-3 m (227) with a=4.9863(5) and 4.9697(3)A, respectively with A 3+ /V 4+ disorder on the (4a) cation site. Powder neutron diffraction experiments indicate clustering of oxide defects in all samples. Bulk magnetic measurements showed the presence of V 4+ and the absence of magnetic ordering at low temperatures. Powder neutron diffraction experiments confirmed the absence of a long range ordered magnetic ground state. - Graphical abstract: Topotactic oxidation of AVO 3 bixbyite to AVO 3.5 defect fluorite structure followed by in-situ powder X-ray diffraction. The upper structural diagram shows a six coordinated (A/V)-O 6 fragment in bixbyite, the lower structure illustrates the same seven-fold coordinated (A/V)-O 7 cubic environment in the defect fluorite structure

  18. Saaremaal anti täiskäik LEADER-programmi käivitamiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Saaremaa Kodukandi korraldatud infopäeval sündis algatusrühm LEADER-tüüpi arendustegevuse ettevalmistamiseks maakonnas. Tabel: Saaremaa algatusrühma tegevuskava LEADER-tüüpi maapiirkondade arendustegevuse ettevalmistamiseks

  19. Effects of AIN457, a Fully Human Antibody to Interleukin-17A, on Psoriasis, Rheumatoid Arthritis, and Uveitis

    NARCIS (Netherlands)

    Hueber, Wolfgang; Patel, Dhavalkumar D.; Dryja, Thaddeus; Wright, Andrew M.; Koroleva, Irina; Bruin, Gerard; Antoni, Christian; Draelos, Zoe; Gold, Michael H.; Durez, Patrick; Tak, Paul P.; Gomez-Reino, Juan J.; Foster, C. Stephen; Kim, Rosa Y.; Samson, C. Michael; Falk, Naomi S.; Chu, David S.; Callanan, David; Nguyen, Quan Dong; Rose, Kristine; Haider, Asifa; Di Padova, Franco

    2010-01-01

    Interleukin-17A (IL-17A) is elaborated by the T helper 17 (T(H)17) subset of T-H cells and exhibits potent proinflammatory properties in animal models of autoimmunity, including collagen-induced arthritis, experimental autoimmune encephalomyelitis, and experimental autoimmune uveitis. To

  20. It "Ain't" Always So: Sixth Graders' Interpretations of Hispanic-American Stories with Universal Themes

    Science.gov (United States)

    Rice, Peggy S.

    2005-01-01

    This article examines the responses of eight sixth grade students discussing four realistic fiction Hispanic-American multicultural stories with universal themes by Gary Soto in peer-led literature discussion groups. The results indicate the importance of a reader's sociocultural frame--class, race, and gender, on their interpretation of…

  1. Merle Karusoo uue tüki aines pärineb lõpukirjandist / Garel Püüa

    Index Scriptorium Estoniae

    Püüa, Garel

    2006-01-01

    Merle Karusoo alustab proove eesti ja vene koolide õpilaste lõpukirjandite põhjal koostatud lavastusega. Septembris Draamateatris esietenduva Karusoo lavastuse tööpealkiri on "Küpsuskirjand 2005"

  2. Merle Karusoo uue tüki aines pärineb lõpukirjanditest / Garel Püüa

    Index Scriptorium Estoniae

    Püüa, Garel

    2006-01-01

    Lavastaja Merle Karusoo alustab peagi proove lavastusega, mis on koostatud õpilaste lõpukirjandite põhjal. Käsitletavad kirjanditeemad on venekeelsetelt lõpetajatelt ́ђجSeda maad nimetan ma kodumaakśђح ja eestlastelt ́ђجRahvussuhted 21. sajandiĺђح

  3. Hydride vapor phase epitaxy growth of GaN, InGaN, ScN, and ScAIN

    NARCIS (Netherlands)

    Bohnen, T.

    2010-01-01

    Chemical vapor deposition (CVD); hydride vapor phase epitaxy (HVPE); gallium nitride (GaN); indium gallium nitride (InGaN); scandium nitride (ScN); scandium aluminum nitride (ScAlN); semiconductors; thin films; nanowires; III nitrides; crystal growth - We studied the HVPE growth of different III

  4. Söötmisega disainitud piim tagab tervisliku toidukraami / Ene Tammsaar ; intervjueerinud Ain Alvela ; kommenteerinud Üllas Jaaska

    Index Scriptorium Estoniae

    Tammsaar, Ene, 1952-

    2014-01-01

    Et farmidest tööstusse minevast toorpiimast saaks toota maitsvaid ja tervislikke tooteid, peab toorpiim olema kõrgeima võimaliku kvaliteediga. Selle tagamiseks on piimatööstused koostöös teadlastega ette võtnud piima koostise disainimise

  5. Nahast küünarvarrekaitsmed keskaegsest Tartust / Ain Mäesalu, Jüri Peets, Elna Haiba

    Index Scriptorium Estoniae

    Mäesalu, Ain

    2008-01-01

    2000. aastal Tartust leitud 14. sajandi lõpukümnenditest või 15. sajandi algusest pärinevatest küünarvarrekaitsmetest. Keskaegsest kaitsevarustusest, Tartu küünarvarrekaitsmete valmistamistehnikast, nende kahjustustest ja konserveerimisest

  6. Küttimine võib septembris peatuda. Maaomanikud vs. jahimehed / Ain Alvela ; kommenteerinud Heiki Hepner, Val Rajasaar

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Maksumaksjad ja maaomanikud toetavad Eesti jahindust sisuliselt viie miljoni euroga aastas, kuigi keskkonnaspetsialistide hinnangul võiks asi olla vastupidi. Kehtiv jahiseadus ei aita kaasa metsa väärtuse parandamisele. Tabelid

  7. Kultuuriaasta väljapaistvaimaks sündmuseks osutus kirjandusfestival / Ly Brikkel, Ain Mäeots ; interv. Raimu Hanson

    Index Scriptorium Estoniae

    Brikkel, Ly

    2005-01-01

    Aasta parimaks harrastuslikuks koosluseks tunnistati näitemänguselts Vilde Teater (projektijuht L. Brikkel, lavastus "Tagahoov"), aasta looja nimetuse pälvis A. Mäeots ("Mullatoidu restoran)" jt. Tartu Kultuurkapitali nõukogu määras aastapreemia 50000 krooni H. Elvistele ja L. Eelmäele

  8. Twin City - past 1823-2013 : EHTE ja Haaga-Helia ühisprojekt / Tiit Kask, Ain Hinsberg

    Index Scriptorium Estoniae

    Kask, Tiit

    2012-01-01

    Turismikoolide ühisprojektist "Twin City - Empowering & Designing Twin-Capital Destination - Past, Present and Future of Tourism in Greater-Helsinki and Greater-Tallinn Area", mille eesmärgiks on Tallinna ja Helsingi kui ühtse turismisihtkoha käsitluse loomine ja 26. aprillil Tallinnas toimunud seminarist "TwinCity Helsinki-Tallinn / Tallinn & Estonian tourism 1813-2013", mis kutsus üles tähistama Tallinna (Kadrioru) merekuurordi ja "Eesti Turismimajandus 200" juubelit 2013. aastal

  9. Keskkonnakaitsjad pakuvad välja abinõud GMO saaste vältimiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Eesti Keskkonnaühenduste Koda esitas ettepanekud tagamaks geneetiliselt muundatud põllumajanduskultuuride kasvatamise selliselt, et need ei tekitaks kahju tava- ja mahepõllumeestele. Vt. samas: Põllumajandusminister Ester Tuiksoo kommentaar EKO ettepanekutele. Vt. samas: Eesti ilmselt toetab geenmuundatud taimede lubamist Euroopa Liitu ja lühiinterv. põllumajandusministeeriumi taimetervise osakonna juhataja Tambet Sovaga. Vt. ka lk. 5: Nastja Pertsjonok. GMO keskkonnakaitsja pilgu läbi

  10. Method 445.0 In Vitro Determination of Chlorophyll a and Pheophytin ain Marine and Freshwater Algae by Fluorescence

    Science.gov (United States)

    This method provides a procedure for low level determination of chlorophyll a (chl a) and its magnesium free derivative, pheophytin a (pheo a), in marine and freshwater phytoplankton using fluorescence detection.(1,2) Phaeophorbides present in the sample are determined collective...

  11. Development of Production PVD-AIN Buffer Layer System and Processes to Reduce Epitaxy Costs and Increase LED Efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cerio, Frank

    2013-09-14

    The DOE has set aggressive goals for solid state lighting (SSL) adoption, which require manufacturing and quality improvements for virtually all process steps leading to an LED luminaire product. The goals pertinent to this proposed project are to reduce the cost and improve the quality of the epitaxial growth processes used to build LED structures. The objectives outlined in this proposal focus on achieving cost reduction and performance improvements over state-of-the-art, using technologies that are low in cost and amenable to high efficiency manufacturing. The objectives of the outlined proposal focus on cost reductions in epitaxial growth by reducing epitaxy layer thickness and hetero-epitaxial strain, and by enabling the use of larger, less expensive silicon substrates and would be accomplished through the introduction of a high productivity reactive sputtering system and an effective sputtered aluminum-nitride (AlN) buffer/nucleation layer process. Success of the proposed project could enable efficient adoption of GaN on-silicon (GaN/Si) epitaxial technology on 150mm silicon substrates. The reduction in epitaxy cost per cm{sup 2} using 150mm GaN-on-Si technology derives from (1) a reduction in cost of ownership and increase in throughput for the buffer deposition process via the elimination of MOCVD buffer layers and other throughput and CoO enhancements, (2) improvement in brightness through reductions in defect density, (3) reduction in substrate cost through the replacement of sapphire with silicon, and (4) reduction in non-ESD yield loss through reductions in wafer bow and temperature variation. The adoption of 150mm GaN/Si processing will also facilitate significant cost reductions in subsequent wafer fabrication manufacturing costs. There were three phases to this project. These three phases overlap in order to aggressively facilitate a commercially available production GaN/Si capability. In Phase I of the project, the repeatability of the performance was analyzed and improvements implemented to the Veeco PVD-AlN prototype system to establish a specification and baseline PVD-AlN films on sapphire and in parallel the evaluation of PVD AlN on silicon substrates began. In Phase II of the project a Beta tool based on a scaled-up process module capable of depositing uniform films on batches of 4”or 6” diameter substrates in a production worthy operation was developed and qualified. In Phase III, the means to increase the throughput of the PVD-AlN system was evaluated and focused primarily on minimizing the impact of the substrate heating and cooling times that dominated the overall cycle time.

  12. "It ain't all as bad as it may seem": young Black lesbians' responses to sexual prejudice.

    Science.gov (United States)

    Reed, Sarah J; Valenti, Maria T

    2012-01-01

    This article explores the ways in which young, Black lesbians manage their sexual minority identity when experiencing sexual prejudice. Fourteen Black lesbians between the ages of 16 and 24 participated in semistructured interviews. Instances of sexual prejudice and the young women's responses were thematically analyzed using open and axial qualitative coding techniques. Results indicated that participants experienced sexual prejudice frequently and even within the lesbian community. Responses to sexual prejudice included: cognitive reframing of heterosexist messages, passing, gaining support from self-created gay families, and fighting back (physically and verbally) in the event of isolated instances of sexual prejudice. Analysis focuses on how gender identity relates to experiences of sexual prejudice and identity management strategies. Findings suggest that there are parallels between the management strategies of these women and young, Black gay and bisexual males and between these women and Black women who are coping with sexism and racism.

  13. Lootus : [luuletused] / Friedrich Schiller ; tlk. Ain Kaalep, Rein Sepp, Paul Viiding, Eduard Roos, Jaan Kross, Jakob Tamm

    Index Scriptorium Estoniae

    Schiller, Friedrich, 1759-1805

    2006-01-01

    Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239

  14. Tootest olulisemaks saab ärimudel. Kandiline arbuus tavalisest 30 korda kallim / Ain Alvela ; kommenteerinud Janek Kalvi

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Eesti Arengufondi juhatuse esimehe Ott Pärna, ASi Kalev Chocolate Factory juhataja Kaido Kaare ja ASi Balsnack International Holding juhatuse esimehe Elmar Rusingu ettekannetest toiduainetööstuse aastakonverentsil "Uue tõusu ootuses". Graafik

  15. In-situ metrology in multiwafer reactors during MOVPE of AIN-based UV-LEDs (Conference Presentation)

    Science.gov (United States)

    Knauer, Arne; Brunner, Frank; Kolbe, Tim; Hagedorn, Sylvia; Kueller, Viola; Weyers, Markus

    2017-02-01

    UV-LEDs are of great interest for applications like disinfection, gas sensing, and phototherapy. The cost sensitive LEDs are commonly grown by MOVPE on transparent AlN/sapphire templates. The large thermal and lattice mismatch between AlN and sapphire generates a very high dislocation density (DD) and causes big challenges in strain management. The threading dislocation density should be reduced to the order of low 108cm-2 for high internal efficiency of the AlGaN based UV-LED structures. The TDD will be reduced mainly by dislocation annihilation during the growth of thick Al(Ga)N layers, which is a challenge in terms of strain management. We present how in-situ reflectometry and curvature measurement (EpiCurveTT(at)LayTec) in commercial multiwafer growth reactors helps to optimize the growth processes concerning growth rates, surface roughening and avoidance of layer cracking on 2inch substrates and enhance the reproducibility of epitaxial growth. The growth of up to 3 μm thick planar AlN templates and up-to 10 μm thick AlN/sapphire templates by epitaxial lateral overgrowth of stripe patterned templates for UV-C LED structures will be highlighted. The implementation of different types of AlN/GaN superlattices for the subsequent growth of up to 5μm thick Al0.5Ga0.5N layer for UVB LED structures will be shown. Correlations to ex-situ measurements like X-ray diffraction and TEM analysis of defects in the LED structures will be shown. Some challenges of in-situ control through very narrow viewports as in Close Coupled Showerhead reactors will be discussed as well as the influence of silicon doping on curvature and dislocation density in Al(Ga)N layers.

  16. Päästetute koor : [luuletused] / Nelly Sachs ; saksa k. tlk. [ja järelsõna:] Ain Kaalep

    Index Scriptorium Estoniae

    Sachs, Nelly

    2003-01-01

    Sisu: Päästetute koor ; Kes aga tühjendas liivast teie kingad ; Et jälitatuist ei saaks jälitajad ; Sündmatute koor ; Liblikas ; Maailma rahvad ; Valmis on kõik maad ; Nii üksildane on inimene

  17. Õpilaste teadlikkus E-ainetest ja karastusjookides olevad E-ained / Dorel Donner ; juhendanud Karin Tuul

    Index Scriptorium Estoniae

    Donner, Dorel

    2014-01-01

    Räpina ühisgümnaasiumi 11. kl. õpilase uurimistööst, milles antakse ülevaade E-ainetest, nende kasutusaladest, eeldatavatest kõrvalmõjudest ning gümnaasiumiastme õpilaste karastusjookide tarbimise harjumustest ja üldisest E-ainetega seotud teadlikkusest

  18. Läti elanikud NSVL SARK filterlaagrites 1944-1948 (allikate ülevaade) / Ainārs Bambals

    Index Scriptorium Estoniae

    Bambals, Ainārs, 1964-

    2010-01-01

    Läti filtreerimise kontroll-koondamispunktid olid Riias, Daugavpilsis, Jelgavas, Kuldīga, Liepājas, Skrundas, Tukumsis, Vāiņodes, Ventspilsis, Ugāles. Pärast Teist maailmasõda allutati filtreerimisele 91 000 Läti elanikku

  19. Your tooth it ain't so purty but it's gen-u-ine: Cole Porter's comic song "Snagtooth Gertie".

    Science.gov (United States)

    Christen, Arden G; Christen, Joan A

    2010-01-01

    Cole Porter (1891-1964), an American musical icon, has been internationally acknowledged as one of the most cosmopolitan, sophisticated, elegant and influential composer-lyricists of the 20th century. Born in Indiana and raised in wealth and privilege, he attended both Yale and Harvard universities where he honed his song-writing skills. In his 800 tunes, many of which became smash hits, he blended fresh, witty, urbane and colloquial lyrics with catchy, singable melodies. He composed musical scores for both Broadway stage and Hollywood movies, but focused on the former. While Porter enjoyed penning comic songs, he rarely had them published. In 1946, Cole wrote the music and lyrics for a Broadway show entitled Around the World in Eighty Days. Deemed a failure, it closed after only 75 performances. One light-hearted ditty, "Snagtooth Gertie", which he composed for the show, was never used. The lyrics are presented for the first time in this paper.

  20. It ain't what you say, it's how you say it: linguistic and cultural diversity in the classroom.

    Science.gov (United States)

    Robinson, Cynthia Cole; Clardy, Pauline

    2011-01-01

    The disparity between the cultural and linguistic diversity of the teaching population and the student population continues to grow as teacher education programs enroll and graduate primarily white teacher candidates (83.7%). At the same time, the diversity of the K-12 student body has increased with 65% of public school students being from culturally and linguistically diverse backgrounds (National Center for Education Statistics, 2007). This chasm between the diversity of the teaching force and student population is of concern as many teachers report that they do not have the cultural knowledge and experience of working or living in diverse environments, yet will be faced with teaching a very diverse student population. Hence, the need for teacher candidates and current teachers to be explicitly taught the skills needed to successfully teach diverse student populations is urgent. In this article, we explore the following phenomena: how linguistic and cultural diversity is regarded in teacher education programs, as well as teacher candidates' and current K-12 teachers' dispositions towards students who do not share their cultural backgrounds or language (including those who vary in their dialects). Finally, we will present strategies that teacher educators can use to embrace and empower culturally and linguistically diverse (CLD) teacher candidates, as well as prepare teacher candidates to teach diverse student populations.

  1. Piimandus: laenukarid, ikaldused ja hinnaralli tõid kriisi / Ain Alvela ; kommenteerinud Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2009-01-01

    Kuigi piimatootmisega tegelevad ettevõtted vajaksid tegevuse arendamiseks hädasti investeeringuid, jäävad enamiku rahastamisplaanid paremaid aegu ootama. Diagramm. Kommenteerivad Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

  2. Antisymmetric entangled two-photon states generated in nonlinear GaN/AIN photonic-band-gap structures

    Czech Academy of Sciences Publication Activity Database

    Peřina ml., Jan; Centini, M.; Sibilia, C.; Bertolotti, M.; Scalora, M.

    2007-01-01

    Roč. 75, č. 1 (2007), 013805/1-013805/1 ISSN 1050-2947 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : parametric down-conversion * quantum teleportation * interference * indistinguishability * dispersion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.893, year: 2007

  3. Estudio de mezclas de disolventes orgánicos y trigliceridos de aceite de linaza o los ácidos grasos libres. II.- Aplicación a la viscosidad de las ecuaciones de Andrade, Krone, McAllister e Hildebrand

    OpenAIRE

    Mantell Serrano, C.; Muñoz Cueto, M. J.; Galán Vallejo, M.; Rodríguez Rodríguez, M.

    1995-01-01

    A regression study of Andrade, Krone, McAllister and Hildebrand equations with experimental data of viscosity of mixtures of triglycerides or free fatty acids and trichloroethylene, tetrachloroethylene and hexane was carried out. Temperature range studied was 278-313 K in steps of 5K.
    The results showed that the Hildebrand equation presents the best fit for all the viscosity data of the mixtures studied, tending towards a lineal or parabolic function of its parameters.
    ...

  4. Estudio de mezclas de disolventes orgánicos y trigliceridos de aceite de linaza o los ácidos grasos libres. II.- Aplicación a la viscosidad de las ecuaciones de Andrade, Krone, McAllister e Hildebrand

    Directory of Open Access Journals (Sweden)

    Mantell Serrano, C.

    1995-10-01

    Full Text Available A regression study of Andrade, Krone, McAllister and Hildebrand equations with experimental data of viscosity of mixtures of triglycerides or free fatty acids and trichloroethylene, tetrachloroethylene and hexane was carried out. Temperature range studied was 278-313 K in steps of 5K.
    The results showed that the Hildebrand equation presents the best fit for all the viscosity data of the mixtures studied, tending towards a lineal or parabolic function of its parameters.
    Andrade and Krone equations presented acceptable fits for all mixtures studied except the fatty acids and hexane mixture. The McAllister equation was applicable only to mixtures with tetrachloroethylene.

    Se ha realizado el estudio de regresión de las ecuaciones de Andrade, Krone, McAllister e Hildebrand con datos experimentales de viscosidad de mezclas de triglicéridos o ácidos grasos libres con tricloroetileno, tetracloroetileno y hexano en el intervalo de temperaturas de 278 a 313 K cada 5 K.
    Los resultados obtenidos indican que el mejor ajuste de los datos experimentales de viscosidad lo presenta la ecuación de Hildebrand, buscándose una función lineal o parabólica con la fracción molar de sus dos parámetros.
    Las ecuaciones de Andrade y Krone presentan un ajuste aceptable para todas las mezclas estudiadas excepto para las de ácidos grasos en hexano y la ecuación de McAllister es únicamente aplicable a las mezclas con tetracloroetileno.

  5. 'If it ain't broke, don't fix it?': scandals, 'risk', and cosmetic surgery regulation in the UK and France.

    Science.gov (United States)

    Latham, Melanie

    2014-01-01

    The recent PIP scandal that affected patients worldwide, and received extensive media coverage, led to concerns being felt by patients about the 'risks' of cosmetic surgery. Theories about regulation and risk refer to societies such as those in the West becoming more risk averse. Regulation, in turn, has come to be seen as an instrument to solve a problem for a community seen to be or which perceives itself to be at risk. The political and electoral risk acknowledged by government if it ignores that concern, or at least media coverage of it, can lead to regulation, or the tightening up of regulation, as a response. This article looks at current proposals for legislation in the UK following the PIP silicone implant scandal as an example of the risk-regulation premise. Are cosmetic surgery patients in the UK now going to see stricter regulation of the cosmetic surgery industry? The article argues that the UK and France have both reacted to healthcare scandals and the ensuing societal conception of risk by drawing up more thorough legislation on cosmetic surgery than previously existed. France enacted the Kouchner law in 2002 and the UK government published the Keogh Report in April 2013. A comparison is made of these to establish whether the UK can learn from the French legislation when it comes to drafting actual regulation in the future, perhaps in 2014. Finally, some arguments are made about whether risk aversion may make better law. © The Author [2014]. Published by Oxford University Press; all rights reserved. For Permissions, please email: journals.permissions@oup.com.

  6. Õnnistus : [luuletused] / Charles Baudelaire ; tlk. Johannes Semper, Ants Oras, August Sang, Ilmar Laaban, Ain Kaalep, Indrek Hirv, Jaan Kross

    Index Scriptorium Estoniae

    Baudelaire, Charles, 1821-1867

    2006-01-01

    Sisu: Õnnistus ; Albatross ; Ülenemine ; Vastavusi ; Kutse teekonnale ; Muusika ; Elav tungal ; Vaenlane ; Ebaõnn ; Mees ja meri ; Ilu ; Hiigelnaine ; Hümn ilule ; Kalliskivid ; Eksootiline lõhn ; Raibe ; Vampiir ; Pihtimus ; Kass ; Mis ütled, vaene hing ; Lõhnapudel ; Sume laotus ; Kutse teele ; Sügissonett ; Öökullid ; Olematuse maitse ; Spliin : "Mu mälestuste last on nii painajalik..." ; Spliin : "Ma olen nii kui vürst, vürst sajulisel maal..." ; Mõrane kell ; "Nagu põhjatu taevas, öös tummuv ja mustav..." ; Kell ; Maastik ; Päike ; Punajuukselisele kerjustüdrukule ; Luik ; Hämarus ; Mäng ; Somp ja udud ; Pariisi unenägu ; Hommikuhämarik ; Üksildaste vein ; Üks märtritar ; Beatrice ; Aabel ja Kain ; Armastajate surm ; Vaeste surm ; Matk ; Lunahind ; Ühe pilgu lubadused. Eluloolisi andmeid autori kohta lk. 703

  7. Mass movement susceptibility mapping - A comparison of logistic regression and Weight of evidence methods in Taounate-Ain Aicha region (Central Rif, Morocco

    Directory of Open Access Journals (Sweden)

    JEMMAH A I

    2018-01-01

    Full Text Available Taounate region is known by a high density of mass movements which cause several human and economic losses. The goal of this paper is to assess the landslide susceptibility of Taounate using the Weight of Evidence method (WofE and the Logistic Regression method (LR. Seven conditioning factors were used in this study: lithology, fault, drainage, slope, elevation, exposure and land use. Over the years, this site and its surroundings have experienced repeated landslides. For this reason, landslide susceptibility mapping is mandatory for risk prevention and land-use management. In this study, we have focused on recent large-scale mass movements. Finally, the ROC curves were established to evaluate the degree of fit of the model and to choose the best landslide susceptibility zonation. A total mass movements location were detected; 50% were randomly selected as input data for the entire process using the Spatial Data Model (SDM and the remaining locations were used for validation purposes. The obtained WofE’s landslide susceptibility map shows that high to very high susceptibility zones contain 62% of the total of inventoried landslides, while the same zones contain only 47% of landslides in the map obtained by the LR method. This landslide susceptibility map obtained is a major contribution to various urban and regional development plans under the Taounate Region National Development Program.

  8. Mars ain't the kind of place to raise your kid: ethical implications of pregnancy on missions to colonize other planets.

    Science.gov (United States)

    Schuster, Haley; Peck, Steven L

    2016-12-01

    The colonization of a new planet will inevitably bring about new bioethical issues. One is the possibility of pregnancy during the mission. During the journey to the target planet or moon, and for the first couple of years before a colony has been established and the colony has been accommodated for children, a pregnancy would jeopardize the safety of the crew and the wellbeing of the child. The principal concern with a pregnancy during an interplanetary mission is that it could put the entire crew in danger. Resources such as air, food, and medical supplies will be limited and calculated to keep the crew members alive. We explore the bioethical concerns of near-future space travel.

  9. Perforated Peptic Ulcer: Different Ethnic, Climatic and Fasting Risk Factors for Morbidity in Al-Ain Medical District, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Fawaz Chikh Torab

    2009-04-01

    Conclusion: Patients with dyspeptic symptoms and a history of previous PUD should be considered for prophylactic treatment to prevent ulcer recurrence during prolonged daytime fasting in Ramadan, especially during the winter time.

  10. A nickel ain't worth a dime anymore: the illusion of money and the rapid encoding of its true value.

    Directory of Open Access Journals (Sweden)

    Rongjun Yu

    Full Text Available People often evaluate money based on its face value and overlook its real purchasing power, known as the money illusion. For example, the same 100 Chinese Yuan can buy many more goods in Tibet than in Beijing, but such difference in buying power is usually underestimated. Using event related potential combined with a gambling task, we sought to investigate the encoding of both the real value and the face value of money in the human brain. We found that the self-reported pleasantness of outcomes was modulated by both values. The feedback related negativity (FRN, which peaks around 250ms after feedback and is believed to be generated in the anterior cingulate cortex (ACC, was only modulated by the true value but not the face value of money. We conclude that the real value of money is rapidly encoded in the human brain even when participants exhibit the money illusion at the behavioral level.

  11. "That Ain't No Ninja Turtles": The Prevalence and Influence of Popular Culture in the Talk and Writing of Prekindergarten Children

    Science.gov (United States)

    Kissel, Brian T.

    2011-01-01

    This article describes how 2 classrooms of 4-year-old children incorporated popular media (cartoons, television shows, video games, movies, and music) into their conversations with peers during writing. The findings assert that (a) children naturally incorporate popular culture into their writing, (b) children include popular culture in their…

  12. Maastikusõiduk UTV aitab tööd teha ja lõõgastuda / Ain Alvela ; kommenteerinud Tanel Rütman

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Analoogselt ATVga (ingl k All Terrain Vehicle - iga maastiku sõiduk) võib ka UTVd (ingl k Utility Terrain Vehicle - vahend maastikul liikumiseks) käsitleda nii tarbesõidukina väiksemate maatööde tegemiseks või raskestiläbitaval maastikul liikumiseks kui ka lihtsalt adrenaliinilaksu pakkuva meelelahutajana

  13. Paneeldiskussioon (fonogrammilt lühendatult) / Ain Heinaru, Rein Vaikmäe, Rein Raud, Hardi Tullus, Urve Lippus, Andres Tali, Martin Zobel

    Index Scriptorium Estoniae

    2006-01-01

    Projekti "Eesti doktoriõppe kvaliteedi, tulemuslikkuse ja jätkusuutlikkuse tagamise süsteem" (2005-2008) II konverentsi "Doktorid Eesti tuleviku arengumootoriks" paneeldiskussioonist, millel arutleti doktoriõppe rahastamise ning doktoriõppe korralduse ja doktorandi juhendamise teemadel

  14. Kuidas on läinud vene koolide eestikeelsele aineõppele üleminek? / Natalja Lapikova, Vjatšeslav Gussarov, Irene Käosaar

    Index Scriptorium Estoniae

    Lapikova, Natalja

    2008-01-01

    Küsimusele vastavad Tallinna Haridusameti hariduskorralduse teenistuse üldhariduse osakonna vanemspetsialist Natalja Lapikova, Tallinna Kesklinna Vene Gümnaasiumi direktor Vjatšeslav Gussarov ja HTM-i rahvusvähemuste hariduse osakonna juhataja Irene Käosaar

  15. "A 28-Day Program Ain't Helping the Crack Smoker" -- Perceptions of Effective Drug Abuse Prevention Interventions by North Central Florida African Americans Who Use Cocaine

    Science.gov (United States)

    Brown, Emma J.; Hill, Mary Angelique; Giroux, Stacey A.

    2004-01-01

    Cocaine is a major problem in the rural South, but knowledge is limited regarding the impact on African American populations. Purpose: This study of 18-39-year-old black drug users assessed perceptions of contributing factors to drug use and possible interventions. The study design was qualitative-descriptive, utilizing 4 focus groups with 5 rural…

  16. Measurement of the spin rotation parameter Ain the elastic pion-proton scattering at 1.43 GeV/c

    Science.gov (United States)

    Alekseev, I. G.; Bazhanov, N. A.; Budkovsky, P. E.; Bunyatova, E. I.; Kanavets, V. P.; Kovalev, A. I.; Koroleva, L. I.; Kruglov, S. P.; Morozov, B. V.; Nesterov, V. M.; Novinsky, D. V.; Ryltsov, V. V.; Shchedrov, V. A.; Sulimov, A. D.; Sumachev, V. V.; Svirida, D. N.; Trautman, V. Yu; Zhurkin, V. V.

    2006-02-01

    The ITEP-PNPI collaboration presents new results of the measurements of the spin rotation parameter A in the elastic scattering of negative pions on protons at P beam = 1.43 GeV/c. The results are compared to the predictions of several partial wave analyses. The experiment was performed at the ITEP proton synchrotron, Moscow.

  17. "There Ain't No Accounting for What Folks See in Their Own Mirrors": Considering Colorism within a Sharon Flake Narrative

    Science.gov (United States)

    Brooks, Wanda; Browne, Susan; Hampton, Gregory

    2008-01-01

    This article describes a study of both textual and reader response analyses of "The Skin I'm In" by Sharon Flake. Because gender and race constitute central themes in the narrative, Black feminist thought and feminism undergirded the textual critique. Critics' reviews, scholarly articles, and published author interviews also supported the textual…

  18. "That Ain't Going to Get You a Professorship": Discourses of Writing and the Positioning of Academics' Work with Student Writers in UK Higher Education

    Science.gov (United States)

    Tuck, Jackie

    2016-01-01

    A growing body of academic literacies research has enhanced our understanding of university writing as contested, institutionally situated practice with important consequences, particularly for students as they learn to negotiate the writing demands of university study. Less empirical attention has been paid to the practices of subject academics…

  19. "It Ain't Much, but It's All I Got." The Rural Homelessness Project: A Study of Living Conditions in Two Rural West Virginia Counties.

    Science.gov (United States)

    Spence, Beth

    Many poor families in rural West Virginia live in unsafe, unsanitary structures that do not protect them from the elements, but these families are not considered officially homeless. Lincoln and Clay Counties are very rural, traditionally poor areas, with 45% of their populations receiving welfare and much larger proportions receiving food stamps.…

  20. It Don't Mean a Thing if It Ain't Got Musicality: A Music-First Method for Teaching Historically Rooted Jazz Dance

    Science.gov (United States)

    Liebhard, Erinn

    2015-01-01

    This article proposes a method for teaching jazz dance technique according to music concepts and prioritizing deep embodiment of music. This method addresses what can be seen as a disconnect between current practices and historical understanding in jazz dance today, a gap that can be bridged with education empowering students to make innovative…

  1. Koos Ain Mäeotsaga avasite Londonis The Ragged Schooli galeriis möödunud reedel näituse "Mullatoidu restoran" / Peeter Laurits ; interv. Eero Epner

    Index Scriptorium Estoniae

    Laurits, Peeter, 1962-

    2004-01-01

    The Ragged Schooli galerii näitusekorraldusest, nendepoolsest projekti tutvustamisest, näituse avamisest. Ajaleht "Sunday Times" noomis galeriste enne näituse avamist selle eest, et väljas on õudsed, surma käsitlevad pildid

  2. Kõrghoone "Tower" Tallinnas, Tartu mnt. ja Pääsukese tänava nurgal. Projekt, 1996. Arhitektid Vilen Künnapu ja Ain Padrik

    Index Scriptorium Estoniae

    1997-01-01

    32-korruselise torni neljal esimesel korrusel on kaubamaja, järgmisel viiel korrusel parkla, siis tehnilise korruse järel on 14 korrusel bürooruumid, seejärel viiel korrusel korterid, järgnevastel korrustel bürood, restoran, baar jm.

  3. Contribution à l'étude des techniques de multiplication arboricole dans la ferme de démonstration ITAFV. Ain Temouchent

    OpenAIRE

    BOURICHA, Rym

    2015-01-01

    L'utilisation des porte-greffes en viticulture est devenue indispensable depuis l'invasion phylloxérique de 1885 en Algérie. Les vignes de Vitis Vin jfera cultivées à l'époque « franc de pied » ont été décimées une à une par les dégâts importants occasionnés par l'insecte sur les racines, entrainant à plus ou moins brève échéance la mort des ceps. Le greffage sur des porte-greffes résistants d'origine américaine (Riparie, Rupestris, Bericindieri) est devenu ainsi indispensable et ...

  4. Justiitsminister Langi umbusaldamine kogub hoogu / Tuuli Koch; kommenteerinud Andrus Ansip, AIn Seppik, Valdur Lahtvee, Karel Rüütli, Andres Herkel, Sven Mikser

    Index Scriptorium Estoniae

    Koch, Tuuli

    2009-01-01

    Reformierakonna valitsuspartner IRL ja opositsioon ei mõista justiitsminister Rein Langi otsust ajutise siseministrina kustutada küberrünnakuga seotud Sergei Markovi nimi Schengeni mustast nimekirjast

  5. It ain't over when it's over: The adoption and sustainability of minority protection rules in new EU member states

    Directory of Open Access Journals (Sweden)

    Liudmila Mikalayeva

    2009-12-01

    Full Text Available This paper conducts a multi-value Qualitative Comparative Analysis (QCA of the formal adoption and sustainability of minority protection rules in four new EU member states (Poland, Romania, Estonia, Latvia over a twelve-year period including pre- and post-accession phases (1997-2008 and five minority protection related issue areas (non-discrimination, language use, education, citizenship, integration of Roma based on four conditions (external incentives, government position, veto players, size of minorities, in order to investigate under which external and domestic conditions minority protection and non-discrimination measures are adopted, maintained or revoked in new member states before and after accession to the EU.

  6. Mööbel vajab nišše ja ekspordiauke. Vallutamist ootab vana Euroopa / Ain Alvela ; kommenteerinud Ari Lustila, Heido Vitsur, Priit Tamm

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Olukorrast mööbliturul: edukamad on olnud korpusmööbliga tegelevad ettevõtted. Arvamust avaldavad ASi Suwem turundusjuht Mart Nilson ja OÜ Bellus Furnitur tootmisjuht Rolf Kristian Relander. Diagrammid

  7. It ain't what you do, it's the way that you do it: a qualitative study of advice for young cannabis users.

    Science.gov (United States)

    Faulkner, Nathan; McCambridge, Jim; Slym, Renee L; Rollnick, Stephen

    2009-03-01

    Advice is a widely recommended and practised intervention with young drug users. Study of precisely how advice is given and received in any setting has, however, been limited. We qualitatively analysed 106 audio-recordings of advice sessions on cannabis use for young people within a randomised trial. Inductive data analysis was guided by a focus on practitioner behaviour which served to engage the active participation of the young drug user in the session. A cluster of 'Information Management' activities was identified together with an 'Interactive Orientation' evident in a series of specific behaviours. Participants were most successfully engaged when both were combined, understood here as 'Personalised Advice-giving'. These components identified in this exploratory study might assist further research in rectifying the absence of a solid empirical basis for effective practice in advice giving with young drug users and more widely.

  8. The atomic world spooky? It ain't necessarily so! emergent quantum mechanics, how the classical laws of nature can conspire to cause quantum-like behaviour

    CERN Document Server

    van Holten, Theo

    2017-01-01

    The present book takes the discovery that quantum-like behaviour is not solely reserved to atomic particles one step further. If electrons are modelled as vibrating droplets instead of the usually assumed point objects, and if the classical laws of nature are applied, then exactly the same behaviour as in quantum theory is found, quantitatively correct! The world of atoms is strange and quantum mechanics, the theory of this world, is almost magic. Or is it? Tiny droplets of oil bouncing round on a fluid surface can also mimic the world of quantum mechanics. For the layman - for whom the main part of this book is written - this is good news. If the everyday laws of nature can conspire to show up quantum-like phenomena, there is hope to form mental pictures how the atomic world works. The book is almost formula-free, and explains everything by using many sketches and diagrams. The mathematical derivations underlying the main text are kept separate in a -peer reviewed - appendix. The author, a retired professor ...

  9. It Ain't the Heat, It's the Humanity: Evidence and Implications of a Knowledge-Based Consensus on Man-Made Global Warming

    Science.gov (United States)

    Jacobs, P.; Cook, J.; Nuccitelli, D. A.

    2013-12-01

    One of the most worrisome misconceptions among the general public about climate change is a belief that scientists disagree not only about the cause of the present climate change, but also whether or not the planet is currently warming. Recent surveys have demonstrated that an overwhelming consensus exists, both within the scientific literature and among scientists with climate expertise, that the planet is warming and humans are driving this climatic change. This disconnect, or 'consensus gap', between scientific agreement and public belief has significant consequences for public understanding of the reality and cause of climate change, as well as support for potential solutions. Ensuring that the consensus message is not simply broadcast but is also accepted as legitimate by the public appears to be a primary education and communications opportunity. While the existence of a consensus is not itself evidence of a position's truth, according to Miller (2013) scientific consensus can be taken as evidence that a position is true if it is 'knowledge-based', satisfying the conditions of social calibration, apparent consilience of evidence, and social diversity. We demonstrate that the scientific consensus on anthropogenic climate change is knowledge-based, satisfying Miller's criteria. In so doing, we hope to increase confidence in its use as an education and communications tool, and assure the public of its validity. We show the consensus is socially calibrated, based on common evidential standards, ontological schemes, and shared formalism. We establish that consilience of evidence points overwhelmingly to the reality of anthropogenic climate change by examining the evidence from several perspectives. We identify unique fingerprints expected as a result of increased greenhouse forcing, eliminate potential natural drivers of climate change as the cause of the present change, and demonstrate the consistency of the observed climate response with known changes in natural and manmade forcings across a wide variety of indices. Finally, we determine that the consensus is socially diverse, being geographically and disciplinarily varied, supported within public and private institutions, and endorsed by research organizations as well as groups with obvious financial incentives to deny it, such as fossil fuel companies. Additionally, we briefly discuss examples of purported incorrect consensus in climate research, and detail how they fail to satisfy one or more aspects of Miller's criteria. We conclude by discussing the key role that knowledge-based consensus can potentially play in education, influencing public beliefs about climate change, and increasing support for solutions.

  10. 'It ain't what you do it's the way that you do it': lessons for health care from decommissioning of older people's services.

    Science.gov (United States)

    Robinson, Suzanne; Glasby, Jon; Allen, Kerry

    2013-11-01

    Public sector organisations are facing one of the most difficult financial periods in history and local decision-makers are tasked with making tough rationing decisions. Withdrawing or limiting services is an emotive and complex task and something the National Health Service has always found difficult. Over time, local authorities have gained significant experience in the closure of care homes - an equally complex and controversial issue. Drawing on local knowledge and best practice examples, this article highlights lessons and themes identified by those decommissioning care home services. We believe that such lessons are relevant to those making disinvestment decisions across public sector services, including health-care. The study employed semi-structured interviews with 12 Directors of Adult Social Services who had been highlighted nationally as having extensive experience of home closures. Interviews were conducted over a 2-week period in March 2011. Results from the study found that having local policy guidance that is perceived as fair and reasonable was advocated by those involved in home closures. Many local policies had evolved over time and had often been developed following experiences of home closures (both good and bad). Decisions to close care home services require a combination of strong leadership, clear strategic goals, a fair decision-making process, strong evidence of the need for change and good communication, alongside wider stakeholder engagement and support. The current financial challenge means that public sector organisations need to make tough choices on investment and disinvestment decisions. Any such decisions need to be influenced by what we know constitutes best practice. Sharing lessons and experiences within and between sectors could well inform and develop decision-making practices. © 2013 John Wiley & Sons Ltd.

  11. Just watching the game ain't enough: striatal fMRI reward responses to successes and failures in a video game during active and vicarious playing.

    Science.gov (United States)

    Kätsyri, Jari; Hari, Riitta; Ravaja, Niklas; Nummenmaa, Lauri

    2013-01-01

    Although the multimodal stimulation provided by modern audiovisual video games is pleasing by itself, the rewarding nature of video game playing depends critically also on the players' active engagement in the gameplay. The extent to which active engagement influences dopaminergic brain reward circuit responses remains unsettled. Here we show that striatal reward circuit responses elicited by successes (wins) and failures (losses) in a video game are stronger during active than vicarious gameplay. Eleven healthy males both played a competitive first-person tank shooter game (active playing) and watched a pre-recorded gameplay video (vicarious playing) while their hemodynamic brain activation was measured with 3-tesla functional magnetic resonance imaging (fMRI). Wins and losses were paired with symmetrical monetary rewards and punishments during active and vicarious playing so that the external reward context remained identical during both conditions. Brain activation was stronger in the orbitomedial prefrontal cortex (omPFC) during winning than losing, both during active and vicarious playing. In contrast, both wins and losses suppressed activations in the midbrain and striatum during active playing; however, the striatal suppression, particularly in the anterior putamen, was more pronounced during loss than win events. Sensorimotor confounds related to joystick movements did not account for the results. Self-ratings indicated losing to be more unpleasant during active than vicarious playing. Our findings demonstrate striatum to be selectively sensitive to self-acquired rewards, in contrast to frontal components of the reward circuit that process both self-acquired and passively received rewards. We propose that the striatal responses to repeated acquisition of rewards that are contingent on game related successes contribute to the motivational pull of video-game playing.

  12. Multi-scale Fracture Patterns Associated with a Complex Anticline Structure: Insights from Field Outcrop Analogues of the Jebel Hafit Pericline, Al Ain-UAE

    Science.gov (United States)

    Kokkalas, S.; Jones, R. R.; Long, J. J.; Zampos, M.; Wilkinson, M. W.; Gilment, S.

    2017-12-01

    The formation of folds and their associated fracture patterns plays an important role in controlling the migration and concentration of fluids within the upper crust. Prediction of fracture patterns from various fold shapes and kinematics still remains poorly understood in terms of spatial and temporal distribution of fracture sets. Thus, a more detailed field-based multi scale approach is required to better constrain 3D models of fold-fracture relationships, which are critical for reservoir characterization studies. In order to generate reservoir-scale fracture models representative fracture properties across a wider range of scales are needed. For this reason we applied modern geospatial technologies, including terrestrial LiDAR, photogrammetry and satellite images in the asymmetric, east verging, four-way closure Jebel Hafit anticline, in the eastern part of the United Arab Emirates. The excellent surface outcrops allowed the rapid acquisition of extensive areas of fracture data from both limbs and fold hinge area of the anticline, even from large areas of steep exposure that are practically inaccessible on foot. The digital outcrops provide longer 1D transects, and 2D or 3D surface datasets and give more robust data, particularly for fracture heights, lengths, spacing, clustering, termination and connectivity. The fracture patterns across the folded structure are more complex than those predicted from conceptual models and geomechanical fracture modeling. Mechanical layering, pre-existing structures and sedimentation during fold growth seem to exert a critical influence in the development of fracture systems within Jebel Hafit anticline and directly affect fracture orientations, spacing/intensity, segmentation and connectivity. Seismic and borehole data provide additional constraints on the sub-surface fold geometry and existence of large-scale thrusting in the core of the anticline. The complexity of the relationship between fold geometry and fracture intensity is presented and the implications for prediction of fracture networks in naturally fractured reservoirs are discussed.

  13. Should providers of treatment be regarded as a random factor? If it ain't broke, don't "fix" it: a comment on Siemer and Joormann (2003).

    Science.gov (United States)

    Serlin, Ronald C; Wampold, Bruce E; Levin, Joel R

    2003-12-01

    In their criticism of B. E. Wampold and R. C. Serlin's analysis of treatment effects in nested designs, M. Siemer and J. Joormann argued that providers of services should be considered a fixed factor because typically providers are neither randomly selected from a population of providers nor randomly assigned to treatments, and statistical power to detect treatment effects is greater in the fixed than in the mixed model. The authors of the present article argue that if providers are considered fixed, conclusions about the treatment must be conditioned on the specific providers in the study, and they show that in this case generalizing beyond these providers incurs inflated Type I error rates.

  14. Cambios en la etiología, resultados y características de los pacientes con hemorragia digestiva aguda grave a lo largo del periodo 1999-2005 Changes in the etiology, outcome, and characteristics of patients with acute gastrointestinal bleeding between 1999 and 2005

    Directory of Open Access Journals (Sweden)

    A. Garrido

    2007-05-01

    Full Text Available Objetivos: analizar la evolución, a lo largo del periodo 1999-2005, de las siguientes variables de los pacientes ingresados por hemorragia digestiva (HD en una Unidad de Sangrantes: etiología, patología de base, consumo de AINE/anticoagulación y mortalidad. Material y métodos: durante el periodo 1999-2005 se ha estudiado la evolución de las siguientes causas de HD que requirieron ingreso en la Unidad de Sangrantes: ulcus duodenal (UD, ulcus gástrico (UG, hipertensión portal (HPT y otros. De igual forma se ha analizado la evolución en el porcentaje de enfermos ingresados con patología de base, consumo de fármacos AINE/anticoagulantes y mortalidad. Resultados: se han incluido 1.611 pacientes en el estudio con una edad media de 60,45 años (59,7-61,2, 76,41% hombres (74,3-78,5. La UD fue responsable del 22,20% de episodios (20,2-24,3, la UG del 18,40% (16,6-20,4 y la HPT del 33,60% (31,3-36,0. De forma global realizaban tratamiento con AINE el 34,5% (32,6-37,3, anticoagulación el 7,1% (6,0-8,6, presentaban patología de base el 72,6% (70,4-74,8 y la mortalidad global fue del 6,27% (5,16-7,59. A lo largo del periodo estudiado se constató un aumento de los pacientes con patología de base (p Objectives: to analyze the evolution of the following variables in patients admitted to a Blood Unit for gastrointestinal bleeding throughout 1999-2005: etiology, comorbid diseases, use of NSAIDs/anticoagulants, and mortality. Material and methods: we analyzed the evolution of the following causes of GIB that required admission to the Blood Unit from 1999 to 2005: duodenal ulcer (DU, gastric ulcer (GU, portal hypertension (PHT, and others. We also analyzed changes in the percentage of patients admitted with comorbid disease, use of NSAIDs/anticoagulants, and mortality. Results: 1,611 patients with a mean age of 60.45 years (59.7-61.2 were included in this study; 76.41% were males (74.3-78.5. DU was the cause of bleeding in 22.20% of cases (20

  15. Protein (Cyanobacteria): 146367 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ain protein Halothece sp. PCC 7418 MSLVSFSELVTGAKEGKVVSFPTDTVPALAVRPDCAEAIFELKQREATKPLILMGASPEQLWDYVEGTPEEFQ...VWEQTAQQYFPGQLTLVLPSSSLVRPEVNPKTADTIGIRVPDCAIARQVFASTGVLATTSANRSGQPPLTTPEAINQAFPEVLVLADTEPIVSSGLPSTVAKWTGQDWEILRQGNIYLK ...

  16. Gene : CBRC-GGOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSAPS...TSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSAPS...TPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPS...TPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL

  17. Percepción de los médicos sobre los factores que influyen en la elección de un dicumarínico o de un nuevo anticoagulante oral en pacientes con fibrilación auricular no valvular

    Directory of Open Access Journals (Sweden)

    Manuel Anguita-Sánchez

    2016-10-01

    Conclusiones: El riesgo trombótico y hemorrágico elevado y el fracaso del tratamiento previo con dicumarínicos predisponen a elegir un NACO. La insuficiencia renal, el deterioro cognitivo, el buen control con dicumarínicos y un riesgo hemorrágico bajo inclinan a decantarse por un dicumarínico clásico.

  18. Interações entre ingestão de vitamina K, vitamina K sérica, tempo de protrombina e a dose de varfarina e polimorfismo do gene CYP2C9 em pacientes cardiopatas usuários de anticoagulantes orais de um Instituto de Cardiologia de São Paulo

    OpenAIRE

    Melchior, Claudia [UNIFESP

    2010-01-01

    Introduction: Warfarin is a mainstay in the treatment of oral anticoagulation and prophylaxis of thromboembolic illness. It has a narrow therapeutic index, and it’s important to regulate it’s monitoring to avoid serious adverse effects. There is a wide variety of dose applications, which makes the anticoagulant responses unpredictable. The environmental factors discussed in the literature that most affect the response to anticoagulation are: age, height and weight, diet and drug interactions....

  19. Pacientes con trastornos de la hemostasia: Un grupo de riesgo en la atención estomatológica

    Directory of Open Access Journals (Sweden)

    Marta María Alcalde Dueñas

    2002-08-01

    Full Text Available Los pacientes con alteraciones de la hemostasia constituyen un grupo de riesgo en la atención estomatológica cuando tienen que ser sometidos a procederes que presuponen sangramiento. La hemostasia está determinada por una serie de eventos complejos que evitan que se pierda sangre del torrente circulatorio, y la falla de cualquiera de estos mecanismos provocará salida de sangre de los vasos sanguíneos, máxime si el proceder estomatológico que se va a aplicar conlleva sangramiento de tejidos. Por tal motivo se debe solicitar un estudio del caso antes de proceder, con el fin de diagnosticar qué tipo de trastorno presenta el paciente e indicar tratamiento específico en su caso. Es propósito de este trabajo incursionar en aquellos trastornos de la hemostasia que involucran a las plaquetas y alargan el tiempo de sangramiento, así como abordar las deficiencias de factores de la coagulación que afectan este importante mecanismo; por otro lado, dada su importancia, abarcaremos los efectos antiinflamatorios no esteroideos (AINES y anticoagulantes en pacientes que necesitan un tratamiento quirúrgico estomatológico, de manera que se facilite la labor del profesional de la salud que a diario se enfrenta con problemas de esta índole y dotarlo de un conocimiento valioso en cada uno de los aspectos tratados.Patients with hemostatic disorders are a risk group in dental care when they should undergo dental procedures that presupposes bleeding. Hemostasis is determined by a series of complex events that prevent the loss of blood, so, if any of these mechanisms fails, blood will come out of the blood vessels, especially if the dental procedure to be applied involves tissue bleeding. Before performing the procedure, one should request a study of the case to diagnose what type of disorder the patient might present with and give the specific treatment. This paper is aimed at studying those hemostatic disorders that involve platelets and extend the

  20. Aplicación de las microondas a la desolvatación de disoluciones orgánicas en ICP-AES

    OpenAIRE

    Grindlay, Guillermo

    2003-01-01

    Memoria para optar al Grado de Licenciado en Ciencias Químicas. El análisis elemental de muestras con elevado contenido en disolventes orgánicos representa un problema de difícil solución en Espectrometría Atómica con fuente de ionización de Plasma Acoplado Inductivamente (ICP-AES). La tolerancia reducida, por parte del plasma, a la carga de disolvente desaconseja el análisis directo de este tipo de muestras. La forma más usual de evitar los problemas asociados con este tipo de análisis es...

  1. Prevalencia de anticuerpos antifosfolípidos en pacientes con conectivopatías

    Directory of Open Access Journals (Sweden)

    Óscar Emilio Ruiz-Franco

    2011-07-01

    Full Text Available Objetivos: Determinar la prevalencia de anticuerpos antifosfolípidos en pacientes con conectivopatías. Diseño: Estudio descriptivo transversal. Institución: Hospital Dos de Mayo e Instituto de Investigaciones Clínicas de la UNMSM, Lima, Perú. Participantes: Pacientes con diagnóstico de colagenopatía y sujetos sanos. Intervenciones: En 100 pacientes con diagnóstico de colagenopatía y 50 sujetos sanos, todos provenientes de Lima Metropolitana y atendidos entre enero y noviembre de 2008, se determinó fibrinógeno, tiempo de protrombina, tiempo parcial de tromboplastina activada, anticuerpos anticardiolipina y anticoagulante lúpico. Principales medidas de resultados: Presencia de anticuerpos anticardiolipina y anticoagulante lúpico. Resultados: Los pacientes con conectivopatías presentaron anticuerpos antifosfolípidos en 17%, anticoagulante lúpico en 13% y anticardiolipina IgG 4%. Al dividir el grupo por conectivopatías, en los 70 pacientes con lupus eritematoso sistémico 10 resultaron positivos para anticoagulante lúpico y 3 tuvieron anticardiolipina IgG; de los 30 pacientes con artritis reumatoide, 3 tuvieron anticoagulante lúpico positivo y 1 presentó anticardiolipina IgG. En el grupo de 50 personas sanas, solo se encontró un caso positivo para anticoagulante lúpico. Conclusiones: La prevalencia de anticuerpos antifosfolípidos en pacientes con conectivopatías fue 17%. La conectivopatía estudiada más frecuente fue el lupus eritematoso sistémico. El anticuerpo antifosfolípido más frecuente fue el anticoagulante lúpico.

  2. Fabrication and characterization of aluminum nitride/boron nitride nanocomposites by carbothermal reduction and nitridation of aluminum borate powders.

    Science.gov (United States)

    Kusunose, Takafumi; Sakayanagi, Nobuaki; Sekino, Tohru; Ando, Yoichi

    2008-11-01

    In order to fabricate aluminum nitride/boron nitride (AIN/BN) nanocomposites by pressureless sintering, the present study investigated the synthesis of AIN-BN nanocomposite powders by carbothermal reduction and nitridation of aluminum borate powders. Homogeneous mixtures of alumina (Al2O3), boric acid (H3BO3), and carbon powder were used to synthesize AIN/BN nanocomposite powders containing 10 and 20 vol% BN. Aluminum borate was produced by reacting Al2O3 and B2O3 above 800 degrees C, and AIN and turbostratic BN (t-BN) were produced by reacting aluminum borate with carbon powder and nitrogen gas at 1500 degrees C. Carbothermal reduction followed by nitridation yielded an AIN/BN nanocomposite powder composed of nanosized AIN and t-BN. By pressureless sintering nanocomposite AIN/BN powders containing 5 wt% Y22O3, AIN/BN nanocomposites were obtained without compromising the high thermal conductivity and high hardness.

  3. Kirjutaski endale elu pileti / Maarja Kangro

    Index Scriptorium Estoniae

    Kangro, Maarja, 1973-

    2010-01-01

    Arvustus: Pessoa, Fernando. Sõnum / tõlkinud Ain Kaalep, Maarja Kaplinski, Jüri Talvet ja Anneli Tuulik ; koost. Ain Kaalep ja Jüri Talvet. Tartu : Tartu Ülikooli Kirjastus, 2010. (Maailmakirjanduse tõlkevaramu)

  4. Valdmanni rahaseis peo peal / Peeter Raidla

    Index Scriptorium Estoniae

    Raidla, Peeter, 1955-

    2007-01-01

    Tallinna linnavalitsuse kommunaalameti juhataja Ain Valdmanni on mitmel korral tabanud korruptsioonisüüdistused. Vt. samas: Valdmanni ärid linna klientidega; Kronoloogia: Ain Valdmann on võtnud kaheksa aasta jooksul suuri laene

  5. Análise comparativa dos meios lubri-refrigerantes na furação do ferro fundido vermicular com brocas helicoidais de metal duro revestidas com TiAIN

    OpenAIRE

    Bossardi, Júlio Celso dos Santos

    2008-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia Mecânica O aumento da eficiência térmica, aliado à redução do peso do motor, caracteriza o bloco de motor a diesel, em cuja fabricação é cada vez mais utilizado o ferro fundido vermicular (CGI). O emprego desse material viabiliza a construção de veículos com motores mais eficientes, no sentido de diminuir tanto o consumo de combustível quanto a emissão de poluentes, ...

  6. Análise da furação do ferro fundido vermicular com brocas de metal-duro com canais retos revestidas com TiN e TiAIN

    OpenAIRE

    Andrade, Cássio Luiz Francisco de

    2005-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia Mecânica A furação, com o uso de brocas helicoidais ou de canais retos, é uma das maiores operações em tempo efetivo de corte na usinagem de um bloco de motor, possuindo assim grande influência sobre os custos de ferramentas de corte deste produto. Estes custos têm o seu valor dobrado se considerada a aplicação do ferro fundido vermicular como material alternativo ao...

  7. Producción de AIN por Nitruración Iónica y Deposición Física de Vapor en la Aleación de Aluminio 7022

    OpenAIRE

    Figueroa López, Ulises

    2005-01-01

    En este trabajo se presentan los resultados obtenidos del estudio de dos tecnologías propuestas para mejorar las propiedades tribológicas de una aleación de aluminio 7022-T6: mediante la producción de nitruro de aluminio por Nitruración Asistida con Plasmás o por Deposición Física de Vapor en modo reactivo con nitrógeno a partir de blancos de aluminio. Ambas tecnologías buscan generar un sistema consistente en una fase dura como el nitruro de aluminio, AlN, sobre el substrato blando de la ale...

  8. "It Don't Mean a Thing if It Ain't Got that Swing"- an Alternative Concept for Understanding the Evolution of Dance and Music in Human Beings.

    Science.gov (United States)

    Richter, Joachim; Ostovar, Roya

    2016-01-01

    The functions of dance and music in human evolution are a mystery. Current research on the evolution of music has mainly focused on its melodic attribute which would have evolved alongside (proto-)language. Instead, we propose an alternative conceptual framework which focuses on the co-evolution of rhythm and dance (R&D) as intertwined aspects of a multimodal phenomenon characterized by the unity of action and perception. Reviewing the current literature from this viewpoint we propose the hypothesis that R&D have co-evolved long before other musical attributes and (proto-)language. Our view is supported by increasing experimental evidence particularly in infants and children: beat is perceived and anticipated already by newborns and rhythm perception depends on body movement. Infants and toddlers spontaneously move to a rhythm irrespective of their cultural background. The impulse to dance may have been prepared by the susceptibility of infants to be soothed by rocking. Conceivable evolutionary functions of R&D include sexual attraction and transmission of mating signals. Social functions include bonding, synchronization of many individuals, appeasement of hostile individuals, and pre- and extra-verbal communication enabling embodied individual and collective memorizing. In many cultures R&D are used for entering trance, a base for shamanism and early religions. Individual benefits of R&D include improvement of body coordination, as well as painkilling, anti-depressive, and anti-boredom effects. Rhythm most likely paved the way for human speech as supported by studies confirming the overlaps between cognitive and neural resources recruited for language and rhythm. In addition, dance encompasses visual and gestural communication. In future studies attention should be paid to which attribute of music is focused on and that the close mutual relation between R&D is taken into account. The possible evolutionary functions of dance deserve more attention.

  9. "It don't mean a thing if it ain't got that swing"– an Alternative Concept for Understanding the Evolution of Dance and Music in Human Beings

    Directory of Open Access Journals (Sweden)

    Joachim Richter

    2016-10-01

    Full Text Available The functions of dance and music in human evolution are a mystery. Current research on the evolution of music has mainly focused on its melodic attribute which would have evolved alongside proto-language. Instead, we propose an alternative conceptual framework which focuses on the co-evolution of rhythm and dance (R&D as intertwined aspects of a multimodal phenomenon characterized by the unity of action and perception. Reviewing the current literature from this viewpoint we propose the hypothesis that R&D have co-evolved long before other musical attributes and (proto-language. Our view is supported by increasing experimental evidence particularly in infants and children: beat is perceived and anticipated already by newborns and rhythm perception depends on body movement. Infants and toddlers spontaneously move to a rhythm irrespective of their cultural background. If this behavior is universal, R&D must have an essential function in human evolution. Conceivable evolutionary functions of R&D include sexual attraction, transmission of mating signals, synchronization of many individuals, social bonding, appeasement of hostile individuals, pre- and extra-verbal communication, improvement of body coordination, as well as pain killing, anti-depressive, and anti-boredom functions. The impulse to dance may have been prepared by the susceptibility of infants to be soothed by rocking. Dance enables embodied individual and collective memorizing; in many cultures R&D are used for entering trance, a base for shamanism and early religions. Rhythm is necessary to codify human speech and dance encompasses gesture. In future studies attention should be paid to which attribute of music is focused and that the close mutual relation between R&D is taken into account. The possible evolutionary functions of dance deserve more attention.

  10. Stiiliharjutused / Raymond Queneau ; prantsuse k. tlk. Jana Porila, värsstekstid tlk. Ain Kaalep, Toim. Hasso Krull, Järelsõna: M. V. [Märt Väljataga

    Index Scriptorium Estoniae

    Queneau, Raymond

    1995-01-01

    Sisu: Märkmed; Kahekordselt; Litootes; Metafoorselt; Tagasivaateline; Üllatused; Unenägu; Prognoosid; Vikerkaar; Kõhklused; Täpsustused; Subjektiivne pool; Teistpidi isiklik; Jutustus; Liitsõnad; Eitus; Animism; Anagrammid; Ametlik kiri; Annotatsioon; Teadmatus; Aleksandriinid; Mina igatahes; Hüüatused; Ja siis; Ülev; Ülekuulamine; Komöödia; Vahelaused; Kummituslik; Kõnetlus; Sonett; Gustatiivne; Taktiilne; Telegraafiline; Tanka; Kirjeldus; Hüüdsõnad; Ootamatu

  11. If It Ain't Broke, Why Fix It? Framework and Processes for Engaging in Constructive Institutional Development and Renewal in the Context of Increasing Standards, Assessments, and Accountability for University-Based Teacher Preparation

    Science.gov (United States)

    Lit, Ira; Nager, Nancy; Snyder, Jon David

    2010-01-01

    In this article, the authors offer a descriptive essay outlining the framework and processes of a five-year institutional renewal effort at Bank Street College of Education. Extended the opportunity to participate in the "Teachers for a New Era" (TNE) initiative, a multi-year, multi-million dollar effort to enhance and "radically…

  12. T'ain't what you say, it's the way that you say it--left insula and inferior frontal cortex work in interaction with superior temporal regions to control the performance of vocal impersonations.

    Science.gov (United States)

    McGettigan, Carolyn; Eisner, Frank; Agnew, Zarinah K; Manly, Tom; Wisbey, Duncan; Scott, Sophie K

    2013-11-01

    Historically, the study of human identity perception has focused on faces, but the voice is also central to our expressions and experiences of identity [Belin, P., Fecteau, S., & Bedard, C. Thinking the voice: Neural correlates of voice perception. Trends in Cognitive Sciences, 8, 129-135, 2004]. Our voices are highly flexible and dynamic; talkers speak differently, depending on their health, emotional state, and the social setting, as well as extrinsic factors such as background noise. However, to date, there have been no studies of the neural correlates of identity modulation in speech production. In the current fMRI experiment, we measured the neural activity supporting controlled voice change in adult participants performing spoken impressions. We reveal that deliberate modulation of vocal identity recruits the left anterior insula and inferior frontal gyrus, supporting the planning of novel articulations. Bilateral sites in posterior superior temporal/inferior parietal cortex and a region in right middle/anterior STS showed greater responses during the emulation of specific vocal identities than for impressions of generic accents. Using functional connectivity analyses, we describe roles for these three sites in their interactions with the brain regions supporting speech planning and production. Our findings mark a significant step toward understanding the neural control of vocal identity, with wider implications for the cognitive control of voluntary motor acts.

  13. Cultural tourism 2011 - Projekt Central Baltic INTERREGIV A Project Cultural Tourism 2011 - Developing cultural tourism as a joint network in Capitals of Culture 2011 võtab kokku ja plaanib jätku / Maritta Hiltunen, Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2012-01-01

    Soome organisatsiooni Matkailun ja elämystuotannon osaamisklusteri (OSKE) algatatud koostööprojektist Tallinna ja Turu kultuuripealinna vahel, mille laiem eesmärk on edendada Läänemere regiooni kultuuriturismi alast koostööd ning luua Läänemere regiooni hõlmav kultuuriturismi bränd

  14. Uudised : Vello Pähn Savonlinnas. Eri Klas pärast juubelit. Ain Anger Mirjam Helini konkursil. Türnpu sünnipäevakontsert / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    1999-01-01

    V. Pähn dirigeeris Savonlinna ooperifestivalil Gounod" ooperit "Faust". E.Klas erinevate orkestrite ees juuni-september 1999. 8.-20. augustini Helsingis toimunud IV rahvusvahelisest M. Helini konkursist, kus osales A. Anger. 13.augustil tähistati K. Türnpu 134. sünniaastapäeva kontserdiga Tuulna külas Keila vallas

  15. Contribution of G.I.S. for the survey and the management of water ...

    African Journals Online (AJOL)

    Contribution of G.I.S. for the survey and the management of water resources in the basin “Benhandjir – Tirkount” (Ain Sefra) – mounts of Ksour - Saharian Atlas ... Journal of Fundamental and Applied Sciences ... Keywords: Ain Sefra – G.I.S. - water resources - lower cretaceous sandstone - fault “Ras Touil-Ain Sefra” ...

  16. Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report

    Directory of Open Access Journals (Sweden)

    Abdulla Aljawder

    2016-01-01

    Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.

  17. Download this PDF file

    African Journals Online (AJOL)

    Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...

  18. Presence or Absence of Significant HPVE4 Expression in High-grade Anal Intraepithelial Neoplasia With p16/Ki-67 Positivity Indicates Distinct Patterns of Neoplasia: A Study Combining Immunohistochemistry and Laser Capture Microdissection PCR.

    Science.gov (United States)

    Leeman, Annemiek; Pirog, Edyta C; Doorbar, John; van de Sandt, Miekel M; van Kemenade, Folkert J; Jenkins, David; Quint, Wim G V

    2018-04-01

    Progression of anal intraepithelial neoplasia (AIN) involves transition from productive to transforming human papillomavirus (HPV) infection. Grading aims to distinguish productive low-grade AIN from high-grade anal intraepithelial neoplasia (HGAIN) with risk of cancer. We describe immunohistochemical patterns in AIN adding a novel marker for initiation of the productive phase of the HPV life cycle (panHPVE4) to those for cell cycle activity (Ki-67) and transforming activity of HPVE7 gene (p16). We studied 67 anal biopsies for suspected anal neoplasia (17 normal, 15 AIN1, 20 AIN2, 15 AIN3) from 54 men who have sex with men at New York Presbyterian Hospital, USA. Two pathologists generated consensus AIN and immunogrades. Whole tissue and laser capture microdissection samples from multiple HPV-infected biopsies were tested for HPV with SPF10-PCR-DEIA-LiPA25, version 1. (Para)basal Ki-67 expression distinguished normal from AIN (≥lower-third Ki-67) with sensitivity 0.92 and specificity 1.0. Ki-67 did not distinguish grades of AIN. Null/patchy p16 versus diffuse ≥lower-third patterns discriminated HGAIN (sensitivity, 1.0; specificity, 0.84). There was marked heterogeneity in E4 expression within HGAIN. Most AIN2 (14/20) was E4 versus 0/15 AIN3 (sensitivity, 0.70; specificity 1.0). HPV was detected in 63 (94%) biopsies, with 49 (77.8%) high-risk HPV. HPV16 was the most frequent (13%). Multiple HPV genotypes were found in 15 (24%) biopsies and laser capture microdissection -polymerase chain reaction confirmed specific HPV types in E4 +/- AIN. Although Ki-67 discriminated AIN and p16 HGAIN, E4/p16 staining shows that most AIN2 is different from transformed AIN3 in showing both entry into productive HPV infection and transforming activity.

  19. Nuevos antitrombóticos. ¿Qué debe conocer el cirujano cardiovascular?

    Directory of Open Access Journals (Sweden)

    José A. Páramo

    2011-01-01

    Full Text Available La trombosis es una de las causas de muerte más importante en los países industrializados. La trombosis arterial es responsable del infarto de miocardio y de los accidentes cerebrovasculares y se genera en zonas de daño arterial. Los antiplaquetarios y anticoagulantes desempeñan un papel fundamental en la prevención y tratamiento. La enfermedad tromboembólica venosa, a través de la trombosis venosa profunda y la embolia pulmonar, es la tercera causa de muerte después de los eventos arteriales. Ésta suele tratarse con anticoagulantes. En este trabajo se revisan los nuevos fármacos antiplaquetarios y anticoagulantes y su impacto en la cirugía cardiovascular.

  20. Relevancia clínica de la interacción de la warfarina y del acetaminofén: estudio de cohortes retrospectivo

    Directory of Open Access Journals (Sweden)

    Mauricio Ceballos

    2016-09-01

    Conclusión: El uso concomitante de la warfarina y el acetaminofén está asociado a un aumento del INR igual o mayor de 0,5 unidades, lo cual podría generar un mayor efecto anticoagulante y, por tanto, un mayor riesgo potencial de sangrado.

  1. "Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire

  2. Aluminium nitrate ceramics: A potential UV dosemeter material

    DEFF Research Database (Denmark)

    Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.

    2002-01-01

    The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... of Al2O3:C; and (4) a large dynamic range TL signal (5 orders of magnitude). Although there is relatively high fading, it is demonstrated that AIN is a feasible material for UVR dosimetry using short integration times....

  3. Flip Chip on Organic Substrates: A Feasibility Study for Space Applications

    Science.gov (United States)

    2017-03-01

    ain opens were 50 hours. The umption due to those observed erature storage high level of also consistent Underfill B. die each of the subjected...to for each of the performed in Condition B, c between hot ain continuity ed among the rfill materials erfill exhibited d Underfill B die size and...fast ramp rate p chip solder st ramp rate ain coarsening . of th expo phen close cyclin form Fig

  4. Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis

    OpenAIRE

    Moreno A.; Vargas E.; Soto J.; Rejas J.

    2003-01-01

    Antecedentes: Los antiinflamatorios no esteroideos (AINE), utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI) graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2), ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en e...

  5. Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis Cost-effectiveness analysis of the use of celecoxib for the treatment of osteoarthritis

    OpenAIRE

    A. Moreno; E. Vargas; J. Soto; J. Rejas

    2003-01-01

    Antecedentes: Los antiinflamatorios no esteroideos (AINE), utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI) graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2), ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en e...

  6. ORF Alignment: NC_000868 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ain Orsay) ... Length = 133 ... Query: 7 ... MSQYLDEFLADARDRIDSLSNAILTLEKIVKEGG...SEEEKAELINQIFRDAHTLKGTAATM 66 ... MSQYLDEFLADARDRIDSLSNAILTLEKIVKEGGSEEEKAELINQIFRDAHTLKGTAATM Sbjct:... 1 ... MSQYLDEFLADARDRIDSLSNAILTLEKIVKEGGSEEEKAELINQIFRDAHTLKGTAATM 60 ... Query: 127 DLFRRADEFLQ 137 ... DLFRRADEFLQ Sbjct: 121 DLFRRADEFLQ 131

  7. Kihutav politseijuht Antropov testis Saaremaal Hummerit / Risto Berendson, Tuuli Koch

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2003-01-01

    Politsei pressishefi sõnul testis politseijuht Robert Antropov Saaremaal julgestuspolitsei tarbeks maastikuautot Hummer. Endise politseijuhi Ain Seppiku kommentaare. Tabel: Tavaline politseimaastur võrreldes Hummeriga

  8. Simple Comb Generator Design for SWaP Constrained Applications

    Science.gov (United States)

    2016-01-26

    coefficients ck x = −j Ain πk [1− (−1)k], (1) where Ain is the maximum output voltage and k is the frequency number. Since the function exhibits even...y(t) = ∞∑ n=−∞ Aoute −α(t−nT0)u(t− nT0), (3) where Aout is a scaled version of the input voltage Ain , α is the decay rate that controls the pulse...of crystal oscillators by Fox Electronics and was housed in a small surface mount package. This part provided an amplitude, Ain , of 1.0 V, with an

  9. Revizorõ sherstjat tshinovnikov / Jüri Kütt

    Index Scriptorium Estoniae

    Kütt, Jüri

    2001-01-01

    Tallinna linnavolikogu revisjonikomisjoni esimees Jaana Padrik, komisjoni liige Ain Seppik ja volikogu esimees Rein Voog vastasid ajakirjanike küsimustele turvalisuse ja integratsiooniameti tegevuse kohta

  10. Kaks debüüti / Lilian Vellerand

    Index Scriptorium Estoniae

    Vellerand, Lilian, 1932-

    1997-01-01

    "Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar

  11. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ain ... protein [Methylococcus capsulatus str. Bath] ... Length = 147 ... Query: 1 ... MNLEMARLFRTITHGVYVVGVADAEGPNAFTA...AWVMQTSFDPPMLALSINPYCLSYRKLM 60 ... MNLEMARLFRTITHGVYVVGVADAEGPNAFTA...AWVMQTSFDPPMLALSINPYCLSYRKLM Sbjct: 1 ... MNLEMARLFRTITHGVYVVGVADAEGPNAFTAAWVMQTSFDPPMLALSINPYCL

  12. Trimethoprim-sulfamethoxazole induced acute interstitial nephritis in renal allografts; clinical course and outcome.

    LENUS (Irish Health Repository)

    Garvey, J P

    2009-11-01

    Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.

  13. Proceso de obtención de aminas secundarias a partir de nitrobenceno en un solo reactor

    OpenAIRE

    Corma, Avelino; Leyva, Antonio; Rubio Marqués, Paula

    2012-01-01

    La presente patente de invención describe un procedimiento de obtención directa de aminas secundarias, como por ejemplo ciclohexilanilina o diciclohexilamina y derivados sustituidos de éstos, a partir de nitrobenceno y derivados en un solo reactor caracterizado porque comprende introducir en dicho reactor un derivado de nitrobenceno, un catalizador sólido, un disolvente, un ácido e hidrógeno y que tiene lugar en una sola etapa (one pot)

  14. Phytotoxic Activity of Stem Bark and Leaves of Blepharocalyx salicifolius (Myrtaceae on Weeds

    Directory of Open Access Journals (Sweden)

    Eduardo HABERMANN

    2015-01-01

    En este estudio se evaluó la fitotoxicidad de los extractos y fracciones de las cortezas del tallo (suber y de las hojas maduras de Blepharocalyx salicifolius Kuth O. Berg sobre el crecimiento inicial de Echinochloa crus- galli L. P. Beauv. (capim-arroz y Euphorbia heterophylla L. (amendoim-bravo. Estos extractos fueron obtenidos por extracción exhaustiva y fraccionamiento por coeficiente de partición con disolventes o

  15. TRASTORNOS DEL ESPECTRO AUTISTA Y EXPOSICIONES OCUPACIONALES DE LOS PROGENITORES

    Directory of Open Access Journals (Sweden)

    Manuel Pino-López

    2013-01-01

    Full Text Available Fundamentos: Estudios con hermanos y gemelos sugieren un componente genético en el origen del autismo que no explica su crecimiento actual. El objetivo es investigar si factores ambientales como algunas exposiciones profesionales (trabajo nocturno, manejo de disolventes y/o campos electromagnéticos incrementan la probabilidad de trastornos del espectro autista (TEA en los hijos. Métodos: Estudio observacional de casos y controles mediante análisis de expedientes de 206 niños entre 16 y 36 meses de edad evaluados en el Servicio de Atención Temprana de Ciudad Real (70 con TEA y 136 no afectados. Para medir el riesgo de TEA asociado al trabajo nocturno, con disolventes y/o campos electromagnéticos se calculó la odds ratio (OR con un intervalo de confianza (IC del 95%. Resultados: El riesgo de TEA se multiplica por 2,22 cuando un progenitor trabaja en las ocupaciones estudiadas (OR=2,22, IC 95%=1,42-3,48, destacando trabajo con disolventes (OR=2,81, IC 95%=1,28-6,17 y nocturno (OR=2,18, IC 95%=1,21-3,93. El riesgo se multiplica por 3 si la madre trabaja en estas ocupaciones (OR=3, IC95%=1,44-6,26, destacando trabajo nocturno (OR=3,47, IC 95%=1,39-8,63 y con disolventes (OR=2,88, IC 95%=1,28-6,17. El riesgo se multiplica por 1,94 si el padre trabaja en estas ocupaciones(OR=1,94, IC 95%=1,07-3,53 y por 2,81 con disolventes (OR=2,81, IC 95%=1,01-7,86. Se encontró asociación positiva entre nivel educativo de los progenitores y TEA. Conclusiones: Encontramos relación significativa entre exposición de los progenitores a los riesgos estudiados y TEA en los hijos. Los resultados sugieren la participación de alteraciones genéticas ocasionadas por factores ambientales en el origen del trastorno.

  16. Exegi monumentum ehk palee Tallinnas / Siim Sultson

    Index Scriptorium Estoniae

    Sultson, Siim

    2007-01-01

    Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik

  17. Reactive gas condensation synthesis of aluminum nitride nanoparticles.

    Science.gov (United States)

    Baker, Colin C; Ceylan, Abdullah; Shah, S Ismat

    2006-01-01

    Aluminum Nitride (AIN) nanoparticles were synthesized using a Reactive Gas Condensation (RGC) technique in which a mixture of ammonia (NH3) and nitrogen (N2) gases were used for the nitridation of aluminum. NH3 served as the reactive gas, while N2 served as both a carrier gas and the inert source for particle condensation. X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS) analyses revealed that at reactive gas compositions greater than 10% NH3 in N2, samples were composed entirely of hexagonal AIN nanoparticles. Electron diffraction patterns showed single crystal hexagonal AIN structure. The particle size was controlled by varying the pressure of the gas mixture. AIN nanoparticles were dispersed in a liquid matrix to enhance thermal conductivity. Results showed that a minimal addition of AIN increased the thermal conductivity of hydrocarbon pump oil by approximately 27%. The thermal conductivity became constant after reaching a maximum above 0.01 wt% AIN. Temporal stability of AIN was studied by XRD. Samples exposed to air for extended periods of time and analyzed by XRD show no degradation of crystalline AIN nanoparticles.

  18. Clinico-epidemiologic features of oculocutaneous albinism in ...

    African Journals Online (AJOL)

    Alaaeldin F. Mohamed

    Clinico-epidemiologic features of oculocutaneous albinism in northeast section of Cairo – Egypt. Alaaeldin F. Mohamed a. , Nermine S. El-Sayed a,. *, Neveen S. Seifeldin b a Medical Genetics Center, Ain Shams University, Egypt b Dermatology Department, Ain Shams University, Egypt. Received 30 January 2010; ...

  19. Study of plasma amino acid levels in children with autism: An ...

    African Journals Online (AJOL)

    Farida M. ElBaz

    2014-02-24

    Feb 24, 2014 ... ORIGINAL ARTICLE. Study of plasma amino acid levels in children with autism: An Egyptian sample. Farida M. ElBaz a. , Mona M. Zaki b. , Azza M. Youssef a,. *, Ghada F. ElDorry c. ,. Dina Y. Elalfy c a Pediatrics Department, Ain Shams University, Cairo, Egypt b Clinical Pathology Department, Ain Shams ...

  20. Detection of occult HBV infection by nested PCR assay among ...

    African Journals Online (AJOL)

    Shereen E. Taha

    2013-07-10

    Jul 10, 2013 ... Shereen E. Taha a,. *, Soha A. El-Hady a. , Tamer M. Ahmed b. , Iman Z. Ahmed b a Department of Medical Microbiology and Immunology, Faculty of Medicine, Ain Shams University, Cairo, Egypt b Department of Internal Medicine, Faculty of Medicine, Ain Shams University, Cairo, Egypt. Received 11 May ...

  1. Genotyping of mannose-binding lectin (MBL2) codon 54 and ...

    African Journals Online (AJOL)

    Rabah M. Shawky

    2013-11-17

    Nov 17, 2013 ... b Medical Genetics Research Centre and Genetics Unit Children's Hospital, Ain Shams University, Egypt c Ain Shams University .... lele) combined with a high expression promoter (YA/B) or a low-expression promoter .... and more severe post bronchiolitis wheezing in full term in- fants before the age of 6 ...

  2. Association of glutathione-S-transferase P1 (GSTP1)-313 A>G gene ...

    African Journals Online (AJOL)

    Afaf Elsaid

    2015-05-14

    May 14, 2015 ... Peer review under responsibility of Ain Shams University. The Egyptian Journal of Medical Human Genetics (2015) 16, 361–365. HOSTED BY. Ain Shams University. The Egyptian Journal of Medical Human Genetics www.ejmhg.eg.net www.sciencedirect.com · http://dx.doi.org/10.1016/j.ejmhg.2015.04.005.

  3. Multi-scale Computational Electromagnetics for Phenomenology and Saliency Characterization in Remote Sensing

    Science.gov (United States)

    2016-07-15

    Aine , and W.C. Chew, “Blackbox Macro- modeling of the Nonlinearity Based on Volterra Series Representation of X- Parameters,” IEEE EPEP, Portland...the Student Paper Competition) 2. X.Y. Xiong, L.J. Jiang, J. Shutt- Aine , and W.C. Chew, “Blackbox Macro- modeling of the Nonlinearity Based on

  4. SATCOM Supply Versus Demand and the Impact on Remotely Piloted Aircraft ISR

    Science.gov (United States)

    2016-03-01

    http://www.cnn.com/2009/US/12/17/drone.video.hacked/index.html (accessed 9 Dec 2015). 34 Pocock, Chris, AIN Online, “The Revolutionary but Thorny U.S...www.photonics.com/Article.aspx?AID=56998. Pocock, Chris, AIN Online, “The Revolutionary but Thorny U.S. Predator-Reaper Program,” 13 June 2015, http

  5. Pärast kõike / intervjueerinud Veiko Märka

    Index Scriptorium Estoniae

    1998-01-01

    Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar

  6. Afican Health Sciences Vol 10 No 4.pmd

    African Journals Online (AJOL)

    Administrator

    Pathology department, Faculty of Medicine and health Sciences, United Arab Emirates University Al Ain,. UAE. 2. Pathology department, Tawam Hospital, Al Ain/ UAE. Key words: Soft tissue sarcoma; Epithelioid sarcoma; Paediatric; Submandibular. African Health Sciences 2010; 10(4): 400 - 404. *Corresponding author:.

  7. LALIGENS, Vol.4 (1), January 2015

    African Journals Online (AJOL)

    client

    2015-01-09

    Jan 9, 2015 ... Slavery required the creation of a particular kind ..... white supremacist view that the black man was created to be a slave, to serve the white man. ..... money to find them. She therefore concludes, “This old People Finding business is for the birds. He ain't never found nobody he ain't took away” (4). Whether ...

  8. Study of Cu-doping effects on magnetic properties of Fe-doped ZnO ...

    Indian Academy of Sciences (India)

    Laboratoire de Physique Fondamentale et Appliquée (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Morroco; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...

  9. Explanation of ferromagnetism origin in N-doped ZnO by first ...

    Indian Academy of Sciences (India)

    Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...

  10. Analysis of Aluminum-Nitride SOI for High-Temperature Electronics

    Science.gov (United States)

    Biegel, Bryan A.; Osman, Mohamed A.; Yu, Zhiping

    2000-01-01

    We use numerical simulation to investigate the high-temperature (up to 500K) operation of SOI MOSFETs with Aluminum-Nitride (AIN) buried insulators, rather than the conventional silicon-dioxide (SiO2). Because the thermal conductivity of AIN is about 100 times that of SiO2, AIN SOI should greatly reduce the often severe self-heating problem of conventional SOI, making SOI potentially suitable for high-temperature applications. A detailed electrothermal transport model is used in the simulations, and solved with a PDE solver called PROPHET In this work, we compare the performance of AIN-based SOI with that of SiO2-based SOI and conventional MOSFETs. We find that AIN SOI does indeed remove the self-heating penalty of SOL However, several device design trade-offs remain, which our simulations highlight.

  11. Efeitos das drogas antiinflamatórias não-estereoidais sobre o epitélio bucal e a capacidade de cicatrização

    OpenAIRE

    Cristiano Nakao

    2008-01-01

    Antiinflamatórios não-esteroidais (AINEs) são muito utilizados para o alívio da dor. Estudos indicam que 1 em 7 pacientes com doenças inflamatórias crônicas usam AINEs e que 1 em 5 pessoas usam AINEs para dores agudas. Os AINEs inibem a cicloxigenase (COX-1 e COX-2) ou seletivamente a COX-2, e apesar de sua excelente ação antiinflamatória e analgésica, muitos são os efeitos colaterais. Problemas gastrointestinais (GI) são a queixa mais comum para os AINEs convencionais, que também são as...

  12. Medical ethics educational improvement, is it needed or not?! Survey for the assessment of the needed form, methods and topics of medical ethics teaching course amongst the final years medical students Faculty of Medicine Ain Shams University (ASU), Cairo, Egypt 2010.

    Science.gov (United States)

    Fawzi, Marwa M

    2011-07-01

    In the process of our faculty gaining accreditation, the debate concerning the necessity for initiating an integrated course in which medical ethics course is implemented have arouse. Arguments concerning what should this course include, the best timing for this course to be applied, how it should be taught, planned for and mostly for what the students are interested to get out of it. The main purpose of this work is to identify the ethical needs and ethical dilemmas freshly graduated medical students face at the beginning of their training and their suggestions to seek better educational approaches that can be applied in teaching medical ethics proposed by the medical students themselves throughout the teaching process and after graduation. It seemed rather appropriate at this stage to carry out an evaluation survey assessing the needs for medical ethics teaching course through the exploration of the opinions of medical students and freshly graduated doctors on ethical issues through a simple survey by using an open ended question questionnaire designed to fulfil the study targeted requirements. 100 volunteers (n = 100) randomly chosen from the fifth year students of our faculty of medicine ASU who had recently studied ethics course in the fourth year (n = 20), interns both junior and senior residents in El Demerdash hospitals (n = 80). 25 questionnaires were excluded due to inappropriate or missing answers resulting in 75% response rate. 60% of the surveyed group favored an integrated ethics course taught throughout the whole academic years study. 56% chose the practical teaching method with problem solving strategies for the daily arising confusing ethical issues to be the best way to teach the course. While 53.4% thought that stuff specialized in medico legal issues were best to teach this course. As regards the highly confusing ethical dilemmas in which they were interested in getting updated feedback about: Confidentiality, doctor-patient relationship and informed consent came first by 69.3%. This study revealed the essential need for a model medical ethics curriculum that responds to students' concerns in addition to providing basic training in moral reasoning and ethical decision making to be applied both horizontally and vertically across the whole years of medical school. A Simple booklet containing recent version of the Egyptian code of ethics, common ethical dilemmas and recently evolving ethical issues should be available for all newly graduated health professionals. Copyright © 2011 Elsevier Ltd and Faculty of Forensic and Legal Medicine. All rights reserved.

  13. "É muito dificultoso!": etnografia dos cuidados a pacientes com hipertensão e/ou diabetes na atenção básica, em Manaus, Amazonas, Brasil "It sure ain't easy!": an ethnographic study of primary health care for patients with hypertension and/or diabetes in Manaus, Amazonas State, Brazil

    Directory of Open Access Journals (Sweden)

    Maximiliano Loiola Ponte de Souza

    2008-01-01

    Full Text Available O texto analisa os resultados de pesquisa avaliativa da Atenção Básica à Saúde do paciente com hipertensão e/ou diabetes em Manaus, Amazonas, Brasil. A abordagem etnográfica utilizou, como categorias analíticas centrais, o acesso aos serviços e a integralidade do cuidado, comparando-se as práticas sanitárias desenvolvidas em unidade do Programa Saúde da Família (PSF e em unidade básica de saúde não-PSF. A facilitação do acesso à unidade de saúde da família implantada em comunidade carente é limitada pela precariedade de infra-estrutura urbana do seu entorno. A unidade básica de saúde tem, nas grandes distâncias, a sua principal barreira de acesso. A inexistência de sistema de referência entre os distintos níveis de complexidade compromete o acesso dos pacientes a exames e especialistas. O cuidado oferecido nas duas unidades é restrito às queixas físicas passíveis de abordagem farmacológica, comprometendo a integralidade. Há baixa capacidade de escuta dos profissionais para problemas distintos do foco da ação programática. Destacam-se as potencialidades da utilização da etnografia na pesquisa avaliativa de sistemas e serviços de saúde.This paper analyzes the results of an evaluative study in the city of Manaus, Amazonas State, Brazil, on primary health care for patients with hypertension and/or diabetes. The ethnographic approach used access to services and comprehensiveness of health care as core analytical categories, comparing the health practices developed by Family Health Program (FHP units with traditional non-FHP primary care units. Access to family health care units in low-income communities is limited by the precarious surrounding urban infrastructure. The main barrier to access to primary care units is distance. The lack of a referral system between the various levels of complexity jeopardizes patients' access to tests and specialists. The care supplied by the two units is limited to patient conditions that can be treated pharmacologically, thus compromising the comprehensiveness of care. The health professionals display a limited capacity to hear problems outside the immediate focus of the program activity. The paper highlights the potential for using ethnography in evaluative research on health systems and services.

  14. Trombosis venosa en el embarazo

    Directory of Open Access Journals (Sweden)

    DR. M. Fernando Ferrer

    2014-11-01

    El uso de anticoagulantes en pacientes obstétricas requiere de un plan de interrupción del embarazo lo más controlado posible. En la práctica clínica cotidiana esto no siempre es posible, debido a la incapacidad de predecir el momento de inicio del trabajo de parto. Por este motivo las recomendaciones relativas al manejo analgésico y anestésico del parto están basadas en el conocimiento de los cambios fisiológicos, farmacocinético y farmacodinámico de los anticoagulantes utilizados, lo que se analiza en extenso en esta revisión.

  15. Does aspirin reduce recurrence after completing anticoagulant treatment for an idiopathic thromboembolic event?

    Directory of Open Access Journals (Sweden)

    Andrés Valenzuela

    2015-04-01

    Full Text Available Resumen La enfermedad tromboembólica idiopática presenta un alto riesgo de recurrencia. Existe controversia respecto a la utilidad de la aspirina para disminuir la recurrencia luego de haber completado el tratamiento anticoagulante. Utilizando la base de datos Epistemonikos, la cual es mantenida mediante búsquedas en 30 bases de datos, identificamos cuatro revisiones sistemáticas que en conjunto incluyen dos estudios aleatorizados. Combinamos la evidencia utilizando metanálisis y generamos una tabla con síntesis de resultados según la metodología GRADE. Concluimos que la indicación de aspirina luego de haber completado el tratamiento anticoagulante disminuye la probabilidad de recurrencia y probablemente no aumenta de manera importante el riesgo de hemorragia.

  16. Prevalencia de fibrilación auricular y características de la fibrilación auricular no valvular en la población general. Registro AFINVA

    Directory of Open Access Journals (Sweden)

    Vicente Mora-Llabata

    2017-01-01

    Conclusiones: La prevalencia de fibrilación auricular fue del 2,1%, aumentando con la edad, con elevada proporción de cardiopatía concomitante. La proporción de pacientes anticoagulados y la calidad de la anticoagulación son deficientes, revelándose así la necesidad de mejor monitorización y mayor utilización de nuevos anticoagulantes directos en los casos indicados.

  17. Calcifilaxis: más allá de CKD-MBD

    Directory of Open Access Journals (Sweden)

    María Fernández

    2017-09-01

    Conclusión: Aunque la incidencia de la CUA sigue siendo baja, su mortalidad es muy elevada, por lo que debe prestarse especial atención a la presentación de la CUA en los trasplantados renales y en las formas «no renales». Los anticoagulantes orales y los esteroides aparecen como principales factores de riesgo. La CUA es un reto: necesitamos un registro de nuestros pacientes y establecer una terapia estándar.

  18. Cirugía de preservación valvular aórtica en los aneurismas de la raíz aórtica en el síndrome de Marfan

    Directory of Open Access Journals (Sweden)

    Alberto Forteza

    2010-10-01

    Conclusiones: La técnica de reimplante de la válvula aórtica ofrece unos resultados excelentes a corto y medio plazo. Elimina las complicaciones asociadas a las prótesis valvulares y al tratamiento anticoagulante, por lo que debe considerarse el tratamiento de elección para los aneurismas de la raíz de aorta en pacientes con SM.

  19. Tromboflebitis extensa como causa de fiebre insidiosa puerperal

    OpenAIRE

    Charco Roca, Luisa María; Bonmatí García, Lorena; Rubio Postigo, Gem

    2015-01-01

    Los eventos tromboembólicos son factores contribuyentes esenciales de morbilidad y mortalidad materna. La enfermedad tromboembólica complicada en el periodo puerperal a menudo se presenta con fiebre de causa desconocida y un dolor abdominal que puede confundirse con síntomas del postparto (1). El diagnostico de estos procesos deben hacerse por tomografía axial computerizada (TAC) (1,2). La terapia antiinflamatoria, antibiótica y anticoagulante oportuna y eficaz puede mejorar significativament...

  20. A importância de reconhecer a síndrome antifosfolípide na medicina vascular

    Directory of Open Access Journals (Sweden)

    Andreas Funke

    Full Text Available Resumo A síndrome antifosfolipíde (SAF é uma doença autoimune sistêmica caracterizada por trombose arterial ou venosa recorrente e/ou morbidade gestacional e pela presença dos anticorpos antifosfolipídeos, podendo apresentar outras manifestações vasculares, como microangiopatia, arteriopatia crônica e SAF catastrófica. Determinados testes laboratoriais para a síndrome (por exemplo, o anticoagulante lúpico podem sofrer interferência do uso de medicações anticoagulantes, dificultando o diagnóstico. A fisiopatologia da SAF é complexa, sendo enumerados no texto diversos mecanismos patogênicos relacionados à coagulação, ao endotélio e às plaquetas. Por fim, discutimos o tratamento da SAF de acordo com a presença e o tipo de manifestações clínicas, o uso dos anticoagulantes orais diretos e o manejo perioperatório de pacientes com SAF.

  1. Views and experiences of mental health nurses working with undergraduate assistants in nursing in an acute mental health setting.

    Science.gov (United States)

    Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E

    2012-04-01

    Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.

  2. Metal nitride coatings by physical vapor deposition (PVD) for a wear resistant aluminum extrusion die.

    Science.gov (United States)

    Lee, Su Young; Kim, Sang Ho

    2014-12-01

    The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.

  3. Processing of spent nickel catalyst for fat recovery

    Directory of Open Access Journals (Sweden)

    Ibrahim Nasir, Mohammad

    2002-06-01

    Full Text Available Spent nickel catalyst (SNC have the potential of insulting the quality of the environment in a number of ways. The disposal of SNC will have a pollution effect. Optimum recovery of fat from SNC , could save the environment and reduce the oil loss. Hexane has been the solvent of choice for oil extraction. Alternative solvents that are considered safer have been evaluated. Hexane, isopropanol, ethanol, and heptane were examined using soxhlet extraction. While hexane was more efficient in oil recovery from SNC, isopropanol proved to be very good, to clarifying separation of oil from waste material and also provide high solvent recovery compared to other solvents. Isopropanol extraction with chill provided separation of miscella into two phases: lower oil–rich and an upper solvent – rich. It saved much energy of vaporization for distilling. An aqueous extraction process with immiscible solvent assisted was tested. Solvent like hexane added to SNC, and water added later with continuous stirring. The mixture was stirred for about 30 minutes, prior to centrifugation. Aqueous process extracted less amount of oil compared to solvent extraction.El catalizador agotado de níquel (SNC tiene el potencial de dañar la calidad del medio ambiente de diversas formas. El depósito de SNC tendrá un efecto de polución. La recuperación óptima de la grasa a partir del SCN, podría conservar el medio ambiente y reducir la pérdida de aceite. El hexano ha sido el disolvente elegido para la extracción del aceite. También se han evaluado disolventes alternativos que son considerados seguros. Se han examinado hexano, isopropanol, etanol y heptano usando extracción con soxhlet. Mientras que el hexano fue el mas eficaz en la recuperación del aceite, el isopropanol demostró ser muy bueno para aclarar la separación del aceite a partir de la materia residual y también proporcionó una alta recuperación del disolvente en comparación con los otros

  4. Technology Research, Integration, and Demonstration (TRIAD) Program, Delivery Order 0013: High Strain Rate Tension Testing of Titanium 6-2-4-2S at Temperature

    Science.gov (United States)

    2016-06-01

    ain . R ate de ter mi ne d o ve r a st ra in ra ng e a fte r y iel d a nd up to U TS...str ain ) [% ] En gin ee rin g 0.2 % O ffs et Yie ld St re ss [M Pa ] Ma ch ine Ra te [m m/ s] Mo du lus [G Pa ] En gin ee rin g 0.2 % O ffs et...at Br ea k (G lob al str ain ) [% ] Sp ec im en si ze : 5 W fla t d og bo ne w ith a 5m m wi dth an d 1

  5. Extraction of oil from pequi fruit (Caryocar Brasiliense, Camb. using several solvents and their mixtures

    Directory of Open Access Journals (Sweden)

    Antoniassi, R.

    2011-09-01

    Full Text Available In this study, the oil extraction process from pequi pulp using different solvents (hexane, acetone and ethyl alcohol and their mixtures was investigated, using a simplex-centroid design. The extraction occurred at 50°C, under stirring (22 Hz, for 16 hours. The solid-liquid ratio used was 1:10 (w/w. Higher yield values were obtained for extractions with acetone and hexane, especially their mixtures with ethanol. Iodine value, saponification value and refractive index did not differ significantly among the treatments. A higher acid value was obtained for the extraction with ethyl alcohol. Higher carotenoid contents were obtained for the extraction with acetone and ethyl alcohol as pure solvents. The fatty acid profile in the oil fraction of the extracts did not vary among the different types of solvents and their mixtures.En este trabajo fue estudiado el proceso de extracción de aceite de la pulpa de pequi utilizando diferentes disolventes (n-hexano, acetona y etanol y sus mezclas, empleando diseño central simplex. Las extracciones fueron realizadas a 50°C, durante 16 horas de agitación (22 Hz. La proporción sólido:líquido empleada fue 1:10 (p/p. Los mayores rendimientos fueron obtenidos para las extracciones con acetona y con hexano, especialmente cuando fueron mezclados con etanol. El índice de yodo, el índice de saponificación y el índice de refracción no difirieron significativamente entre los tratamientos. Los mayores valores de acidez se obtuvieron en la extracción con etanol. Los mayores contenidos en carotenoides se obtuvieron en las extracciones con acetona y etanol como disolventes puros. El perfil de los ácidos grasos en las fracciones de aceite de los extractos no presentó variación entre los diferentes tipos de disolventes y sus mezclas.

  6. Anticoagulación oral en el adulto mayor frágil con fibrilación auricular

    Directory of Open Access Journals (Sweden)

    Miguel Oswaldo Cadena-Sanabria

    2016-12-01

    Full Text Available Introducción: El envejecimiento incrementa el riesgo de trombosis y fenómenos embólicos, trae cambios fisiológicos y comorbilidades como la fibrilación auricular que hacen complejo el inicio y la seguridad de la anticoagulación. Apesar de la mayor disponibilidad de clínicas de anticoagulación y nuevos anticoagulantes orales, es bajo el porcentaje de adultos mayores que están anticoagulados aunque tengan indicación plena y ausencia de contraindicaciones. Objetivo: Revisar las principales estrategias para predecir y disminuir el riesgo de sangrado con el empleo de anticoagulantes orales en pacientes adultos mayores frágiles. Metodología: Se realizó una búsqueda sistemática sobre estudios que evaluaran la seguridad y eficacia de anticoagulantes orales en pacientes con fibrilación auricular en adultos mayores de 65 años, y una búsqueda de estudios sobre el síndrome de fragilidad y su impacto en el adulto mayor anticoagulado. Resultados y Discusión: Se ha denominado fragilidad al porcentaje de adultos mayores que presentan un mayor deterioro de sus sistemas biológico, físico y cognitivo, conduciendo a una mayor probabilidad de desenlaces adversos en salud, discapacidad y muerte. Se han estudiado características clínicas que permiten identificar pacientes como frágiles; el fenotipo de fragilidad de Linda Fried evalúa esas características; además, existen estrategias de monitoreo de los anticoagulantes orales que deben ser conocidos para minimizar el riesgo de eventos adversos. Conclusiones: el anciano frágil presenta factores de riesgo que probablemente afectan la eficacia y seguridad de la terapia con anticoagulantes orales. Las guías clínicas existentes no proveen la suficiente evidencia y no consideran de manera multidimensional al paciente geriátrico. [Cadena-Sanabria MO, Pinto-Saavedra OM, Contreras-Valero JF, Ortega-Ramírez GE, Bautista-Mier HA. Anticoagulación oral en el adulto mayor frágil con fibrilaci

  7. Electrical Properties of Membranes Made with Polymer Electrolyte Complexes PVA-OH/LI2SO4/PEG(400)

    OpenAIRE

    Arbey Villegas, Edgar; Humberto Castillo, Jose; Bueno, Paulo Roberto [UNESP

    2014-01-01

    Electrolitos poliméricos conductores de iones de litio, basados en alcohol de polivinilo (PVA-OH) complejado con la sal Li2SO4 y diferentes relaciones de porcentaje en peso de plastificante PEG400 fueron preparados por la técnica de solución utilizando agua desionizada como disolvente. El estudio FTIR confirma la formación del complejo polímero-sal. Las curvas de descomposición térmica obtenidas por termogravimetría (TGA) muestran que la estabilidad térmica de los electrolitos depende del por...

  8. Estudio Experimental de plasmas binarios de alcohol etílico con gases inertes

    OpenAIRE

    Perusquía Hernández, Salvador

    2016-01-01

    En la actualidad el estudio de plasmas generados a partir de VOC, han sido tema de gran interés por numerosos Laboratorios alrededor del mundo, la descarga producida con esta atmósfera, se analizará por medio de espectroscopia óptica de emisión y usando sondas de Langmuir. El alcohol etílico es un VOC que se aplica en innumerables productos como disolvente y diluyente de pintura, sino que también se emite a la atmósfera a partir de una variedad de fuentes antropogénicas y naturales. En es...

  9. Extracción y separación de compuestos orgánicos de Thymus Vulgaris

    OpenAIRE

    González Galán, Iván José

    2017-01-01

    El objetivo del estudio es la extracción y separación de la planta Thymus Vulgaris (tomillo), y la evaluación de los procedimientos de extracción para maximizar las concentraciones en base a las necesidades. Los métodos de extracción utilizados han sido el método Soxhlet y la maceración dinámica, utilizando como disolventes 96% etanol, etil-acetato y n-pentano para el primer caso; y 96% etanol, mezcla 50:50 etanol absoluto-agua y agua para el segundo caso. Todos los experimento...

  10. Producción de emulsiones submicrónicas formuladas con dos biodisolventes y tres tensioactivos ecológicos diferentes

    OpenAIRE

    Trujillo-Cayado, L.A.; Alfaro, M.C.; Muñoz, J.

    2017-01-01

    El objetivo de este trabajo fue comparar las propiedades emulsionantes de tres tensioactivos ecológicos que derivan del aceite de coco para la preparación de emulsiones aceite-en-agua formuladas con una mezcla de disolventes verdes como fase dispersa, N,Ndimetildecanamiday a-pineno. La reología, la difracción láser, la microscopía óptica y el “multiple lightscattering” fueron las técnicas principales utilizadas para evaluar las propiedades emulsionantes de estos tensioactivos. Se obtuvieron e...

  11. Tecnología de emulsiones verdes: caracterización reológica, microestructural y estabilidad física

    OpenAIRE

    Trujillo Cayado, Luis Alfonso

    2016-01-01

    Esta tesis doctoral forma parte del proyecto de investigación “Caracterización Reológica y Estabilidad Física de Emulsiones Formuladas con Disolventes Verdes” (CTQ2011- 27371) financiado por el Ministerio de Economía y Competitividad (MINECO) y la Comisión Europea (Programa FEDER). Esta tesis ha sido posible gracias a la financiación por parte del “Subprograma de Ayudas FPI” del Ministerio de Economía y Competitividad (MINECO). Un objetivo prioritario de la química verde es desarrollar compue...

  12. Equilibrio entre fases para la aplicación de solventes verdes en Tecnología de Alimentos

    OpenAIRE

    Hernández Ramos, Elvis Judith

    2010-01-01

    [ES]: En este trabajo se presentan los resultados obtenidos del estudio (experimental y teórico) del equilibrio entre fases de compuestos alimentarios y solventes verdes, aportando nuevos resultados a los fundamentos de los procesos de separación por contacto en equilibrio de la tecnología de alimentos. Se obtuvieron nuevos datos de equilibrio entre fases, aplicando métodos experimentales a altas presiones (equilibrio líquido – fluido supercrítico, para el disolvente dióxido de carbono) y ...

  13. Teoría y simulación de la dinámica de procesos unimoleculares en disolución

    OpenAIRE

    Muñoz Sanz, Raúl

    1997-01-01

    Las reacciones unimoleculares de isomerización y descomposición han sido objeto de estudio mediante técnicas de simulación por ordenador con las que se pretendía comprender la influencia dinámica del disolvente sobre importantes fenómenos como la transferencia intermolecular de energía o la reactividad. Para ello se eligieron los siguientes sistemas químicos. Las moléculas de metil-isonitrilo y metil-ciclohexano, cuya isomerización fue estudiada por mecánica clásica con un esquema de dinámica...

  14. nuevos desafíos en espectroscopia vibracional

    OpenAIRE

    Cascant Vilaplana, Mari Merce

    2017-01-01

    El principal objetivo de la Química Analítica Verde es la sustitución de metodologías contaminantes por otras más limpias, mediante:  La reducción de reactivos y disolventes empleados en el pre-tratamiento y análisis de las muestras.  Minimizar las cantidades y de la toxicidad de los compuestos empleados en las etapas de preparación y medida, especialmente mediante automatización y miniaturización.  El desarrollo de metodologías directas de análisis sin uso de reactivos o disolven...

  15. Diseño y simulación de un sistema de iluminación natural energéticamente eficiente de una planta industrial dedicada al pintado de piezas plásticas para la industria de la automoción

    OpenAIRE

    YE ZHU, DINGDING

    2017-01-01

    El desarrollo de este trabajo se centra en el diseño y simulación de un sistema de iluminación, buscando la eficiencia energética de éste, partiendo desde la premisa de que la nave seleccionada trabaja con un sistema de iluminación 100% artificial. La planta elegida, es una planta de pintura en base disolvente, de piezas plásticas para automoción. Primeramente, se comienza con el desarrollo del marco teórico del trabajo, en el que se comentará brevemente el sector de la automoción, el ...

  16. Procesos de oxidación avanzada para el tratamiento de aguas residuales industriales contaminadas con 1,4 dioxano

    OpenAIRE

    Barndok, Helen

    2016-01-01

    La mayor concienciación medio ambiental, una legislación cada vez más rigurosa, la optimización de los circuitos de agua, la reutilización de los efluentes industriales, así como los nuevos métodos de monitorización y control, obligan al desarrollo de nuevas tecnologías, cada vez más avanzadas, que permitan una mejor depuración de las aguas residuales industriales. Entre los contaminantes comunes en las aguas residuales industriales están los disolventes orgánicos, usados como productos de li...

  17. Análisis de polifenoles en "smoothies", zumos y néctares de frutas rojas

    OpenAIRE

    Vicente Castillo, Alexandra

    2013-01-01

    Las conclusiones de este PFC son: 1. Los mejores disolventes de extracción de polifenoles en zumos, zumos concentrados y purés de una sola fruta son el agua para la extracción de antocianos y el metanol-HCl para extracción genérica de polifenoles. 2. En el análisis de polifenoles totales (TP) por colorimetría utilizando el reactivo de Folin-ciocalteu se obtiene la máxima cuantificación de polifenoles cuando se utiliza la muestra sin tratar. 3. Para el análisis por UHPLC de p...

  18. Clonación y caracterización de las aciltransferasas lpaat y dagat implicadas en la síntesis de triacilglicéridos en semillas de girasol (helianthus annuus l.) y obtención de líneas con composición modificada de lípidos

    OpenAIRE

    Fernández García, Juan Diego

    2016-01-01

    Falta palabras clave Las oleaginosas son plantas de cuya semilla o fruto puede extraerse aceite. Los aceites vegetales son muy importantes desde un punto de vista económico, por la gran versatilidad de sus aplicaciones, ya sea en alimentación, tanto animal como humana, como en aplicaciones industriales, desde síntesis química a disolventes o biolubricantes. Sin embargo, no todos los aceites disponibles en la actualidad poseen las características tecnológicas requeridas pa...

  19. Anaerobic biodegradation of solvents from the packaging industry: study and enhancement

    OpenAIRE

    Vermorel, Nadine

    2017-01-01

    Con el desarrollo de la política ambiental de la Unión Europea, la calidad del aire en Europa ha mejorado considerablemente. No obstante, la contaminación atmosférica continúa siendo importante lo que hace necesario el desarrollo continuo de soluciones tecnológicas de depuración del aire para mitigar los problemas de calidad ambiental. Con objeto de preservar el medio ambiente y evitar problemas de salud pública, las emisiones industriales de disolventes están estrictamente ...

  20. Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak

    Index Scriptorium Estoniae

    Juurak, Raivo, 1949-

    2001-01-01

    Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades

  1. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"

  2. Western Abandoned Uranium Mine Region Fact Sheets

    Science.gov (United States)

    Fact sheets related to Western Abandoned Uranium Mine (AUM) Region, more than 100 abandoned uranium mine claims located along the Little Colorado River and Highway 89, ain the Cameron, Coalmine Canyon, Bodaway/Gap, and Leupp Chapters in Northern Arizona.

  3. Valdek Murd: "Kuulake kannatlikult inimesi!" / Valdek Murd ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Murd, Valdek

    2005-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota 17. september lk. 3. Sillamäe volikogu esimees põhjustest, miks ta kohalike valimistel ei kandideeri. Kommenteerivad Kohtla-Järve linnapea aastatel 1991-1996 Ain Kalmaru ja spordiaktivist Rene Kundla

  4. Disease: H00536 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available oencephalopathy (CADASIL) CADASIL is a chronic cerebrovascular disorder characterized by recurrent ischemic attacks and frequent migr...aines associated with diffuse white-matter abnormalities. CADASIL is caused by muta

  5. Spielpläne

    Index Scriptorium Estoniae

    2007-01-01

    Laulja Annely Peebo ooperis "Jenufa" 2., 4., 6., 9., 11., 13. ja 15. mail Mailandis. Eesti Filharmoonia Kammerkoor esinemas 27. ja 28. mail Bergenis. Laulja Ain Anger 19. mail Placido-Domingo Galal ja 31. mail ooperis "Othello" Viini Riigiooperis

  6. One dimensional aluminum nitride nanostructures: synthesis, structural, and luminescence properties.

    Science.gov (United States)

    Mousavi, S H; Gharavi, M A; Haratizadeh, H; Kitai, A; de Oliveira, P W

    2011-09-01

    Aluminum nitride (AIN) is a direct bandgap semiconductor with a bandgap about 6.1 eV at room temperature, the largest among semiconductors. This paper emphasizes experimental results of the growth and optical properties of AIN nanostructures by direct nitridation. The nitridation process was performed by chemical vapor deposition method with nitrogen (N2) gas flow. AIN nanostructures were analyzed by scanning electron microscope (SEM) equipped with energy-dispersive X-ray (EDX) spectroscope and photoluminescence (PL) spectroscopy. AIN nanowires with different widths from ultrathin to thick were synthesized with this method. All of the samples had high purity without presence of any other material in EDX spectrum. The PL spectra were obtained by a 325-nm helium-cadmium (He-Cd) laser as the excitation source showing high-intensity light emitting visible wavelengths for these structures at room temperature.

  7. Jälle põlved ja küünarnukid / Mihkel Mutt

    Index Scriptorium Estoniae

    Mutt, Mihkel

    1996-01-01

    Jess Borgesoni, Adam Longi ja Daniel Singeri 'Shakespeare'i kogutud teosed' Rakvere teatris (lav. Ain Prosa); Hermann Bahri 'Mees, naine ja kontsert' (lav. Eino Baskin) ning Tankred Dorsti 'Härra Paul' Eesti Draamateatris (lav. Mati Unt)

  8. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2005-01-01

    Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"

  9. BACTERIOLOGICAL ANALYSIS AND PUBLIC PERCEPTION ...

    African Journals Online (AJOL)

    Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S

    2016-05-01

    . These results ... be free from organisms and chemical substances in concentration large enough to affect health. [8]. In Algeria, the two ... Location of Arib area in Ain Defla (Algeria) (Agence nationale de Développement de.

  10. Pap smears for men: a vision of the future?

    LENUS (Irish Health Repository)

    Oon, S F

    2012-02-01

    BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.

  11. Quixotic coupling between irrigation system and maize-cowpea ...

    African Journals Online (AJOL)

    arid regions which suffer from water scarcity. A study was conducted at the Research and Experimental Station, Faculty of Agriculture, Ain Shams University at Shalakan, Kalubia Governorate, Egypt, to evaluate the effect of two irrigation ...

  12. Popmuusika / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2006-01-01

    Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"

  13. Ühispanga omanikud : me ei pea olema liidrid / Marcus Wallenberg ; interv. Hindrek Riikoja

    Index Scriptorium Estoniae

    Wallenberg, Marcus

    2006-01-01

    Ühispanga omanik, SEB nõukogu esimees vastab küsimustele, mis puudutavad Ühispanga positsiooni Eesti turul, endise pangapresidendi Ain Hanschmidtiga seotud skandaali mõju pangale ning panga laienemist Venemaale

  14. Dgroup: DG01675 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available aine ... D01152 ... Oxethazaine (JP17/USAN); Oxetacaine (INN) ... D08311 ... Oxetacaine hydrochloride ... DG00801 ... Bupivacaine ... D07552 ... Bupiva...caine (USAN/INN) ... D01450 ... Bupivacaine hydrochloride (USP); Bupivacaine hydrochl

  15. Data of evolutionary structure change: 1YDVA-1AW2H [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-1AW2H 1YDV 1AW2 A H RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVV...--- RHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSAIILGA...nfEVID> 0 1YDV A 1YDVA...ain> 1YDV A 1YDVA

  16. ETV uus seriaal "Vistrik" kavatseb nime muuta / Anne Vetik

    Index Scriptorium Estoniae

    Vetik, Anne

    2006-01-01

    Toimuvad ETV uue krimisarja "Vistrik" võtted, stsenarist Mihkel Ulman, režissöör Ain Prosa, produtsent Raivo Suviste, kesksetes rollides Marko Matvere, Jaan Rekkor, Elisabet Tamm, tootjaks OÜ Balti Video

  17. Ohtlikud lennud / Simo Meinert

    Index Scriptorium Estoniae

    Meinert, Simo

    2006-01-01

    ETV uus algupärane krimisari "Ohtlik lend" : stsenarist Mihkel Ulman : lavastaja Ain Prosa : produtsent Raivo Suviste : peaosades Elisabet Tamm, Marko Matvere : Balti Video. Sama ka : Teleleht nr. 38, lk. 6-7 : ill

  18. Vek lovi - vek utshis / Hillar Jõõts ; interv. Kalju Hook

    Index Scriptorium Estoniae

    Jõõts, Hillar

    2005-01-01

    Keskkonnainspektsiooni Pärnumaa osakonna juhtivspetsialist Hillar Jõõts keskkonnaministeeriumi kalavarude osakonna juhataja Ain Soome, Eesti Kalurite Liidu juhatuse esimehe Andres Variku ja Eesti Mereinstituudi direktori Toomas Saati kohtumisest Pärnumaa kaluritega

  19. Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2003-01-01

    Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill

  20. AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2011-01-01

    2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008

  1. Saare tantsupiigad pürgivad Eurovisiooni lauluvõistlusele / Janne Nurmik

    Index Scriptorium Estoniae

    Nurmik, Janne

    2009-01-01

    Lauri Pihlapi eurolaulu tiimis pürgivad Moskvas toimuvale Eurovisioonile Eestit esindama ka Kuressaare tantsukooli Semiir tantsijad Kristi Aksiim ja Triinu Tarus. Lauri Pihlapi ehk Lowry laulu "You Ain't What I Need" muusikavideost

  2. Technical Progress Report for "Optical and Electrical Properties of III-Nitrides and Related Materials"

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Hongxing

    2008-10-31

    Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.

  3. Klassitsheski ideal krasotõ v biznes-tsentre

    Index Scriptorium Estoniae

    2003-01-01

    Viru kaubanduskeskuse ette planeeritakse August Weizenbergi skulptuuri "Hämarik" pronkskoopiat. Idee on pärit projekteerijatelt Vilen Künnapult ja Ain Padrikult. Krista Kodres ei pea kohta klassikalisele skulptuurile sobivaks

  4. Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja

    Index Scriptorium Estoniae

    Iir Hermeliin, pseud., 1973-

    2000-01-01

    Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"

  5. Алексий II 1929-2008

    Index Scriptorium Estoniae

    2008-01-01

    Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president

  6. Vene elu hõng Pilistvere rehealuses / Margot Visnap

    Index Scriptorium Estoniae

    Visnap, Margot, 1959-

    2008-01-01

    Pilistvere rehehoones etendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas Indrek Saar

  7. Päästev palsam / Karmen Tamme

    Index Scriptorium Estoniae

    Tamme, Karmen

    2016-01-01

    Mitmetoimelistest nahapalsamitest, mille põhikomponendiks on mesilasvaha, shea-või, oliiviõli või muu pehmendav aine, millele on juurde segatud niisutavaid/ravivaid taimeekstrakte, eeterlikke õlisid ja vitamiine

  8. Becketti Krapp on tagasi ja kuulab minevikku / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2010-01-01

    Eesti Draamateatri maalisaalis 7. novembril esietendunud Samuel Becketti kahest näidendist koosnevast lavastusest "Krappi viimane lint. Sammumisi". Lavastaja Rein Oja. Osades Ain Lutsepp, Kaie Mihkelson ja Ester Pajusoo

  9. Lugedes Pilve ja Pazi / Mathura

    Index Scriptorium Estoniae

    Mathura, pseud., 1973-

    2007-01-01

    Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)

  10. Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov

    Index Scriptorium Estoniae

    Ivanov, Sergei, 1958-

    2005-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist

  11. Low-dose corticosteroid and gallium-67 scintigraphy and acute interstitial nephritis

    Directory of Open Access Journals (Sweden)

    Tetsu Akimoto

    2014-01-01

    Full Text Available We describe a 19-year-old male who developed diclofenac-induced acute inters-titial nephritis (AIN. Diffuse mononuclear cell infiltration was confirmed by renal biopsy and a Gallium (Ga-67 scintigraphy revealed diffuse uptake of the isotope in both kidneys. His renal function had gradually and promptly recovered after initiation of low-dose prednisolone (0.5 mg/kg/day. There are no established criteria for the administration of corticosteroids in the treatment of drug-induced AIN. Moreover, no clear recommendations regarding the optimal dose and duration of steroid administration in the treatment for drug-induced AIN has been established. In addition, we discuss the clinical benefit of steroid treatment and the diagnostic impact of Ga scanning on the management of drug-induced AIN.

  12. Plaat

    Index Scriptorium Estoniae

    2008-01-01

    Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"

  13. Absence of HIV-Associated Nephropathy Among Antiretroviral Naive Adults With Persistent Albuminuria in Western Kenya

    Directory of Open Access Journals (Sweden)

    M.K. Koech

    2017-03-01

    Discussion: Among ART-naïve adults with persistent albuminuria at a referral center in Western Kenya, we observed no cases of HIVAN. AIN was the most common cause of persistent proteinuria in this setting.

  14. Mechanism of the Association between Na+ Binding and Conformations at the Intracellular Gate in Neurotransmitter:Sodium Symporters

    DEFF Research Database (Denmark)

    Stolzenberg, Sebastian; Quick, Matthias; Zhao, Chunfeng

    2015-01-01

    Neurotransmitter:sodium symporters (NSSs) terminate neurotransmission by Na+-dependent reuptake of released neurotransmitters. Previous studies suggested that Na+-binding reconfigures dynamically coupled structural elements in an allosteric interaction network (AIN) responsible for function...... in both LeuT and human dopamine transporter (hDAT), we apply the novel method to identify the composition and the dynamic properties of their conserved AIN. In LeuT, two different perturbations disrupting Na+ binding and transport (i.e. replacing Na+ with Li+ or the Y268A mutation at the intracellular...... gate) affect the AIN in strikingly similar ways. In contrast, other mutations that affect the intracellular gate (i.e. R5A and D369A) do not significantly impair Na+ cooperativity and transport. Our analysis shows these perturbations to have much lesser effects on the AIN, underscoring the sensitivity...

  15. Kas vangide ennetähtaegne vabastamine oli viga?

    Index Scriptorium Estoniae

    1998-01-01

    Eesti Päevalehe küsitlusele vastavad Viljandi politseiprefekt Ester Kallakas, Jaan Tõnissoni Instituudi direktor, Isamaaliit Agu Laius, vandeadvokaat, Reformierakond Märt Rask, endine politseiameti peadirektor Ain Seppik ja vandeadvokaat Simon Levin

  16. Melanoides tuberculata as intermediate host of Centrocestus ...

    African Journals Online (AJOL)

    Nishigori, 1924) in Tunisia. G Najet, D Sabah, H Hayet. Abstract. Melanoides tuberculata that naturally harbored trematode larvae were collected at the irrigation system in Ain Soltan's oasis (southwest of Tunisia), during malacological surveys ...

  17. Mis saab maaärist? / Ester Šank

    Index Scriptorium Estoniae

    Šank, Ester, 1956-

    2000-01-01

    Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad

  18. On the limit distribution of lower extreme generalized order statistics

    Indian Academy of Sciences (India)

    Author Affiliations. H M Barakat1 Magdy E El-Adll2. Department of Mathematics, Faculty of Science, Zagazig University, Zagazig, Egypt; Department of Mathematics, Faculty of Science, Helwan University, Ain Helwan, Cairo, Egypt ...

  19. Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju

    Index Scriptorium Estoniae

    Varju, Peep

    2008-01-01

    Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu

  20. USA-s jagati kirjandusauhindu / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2007-01-01

    Ameerika Ühendriikide kirjandusauhinna National Book Award laureaadid 2007. a.: parim prosaist - Denis Johnson (romaan "Suitsupuu"), parim noorsookirjanik - Sherman Alexie ("Poole kohaga indiaanlase absoluutselt tõene päevik"), parim luuletaja - Robert Hass (luulekogu "Aeg ja ained")

  1. Vene õpetajad kardavad kakskeelset kooliõpet / Sirle Sommer- Kalda, Dagne Hanschmidt

    Index Scriptorium Estoniae

    Sommer-Kalda, Sirle, 1974-

    2005-01-01

    Vene õpetajate suhtumisest vene koolide üleminekusse osaliselt eestikeelsele õppele. TSN Emori uuringust, mille kohaselt on koolijuhtidel olnud seni eestikeelse aineõppe sisseviimisel mitmesuguseid ajendeid - seotuse tunnetamine Eestiga, aga ka hariduspoliitline surve ja kavandatav reform. Lisa: Kakskeelne õpe

  2. Case C-182/15, Proceedings Relating to the Extradition of Aleksei Petruhhin / Filippo Fontanelli

    Index Scriptorium Estoniae

    Fontanelli, Fillippo

    2017-01-01

    Euroopa Kohtu lahendist, mis puudutab Venemaa ametiasutuste poolt Läti ametiasutustele saadetud Eesti kodaniku Aleksei Petruhhini väljaandmise taotlust seoses narkootilise aine turustamise süüteoga

  3. Professional preparation of teachers - problems and possibilities. The Estonian case / Katrin Poom-Valickis, Ülle Saarits, Helle Sikka... [jt.

    Index Scriptorium Estoniae

    2008-01-01

    Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul

  4. Kuidas on teie kool varustatud õppevahenditega kakskeelsele õppele üleminekuks? Millest kõige rohkem puudust tunnete? / Andrei Aleksejev, Raissa Frei, Riho Kutsar, Jelena Laul...[jt.

    Index Scriptorium Estoniae

    2007-01-01

    Haridus-ja Teadusministeeriumi Tallinna esinduses tutvustati TNS Emori uuringut "Eestikeelne aineõpe vene õppekeelga koolides: hetkeolukord ja vajadused". Küsimusele vastavad viie üldhariduskooli juhid

  5. Krundi müük võiks EKA ehitusest viiendiku säästa / Ann-Marii Nergi ; kommenteerinud Jaak Aaviksoo

    Index Scriptorium Estoniae

    Nergi, Ann-Marii

    2011-01-01

    Eesti Kunstiakadeemia peab õigeks ehitada uus õppehoone ajaloolisele asukohale. Hoone ehituse ettevalmistamiseks on kulunud ligi viis miljonit eurot. EKA uue hoone mujale ehitamise osas avaldavad arvamust Metro Capital Management Eesti juht Ain Kivisaar ja riigihangete keskuse juhatuse liige Margus Lantin

  6. Tartu kaabel-TV monopolisurma ootel / Martin Pau

    Index Scriptorium Estoniae

    Pau, Martin, 1975-

    2001-01-01

    Riigikogus esimesele lugemisele minev uus kaabelleviseadus võib avada nii Tartu kui ka kogu Eesti turu vabale konkurentsile. Kommenteerivad Kalev Kallo, Peeter Kern, Peep Põltsam, Ain Mäeots. Parlamendisaadik (Kalev Kallo). Kaart: Tartu kaabel-TV operaatorid

  7. Lapi torn, Ameerika kotkas ja gooti kell / Vilen Künnapu ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    Künnapu, Vilen, 1948-

    2010-01-01

    Arhitekt Vilen Künnapu oma installatsioonist "Gooti kell", mis avati 2. novembril Lilleoru pargis, arhitekti rollist, osalemisest koos Ain Padriku, Lennart Meri ja Andres Siimuga rahvusvahelistel arhitektuurivõistlustel, valminud hoonetest, installatsioonidest, praegusest tegevusest jm.

  8. Politicians spin attacks against methadone, syringe replacement / Milda Seputyte

    Index Scriptorium Estoniae

    Seputyte, Milda

    2005-01-01

    Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat

  9. Õpetaja professionaalse rolli internaliseerimise hindamine õpetajakoolituse esmaõppe üliõpilaste hulgas / Äli Leijen, Katrin Kullasepp, Aivar Ots

    Index Scriptorium Estoniae

    Leijen, Äli, 1979-

    2013-01-01

    Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis

  10. Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx

    Index Scriptorium Estoniae

    Marx, Karl

    2000-01-01

    Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist

  11. Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm

    Index Scriptorium Estoniae

    Vaus-Tamm, Heili, 1961-

    2007-01-01

    Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko

  12. Kolhoosikeskus - oma ja võõras = Collective farm centre - familiar and alien / Liina Jänes ; tõlk. Liisi Ojamaa

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2000-01-01

    Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart

  13. Meie igapäevane paanika / Ott Karulin

    Index Scriptorium Estoniae

    Karulin, Ott, 1980-

    2007-01-01

    Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste

  14. 9. II avati taas von Krahli Akna galerii

    Index Scriptorium Estoniae

    2004-01-01

    Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid

  15. In situ EELS and TEM observation of Al implanted with nitrogen ions

    International Nuclear Information System (INIS)

    Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.

    1995-01-01

    Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs

  16. Materjalide jagamisest võidavad kõik / Maarja Soone

    Index Scriptorium Estoniae

    Soone, Maarja

    2011-01-01

    Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele

  17. Browse Title Index

    African Journals Online (AJOL)

    . Kati Ain ... Vol 38, No 6 (2015), Connected domination stable graphs upon edge addition, Abstract ... Vol 29, No 4 (2006), Continued fractions and the geometric decomposition of modular transformations, Abstract.

  18. Tallinn pokupajet zemlju dlja prokladki shosse Põhjaväil

    Index Scriptorium Estoniae

    2007-01-01

    Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega. Kommenteerivad Alo Brandt ja Ain Valdmann

  19. Moroz i rozõ / Lev Livshits

    Index Scriptorium Estoniae

    Лившиц, Лев, 1924-2013

    2006-01-01

    Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest

  20. Bez kota mõsham razdolje / Jevgeni Kapov

    Index Scriptorium Estoniae

    Kapov, Jevgeni

    2004-01-01

    Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme

  1. Muusikalinn Viin / Kristina Kõrver

    Index Scriptorium Estoniae

    Kõrver, Kristina, 1979-

    2008-01-01

    Viini Kammerorkestri, Viini Filharmoonikute ja Viini Sümfoonikute kontsertidest, Straussi "Roosikavalerist" ja Wagneri "Lendavast Hollandlasest" Viini riigiooperis, Bizeti "Carmenist" Volksoperis, Leif Ove Anderseni kontserdist, Janacheki ooperist "Katja Kabanova" Theater an der Wienis, Ain Angeri kontserdist Musikvereini klaassaalis

  2. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2006-01-01

    Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"

  3. [Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva

    Index Scriptorium Estoniae

    Kaldmaa, Kätlin, 1970-

    2011-01-01

    Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30

  4. Küsitlus : Ilvest usaldan, Savisaart mitte / Gert D. Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Gert D.

    2006-01-01

    Äripäeva korraldatud küsitlusest selgub, et usaldusväärseimaks poliitikuks peavad Eesti elanikud Toomas Hendrik Ilvest, ebausaldusväärseimaks Edgar Savisaart; usaldusväärseim ärimees on vastanute arvates Urmas Sõõrumaa, ebausaldusväärseim Ain Hanschmidt. Kommenteerivad Andrus Saar, Toomas Hendrik Ilves, Urmas Sõõrumaa, Ain Hanschmidt ja Edgar Savisaar. Tabelid: Usaldan; Ei usalda

  5. Immune profile and Epstein-Barr virus infection in acute interstitial nephritis: an immunohistochemical study in 78 patients.

    LENUS (Irish Health Repository)

    Mansur, Abdurrezagh

    2011-01-01

    Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.

  6. Colonic aberrant crypt formation accompanies an increase of opportunistic pathogenic bacteria in C57BL/6 mice fed a high-fat diet.

    Science.gov (United States)

    Zeng, Huawei; Ishaq, Suzanne L; Liu, Zhenhua; Bukowski, Michael R

    2018-04-01

    The increasing worldwide incidence of colon cancer has been linked to obesity and consumption of a high-fat Western diet. To test the hypothesis that a high-fat diet (HFD) promotes colonic aberrant crypt (AC) formation in a manner associated with gut bacterial dysbiosis, we examined the susceptibility to azoxymethane (AOM)-induced colonic AC and microbiome composition in C57/BL6 mice fed a modified AIN93G diet (AIN, 16% fat, energy) or an HFD (45% fat, energy) for 14 weeks. Mice receiving the HFD exhibited increased plasma leptin, body weight, body fat composition and inflammatory cell infiltration in the ileum compared with those in the AIN group. Consistent with the gut inflammatory phenotype, we observed an increase in colonic AC, plasma interleukin-6, tumor necrosis factor-α, monocyte chemoattractant protein-1 and inducible nitric oxide synthase in the ileum of the HFD-AOM group compared with the AIN-AOM group. Although the HFD and AIN groups did not differ in bacterial species number, the HFD and AIN diets resulted in different bacterial community structures in the colon. The abundance of certain short-chain fatty acid (SCFA) producing bacteria (e.g., Barnesiella) and fecal SCFA (e.g., acetic acid) content were lower in the HFD-AOM group compared with the AIN and AIN-AOM groups. Furthermore, we identified a high abundance of Anaeroplasma bacteria, an opportunistic pathogen in the HFD-AOM group. Collectively, we demonstrate that an HFD promotes AC formation concurrent with an increase of opportunistic pathogenic bacteria in the colon of C57BL/6 mice. Published by Elsevier Inc.

  7. Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe

    Index Scriptorium Estoniae

    Mäe, Aarne, 1967-

    2008-01-01

    7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"

  8. Geochemistry of dark coastal heavy-mineral beaches sand (Annaba ...

    African Journals Online (AJOL)

    Mots clés : Minéraux lourds- élément majeur –élément trace – les terres rares- sable de plage. The study area (Ain Achir and Plage-Militaire beaches) is a part of the Edough Massif/Annaba /Algeria. Recent beach sediments of Ain Achir are characterized by light sand and dark reddish one. This latter appears mostly after a ...

  9. Tolerancia a inhibidores selectivos de la ciclooxigenasa 2 en casos de alergia o intolerancia a los antiinflamatorios no esteroideos convencionales: experiencia en un centro.

    OpenAIRE

    Echeverri Junca, Gabriel Jaime; Serrano Reyes, Carlos Daniel

    2012-01-01

    Antecedentes. La baja prevalencia de reacciones cruzadas con inhibidores selectivos de la ciclooxigenasa 2 (COX-2) en pacientes con alergia o intolerancia a los antiinflamatorios no esteroideos (AINE) convencionales, permite practicar una prueba de provocación con buen margen de seguridad para verificar la tolerancia a uno o varios de estos fármacos. Objetivo. Evaluar la tolerancia a inhibidores selectivos de la COX-2 en pacientes con intolerancia o alergia a los AINE convencionales en un cen...

  10. Relevancia clínica de las interacciones medicamentosas entre antiinflamatorios no esteroideos y antihipertensivos

    Directory of Open Access Journals (Sweden)

    Juan Villa

    2014-11-01

    Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.

  11. Low-Energy Tunable Self-Modulated Nanolasers (1.1 SHORT-TERM INNOVATIVE RESEARCH (STIR) PROGRAM)

    Science.gov (United States)

    2016-09-28

    300 400 500 Th resh o ld G ain (cm -1) Q f ac to r SiO2 bot-layer thickness (nm) Varying SiO2 bot-layer thickness ONLY Q gth (a) 0 50 100...150 200 250 300 350 400 450 500 1300 1350 1400 1450 1500 1550 1600 0 50 100 150 200 250 300 350 Th resh o ld G ain (cm -1) Q f ac to r ITO

  12. Entanglement Rate for Gaussian Continuous Variable Beams

    Science.gov (United States)

    2016-08-24

    ain ,in ,in ,in ,in T( ˆ ˆ ˆ ˆ )† † . The quantumLangevin equations can be cast in the following compact form k= -A MA A , 30in˙ ( ) where...d w wá - ¢ ñ = + ¢¢ ¢a a 2q q qq,in ,inˆ ( ) ˆ ( ) ( ) † . For convenience, we define the vectors w w w w w= - -+ + - -A a a a ain out ,in out ,in out

  13. Pose de la première pierre du bâtiment SMA18 du Cern

    CERN Multimedia

    CERN Press Office. Geneva

    1999-01-01

    On 30 April 1999, Jean Pépin, Sénateur for the Department of the Ain and President of the Conseil Général, and Professor Luciano Maiani the Director-General of CERN will lay the foundation stone of Building SMA18, financed by the Department of the Ain in the framework of France's special contribution to CERN's Large Hadron Collider (LHC) project.

  14. Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride

    International Nuclear Information System (INIS)

    Adlassnig, A.; Schuster, J. C.; Smetana, W.; Reicher, R.

    1997-01-01

    A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)

  15. Wireless intelligent network: infrastructure before services?

    Science.gov (United States)

    Chu, Narisa N.

    1996-01-01

    The Wireless Intelligent Network (WIN) intends to take advantage of the Advanced Intelligent Network (AIN) concepts and products developed from wireline communications. However, progress of the AIN deployment has been slow due to the many barriers that exist in the traditional wireline carriers' deployment procedures and infrastructure. The success of AIN has not been truly demonstrated. The AIN objectives and directions are applicable to the wireless industry although the plans and implementations could be significantly different. This paper points out WIN characteristics in architecture, flexibility, deployment, and value to customers. In order to succeed, the technology driven AIN concept has to be reinforced by the market driven WIN services. An infrastructure suitable for the WIN will contain elements that are foreign to the wireline network. The deployment process is expected to seed with the revenue generated services. Standardization will be achieved by simplifying and incorporating the IS-41C, AIN, and Intelligent Network CS-1 recommendations. Integration of the existing and future systems impose the biggest challenge of all. Service creation has to be complemented with service deployment process which heavily impact the carriers' infrastructure. WIN deployment will likely start from an Intelligent Peripheral, a Service Control Point and migrate to a Service Node when sufficient triggers are implemented in the mobile switch for distributed call control. The struggle to move forward will not be based on technology, but rather on the impact to existing infrastructure.

  16. Fractal dimension and image statistics of anal intraepithelial neoplasia

    Energy Technology Data Exchange (ETDEWEB)

    Ahammer, H., E-mail: helmut.ahammer@medunigraz.a [Institute of Biophysics, Center of Physiological Medicine, Medical University of Graz, Harrachgasse 21, A-8010 Graz (Austria); Kroepfl, J.M. [Human Performance Research Graz (HPR Graz), Karl-Franzens and Medical University of Graz, Max-Mell Allee 11, A-8010 Graz (Austria); Hackl, Ch. [Research Group of Applied Theoretical Pathology, Department of Pathology, Country Medical Centre St.Poelten, Propst Fuehrer Strasse 4, A-3100 St.Poelten (Austria); Sedivy, R. [Research Group of Applied Theoretical Pathology, Department of Pathology, Country Medical Centre St.Poelten, Propst Fuehrer Strasse 4, A-3100 St.Poelten (Austria); Department of Pathology, Country Medical Centre St.Poelten, Propst Fuehrer Strasse 4, A-3100 St.Poelten (Austria)

    2011-01-15

    Research Highlights: Human papillomaviruses cause anal intraepithelial neoplasia (AIN). Digital image processing was carried out to classify the grades of AIN quantitatively. The fractal dimension as well as grey value statistics was calculated. Higher grades of AIN yielded higher values of the fractal dimension. An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.

  17. Acute interstitial nephritis with acetaminophen and alcohol intoxication

    Directory of Open Access Journals (Sweden)

    Alexopoulou Iakovina

    2011-04-01

    Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.

  18. GEL OBTENIDO TRIBOQUÍMICAMENTE Y ELUCIDACIÓN DE SUS COMPONENTES

    Directory of Open Access Journals (Sweden)

    Lilia Fernández

    2012-01-01

    Full Text Available El presente trabajo tiene como objetivo reportar un gel obtenido triboquimicamente en la reacción de Cannizzaro y la elucidación de sus componentes. La reacción entre benzaldehido e hidróxido de sodio llevada a cabo sin disolvente y agitando las fases (método triboquímico forma una suspensión que reacciona rápidamente (1 minuto, produciendo un gel blanco, el análisis infrarrojo arroja alcohol bencílico y benzoato de sodio. La difracción de rayos X confirma la fase continua del gel como benzoato de so dio. El análisis micrográfico del gel muestra una fase amorfa correspondiente al benzoato de sodio. La exposición del gel triboquímico a un rayo láser permite observar la dispersión de la luz. La técnica triboquímica es un proceso limpio acorde con los principios de la química verde. La espectroscopía en fa se sólida y de los líquidos sin disolventes contribuye al desarrollo de una química analítica verde.

  19. Extracción convencional de oleorresina de pimentón dulce y picante II. Peligros y puntos de control crítico y requerimientos comerciales

    Directory of Open Access Journals (Sweden)

    Fernández-Trujillo, J. Pablo

    2007-12-01

    Full Text Available This paper reviews the hazards analysis and critical control points (HACCP for the conventional extraction of paprika oleoresin, a product with potential to be produced in Africa and South America. These points include the toxicological, fire and explosion risks of the solvents, the temperature for miscella stripping, the risk of oxidations, isomerization and contaminant concentration in the oleoresin. Legal regulations in US and EU are also discussed, as well as some technical requirements and commercial and demand characteristics of the oleoresin.Se revisan los principales peligros y puntos de control crítico del proceso de extracción convencional por disolventes de la oleorresina de pimentón, un producto con potencial para ser producido en África e Iberoamérica. Entre estos puntos se incluyen entre otros el riesgo toxicológico, de incendio y explosión de los disolventes o su descomposición, la formación de finos, la temperatura de desolventización de la miscela, o el riesgo de oxidaciones, isomerizaciones y concentración de contaminantes en la oleorresina. Los condicionantes técnicos derivados de la legislación americana y europea son también discutidos, así como los condicionantes técnicos y características comerciales y de la demanda del producto en la actualidad.

  20. Equipo Portátil para Análisis Químicos del Suelo

    Directory of Open Access Journals (Sweden)

    Jaramillo Madarriaga G.

    1939-12-01

    Full Text Available En estos últimos años, principalmente en los Estados Unidos, ha surgido una gran variedad de equipos portátiles para el examen rápido de suelos, basados la mayor parte en reacciones calorimétricas para fósforo, potasio, nitratos y algunos otros elementos considerados de importancia para la vida de la planta. El factor que determina la gran variedad de resultados obtenidos con tales equipos es la naturaleza del disolvente empleado para extraer los elementos de la muestra de suelo, disolvente que consiste, por lo general en soluciones de distinta concentración de ácido clorhídrico, sulfúrico, acético. etc. Si se admite que estos exámenes rápidos en el campo pueden ser útiles en países donde los agricultores cuentan con grandes facilidades para hacer verificar análisis completes de sus tierras, con mayor razón debemos admitir que en nuestro país, donde no abundan los laboratorios especializados, los equipos portátiles son casi una necesidad para la orientación de los agrónomos oficiales que operan en regiones apartadas. Debido a esto, la Facultad Nacional de Agronomía se ha interesado en el desarrollo de un equipo portátil lo más compacto posible para el uso de los agrónomos.

  1. Studies on drying kinetics of olive foot cake

    Directory of Open Access Journals (Sweden)

    Hamlat, M. S.

    2002-06-01

    Full Text Available The olive foot cake is a very important by-product of olive oil industry since it can contain until 12 % of oil which can be extracted using solvent. The used solvent is often immiscible with water. This is the reason why its effect is limited by the moisture of olive foot cake making its drying imperative. In this paper, we present the behaviour of olive foot cake subjected to convective drying. The experimental results show that the drying rate versus moisture presents only one period of decreasing rate. The influence of the main parameters on drying kinetics is studied.El orujo es un importante subproducto de la industria del aceite de oliva ya que puede contener hasta el 12 % del aceite, el cual puede ser extraído usando un disolvente apropiado. El uso del disolvente es a menudo inmiscible con el agua. Esta es la razón por la que su efecto está limitado por la humedad del orujo, haciendo su secado imperativo. En este artículo se presenta el comportamiento del orujo sometido a un secado por convección. Los resultados experimentales mostraron que la velocidad de secado frente a la humedad, presenta un solo período de disminución de dicha velocidad. Se ha estudiado la influencia de los principales parámetros sobre la cinética de secado.

  2. Caracterización del aceite de semilla de uva extraído con dióxido de carbono supercrítico

    Directory of Open Access Journals (Sweden)

    Molero Gómez, A.

    1995-02-01

    Full Text Available In this work the quality of grape seed oil obtained by extraction with supercritical carbon dioxide was studied. At the optimun operating conditions (313 K and 25 MPa, the yield of supercritical extraction is similar to the conventional extraction by liquid solvent, but the quality of the grape seed oil extracted by supercritical carbon dioxide is higher.
    Furthermore, supercritical extraction could be more economical than liquid extraction because the solvent removal by distillation is not necessary and several steps of the subsequent oil refining process can be eliminated.

    En este trabajo se realiza un estudio de la calidad del aceite de semillas de uva obtenido por extracción con dióxido de carbono supercrítico. En las condiciones operativas óptimas del proceso (313 K y 25 MPa el rendimiento de la extracción supercrítica es similar al de la extracción con disolventes líquidos, pero la calidad del aceite es muy superior.
    En consecuencia, el proceso supercrítico resulta competitivo con el convencional al reducir las etapas de refinado del aceite y eliminar la destilación del disolvente, las más costosas desde el punto de vista energético.

  3. Optimización del proceso de extracción de tocoferol de germen de trigo con dióxido de carbono líquido y supercrítico.

    Directory of Open Access Journals (Sweden)

    Blanco Muñoz, M. A.

    1999-08-01

    Full Text Available In this work the extraction of tocopherol from wheat germ by liquid and supercritical carbon dioxide has been studied. It has been analysed the operative conditions as well as the row material pre-treatment. At the optimum operating conditions, the yield of supercritical extraction is similar to the conventional extraction by hexano as solvent. So, this technique can be competitive respect of the conventional technique because the solvent removal by distillation is not necessary.

    En el presente trabajo se estudia la extracción de tocoferol a partir de germen de trigo utilizando dióxido de carbono líquido y supercrítico como disolvente. Las variables que intervienen en la extracción se han analizado tanto desde el punto de vista operativo como de adecuación de la materia prima. Los rendimientos obtenidos son muy similares a los encontrados en la extracción convencional utilizando hexano. Esta técnica, portante, puede resultar competitiva respecto a la convencional, ya que se evita tener que destilar el extracto para eliminar el disolvente.

  4. Caracterización del aceite de germen de trigo extraído con dióxido de carbono líquido y supercrítico.

    Directory of Open Access Journals (Sweden)

    Molero Gómez, A.

    1997-04-01

    Full Text Available In this work the quality of wheat germ oil obtained by extraction with liquid and supercritical carbon dioxide was studied. At the optimum operating conditions, the yield of supercritical extraction is similar to the conventional extraction by organic solvent, but the quality of the wheat germ oil extracted by supercritical carbon dioxide is higher. Furthermore, supercritical extraction could be more economical than organic extraction because the solvent removal by distillation is not necessary and several steps of the following oil refining process can be simplified.

    En el presente trabajo se realiza un estudio de la calidad del aceite de germen de trigo obtenido mediante la extracción con dióxido de carbono a alta presión. En las condiciones operativas óptimas del proceso, el rendimiento de la extracción con dióxido de carbono líquido y supercrítico es similar al de la extracción con disolventes orgánicos, si bien la calidad del aceite obtenido es superior. De ello se desprende el hecho de que el proceso de extracción utilizando dióxido de carbono, en condiciones sub- y supercríticas, puede resultar competitivo con el convencional al simplificar sustancialmente las etapas de refinado del aceite y eliminar la destilación del disolvente, las más costosas desde el punto de vista energético.

  5. Quality assessment of Moringa concanensis seed oil extracted through solvent and aqueous-enzymatic techniques

    Directory of Open Access Journals (Sweden)

    Anwar, Farooq

    2008-03-01

    Full Text Available The composition and quality of the M. concanensis seed oil extracted through an aqueous-enzyme-assisted technique, using three commercial enzyme-mixtures (Natuzyme, Kemzyme, and Feedzyme was compared to those of the control-, (without enzymes and solvent-extracted oils. Aqueous enzyme-extracted M.concanensis seed oil content ranged from 23.54 to 27.46% and was significantly (P 0.05 variation in the contents of fiber and ash within the three extraction methods. However, the protein content of the meal obtained through the aqueous-enzyme and control methods was significantly (P M. concanensis seed oils extracted using the three methods. The specific extinctions at 232 and 270 nm, peroxide value, p-anisidine, free fatty acid contents and color values of the aqueous-enzyme-extracted oil were found to be lower than that of solvent-extracted oil and thus revealed good quality. The oils extracted through the three methods exhibited no significant (P En este estudio se compara la composición y la calidad del aceite de semilla de M. concanensis extraído mediante enzimas, utilizando tres enzimas comerciales (Natuzyme, Kemzyme, y Feedzyme con las de un control extraído sin enzimas y con las del aceite extraído con disolvente. El contenido en aceites de las semilla extraídas con enzimas osciló entre 23,54 a 27,46% y fue significativamente más elevado (P 0,05 en el contenido de fibra y ceniza para los tres métodos de la extracción. Sin embargo, el contenido proteínico de la harina obtenido por métodos enzimáticos y el control sin enzimas fue significativamente menor (P < 0,05 que el de la harina obtenida después de la extracción por disolvente. Las diferencias en el índice de yodo (67.1-68.0 g /100 g of oil, densidad en 24 °C (0,865-0,866 g/mL, índice de refracción a 40 °C (1,4622-1,4627 y fracción insaponificable (0,69-0,76 % no fueron significativamente diferentes para ninguna de las técnicas de extracción. Las extinciones espec

  6. Yogurt protects against growth retardation in weanling rats fed diets high in phytic acid

    Science.gov (United States)

    Gaetke, Lisa M.; McClain, Craig J.; Toleman, C. Jean; Stuart, Mary A.

    2010-01-01

    The purpose of this study was to determine the affects of adding yogurt to animal diets which were high in phytic acid (PA) and adequate in zinc (38 μg Zn/g). The PA:Zn molar ratio was 60:1. Zinc status was determined by documenting growth and measuring the zinc concentration in bone (tibia) and plasma. For 25 days, 6 groups (n=6) of Sprague-Dawley weanling rats were fed one of the following AIN-76 diets. Half of the diets contained PA. Four of the diets contained yogurt with either active or heat-treated (inactive) cultures added at 25% of the diet. Diets: (without PA) 1) AIN, 2) AIN with active yogurt, 3) AIN and inactive yogurt; and (with PA) 4) AIN with PA, 5) AIN with PA plus active yogurt, and 6) AIN with PA plus inactive yogurt. Body weight, weight gain, and zinc concentration in bone and plasma were measured, and feed efficiency ratio (FER) was calculated. Rats fed diets with PA and yogurt had normal growth compared to the control group. Growth retardation was evident in the group fed the diet with PA and no yogurt. This group had significantly lower body weight compared to all other groups (p<0.05). Rats fed diets with PA, with or without yogurt, had significantly lower zinc concentration in bone and plasma (p<0.05). Adding yogurt to diets high in PA resulted in normal growth in weanling rats, however, zinc concentration in bone and plasma was still sub-optimal. PMID:19269152

  7. Non-native acylated homoserine lactones reveal that LuxIR quorum sensing promotes symbiont stability.

    Science.gov (United States)

    Studer, Sarah V; Schwartzman, Julia A; Ho, Jessica S; Geske, Grant D; Blackwell, Helen E; Ruby, Edward G

    2014-08-01

    Quorum sensing, a group behaviour coordinated by a diffusible pheromone signal and a cognate receptor, is typical of bacteria that form symbioses with plants and animals. LuxIR-type N-acyl L-homoserine (AHL) quorum sensing is common in Gram-negative Proteobacteria, and many members of this group have additional quorum-sensing networks. The bioluminescent symbiont Vibrio fischeri encodes two AHL signal synthases: AinS and LuxI. AinS-dependent quorum sensing converges with LuxI-dependent quorum sensing at the LuxR regulatory element. Both AinS- and LuxI-mediated signalling are required for efficient and persistent colonization of the squid host, Euprymna scolopes. The basis of the mutualism is symbiont bioluminescence, which is regulated by both LuxI- and AinS-dependent quorum sensing, and is essential for maintaining a colonization of the host. Here, we used chemical and genetic approaches to probe the dynamics of LuxI- and AinS-mediated regulation of bioluminescence during symbiosis. We demonstrate that both native AHLs and non-native AHL analogues can be used to non-invasively and specifically modulate induction of symbiotic bioluminescence via LuxI-dependent quorum sensing. Our data suggest that the first day of colonization, during which symbiont bioluminescence is induced by LuxIR, is a critical period that determines the stability of the V. fischeri population once symbiosis is established. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

  8. Effects of feeding strategy on larval development of the Amazon River prawn Macrobrachium amazonicum

    Directory of Open Access Journals (Sweden)

    Mariana Cutolo de Araujo

    Full Text Available ABSTRACT Effects of four feeding regimes on the development and feed intake, survival, productivity, and growth of Macrobrachium amazonicum larvae were investigated. Larvae were fed from stage II to IX, as follows: Artemia nauplii + inert diet during the entire larval cycle (AIn; Artemia nauplii for the entire larval cycle + inert diet from stage V onward (A/AIn; Artemia nauplii until stage IV + inert diet from stage IV onward (A/In; and only inert diet for the entire larval cycle (In. Each feeding regime (treatment was carried out in three 50-L rectangular black tanks, set up in a recirculating system, filled with 10 salinity brackish water, and stocked at 81.8±0.8 larvae/L. The larval stage index, occurrence of Artemia nauplii and/or inert feed into the digestive tract, survival (number of larvae and postlarvae, productivity (number of postlarvae/L, and weight gain (mg were evaluated. Larval development was similar in treatments AIn, A/Ain, and A/In, but was delayed in treatment In. Artemia nauplii were ingested by larvae irrespective of developmental stages, while inert feed was ingested only from stage III onward. Survival and productivity were higher in treatment AIn and decreased according to the number of days larvae were fed Artemia nauplii. Macrobrachium amazonicum larvae are omnivorous and polytrophic, but live feed is essential in the first stages and act as a complementary diet in the last half of larval cycle. There is a potential for inert diet to replace Artemia in the last phase of development if the nutrient composition matches larvae requirements. The combination of Artemia nauplii and inert diet during all larval cycles is the best management to maximize productivity.

  9. O que devemos saber sobre a anticoagulação em portadores de doença valvar e fibrilação atrial - parte 1

    Directory of Open Access Journals (Sweden)

    Paulo de Lara Lavítola

    2010-03-01

    Full Text Available A indicação do anticoagulante oral é frequente nos pacientes com fibrilação atrial e disfunção valvar operados ou não. É tratamento prolongado e seu manuseio ao longo do tempo é complexo por estar atrelado a normas muitas vezes difíceis de serem obedecidas. Sua suspensão diante de procedimentos cirúrgicos é motivo de preocupação, aumentando ainda mais a complexidade do tratamento.

  10. Trombo flutuante em veia femoral

    Directory of Open Access Journals (Sweden)

    Matheus Bertanha

    2017-12-01

    Full Text Available Resumo O trombo venoso flutuante em veia femoral é um tipo de trombo com alto potencial de embolização pulmonar. Entretanto, ainda é controversa a conduta mais apropriada nesses casos. Tratamentos clínicos com anticoagulantes ou fibrinolíticos e trombectomias abertas ou por meio de dispositivos endovasculares vêm sendo empregados ainda sem um critério de indicação bem definido. Apresentamos três casos clínicos de trombos flutuantes em veia femoral, de etiologias distintas, cujos tratamentos e respectivas evoluções serão discutidos.

  11. Protocolo de atención a niños y adolescentes con cardiopatía congénita en odontopediatría. Revision bibliográfica

    OpenAIRE

    Juan Manuel de Jesús Cortes de la Torre; Raúl Arturo Cortes de la Torre; Laura Otilia Salazar; Alfredo Salazar de Santiago; Celia Elizabeth Luna Pacheco

    2015-01-01

    Introducción. Las cardiopatías congénitas son las malformaciones más habituales en el desarrollo de los niños los cuales, además, son susceptibles a desarrollar infecciones sistémicas microbianas secundarias a infecciones locales polimicrobianas como consecuencia de procedimientos dentales invasivos o toman fármacos, por ejemplo anti-coagulantes, antiarrítmicos, u otros, que pueden interferir con el manejo odontológico. Objetivo. Proponer un protocolo de manejo odontológico que permita detect...

  12. Desenvolvimento e validação de métodos analíticos e estudos de estabilidade da rivaroxabana

    OpenAIRE

    Nathalie Ribeiro Wingert

    2015-01-01

    A análise de fármacos é fundamental nas diversas fases do desenvolvimento farmacêutico, tais como estudos de formulação, estabilidade e controle de qualidade do produto. A rivaroxabana (RIV) é um anticoagulante de uso oral indicado para prevenção da formação de coágulos venosos. A literatura pesquisada apresenta poucos relatos de determinação quantitativa e de estudos de estabilidade do fármaco em comprimidos. E ainda nenhum método analítico em compêndios oficiais Diante do exposto, o objetiv...

  13. ¿Sabía usted? Anticuerpos antifosfolípidos

    Directory of Open Access Journals (Sweden)

    Javier Molina

    1992-02-01

    Full Text Available

    Los anticuerpos antifosfolípidos comprenden varias poblaciones de inmunoglobulinas, que pueden ocasionar falsos positivos biológicos con el VDRL, interferir con el complejo activador de la protrombina (anticoagulante lúpico o reaccionar con elfosfolípido cardiolipina en una prueba de enzimoinmunoanálisis (EIA.

  14. Anticoagulación oral en el adulto mayor frágil con fibrilación auricular

    OpenAIRE

    Miguel Oswaldo Cadena-Sanabria; Oscar Mariano Pinto-Saavedra; Juan Fernando Contreras-Valero; Gustavo Eduardo Ortega-Ramírez; Heider Alexis Bautista-Mier

    2016-01-01

    Introducción: El envejecimiento incrementa el riesgo de trombosis y fenómenos embólicos, trae cambios fisiológicos y comorbilidades como la fibrilación auricular que hacen complejo el inicio y la seguridad de la anticoagulación. Apesar de la mayor disponibilidad de clínicas de anticoagulación y nuevos anticoagulantes orales, es bajo el porcentaje de adultos mayores que están anticoagulados aunque tengan indicación plena y ausencia de contraindicaciones. Objetivo: Revisar las principales estra...

  15. Efecto in vitro del látex de Ficus insipida sobre la cascada de la coagulación sanguínea.

    Directory of Open Access Journals (Sweden)

    Fernando Concha-Benavente

    2010-07-01

    Full Text Available Es necesario investigar drogas naturales nuevas que aporten principios farmacológicos activos para ser utilizadas como una alternativa terapéutica. Por este motivo nos propusimos estudiar a Ficus insipida, cuyo látex ha sido usado como antihelmíntico durante muchos años en la amazonía, pero se investigó solo superficialmente su efecto anticoagulante in vitro. Objetivo: Comprobar el efecto anticoagulante in vitro y determinar la vía de la coagulación sobre la que actúa el látex de Ficus insípida. Material y métodos: Se obtuvo el látex de Ficus insipida y se prepararon diferentes concentraciones del mismo. Se obtuvieron muestras de sangre venosa periférica de 5 donantes voluntarios, anticoagulándolas con citrato de sodio. Luego, éstas se mezclaron con las diluciones del látex, se centrifugaron y se extrajo el plasma. Posteriormente, se obtuvo un pool de plasma para cada concentración del látex y se procedió a determinar el Tiempo de Protrombina (TP y el Tiempo de Tromboplastina Parcial activada (TTPa, respectivamente. Resultados: Se encontró que el látex de Ficus insipida prolongó el TP a una concentración mayor o igual a 0,03125% (V/V, y ambos, el TP y TTPa a una concentración mayor o igual a 0,15% (V/V. Conclusiones: Los resultados obtenidos nos permiten afirmar que el látex de Ficus insipida posee un efecto anticoagulante in vitro dosis dependiente sobre la vía extrínseca de la coagulación sanguínea a una concentración igual o mayor a 0,03125% (V/V y que a una concentración igual o mayor a 0,15% (V/V posee un potente efecto anticoagulante sobre ambas vías de la coagulación.(Rev Med Hered 2010;21:146-152.

  16. SÍNDROME ANTIFOSFOLÍPIDOS Y TROMBOCITOPENIA MATERNA EN GEMELAR BICORIÓNICO CON RESTRICCIÓN FETAL GRAVE

    OpenAIRE

    Hasbun H,Jorge; Conte L,Guillermo; Sepúlveda L,Waldo; Manríquez S,María Angélica; Martínez M,José

    2006-01-01

    Se presenta un caso clínico de síndrome antifosfolípidos con antecedente de mortinato y tratamiento anticoagulante prolongado. En la segunda gestación (gemelar bicoriónico) desarrolla una restricción fetal precoz selectiva en un gemelo, seguido de detención definitiva de su crecimiento en semana 25. Luego del tratamiento de una trombocitopenia materna intercurrente se decidió la interrupción del embarazo en semana 28 por operación cesárea. Ambos gemelos de 860 y 406 gramos sobrevivieron en bu...

  17. Casos de intoxicações exógenas em cães e gatos atendidos na Faculdade de Veterinária da Universidade Federal Fluminense durante o período de 2002 a 2008

    OpenAIRE

    Medeiros,Renata Jurema; Monteiro,Fábio de Oliveira; Silva,Gleice Castelo da; Nascimento Júnior,Amary

    2009-01-01

    Nos últimos anos, casos de intoxicação exógena de animais domésticos foram atendidos na Faculdade de Veterinária da Universidade Federal Fluminense (UFF). Sejam acidentais ou intencionais, esses casos ocorrem principalmente no ambiente doméstico e envolvem diferentes agentes tóxicos, tais como agrotóxicos, raticidas anticoagulantes, medicamentos, dentre outros. O presente trabalho objetivou realizar um estudo retrospectivo dos casos de intoxicação em cães e gatos atendidos na Faculdade de Vet...

  18. Dolor abdominal y hematoma cutáneo

    OpenAIRE

    MANUEL JESÚS NÚÑEZ FERNÁNDEZ; JUAN CARLOS GARCÍA GARCÍA

    2012-01-01

    Mujer de 83 años portadora de cardiopatía isquémica, insuficiencia mitral moderada, fibrilación auricular crónica. A tratamiento con nitroglicerina transdérmica, diuréticos, calcioantagonistas, estatinas y anticoagulantes orales (acenocumarol).Ingresa en nuestro Servicio por infección respiratoria e insuficiencia respiratoria, con tos frecuente y expectoración amarillenta en los 4 días previos. En el noveno día de su ingreso refiere la presencia de un hematoma espontáneo a nivel abdominal aco...

  19. Dolor abdominal y hematoma cutáneo

    Directory of Open Access Journals (Sweden)

    MANUEL JESÚS NÚÑEZ FERNÁNDEZ

    2012-09-01

    Full Text Available Mujer de 83 años portadora de cardiopatía isquémica, insuficiencia mitral moderada, fibrilación auricular crónica. A tratamiento con nitroglicerina transdérmica, diuréticos, calcioantagonistas, estatinas y anticoagulantes orales (acenocumarol.Ingresa en nuestro Servicio por infección respiratoria e insuficiencia respiratoria, con tos frecuente y expectoración amarillenta en los 4 días previos. En el noveno día de su ingreso refiere la presencia de un hematoma espontáneo a nivel abdominal acompañado de dolor a dicho nivel.

  20. SINDROME ANTIFOSFOLIPIDOS Y EMBARAZO

    OpenAIRE

    Correa P.,Angel; Valderrama C.,Oscar; Angel G.,Raul; Sáez C.,Jaime; Villablanca O.,Ernesto

    2002-01-01

    El SAF es una enfermedad del sistema inmune (Trombofilia), en la cual existen anticuerpos con aparente especificidad por fosfolípidos con carga eléctrica negativa. Se define como la ocurrencia de trombosis, aborto recurrente o ambos junto con la presencia de anticuerpos antifosfolípidos circulantes (Anticoagulante lúpico, anticardiolipinas y ß2-glicoproteina I). Su incidencia de todas las Trombofílias es de un 3,5% a 6%. Existen hipótesis actuales que explicarían su patogenia basados en la ac...