WorldWideScience

Sample records for anticoagulantes disolventes aines

  1. El CO2 como disolvente y como reactivo

    OpenAIRE

    La Franca Pitarresi, Vincenzo Rosario

    2016-01-01

    Existen numerosas ventajas asociada con el uso de CO2 , tanto como disolvente que como reactivo, y todas se pueden resumir en cuatro categorías generales: beneficios ambiental, beneficios de salud y seguridad, beneficios en el procedimiento y beneficios químicos. Los procesos que implican el CO2 como disolvente no aumentaría las emisiones de CO2, más bien proporcionaría una oportunidad para el reciclaje de CO2 residual. Además, los esfuerzos para secuestrar el CO2 producido de los gases de co...

  2. Extraccion de aceite de coco a partir de la copra por medio de disolventes quimicos

    OpenAIRE

    J. Rosario Rivera Hernández; Juana María Lomelí Soto; Lorena Román Salinas; Francisco Vera Figueroa

    2001-01-01

    Acetato de Etilo, alcohol Isopropílico, Hexano, Tetracloruro de carbono y xileno, fueron usados como disolventes para extraer de la copra aceite de coco. Se aplicaron dos procedimientos de extracción sólido-líquido a la temperatura de ebullición de los disolventes, así mismo se efectuaron tres corridas de extracción a tiempos de 1.0, 1.5 y 2.0 hrs. los resultados de las extracciones aparecen en las tablas 1 y 2.

  3. Uso de los anticoagulantes orales directos en la práctica clínica

    Directory of Open Access Journals (Sweden)

    Rubén Guillermo Jaramillo Salamanca

    2016-04-01

    Full Text Available Los anticoagulantes orales directos surgieron en respuesta a la búsqueda de un anticoagulante ideal después de que la warfarina fuera por mucho tiempo el único disponible. Los inhibidores del factor X activado —rivaroxabán y apixabán— y el inhibidor de trombina —dabigatrán etexilato— ya están aprobados en Colombia. Estos grupos farmacológicos están indicados en la tromboprofilaxis luego de artroplastia de rodilla y cadera, en la prevención del accidente cerebrovascular y el embolismo sistémico en pacientes con fibrilación auricular no valvular y en el tratamiento del tromboembolismo venoso. La aprobación de los inhibidores se dio luego de mostrar eficacia y seguridad al compararse con warfarina y enoxaparina. Entre las ventajas que estos presentan figuran las siguientes: inicio rápido de acción, efecto predecible, poca variabilidad interindividual que elimina la necesidad de la monitorización frecuente y menos interacciones medicamentosas; pero, al igual que en la warfarina, el sangrado es el principal evento adverso.   El objetivo de esta revisión es conocer la farmacología de los anticoagulantes orales directos aprobados en Colombia, los resultados de los ensayos clínicos que respaldan su uso, la dosificación, el uso perioperatorio y el cambio entre anticoagulantes; situaciones que plantean particularidades para cada uno.

  4. ANTICOAGULANTE ORAL: CONSTRUÇÃO E VALIDAÇÃO

    Directory of Open Access Journals (Sweden)

    Flávia Martinelli Pelegrino

    2014-01-01

    Full Text Available Se trata de un relato de experiencia sobre la construcción y validación de un protocolo educativo para pacientes en fase de uso de anticoagulación oral. Con base en la Teoría Cognitiva Social de Bandura se identificó tres fases necesarias para componer el protocolo educativo. La revisión de la literatura sobre anticoagulante oral ayudó a preparar el contenido de cada fase del protocolo. Como resultado, en la fase de la atención y retención se dio la elaboración de orientación verbal y escrita. En la fase de la reproducción y motivación fue realizado un refuerzo por contacto telefónico. Finalmente, en la fase de desempeño se espera la mejora en la evaluación de los resultados relacionados al uso de anticoagulante oral. Definido el protocolo educativo se dio la validación de la cara y el contenido. Este proceso permitió adaptaciones que permitieron la finalización de la construcción del protocolo educativo.

  5. Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar

  6. Fabrication of AIN/cU Composites Using Electroless Plating and Evaluation of Their Thermal Properties according to AIN Particle Size

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Sung Chul; Han, Jun Hyun [Chungnam National University, Daejeon (Korea, Republic of); Ko, Se-Hyun [Korea Institute of Industrial Technology, Incheon (Korea, Republic of); Kim, Hye Sung [Pusan National University, Miryang (Korea, Republic of); Han, Jun Hyun [Korea Institute of Science and Technology, Seoul (Korea, Republic of)

    2015-12-15

    AIN/Cu composite powders with a core-shell structure were synthesized by a new technique using electroless plating of Cu on AIN particles and consolidated by spark plasma sintering (SPS). Dependence of the thermal conductivity and coefficient of thermal expansion (CTE) of the AIN/Cu composites on the particle size of AIN were studied. The thermal conductivity and coefficient of thermal expansion were significantly dependent on the existence of both boundary pores surrounding the Cu-coated AIN particles and the internal pores of the AIN particles. In order to eliminate the pores, the temperature and pressure of SPS were increased and the AIN particles were heat-treated at high temperature. Adoption of the core-shell AIN/Cu composite powders facilitated the fabrications of AIN/Cu composites with low porosity and uniform distribution in the AIN in Cu matrix.

  7. Indicaciones y control de la medicación anticoagulante

    Directory of Open Access Journals (Sweden)

    Armando Solano Puerto

    1954-09-01

    Full Text Available Considero importante el tratar de hacer un balance de nuestros conocimientos actuales en materia de medicación anticoagulante. En primer lugar, porque los avances realizados en estos últimos años, debidos en buena parte a la labor de investigadores canadienses y franceses, han llevado a un alto grado de perfeccionamiento la terapéutica, tanto preveritiva como curativa, de trombosis arteriales y venosas.

  8. Riesgo cardiovascular en pacientes nonagenarios: Antiagregantes y anticoagulantes

    OpenAIRE

    Pérez Expósito, Lucía

    2017-01-01

    A pesar del incremento de la esperanza de vida en los últimos años, las guías de práctica clínica sobre riesgo cardiovascular no tienen en cuenta las comorbilidades, la plurimedicación o las características propias asociadas al envejecimiento de los pacientes de mayor edad. Es más, la prescripción de tratamientos antiagregantes y anticoagulantes en pacientes nonagenarios parece no estar condicionada por la edad, el grado de deterioro mental, el grado de dependencia ni con la...

  9. Efecto de inclusión de anticoagulantes durante el beneficio de Hevea brasiliensis (Willd. ex A.Juss. Müll.Arg.

    Directory of Open Access Journals (Sweden)

    Lina Paola Mendoza Vargas

    2018-01-01

    Full Text Available Se evaluó el efecto de un agente anticoagulante del látex en el árbol de caucho (Hevea brasiliensis. Se caracterizó el contenido de solidos totales (TSC y contenido de caucho seco (DRC del látex, se evaluaron cuatro tratamientos de anticoagulantes en campo: (T1 amoniaco, (T2 bórax, (T3 amoniaco-bórax y (T0 sin anticoagulante. En las láminas se evaluaron cinco diluciones (v/v de látex en agua D1 (100 %, D2 (75 %, D3 (50 %, D4 (25 % y D5 (0 %, a estas se hicieron pruebas de tensión, compresión y espesor. El látex caracterizado obtuvo TSC (37.1 %+0.27, DRC (34.3 %+0.19. Encontrándose en T3D1 mayor resistencia de tensión hasta punto de ruptura de 13.37 KgF, compresión de 5 KgF, y menor espesor de 1.52 mm, sin diferencia significativa entre los tratamientos T3 y T2 y las diluciones D1 a D2, posibilitando reducir el consumo de agua (25 %, y la producción de ripio (38 % con anticoagulantes, sin afectar negativamente sus propiedades mecánicas.

  10. Profilaxis de la úlcera gastrointestinal producida por AINES

    Directory of Open Access Journals (Sweden)

    Carlos Bustamante Rojas

    1998-04-01

    Full Text Available Como grupo, los AINES son los fármacos más frecuentemente  relacionados con informes acerca de Reacciones Adversas en varios países, se considera que más de 30 millones de personas en el mundo toman a diario AINES por  prescripción médica o por autoprescripción y que un alto porcentaje de dichas personas corresponden al grupo de edad mayor de 60 años. Diversos metaanálisis revelan que el riesgo de presentar eventos gastrointestinales graves en consumidores regulares de AINES puede ser de 3 a 4 veces mayor que en no usuarios al cabo de 30 dias y que dicho riesgo relativo estimado puede elevarse a 5.5 en pacientes ancianos (7 y a valores cercanos a 8.0 cuando se usan altas dosis del AINE (I, 8. También se ha relacionado el empleo crónico de AINES con un aumento en la mortalidad en ancianos.

  11. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2004-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  12. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  13. ain defla, algeria

    African Journals Online (AJOL)

    Hamaidi-Chergui F, Brahim Errahmani M, Debib A, Hamaidi M.S

    2016-05-01

    May 1, 2016 ... Water from boreholes in Arib (Ain Defla) was investigated to ... of 100 ml is drawn through a membrane filter (0.45 μm pore size) using a vacuum pump. The .... boreholes are very important as clean and hygienic environment ...

  14. Nuevos anticoagulantes orales en pacientes con enfermedad renal crónica

    Directory of Open Access Journals (Sweden)

    Lara Belmar Vega

    2017-05-01

    Full Text Available Los pacientes con enfermedad renal crónica (ERC tienen tendencias hemorrágicas y trombóticas, por lo que la indicación de anticoagulación ante la aparición de fibrilación auricular (FA es compleja. La FA es la arritmia cardíaca crónica más frecuente, siendo el tromboembolismo y el ictus isquémico en particular las complicaciones más importantes. En los últimos años se han desarrollado nuevos fármacos anticoagulantes orales que han mostrado superioridad respecto a los clásicos antagonistas de la vitamina K (AVK en la prevención de ictus, embolismo sistémico y riesgo de sangrado, constituyendo una alternativa eficaz a ellos.

  15. Electronic structure and optical properties of AIN under high pressure

    International Nuclear Information System (INIS)

    Li Zetao; Dang Suihu; Li Chunxia

    2011-01-01

    We have calculated the electronic structure and optical properties of Wurtzite structure AIN under different high pressure with generalized gradient approximation (GGA) in this paper. The total energy, density of state, energy band structure and optical absorption and reflection properties under high pressure are calculated. By comparing the changes of the energy band structure, we obtained AIN phase transition pressure for 16.7 GPa, which is a direct band structure transforming to an indirect band structure. Meanwhile, according to the density of states distribution and energy band structure, we analyzed the optical properties of AIN under high-pressure, the results showed that the absorption spectra moved from low-energy to high-energy. (authors)

  16. NUEVOS ANTICOAGULANTES ORALES EN FIBRILACIÓN AURICULAR

    Directory of Open Access Journals (Sweden)

    Dra. E. Marianella Seguel R.

    2015-03-01

    Full Text Available La fibrilación auricular es la arritmia más frecuente y se relaciona con una alta tasa de accidente cerebrovascular y embolia sistécmica. La terapia establecida tanto para prevención primaria como secundaria es la anticoagulación con warfarina, antagonista de la vitamina K. Existen escalas que predicen el riesgo tromboembólico y la probabilidad de beneficiarse de terapia antitrombótica. El CHADS2 ha sido la más simple y ampliamente utilizada, pero actualmente el CHA2DS2-VASc ha incorporado otros factores de riesgo, otorgando una mejor estratificación. El estrecho margen terapécutico de la warfarina y la interacción con fármacos y alimentos requiere controles seriados de la intensidad de la anticoagulación, limitando su uso clínico. Han aparecido nuevos anticoagulantes que ofrecen ventajas sobre los antagonistas de vitamina K. Estos actúan en dos sitios distintos de la cascada de la coagulación: inhibiendo directamente la trombina como el dabigatran, o el factor X activado como el rivaroxaban, apixaban, edoxaban y betrixaban. Estos nuevos fármacos han ido reemplazando a la warfarina y ya están incluidos en las guías de manejo de fibrilación auricular no valvular.

  17. Oxidation behaviour of Ti2AIN films composed mainly of nanolaminated MAX phase.

    Science.gov (United States)

    Wang, Q M; Garkas, W; Renteria, A Flores; Leyens, C; Kim, K H

    2011-10-01

    In this paper, we reported the oxidation behaviour of Ti2AIN films on polycrystalline Al2O3 substrates. The Ti2AIN films composed mainly of nanolaminated MAX phase was obtained by first depositing Ti-Al-N films using reactive sputtering of two elemental Ti and Al targets in Ar/N2 atmosphere and subsequent vacuum annealing at 800 degrees C for 1 h. The Ti2AIN films exhibited excellent oxidation resistance and thermal stability at 600-900 degrees C in air. Very low mass gain was observed. At low temperature (600 degrees C), no oxide crystals were observed on film surface. Blade-like Theta-Al2O3 fine crystals formed on film surfaces at 700-800 degrees C. At high temperature (900 degrees C), firstly Theta-Al2O3 formed on film surface and then transformed into alpha-Al2O3. At 700-900 degrees C, a continuous Al2O3 layer formed on Ti2AIN films surface, acting as diffusion barrier preventing further oxidation attack. The mechanism of the excellent oxidation resistance of Ti2AIN films was discussed based on the experimental results.

  18. Terapia anticoagulante en fibrilación auricular

    Directory of Open Access Journals (Sweden)

    Sebastián Prieto

    2011-06-01

    Full Text Available La fibrilación auricular es la taquiarritmia cardíaca más frecuente. Su incidencia aumenta con la edad, presentándose en un 1.5% entre los 50 a 59 años, y en un 8-10% entre los 80 a 89 años. Esta arritmia incrementa en cinco veces el riesgo de sufrir un evento cerebrovascular isquémico cardioembólico y causa el 15% de todos los accidentes cerebrovasculares isquémicos. Su manejo se enfoca en la prevención de los fenómenos tromboembólicos y el control de la frecuencia y ritmo cardíaco. El tratamiento anticoagulante ha demostrado ser la principal herramienta en la prevención de eventos cardioembólicos. Aunque las complicaciones hemorrágicas por el tratamiento son esperables y aumentan con la edad, el beneficio de usar anticoagulación sobrepasa por mucho al riesgo de sangrado. Precisamente debido a la heterogeneidad clínica de esta arritmia y a la dificultad de establecer un tratamiento adecuado para cada caso en particular, el American College of Cardiology, la American Heart Association, la European Society of Cardiology y el American College of Chest Physicians han establecido guías para mejorar el tratamiento de estos pacientes. La revisión de esta enfermedad y de las directrices propuestas puede facilitar y mejorar notablemente el tratamiento de los pacientes con fibrilación auricular.

  19. Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau

    Index Scriptorium Estoniae

    Karnau, Andrus

    2005-01-01

    Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet

  20. Põhikooli ainesõnastikud / Heiki Jaan Kaalep, Jaan Mikk

    Index Scriptorium Estoniae

    Kaalep, Heiki-Jaan, 1962-

    2008-01-01

    Eesti vene õppekeelega koolidele keskastme ainesõnastike loomise konkursi tulemustest, kirjeldatakse koostatud sõnastike eesmärke ja kirjestruktuuri, samuti loomisprotsessi etappe. Vaadeldakse ka morfoloogiaalase tarkvara kasutamisvõimalusi sõnastiku loomisel

  1. HPV infection, anal intra-epithelial neoplasia (AIN and anal cancer: current issues

    Directory of Open Access Journals (Sweden)

    Stanley Margaret A

    2012-09-01

    Full Text Available Abstract Background Human papillomavirus (HPV is well known as the major etiological agent for ano-genital cancer. In contrast to cervical cancer, anal cancer is uncommon, but is increasing steadily in the community over the last few decades. However, it has undergone an exponential rise in the men who have sex with men (MSM and HIV + groups. HIV + MSM in particular, have anal cancer incidences about three times that of the highest worldwide reported cervical cancer incidences. Discussion There has therefore traditionally been a lack of data from studies focused on heterosexual men and non-HIV + women. There is also less evidence reporting on the putative precursor lesion to anal cancer (AIN – anal intraepithelial neoplasia, when compared to cervical cancer and CIN (cervical intraepithelial neoplasia. This review summarises the available biological and epidemiological evidence for HPV in the anal site and the pathogenesis of AIN and anal cancer amongst traditionally non-high risk groups. Summary There is strong evidence to conclude that high-grade AIN is a precursor to anal cancer, and some data on the progression of AIN to invasive cancer.

  2. Polimorfísmos genéticos de COX-1 y eNOS y hemorragias gastrointestinales: interacción con aire: Un estudio de casos y controles

    OpenAIRE

    Salado Valdivieso, María Inés

    2014-01-01

    La hemorragia gastrointestinal alta es un cuadro grave que está producido por medicamentos en un porcentaje elevado de los casos. Ciertos fármacos como los antiinflamatorios no esteroideos (AINE), los antiagregantes plaquetarios o los anticoagulantes orales, pueden dar lugar a una hemorragia que exija la hospitalización del paciente y, en ocasiones, provoque la muerte. Además de los fármacos, se han identificado otros factores que se asocian con la hemorragia gastrointestinal; entre ellos es...

  3. Fabrication and performance of AIN insulator coatings for application in fusion reactor blankets

    International Nuclear Information System (INIS)

    Natesan, K.

    1995-09-01

    The liquid-metal blanket concept for fusion reactors requires an coating on the first-wall structural material to minimize the magnetohydrodynamic pressure drop that occurs during the flow of liquid metal in a magnetic field. Based on the thermodynamics of interactions betwen the coating and the liquid lithium on one side and the structural V-base alloy on the other side, an AIN coating was selected as a candidate. Detailed investigations were conducted on the fabrication, metallurgical microstructure, compatibility in liquid Li, and electrical characteristics of AIN material obtained from several sources. Lithium compatibility was studied in static systems by exposing AIN-coated specimens to liquid Li for several time periods. Electrical resistance was measured at room temperature on the specimens before and after exposure to liquid Li. The results obtained in this study indicate that AIN is a viable coating from the standpoint of chemical compatibility in Li, electrical insulation, and ease of fabrication; for these reasons, the coating should be examined further for fusion reactor applications

  4. Pancreatite aguda devida a hematoma intramural do duodeno por uso de anticoagulante Acute pancreatitis due to intramural hematoma of the duodenum by use of anticoagulant therapy

    Directory of Open Access Journals (Sweden)

    Samer FARHOUD

    2001-01-01

    Full Text Available Racional - A hemorragia intramural espontânea do duodeno causada por complicações da terapêutica anticoagulante é rara e seu tratamento controverso. Objetivo -- Apresentar a experiência advinda do tratamento de doente com essa condição clínica. Relato do caso - Expõe-se o caso de uma mulher de 71 anos de idade, que há 3 meses fazia uso de anticoagulante oral para tratamento de trombose venosa profunda dos membros inferiores. Apresentou-se com cefaléia e dores abdominais intensas no andar superior do abdome, associadas a náuseas e vômitos. Os exames laboratoriais e de imagem comprovaram o diagnóstico de surto agudo de pancreatite, decorrente de hematoma intramural de duodeno. Os valores de protrombina (49,7 s e o sangramento de tecidos moles cervicais e urinário, sugeriam complicação da terapêutica anticoagulante. Resultados - A terapêutica conservadora foi efetiva, tendo a doente recebido alta, assintomática, no 10º dia de internação. Conclusão - É recomendado o emprego do anticoagulante em doses menores nos doentes de risco e adequado controle dos parâmetros da coagulação. Acredita-se ser ideal a conduta conservadora e recomenda-se a cirurgia somente nos casos que evoluem com complicações.Background - Spontaneous intramural hemorrhage of the duodenum due to anticoagulant therapy is rare and the treatment is controversial. Objective - To present the acquired knowledge with the treatment of these disease. Case report - A 71-year-old women receiving for a 3 month period an anticoagulant therapy presented cervical bleeding of soft tissues and symptoms of acute pancreatitis and high small bowel obstruction. Early noninvasive diagnosis by computed tomographic scan was possible and conservative therapy proved successful in complete resolution of the pancreatitis and obstructive symptoms, with resumption of oral intake in the fourth day of treatment. The frequency of bleeding in high risk patients during warfarin therapy

  5. Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina

    Index Scriptorium Estoniae

    Seppik, Ain, 1952-

    2007-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku

  6. Avaliação do desempenho dos reagentes do tempo de tromboplastina parcial ativada utilizados para detectar o anticoagulante lúpico Assessment of the performance of reagents of activated partial thromboplastin time used to detect the lupus anticoagulant

    Directory of Open Access Journals (Sweden)

    Fernanda Chiuso

    2005-06-01

    Full Text Available INTRODUÇÃO: O anticoagulante lúpico é uma imunoglobulina pertencente à família dos anticorpos antifosfolípides. A sua ação in vitro é interferir nos testes de coagulação dependentes de fosfolípides. O tempo de tromboplastina parcial ativada (TTPA é um teste utilizado como screening na pesquisa do anticoagulante lúpico. Os reagentes utilizados neste teste apresentam grandes variações quanto à sensibilidade. OBJETIVO: Avaliar o desempenho dos reagentes do TTPA e detectar a presença do anticoagulante lúpico através de diferentes testes da coagulação. MATERIAL E MÉTODO: A pesquisa do anticoagulante lúpico foi realizada em 50 amostras plasmáticas de pacientes do sexo feminino através dos testes do TTPA, do tempo de coagulação do caulim (TCC, do tempo de tromboplastina parcial ativada diluída (TTPAd e do tempo do veneno da víbora de Russel diluído (TVVRd. Três cefalinas comerciais foram avaliadas pelos testes do TTPA e do TTPAd. Na comparação entre os reagentes estudados foi aplicado o cálculo do intervalo de confiança (95%. RESULTADOS: Os três reagentes avaliados apresentaram boa concordância e os métodos utilizados responderam bem à pesquisa do anticoagulante lúpico. DISCUSSÃO E CONCLUSÃO: As três cefalinas comerciais avaliadas podem ser utilizadas na rotina laboratorial para a pesquisa do anticoagulante lúpico.INTRODUCTION: The lupus anticoagulant is an immunoglobin which belongs to the antiphospholid antibodies family. Its in vitro function is to interfere with coagulation tests that are dependent on phospholipids. The activated partial thromboplastin time (APTT is a test used as screening on lupus anticoagulant research. Reagents used in this test demonstrate wide sensitivity ranges. OBJECTIVE: To assess the performance of APTT reagents and detect the presence of lupus anticoagulant through various coagulation tests. MATERIAL AND METHOD: The lupus anticoagulant research was performed in plasma from 50

  7. F-type centers in neutron-irradiated AIN

    International Nuclear Information System (INIS)

    Atobe, Kozo; Honda, Makoto; Fukuoka, Noboru; Okada, Moritami; Nakagawa, Masuo.

    1990-01-01

    The production of point defects by neutron irradiation and thermal decay in sintered AIN polycrystal are investigated. The absorption band at 370 nm is observed after reactor neutron irradiation to a dose of 10 16 n/cm 2 (E > 0.1 MeV). The defect corresponding to the band is tentatively assigned as an F-type center from the optical absorption and electron spin resonance. (author)

  8. Leaky surface acoustic waves in Z-LiNbO3 substrates with epitaxial AIN overlays

    International Nuclear Information System (INIS)

    Bu, G.; Ciplys, D.; Shur, M.S.; Namkoong, G.; Doolittle, W.A.; Hunt, W.D.

    2004-01-01

    The properties of leaky surface acoustic waves (LSAW) in MBE grown AIN layer on Z-cut LiNbO 3 structures have been studied by numerical simulation and experimental measurements and compared with those of Rayleigh waves in the same structure. In the range of AIN layer thicknesses studied (0 3 substrate was essentially constant at around 4400 m/s. The measured electromechanical coupling coefficients (K 2 ) for the LSAW are roughly 1/4 of the predicted values, which might be due to the strong attenuation of the leaky wave unaccounted for during the parameter extraction. The thin AIN film slightly improved the measured temperature coefficient of frequency for the LSAW over that attained for the Z-cut, X-propagating LiNbO 3 substrate alone

  9. Purificação, caracterização físico-química e atividade anticoagulante de glicosaminoglicanos isolados da pele de tilápia do Nilo (Oreochromis niloticus - doi: 10.4025/actascitechnol.v33i3.9400

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2011-07-01

    Full Text Available Os glicosaminoglicanos (GAGs constituem a matriz extracelular de tecidos animais e os resíduos do processamento de peixes comercialmente cultivados podem oferecer novos agentes anticoagulantes em substituição à heparina (HEP nas ciências médicas. Objetivou-se purificar, caracterizar físico-quimicamente e avaliar a atividade anticoagulante dos GAGs isolados da pele da tilápia do Nilo, Oreochromis niloticus. Os GAGs foram extraídos com papaína em tampão acetato de sódio 100 mM (pH 5,0 contendo cisteína e EDTA (5 mM, seguido por cromatografia de troca iônica em coluna de DEAE-celulose, utilizando um gradiente de NaCl. As frações obtidas foram liofilizadas e submetidas à eletroforese em gel de agarose a 0,5%. A atividade anticoagulante foi avaliada por meio do tempo de tromboplastina parcial ativada (TTPA, usando-se plasma humano normal e HEP padrão (193 UI mg-1. O perfil cromatográfico mostrou a separação de duas diferentes frações de GAGs (F I e F II, eluídas com 0,50 e 0,75 M de NaCl, respectivamente, revelando, por eletroforese, frações distintas em densidade de cargas, porém ambas mostrando GAGs com mobilidades semelhantes ao dermatam sulfato (DS padrão, sugerindo-se a identificação preliminar desse GAG. Os GAGs modificaram o TTPA, cujas atividades perfizeram, respectivamente, 4,72 (F I e 23,80 (F II UI mg-1, e expressaram-se dose-dependente. Portanto, o DS anticoagulante da pele de O. niloticus sugere uma fonte interessante para estudos posteriores de atividade antitrombótica.

  10. Vitamina K: metabolismo, fontes e interação com o anticoagulante varfarina Vitamin K: metabolism, sources and interaction with the anticoagulant warfarin

    Directory of Open Access Journals (Sweden)

    Karin Klack

    2006-12-01

    Full Text Available A vitamina K é lipossolúvel, principalmente, na coagulação sanguínea. Se apresenta sob as formas de filoquinona (K1-predominante, dihidrofiloquinona (dK, menaquinona (K2 e menadiona (K3. Os fatores que interferem em sua absorção são: má absorção gastrintestinal, secreção biliar, ingestão insuficiente e uso de anticoagulantes, entre outros. As principais fontes de vitamina K são os vegetais e óleos, sendo esses os responsáveis pelo aumento da absorção da filoquinona. Os alimentos folhosos verde escuro, os preparados à base de óleo, oleaginosas e frutas como o kiwi, abacate, uva, ameixa e figo contêm teores significantes de vitamina K, enquanto que os cereais, grãos, pães e laticínios possuem teores discretos. A ingestão diária de aproximadamente 1µg por quilo de peso é considerada a mais segura, inclusive para a utilização de anticoagulantes orais, em que a concentração estável da vitamina proporciona a eficácia no tratamento. A droga anticoagulante oral geralmente utilizada é a varfarina, administrada como profilática e para tratamento de fenômenos tromboembólicos. Essa intervenção medicamentosa é monitorada pelo tempo de protrombina expresso pela razão normalizada internacional, tendo como objetivo estabelecer a faixa terapêutica entre 2 e 3, minimizando o risco de hemorragias. O efeito anticoagulante pode ser reduzido por fatores como ganho de peso, diarréia, vômito, idade menor que 40 anos e consumo excessivo de vitamina K na dieta alimentar.Vitamin K is a fat-soluble substance, mainly involved in the blood coagulation. It is presented as Phylloquinone (K1-predominant, Dihydrophyloquinone (dK, Menaquinone (K2, and Menadione (K3. The factors that interfere with its absorption are: gastrointestinal malabsorption, biliary secretion, inadequate ingestion and anticoagulant use, among others. The main vitamin K sources are vegetables and organic lipids, that are involved in the increased absorption of

  11. Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

  12. ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

  13. Nuevos anticoagulantes orales en fibrilación auricular no valvular

    Directory of Open Access Journals (Sweden)

    Andrés F. Buitrago, MD

    2012-07-01

    Full Text Available La fibrilación auricular es la arritmia cardiaca sostenida más común y su prevalencia se duplica cada decenio por encima de los cincuenta años. Entretanto, las condiciones clínicas que más se asocian con ésta son la hipertensión arterial, la insuficiencia cardíaca, la enfermedad valvular cardíaca y la diabetes mellitus. Como complicaciones está la falla cardiaca, pero tal vez una de las peores son los eventos cardioembólicos, que ocurren aproximadamente en 4,5% de los pacientes no anticoagulados. El tratamiento antitrombótico con antagonistas de la vitamina K fue, durante más de cincuenta años, la única alternativa disponible, a pesar de sus múltiples limitaciones, las mismas que llevaron al desarrollo de nuevos fármacos anticoagulantes que disminuyen muchos de los problemas de los antagonistas de la vitamina K. Pueden agruparse en dos clases: inhibidores orales directos de la trombina e inhibidores orales del factor X activado. Tanto dabigatrán, rivaroxabán como apixabán, cuentan ya con estudios clínicos controlados aleatorizados que apoyan su uso en el tratamiento antitrombótico de la fibrilación auricular y recientemente se incluyeron en las guías basadas en la evidencia como alternativa (ACC e incluso con un grado de recomendación superior (CCS, CHEST al de los antagonistas de la vitamina K.

  14. Dietary intake of ain-93 standard diet induces Fatty liver with altered hepatic fatty acid profile in Wistar rats.

    Science.gov (United States)

    Farias Santos, Juliana; Suruagy Amaral, Monique; Lima Oliveira, Suzana; Porto Barbosa, Júnia; Rego Cabral, Cyro; Sofia Melo, Ingrid; Bezerra Bueno, Nassib; Duarte Freitas, Johnatan; Goulart Sant'ana, Antônio; Rocha Ataíde, Terezinha

    2015-05-01

    There are several standard diets for animals used in scientific research, usually conceived by scientific institutions. The AIN-93 diet is widely used, but there are some reports of fatty liver in Wistar rats fed this diet. We aimed to evaluate the hepatic repercussions of the AIN-93 diet intake in Wistar rats. Forty newly-weaned 21-day-old male Wistar rats were fed either the AIN-93 diet or a commercial diet for either 1 month or 4 months. Weight gain, serum biochemistry, hepatic histology, and hepatic fatty acid profile were analyzed. Hepatic steatosis was observed, especially in the group fed the AIN-93 diet. Serum blood glucose, absolute and relative liver weight and hepatic levels of oleic, palmitoleic, stearic, and palmitic fatty acids were related to the observed steatosis, while lipidogram and serum markers of liver function and injury were not. AIN-93 diet induced acute hepatic steatosis in Wistar rats, which may compromise its use as a standard diet for experimental studies with rodents. The hepatic fatty acid profile was associated with steatosis, with possible implications for disease prognosis. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

  15. Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

    Index Scriptorium Estoniae

    Padrik, Ain, 1947-

    2001-01-01

    Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

  16. Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2007-01-01

    Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

  17. Aine y riesgo cardiovascular: los menos posibles, a la menor dosis posible y durante el menor tiempo posible

    Directory of Open Access Journals (Sweden)

    Ferrán Catalá-López

    2014-09-01

    Conclusiones: Existe poca evidencia para sugerir que alguno de los AINE estudiados es seguro en términos de riesgo cardiovascular. Naproxeno parece ser menos perjudicial que el resto. El riesgo cardiovascular asociado al uso de AINE debe ser tenido en cuenta en la prescripción de cualquiera de estos medicamentos.

  18. Poolsajandi õnnesoovid Jaak Aaviksoole / Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar...[jt.

    Index Scriptorium Estoniae

    2004-01-01

    Mõtteid Tartu Ülikooli rektorist tema 50. sünnipäeva puhul : Ain Heinaru, Jaak Kangilaski, Tõnu Lehtsaar, Indrek Reimand, Toomas Kiho, Leelo Kriisa, Peeter Olesk, Risto Tammelo, Birute Klaas, Peeter Saari, Andrus Ansip, Mait Klaassen, Marika Kullamaa, Kaupo Bend

  19. Concentração de anticoagulante, tempo e temperatura de armazenagem sobre os parâmetros hematológicos no hemograma automatizado

    OpenAIRE

    Oliveira,Aécio Carlos de; Ribeiro Filho,José Dantas; Guimarães,José Domingos; Silva,André Ricardo e; Dantas,Waleska de Melo Ferreira; Bonfá,Laila de Paula; Farias,Sheila Kreutzfeld de

    2010-01-01

    O estudo teve como objetivo identificar os efeitos do tempo de estocagem, da temperatura de armazenamento e da quantidade de anticoagulante sobre parâmetros hematológicos de cães. Foram utilizadas amostras do sangue de dez cães de raças variadas, clinicamente hígidos. As alíquotas foram colhidas com 1,8mg; 3,6mg; 7,2mg e 14,4mg de ácido etilenodiaminotetracético (EDTA) por mL de sangue, distribuídas em dois grupos: de 2°C a 8°C e temperatura ambiente. Após a coleta, foram avaliadas em...

  20. Hemodiálisis para remover el anticoagulante dabigatrán en situaciones de urgencia

    Directory of Open Access Journals (Sweden)

    Aldo Carrizo

    2014-04-01

    Full Text Available El dabigatrán es un nuevo inhibidor directo de la trombina, de administración oral, empleado para la prevención de eventos tromboembólicos en pacientes con fibrilación auricular no valvular. A diferencia de la warfarina, no se dispone de un antídoto conocido. La hemodiálisis ha sido sugerida como un método para remover el dabigatrán y reducir el efecto anticoagulante. Se presenta el caso de un paciente con antecedente de fibrilación auricular y medicado con dabigatrán, que fue admitido en el hospital para una cirugía abdominal de urgencia. A las seis horas de la última dosis recibida, los estudios de coagulación mostraban alteración. Ante la falta de antídoto para revertir los efectos, se decidió realizar hemodiálisis. Luego de tres horas de diálisis los parámetros de coagulación tendieron a normalizarse y el paciente fue operado sin presentar hemorragias anormales durante la cirugía o en el postoperatorio.

  1. The Scientific Method Ain't What It Used to Be

    Science.gov (United States)

    Herreid, Clyde Freeman

    2010-01-01

    Remember the time when all you had to do was memorize these five steps: ask a question, formulate a hypothesis, perform experiment, collect data, and draw conclusions? And you received full credit for defining the scientific method. Well, those days are gone. This article discusses why the "scientific method ain't what it used to be." (Contains 2…

  2. An activity-based cost analysis of the Honduras community-based, integrated child care (AIN-C) programme.

    Science.gov (United States)

    Fiedler, John L; Villalobos, Carlos A; De Mattos, Annette C

    2008-11-01

    The Honduras AIN-C programme is a preventive health and nutrition programme of the Honduras Ministry of Health (MOH) that relies on volunteers to help mothers monitor and maintain the adequate growth of young children. A quasi-experimental, design-based evaluation found that the programme achieved near-universal coverage and was effective in improving mothers' child-rearing knowledge, attitudes and practices, including feeding and appropriate care-giving and care-seeking practices for children with diarrhoea and acute respiratory illness. The programme is widely regarded as a model. This study was undertaken to provide the first comprehensive estimates of the cost of the AIN-C programme, with the goal of providing a programme and financial planning tool for Honduras. An additional comparison of study findings was also undertaken to determine the cost of the AIN-C programme's community-based services relative to a similar facility-based service. Expressed in mid-2005 US dollars, the study found that after the programme is phased-in: (1) the annual, recurrent cost per child under 2 years participating in the programme is $6.43; (2) the annual, incremental budget requirements per child under 2 years participating in the programme are $3.90; (3) the cost of an AIN-C monthly growth monitoring and counselling session per child is 11% of the cost of a traditional MOH, facility-based growth and development consultation per child; and (4) the effect of mothers substituting AIN-C monitor care for MOH facility-based care 'saves' 203 000 outpatient visits a year, with a potential cost saving of $1.66 million, the equivalent of 60% of the recurrent cost of the programme and roughly equal to the annual incremental budget requirements of the programme. Sensitivity analysis of the cost estimates is performed to provide insight, for countries considering introducing a similar programme, into how modifications of key characteristics of the programme affect its costs.

  3. Pamidronato endovenoso en espondilitis anquilosante refractaria a antiinflamatorios no esteroideos (AINES y sulfasalazina

    Directory of Open Access Journals (Sweden)

    Augusto García-Poma

    2007-03-01

    Full Text Available Objetivo: Evaluar la terapia con pamidronato, en pacientes con espondilitis anquilosante (EA activa, con respuesta subóptima o falla a los antiinflamatorios no-esteroideos (AINES y sulfasalazina. Diseño: Estudio clínico comparativo. Lugar: Hospital Nacional Edgardo Rebagliati Martins, EsSalud, Lima, Perú. Participantes: Pacientes con espondilitis anquilosante. Intervenciones. Se incluyó 9 pacientes con EA (6 varones, con enfermedad activa (BASDAI > o = 4, actividad axial y falta de respuesta a los Aines y sulfasalazina a dosis de 3g/d. Todos los pacientes recibieron 60 mg de pamidronato mensual, en infusión endovenosa, durante 6 meses, y continuaron tomando AINES y sulfasalazina. La mejoría clínica fue evaluada usando el ASAS 20. En forma secundaria se evaluó el ASAS 40, BASDAI 50, BASDAI, BASFI Y BASMI, a las 24 y 48 semanas (32 a 86 semanas. La diferencia entre el índice de pre y postratamiento fue evaluada usando la prueba de Wilcoxon. Principales medidas de resultados: Evaluación del ASAS 20. Resultados: El 67% alcanzó un Asas 20 a las 24 semanas y 78% a las 48 semanas; 33,3% y 55,6% tuvieron ASAS 40 y 33,3%; y 44,4% alcanzó BASDAI 50 a las 24 y 48 semanas, respectivamente. Un paciente recayó a la semana 20. Tres pacientes (33,3% permanecieron sin cambios. A las 24 y 48 semanas, la media de BASDAI disminuyó en 45,1% (p=0,007 y en 52,1% (p=0,01, la media de BASFI en 38,2% (p=0,007 y en 52,3% (p=0,007, y la media de BASMI en 39,2% (p=0,01 y 39,2% (p=0,01, respectivamente. Los eventos adversos no fueron importantes con esta terapia. Conclusiones: El tratamiento con pamidronato demostró ser efectivo en este grupo de pacientes con EA, refractaria a AINES y a sulfasalazina.

  4. Valik arvamusi läbi aastate / Ain-Elmar Kaasik

    Index Scriptorium Estoniae

    Kaasik, Ain-Elmar, 1934-

    2008-01-01

    Valik Eesti Teaduste Akadeemia Aastaraamatus rubriigis "Arvamusi akadeemikutelt" ilmunud kirjutisi, kus vabas vormis käsitletakse mitmesuguseid aktuaalseid küsimusi, eelkõige hariduse, teadustöö ning ühiskonna suhteid. Kokku on rubriigis avaldatud ligi kaks ja poolsada kirjutist. Siinse valiku autoriteks akadeemikud Raimund Hagelberg, Mart Saarma, Boris Tamm, Ene Ergma, Arvo Krikmann, Agu Laisk, Hans-Voldemar Trass, Harald Keres, Anto Raukas, Rein Küttner, Enn Tõugu, Raimund-Johannes Ubar, Ain-Elmar Kaasik

  5. Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

    Index Scriptorium Estoniae

    Pukk, Tiia

    2011-01-01

    1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

  6. GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

  7. Isolamento, fracionamento e atividade anticoagulante de iota-carragenanas da Solieria filiformis Isolation, fractionation and anticoagulant activity of iota-carrageenans from Solieria filiformis

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2010-11-01

    Full Text Available Este estudo teve como objetivo isolar, fracionar e avaliar o potencial anticoagulante de iota-carragenanas (i-CARs da rodofícea Solieria filiformis, quando obtidas por dois métodos de extração (M I e M II. As i-CARs foram isoladas com papaína bruta em tampão acetato de sódio 0,1M (pH 5,0, contendo cisteína 5mM e EDTA 5mM (M I ou água (80°C (M II e, em seguida, determinada sua composição química de carboidratos totais, sulfato livre (SL e proteínas contaminantes. As i-CARs foram submetidas à cromatografia de troca iônica (DEAE-celulose usando um gradiente de cloreto de sódio, sendo avaliado o tempo de tromboplastina parcial ativada (TTPA e tempo de protrombina das frações obtidas e comparadas à heparina (193UI mg-1. Uma fração anticoagulante também foi submetida ao procedimento de eletroforese em gel de agarose a 0,5%. A diferença no rendimento de i-CARs entre os métodos foi 10,14%. A composição química de SL (29,40% e o fracionamento, por DEAE-celulose, indicaram o M I mais eficiente na obtenção de i-CARs, comparado ao M II. O TTPA também foi somente alterado para as i-CARs do M I. Contudo, a atividade anticoagulante in vitro de uma fração rica (8,52UI mg-1 foi inferior à da heparina.This study aimed to isolate, fractionate and evaluate the anticoagulant potential of iota-carrageenans (i-CARs from Solieria filiformis when two extraction methods (M I and M II were used. i-CARs were isolated with papain in 0.1M sodium acetate (pH 5.0 containing 5mM cystein and 5mM EDTA (M I or water (80°C (M II, and then their chemical composition of total carbohydrates, free sulfate (FS and contaminant proteins were determined. i-CARs were submitted to anion-exchange chromatography (DEAE-cellulose using a sodium chloride gradient,being evaluated the activated partial thromboplastin time (APTT and prothrombin time of obtained fractions and compared to heparin (193IU mg-1. A rich fraction of anticoagulant was also submitted to 0

  8. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 92; Issue 1. New frameshift CF mutation 3729delAinsTCT in a Tunisian cystic fibrosis patient. Sondess Hadj Fredj Monia Boudaya Sabrine Oueslati Safa Sahnoun Chaima Sahli Hajer Siala Khedija Boussetta Amina Bibi Taieb Messaoud. Research Note Volume 92 Issue 1 April ...

  9. Compuestos orgánicos volátiles (COVs) en la industria de pinturas y sus disolventes en Perú – análisis de caso y estrategias de gestión ambiental y salud ocupacional

    OpenAIRE

    Riveros Alcedo, Renato Gonzalo

    2017-01-01

    Los compuestos orgánicos volátiles (COVs) son sustancias suficientemente volátiles para existir en forma de vapores en la atmósfera en condiciones normales de temperatura y presión. Sustancias con estas características son utilizadas como insumos en industrias manufactureras y, en particular, para la fabricación de diversos tipos de pinturas, barnices y disolventes industriales. Está demostrado que estas sustancias causan smog fotoquímico, al ser precursores del ozono troposfér...

  10. COxSwAIN: Compressive Sensing for Advanced Imaging and Navigation

    Science.gov (United States)

    Kurwitz, Richard; Pulley, Marina; LaFerney, Nathan; Munoz, Carlos

    2015-01-01

    The COxSwAIN project focuses on building an image and video compression scheme that can be implemented in a small or low-power satellite. To do this, we used Compressive Sensing, where the compression is performed by matrix multiplications on the satellite and reconstructed on the ground. Our paper explains our methodology and demonstrates the results of the scheme, being able to achieve high quality image compression that is robust to noise and corruption.

  11. A retrospective review of the Honduras AIN-C program guided by a community health worker performance logic model.

    Science.gov (United States)

    Rodríguez, Daniela C; Peterson, Lauren A

    2016-05-06

    Factors that influence performance of community health workers (CHWs) delivering health services are not well understood. A recent logic model proposed categories of support from both health sector and communities that influence CHW performance and program outcomes. This logic model has been used to review a growth monitoring program delivered by CHWs in Honduras, known as Atención Integral a la Niñez en la Comunidad (AIN-C). A retrospective review of AIN-C was conducted through a document desk review and supplemented with in-depth interviews. Documents were systematically coded using the categories from the logic model, and gaps were addressed through interviews. Authors reviewed coded data for each category to analyze program details and outcomes as well as identify potential issues and gaps in the logic model. Categories from the logic model were inconsistently represented, with more information available for health sector than community. Context and input activities were not well documented. Information on health sector systems-level activities was available for governance but limited for other categories, while not much was found for community systems-level activities. Most available information focused on program-level activities with substantial data on technical support. Output, outcome, and impact data were drawn from various resources and suggest mixed results of AIN-C on indicators of interest. Assessing CHW performance through a desk review left gaps that could not be addressed about the relationship of activities and performance. There were critical characteristics of program design that made it contextually appropriate; however, it was difficult to identify clear links between AIN-C and malnutrition indicators. Regarding the logic model, several categories were too broad (e.g., technical support, context) and some aspects of AIN-C did not fit neatly in logic model categories (e.g., political commitment, equity, flexibility in implementation). The

  12. Monsieur Philippe Galli Préfet de l’Ain France

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.

  13. Polissacarídeos sulfatados isolados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides – extração, fracionamento e atividade anticoagulante =Sulfated polysaccharides isolated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes – extraction, fractionation and anticoagulant activity

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2010-04-01

    Full Text Available A incidência de doenças cardiovasculares e os efeitos adversos da heparinoterapia têm motivado a busca por novos agentes terapêuticos e os polissacarídeos sulfatados (PS de algas marinhas têm sido reportados como fontes alternativas para tal. Objetivou-se avaliar o potencial anticoagulante dos PS totais (PST isolados e fracionados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides. Inicialmente, os PST foram extraídos com papaína em tampão acetato desódio 0,1 M (pH 5,0 contendo cisteína 5 mM e EDTA 5 mM, seguidos de fracionamento em coluna de troca iônica de DEAE-celulose com gradiente de NaCl. As frações obtidas foram analisadas por eletroforese em gel de agarose a 0,5% e a atividade anticoagulante, mensurada pelo tempo de tromboplastina parcial ativada (TTPA, usando-se plasma humano normal e comparada a uma curva-padrão de heparina (193 UI mg-1. Verificaram-se semelhantes perfiscromatográficos entre os PS de ambas as espécies, porém com padrões de mobilidades distintas quando as frações foram comparadas por eletroforese. Os PS modificaram o TTPA, cujas atividades anticoagulantes foram de apenas 21,23 e 24,36 UI mg-1, quando eluídos com 0,75 M de sal para C. racemosa e C. cupressoides, respectivamente. Portanto, PS anticoagulantes isolados dasclorofíceas C. racemosa e C. cupressoides resultaram em efeitos anticoagulantes inferiores aos da heparina. Estudos comparativos dessas moléculas também são sugeridos como ferramentas auxiliares na identificação de algas do mesmo gênero.The incidence of cardiovascular diseases and adverse effects from heparintherapy have led to a search for new therapeutic agents, and the sulfated polysaccharides (SP of seaweeds have been reported as alternative sources. The aim of this work was to evaluate the anticoagulant potential of total SP (TSP isolated and fractionated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes. Initially, the TSP were extracted with papain

  14. Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco

    Directory of Open Access Journals (Sweden)

    Zitouni A.

    2018-01-01

    In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

  15. Aislamiento y caracterización bioquímica de compuestos fenólicos con actividad anticoagulante del extracto alcohólico de las hojas de Oenothera rosea Aiton “chupasangre”

    OpenAIRE

    Yarlequé Chocas, Mirtha Marieta

    2016-01-01

    Aísla los principios activos fenólicos con actividad anticoagulante sobre el plasma humano y desarrolla su caracterización bioquímica Oenothera rosea, para lo cual se realiza el extracto alcohólico y se detecta la presencia de fenoles, flavonoides, saponinas, glicósidos y tanino. A partir del extracto alcohólico se obtiene la fase acuosa y se realiza una CCF sobre celulosa obteniéndose 9 fracciones, 5 de las cuales resultan positivas para fenoles y flavonoides, y dos de éstas muestran activid...

  16. Mida sina täna õppisid? / Veikko Täär, Ain Aaviksoo, Ingrid Tõniste ... [jt.

    Index Scriptorium Estoniae

    2012-01-01

    Oma õppimistest ja tulevikuplaanidest räägivad näitleja ja ettevõtja Veikko Täär, tervishoiuteadlane Ain Aaviksoo, tegevjuht Ingrid Tõniste, TV3 avalike suhete juht ja uudisteankur Anneli Adermann, arenduskonsultant Anu Puusaag, personaaltreener Katrin Pärt ja loodusarst Tiina Keldrima

  17. Ain't Gonna Study War No More? Explorations of War through Picture Books

    Science.gov (United States)

    Crawford, Patricia A.; Roberts, Sherron Killingsworth

    2009-01-01

    At the height of the Vietnam War, Down by the Riverside was transformed from a traditional folk song to a popular anti-war anthem. The raucous and repetitive chorus, "I ain't gonna study war no more ...," became a rallying cry for those who wanted nothing to do with the war and the pain and controversy that surrounded it. Although it seems…

  18. Anticoagulante lúpico en enfermedades autoinmunes Lupus anticoagulant in autoimmune diseases

    Directory of Open Access Journals (Sweden)

    Dunia de la C Castillo González

    2004-08-01

    Full Text Available El tromboembolismo venoso es una complicación reconocida en diferentes enfermedades autoinmunes. Se ha establecido que la detección del anticoagulante lúpico (AL y posiblemente los anticuerpos anticardiolipina (AAC tipo Ig G en título alto y medio, ayuden a identificar pacientes con riesgo de trombosis. Estudiamos el AL en 81 pacientes con enfermedades autoinmunes: 25 pacientes con lupus eritematoso sistémico (LES, 28 pacientes con púrpura trombocitopénica idiopática (PTI, 15 con anemia hemolítica autoinmune (AHAI y 13 que se incluyeron en el grupo de otras enfermedades, que comprendían vasculitis cutánea de pequeños vasos, enfermedad mixta del tejido conectivo, artritis reumatoidea y esclerodermia. El AL se encontró en el 19,7 % del total de los estudiados: 16 % en pacientes con LES, 21,4 % en pacientes con PTI y 40 % en la AHAI. En el grupo de otras enfermedades no se halló ningún paciente con el AL positivo. El 56,3 % de los pacientes con AL positivo presentaron alguna manifestación atribuible al síndrome antifosfolípido (SAFVenous thromboembolism is a well-known complication in different autoimmune diseases. It has been established that detection of lupus anticoagulant (LA and possibly IgG type anticardiolipin antibodies (AAC in high and medium titers help to identify patients with thrombosis risk. We studied LA in 81 patients with autoimmune erythomatous lupus, 28 patients with idiopathic thrombocytopenic purpura, 15 with autoimmune hemolytic anemia and 13 patients who were included in the group covering other diseases such as small vessel skin vasculitis, combined disease of the connective tissue, rheumatoid arthritis and sclerodermia. LA was found in 19,7 % of the total number of cases, in 16% of patients with LES, 21,4 % of those with ITP and 40 % of cases with AIHA. In the group of other diseases, there was no patient with positive LA. 56,3 % of patients with positive AL showed some manifestations related to

  19. Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria)

    OpenAIRE

    Derdour Abdessamed; Bouanani Abderrazak; Babahamed Kamila

    2018-01-01

    Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS). In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN) is selected to calculate the loss rate and Soil Conserv...

  20. Contribution to the hydrogeological, geochemical and isotopic study of Ain El Beidha and Merguellil (Kairouan plain) aquifers: Implication for the dam-aquifer relationship

    International Nuclear Information System (INIS)

    Ben Ammar, Safouan

    2007-01-01

    In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the

  1. T his article is m ainly about using sim ple trigonom etric identities ...

    Indian Academy of Sciences (India)

    T his article is m ainly about using sim ple trigonom etric identities and basic calculus to deduce som e new and interesting series. In particular, I use basic aspects of. G am m a and B eta integrations to deduce these series. T hese lead to interesting series for ¼ or functions of ¼ . O ne form ofbeta integration w hich is often ...

  2. Pima Community College Planning Grant for Autonomous Intelligent Network of Systems (AINS) Science, Mathematics and Engineering Education Center

    National Research Council Canada - National Science Library

    2006-01-01

    .... The Center was to be funded by the Department of Defense, Office of Naval Research (ONR). The TDRI AINS Center's objectives were to advance ONR's technologies and to improve exposure and participation in science, math, and engineering (SME...

  3. Isotope hydrological investigation of Moghra and Ain El-Sharip environment, north western desert, Egypt

    International Nuclear Information System (INIS)

    Aly, A.I.M.; Nada, A.; Awad, M.; Salman, A.B.; Hamza, M.S.

    1991-01-01

    Groundwater samples collected from some localities in the vicinity of Moghra and Ain El-Sharip in the north western desert were subjected to chemical and to isotopic analyses. The combination of the hydrochemical data with the isotopic compositions of deuterium, oxygen-18 and tritium shows that the groundwater in this region represents a mixture of water recharged from different sources including : Nile, sea and paleo-waters.5 fig.,2 tab

  4. Simultaneous antibacterial and anticoagulant properties of polypropylene non-woven textiles Elaboration d'un textile polypropylène non-tissé présentant simultanément des propriétés antibactériennes et anticoagulantes

    Directory of Open Access Journals (Sweden)

    Jimenez Maude

    2013-11-01

    Full Text Available The aim of this work was to prepare a non-woven Polypropylene (PP textile functionalized with bioactive molecules to improve simultaneously its anticoagulation and antibacterial properties. The immobilization of either heparin (anticoagulation agent or gentamicin (aminoglycoside antibiotic was already proven to be effective on non-woven PP textiles. This work details how we managed to immobilize both gentamicin and heparin on the textile [1]. The immobilization times were studied in order to determine the best compromise between cytocompatibility, anticoagulant effect and antimicrobial activity. Cetté étude décrit le procédé de fonctionnalisation d'un textile polypropylène (PP non-tissé afin d'améliorer à la fois ses propriétés antibactériennes et anticoagulantes. Dans des précédents travaux, l'immobilisation soit de l'héparine (agent anticoagulant, soit de la gentamicine (agent antibiotique aminoglycoside a déjà été reportée. Des effets respectivement anticoagulants et antibactériens ont été obtenus. Cette étude décrit la faç on d'immobiliser ces deux principes actifs sur un même textile. L'effet des temps d'imprégnation sur les propriétés antibactériennes et anticoagulantes a été étudié afin d'obtenir le meilleur compromis possible en termes de cytocompatibilité, effet anticoagulant et activité antimicrobienne.

  5. Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    2012-01-01

    Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

  6. Novos anticoagulantes para a profilaxia do tromboembolismo venoso em cirurgias ortopédicas de grande porte New anticoagulants for the prophylaxis of venous thromboembolism

    Directory of Open Access Journals (Sweden)

    Ricardo de Alvarenga Yoshida

    2011-06-01

    Full Text Available Após cerca de 50 anos de experiência com a heparina e antagonistas da vitamina K (AVK, pesquisas e estudos com novos anticoagulantes vêm evoluindo de forma crescente nos últimos anos. Embora consagrados pelo uso, os anticoagulantes tradicionais têm limitações importantes em termos de controle laboratorial, complicações, efeitos colaterais, interações com medicamentos e dieta. A heparina não fracionada (HNF tem interação com proteínas plasmáticas e parede vascular, pode desencadear trombocitopenia induzida pela heparina (TIH, só pode ser administrada por via parenteral, exige controle laboratorial pelo teste da tromboplastina parcial ativada (TTPa, pode provocar osteoporose e alopecia quando usada por períodos prolongados e sua produção tem origem biológica. A AVK tem a vantagem de poder ser ministrada por via oral, mas o controle (feito pela razão normatizada internacional pode ser difícil em alguns casos, já que tem início de ação demorado, janela terapêutica estreita, interação com dieta e grande número de medicamentos, pode provocar necrose de pele em portadores de deficiência de antitrombina e de proteínas C e S, e pode induzir alterações fetais quando usada na gravidez. Na década de 1980, surgiram as heparinas de baixo peso molecular, que foram uma evolução da heparina não fracionada, pois apresentaram maior biodisponibilidade, dosagem por peso corporal, sem necessidade de controle laboratorial, administração por via subcutânea, menor risco de trombocitopenia induzida pela heparina, e eficácia e segurança similares à heparina não fracionada. Na última década surgiram, então, uma série de novos anticoagulantes no mercado, os quais têm apresentado resultados promissores em várias situações de profilaxia e tratamento do tromboembolismo venoso. Nesta revisão, são apresentados as novas heparinas de baixo peso molecular, as heparinas de ultrabaixo peso molecular, os pentassacarídeos, os

  7. Polissacarídeos sulfatados isolados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides – extração, fracionamento e atividade anticoagulante - doi: 10.4025/actascibiolsci.v32i2.5923 Sulfated polysaccharides isolated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes – extraction, fractionation and anticoagulant activity - doi: 10.4025/actascibiolsci.v32i2.5923

    Directory of Open Access Journals (Sweden)

    Norma Maria Barros Benevides

    2010-05-01

    Full Text Available A incidência de doenças cardiovasculares e os efeitos adversos da heparinoterapia têm motivado a busca por novos agentes terapêuticos e os polissacarídeos sulfatados (PS de algas marinhas têm sido reportados como fontes alternativas para tal. Objetivou-se avaliar o potencial anticoagulante dos PS totais (PST isolados e fracionados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides. Inicialmente, os PST foram extraídos com papaína em tampão acetato de sódio 0,1 M (pH 5,0 contendo cisteína 5 mM e EDTA 5 mM, seguidos de fracionamento em coluna de troca iônica de DEAE-celulose com gradiente de NaCl. As frações obtidas foram analisadas por eletroforese em gel de agarose a 0,5% e a atividade anticoagulante, mensurada pelo tempo de tromboplastina parcial ativada (TTPA, usando-se plasma humano normal e comparada a uma curva-padrão de heparina (193 UI mg-1. Verificaram-se semelhantes perfis cromatográficos entre os PS de ambas as espécies, porém com padrões de mobilidades distintas quando as frações foram comparadas por eletroforese. Os PS modificaram o TTPA, cujas atividades anticoagulantes foram de apenas 21,23 e 24,36 UI mg-1, quando eluídos com 0,75 M de sal para C. racemosa e C. cupressoides, respectivamente. Portanto, PS anticoagulantes isolados das clorofíceas C. racemosa e C. cupressoides resultaram em efeitos anticoagulantes inferiores aos da heparina. Estudos comparativos dessas moléculas também são sugeridos como ferramentas auxiliares na identificação de algas do mesmo gênero.The incidence of cardiovascular diseases and adverse effects from heparintherapy have led to a search for new therapeutic agents, and the sulfated polysaccharides (SP of seaweeds have been reported as alternative sources. The aim of this work was to evaluate the anticoagulant potential of total SP (TSP isolated and fractionated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes. Initially, the TSP were extracted with

  8. The impact of weathering on the uranium-bearing phosphates of Ain Laylon in the Syrian coast, using radon and gamma ray surveys

    International Nuclear Information System (INIS)

    Jubeli, Y.; Al-Hilal, M.; Al-Ali, A.

    1998-06-01

    A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of

  9. Terapia anticoagulante en fibrilación auricular Anticoagulation and atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Sebastián Prieto

    2011-06-01

    Full Text Available La fibrilación auricular es la taquiarritmia cardíaca más frecuente. Su incidencia aumenta con la edad, presentándose en un 1.5% entre los 50 a 59 años, y en un 8-10% entre los 80 a 89 años. Esta arritmia incrementa en cinco veces el riesgo de sufrir un evento cerebrovascular isquémico cardioembólico y causa el 15% de todos los accidentes cerebrovasculares isquémicos. Su manejo se enfoca en la prevención de los fenómenos tromboembólicos y el control de la frecuencia y ritmo cardíaco. El tratamiento anticoagulante ha demostrado ser la principal herramienta en la prevención de eventos cardioembólicos. Aunque las complicaciones hemorrágicas por el tratamiento son esperables y aumentan con la edad, el beneficio de usar anticoagulación sobrepasa por mucho al riesgo de sangrado. Precisamente debido a la heterogeneidad clínica de esta arritmia y a la dificultad de establecer un tratamiento adecuado para cada caso en particular, el American College of Cardiology, la American Heart Association, la European Society of Cardiology y el American College of Chest Physicians han establecido guías para mejorar el tratamiento de estos pacientes. La revisión de esta enfermedad y de las directrices propuestas puede facilitar y mejorar notablemente el tratamiento de los pacientes con fibrilación auricular.Atrial fibrillation is the most frequent cardiac arrhythmia in adults. Its frequency increases with age, being its incidence 1.5% in individuals 50 to 59 years old and 8-10% from 80 to 89 years. Atrial fibrillation increases 5 fold the risk of suffering stroke and actually causes 15% of all strokes. Its management focuses primary in the prevention of thromboembolic phenomena, heart rate and rhythm control. Anticoagulation, when indicated, has demonstrated to be the main tool in the prevention of these thromboembolic events. Although the bleeding complication is frequent in this population and increases with age, anticoagulation benefits are

  10. Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

    Index Scriptorium Estoniae

    2007-01-01

    Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

  11. Use of tritium for estimation of groundwater mean residence time, a case study of the Ain Al-Samak Karst springs (Central Syria)

    International Nuclear Information System (INIS)

    Kattan, Z.

    2003-01-01

    This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m 3 was obtained for the maximum groundwater reservoir size

  12. Kas uus töölepingu seaduse eelnõu on õnnestunud? / Olga Aasav, Arno Arukask, Ain Tammvere...[jt.] ; interv. Martin Pau

    Index Scriptorium Estoniae

    2008-01-01

    Vastavad restoranklubi Atlantis tegevjuht Olga Aasav, ametiühingute keskliidu osakonnajuhataja Arno Arukuusk, AS Estiko Investeeringud juhataja Ain Tammvere, Tartu Ülikooli ametiühingu esimees Aleksander Jakobson, AS Samelin tegevdirektor Leida Kikka, AS Enics Eesti tegevjuht Kalle Kuusik, personalispetsialist Lea Oras ja Tartu Tarbijate Kooperatiivi juhatuse esimees Tarmo Punger

  13. Overexploitation and cumulative drought trend effect on Ras El Ain karstic spring discharge (Khabour Sub-basin, Syria)

    Science.gov (United States)

    Abou Zakhem, Boulos; Kattaa, Bassam

    2017-10-01

    The effects of climate change and overexploitation are being strongly perceived in the studied area and the springs discharge is obviously affected. In this paper, Ras El Ain spring discharge and precipitation were analyzed by normalized methods on an yearly timescale. The deficit of Ras El Ain spring discharge due to overexploitation factors and drought effects was estimated. Cumulative drought analyses were carried out using SPI10 and SQI10. Finally, the decreasing trends of the spring discharge due to the deficiency in rainfall were analyzed. The main results reveal that the annual mean deficit of Ras El Ain spring discharge due to overpumping was between 32 and 45%, whereas, annual mean deficit related to drought was between 22 and 35% on average, during the last 30 years (post-1984). The moving averages of SPI and SQI delineate very well the drought periods during last three decades. The cumulative droughts using SPI10 and SQI10 reveal that wet period (pre-1984) with positive values was characterized by high precipitation and spring discharge. Overexploitation period (1984-1989) is distinguished by decreasing SQI10 values whereas, SPI10 is almost stable. The response of the karst system to the precipitation signal has been changed, during the drought period (1990-2000), and the spring behaviour has been modified due to the first overexploitation period. Finally, overexploitation period (2001-2008) is related to the second phase of groundwater intensive pumping for irrigation purposes. Consequently, this period is completely catastrophic causing the drying up of the spring. The decreasing trends analyzed using DPI and DQI showed annual decreasing rates relative to the mean values of -0.268% and -0.105%, respectively. Thus, the results of theoretical model reveal that precipitation will decrease by about DPI = -20.7% and the discharge will decline by about -9.2% by 2050. Consequently, the declining discharge due to climatic variation under natural conditions as

  14. Modelling rainfall runoff relations using HEC-HMS in a semi-arid region: Case study in Ain Sefra watershed, Ksour Mountains (SW Algeria

    Directory of Open Access Journals (Sweden)

    Derdour Abdessamed

    2018-03-01

    Full Text Available Ain Sefra is one of the Algerian cities that had been experienced several devastating floods during the past 100 years. The purpose of this study is to simulate runoff in the semi-arid region of Ain Sefra watershed through the employing of the Hydrologic Engineering Center – Hydrologic Modelling System (HEC-HMS. In this paper, the frequency storm is used for the meteorological model, the Soil Conservation Service – curve number (SCS-CN is selected to calculate the loss rate and Soil Conservation Service unit hydrograph method have been applied to simulate the runoff rate. After calibration and validation, the simulated peak discharges were very close with observed values. The Nash–Sutcliffe efficiency coefficient was 0.95, indicates that the hydrological modeling results are satisfactory and accepted for simulation of rainfall-runoff. The peak discharges obtained for the 10, 50, 100 and 1000 year storms are respectively 425.8, 750.5, 904.3 and 1328.3 m3∙s−1.

  15. Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS

    Science.gov (United States)

    Issa, S.; Al Shuwaihi, A.

    2009-12-01

    The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.

  16. Implementation of TiAIN and CrN coatings and ion implantation in the modern plastics moulding industry

    International Nuclear Information System (INIS)

    Bienk, E.J.; Mikkelsen, N.J.

    1997-01-01

    Two methods of surface improvement widely used in the modern plastics industry are compared, with a view to improving productivity and product quality. Ion implantation of plastics and physical vapour deposition coatings both offer surface engineering advantages. Each method is described and evaluated with reference to plastics moulding. TiAIN coatings are used to protect hard bulk materials, subjected to evenly distributed loads. The more ductile CrN coatings are used for softer materials which give less support to the coatings. (UK)

  17. Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

    Index Scriptorium Estoniae

    Lellep, Kaili

    2010-01-01

    Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

  18. Evaluation of the clinical maxim: "If it ain't broke, don't fix it".

    Science.gov (United States)

    Howell-Duffy, Chris; Hrynchak, Patricia K; Irving, Elizabeth L; Mouat, Graham S V; Elliott, David B

    2012-01-01

    A significant number of patients return to optometric practice dissatisfied with their spectacles. An important question is whether any of these cases are preventable. There are several different clinical maxims that are used to modify the subjective refraction when determining the refractive prescription. These maxims aim to improve patient comfort and adaptation and thereby reduce patient dissatisfaction with new spectacles. They are not based on research evidence, but rather on expert opinion gained from clinical experience. The aim of this study was to retrospectively analyze a large number of case records of dissatisfied patients to assess the possible usefulness of the prescribing maxim "if it ain't broke, don't fix it." Three hundred eighteen non-tolerance cases from a university-based Canadian optometric clinic were categorized by a focus group of optometrists. Three prescribing categories were defined and comprised cases in which application of the proposed maxim may have prevented the recheck eye examination; a more limited application of the maxim for one working distance may have been appropriate; and finally scenarios in which the maxim did not work in that the practitioner was judged to have initially followed the maxim, yet patient dissatisfaction was still reported. The remaining unallocated records comprised prescribing situations outside the scope of this study. Approximately 32% of non-tolerance cases were judged to have been preventable by use of the proposed maxim. Furthermore, an additional 10% reduction in recheck cases may have been possible by a more liberal interpretation of the maxim. Conversely, 4% of cases were deemed to comprise scenarios in which the maxim was followed yet the patient returned later to report problems with their spectacles. The prescribing maxim "if it ain't broke, don't fix it" appears to have a role in reducing recheck eye examinations and improving patient satisfaction with new spectacles.

  19. Impact of Dietary, Socioeconomic, and Physical Factors on Obese and Overweight Schoolchildren Living in Sidi-Bel-Abbes (West of Algeria and Ain Defla (Centre

    Directory of Open Access Journals (Sweden)

    Didaoui Hayat

    2018-03-01

    Full Text Available Background and aims: The aim of the current study was to assess the impact of environmental factors; food, socio-economic, and physical activity, on a group of obese children living in Ain-Defla (Center Algeria and Sidi-Bel-Abbes (West Algeria.

  20. Fracaso renal agudo secundario a combinación de inhibidores del sistema renina-angiotensina, diuréticos y AINES. “La Triple Whammy”1

    Directory of Open Access Journals (Sweden)

    Rosa Maria Garcia Camin

    2015-03-01

    Conclusiones: El tratamiento con IECA, ARA II, diuréticos y/o AINES presenta elevada incidencia de ingreso por FRA, siendo los diuréticos en monoterapia, doble y triple terapia combinada los que ocasionan la mayor incidencia. El FRAETW supone elevados costes sanitarios y muertes evitables.

  1. TEM and XANES study of MOVPE grown InAIN layers with different indium content

    International Nuclear Information System (INIS)

    Kret, S; Wolska, A; Klepka, M T; Letrouit, A; Ivaldi, F; Szczepańska, A; Carlin, J-F; Kaufmann, N A K; Grandjean, N

    2011-01-01

    We present structure and spatially resolved composition studies by TEM (Transmission Electron Microscopy) and XANES (X-ray Absorption Near Edge Structure) of InAIN MOVPE (Metal-Organic Vapor Phase Epitaxy) epilayers containing 16-27 at% of indium. Investigations of the In L 3 edge by synchrotron radiation absorption show a significant change of the post-edge structure depending on the indium content. We attribute this to the solubility limit and phase separation in this system. Our measurements suggest that the critical composition is 18% for our growth conditions. HRTEM cross-sectional and EDX investigations confirm such phase separation as well as the changing of the structure from 2D growth to columnar like growth for the sample with the highest indium content.

  2. Management of toxic cyanobacteria for drinking water production of Ain Zada Dam.

    Science.gov (United States)

    Saoudi, Amel; Brient, Luc; Boucetta, Sabrine; Ouzrout, Rachid; Bormans, Myriam; Bensouilah, Mourad

    2017-07-01

    Blooms of toxic cyanobacteria in Algerian reservoirs represent a potential health problem, mainly from drinking water that supplies the local population of Ain Zada (Bordj Bou Arreridj). The objective of this study is to monitor, detect, and identify the existence of cyanobacteria and microcystins during blooming times. Samples were taken in 2013 from eight stations. The results show that three potentially toxic cyanobacterial genera with the species Planktothrix agardhii were dominant. Cyanobacterial biomass, phycocyanin (PC) concentrations, and microcystin (MC) concentrations were high in the surface layer and at 14 m depth; these values were also high in the treated water. On 11 May 2013, MC concentrations were 6.3 μg/L in MC-LR equivalent in the drinking water. This study shows for the first time the presence of cyanotoxins in raw and treated waters, highlighting that regular monitoring of cyanobacteria and cyanotoxins must be undertaken to avoid potential health problems.

  3. Antiinflamatorios no esteroideos (AINES.: Consideraciones para su uso estomatológico

    Directory of Open Access Journals (Sweden)

    Andrés A. Pérez Ruiz

    2002-08-01

    Full Text Available Se realiza una revisión extensa y actualizada sobre los antiinflamatorios no esteroideos (AINEs, con el fin de actualizar al estomatólogo en su uso. Para ello se revisan aspectos importantes del proceso inflamatorio en estructuras de la boca que como las pulpitis, presentan sus peculiaridades. Se identifica a una de las 2 familias de autacoides provenientes de los fosfolípidos de membrana celular, es decir, los eicosanoides derivados a partir de algunos ácidos grasos polisaturados, en particular, ácido araquidónico, que tras la acción de enzimas da lugar a la formación de prostaglandinas, prostaciclinas, tromboxeno A2 y leucotrienos. Conocidos estos antecedentes, nos ocupamos de fármacos usados para combatir los síntomas y signos de la inflamación. Casi todos los antiinflamatorios no esteroideos utilizados en la actualidad, casi todos, inhiben las actividades de la ciclooxigenasa 1 constitutiva y la ciclooxigenasa 2, inducida en el sitio de la inflamación y con ello, la síntesis de prostaglandinas y tromboxanos. Se alude a la ventaja terapéutica de los inhibidores de la COX-2 que aparecen hoy en el mercado. Se expone las dosis y frecuencias de los AINEs, sus interacciones, así como las reacciones adversas al medicamento y contraindicaciones, y se proponen aquellos que son de interés en la práctica estomatológica.Non-steroidal anti-inflammatory drugs. Considerations about their dental use. An extensive updated review of non-steroidal anti-inflammatory agents (NSAIN was made to give an updated information to the dentist about their use. To this purpose, important aspects of the inflammatory process in mouth structures like pulpitis that present with their own peculiarities are reviewed. We identified one of the two autacoid families from cell membrane phospholipids, that is, eicosanoids derived from some polysaturated fatty acids, in particular, arachidonic acid, which, after the action of enzymes, give rise to the formation of

  4. Prevalencia de anticuerpos antifosfolípidos en pacientes con conectivopatías

    Directory of Open Access Journals (Sweden)

    Óscar Emilio Ruiz-Franco

    2011-07-01

    Full Text Available Objetivos: Determinar la prevalencia de anticuerpos antifosfolípidos en pacientes con conectivopatías. Diseño: Estudio descriptivo transversal. Institución: Hospital Dos de Mayo e Instituto de Investigaciones Clínicas de la UNMSM, Lima, Perú. Participantes: Pacientes con diagnóstico de colagenopatía y sujetos sanos. Intervenciones: En 100 pacientes con diagnóstico de colagenopatía y 50 sujetos sanos, todos provenientes de Lima Metropolitana y atendidos entre enero y noviembre de 2008, se determinó fibrinógeno, tiempo de protrombina, tiempo parcial de tromboplastina activada, anticuerpos anticardiolipina y anticoagulante lúpico. Principales medidas de resultados: Presencia de anticuerpos anticardiolipina y anticoagulante lúpico. Resultados: Los pacientes con conectivopatías presentaron anticuerpos antifosfolípidos en 17%, anticoagulante lúpico en 13% y anticardiolipina IgG 4%. Al dividir el grupo por conectivopatías, en los 70 pacientes con lupus eritematoso sistémico 10 resultaron positivos para anticoagulante lúpico y 3 tuvieron anticardiolipina IgG; de los 30 pacientes con artritis reumatoide, 3 tuvieron anticoagulante lúpico positivo y 1 presentó anticardiolipina IgG. En el grupo de 50 personas sanas, solo se encontró un caso positivo para anticoagulante lúpico. Conclusiones: La prevalencia de anticuerpos antifosfolípidos en pacientes con conectivopatías fue 17%. La conectivopatía estudiada más frecuente fue el lupus eritematoso sistémico. El anticuerpo antifosfolípido más frecuente fue el anticoagulante lúpico.

  5. Monitorização de reações adversas de novos anticoagulantes orais através de um sistema de farmacovigilância ativa implementado nos Serviços Farmacêuticos do CHCB: experiência profissionalizante na vertente de farmácia comunitária e investigação

    OpenAIRE

    Pereira, Filipa Ferreira

    2013-01-01

    Este trabalho encontra-se dividido em duas partes distintas, sendo que a primeira incide sobre a vertente de investigação desenvolvida e a segunda sobre o relatório de estágio efetuado em farmácia comunitária. O primeiro capítulo do relatório relacionado com a vertente de Investigação pretende descrever o projeto intitulado em: “Monitorização de Reações Adversas de novos anticoagulantes orais através de um sistema de Farmacovigilância Ativa implementado nos serviços Farmacêuticos do ...

  6. Toidutööstus panustab detsembris jõulutoodetele. Pühad toovad käibelisa / Ain Alvela, Ketlin Rauk ; kommenteerinud Ruth Roht, Marek Viilol, Simmo Kruustük, Imre Sokk

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Spetsiaalsed jõulutooted aitavad aasta lõpul suurendada toiduainetööstuste käivet. ASi Atria Eesti müügi- ja turundusdirektori Margus Masingu, ASi Fazer Eesti juhatuse esimehe Kristjan Kongo ja ASi Salvest turundusdirektori Ain Nõlvaku kommentaare

  7. Madame Olga Givernet, Députée de la 3ème circonscription de l’Ain, République française, vendredi 16 février 2018

    CERN Multimedia

    Caraban Gonzalez, Noemi

    2018-01-01

    Madame Olga Givernet Députée 3ème circonscription de l’Ain. Participants CERN, Signature du livre d’or. M. Frédérick Bordry Directeur des accélérateurs et de la technologie Mme Fabiola Gianotti Directrice générale

  8. Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Lepik, Kerli, 1989-

    2013-01-01

    Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

  9. Conhecimento sobre anticoagulantes orais e seu manejo por médicos de pronto atendimento Emergency-room doctors' knowledge about oral anticoagulants and its management

    Directory of Open Access Journals (Sweden)

    Larissa Periotto Borlina

    2010-06-01

    Full Text Available Contexto: Desde sua descoberta, os anticoagulantes orais (AO têm sido cada vez mais estudados e aplicados em diferentes doenças. No entanto, eles apresentam reações medicamentosas com fármacos que trazem riscos ao paciente. Objetivo: Identificar o nível de conhecimento dos médicos plantonistas de pronto atendimento sobre os AO e suas interações, medicamentosas ou não, e verificar se o médico frentista está preparado para integrar o conteúdo teórico com a rotina de urgências. Método: Aplicou-se um questionário a 100 médicos atuantes em pronto atendimentos de dois hospitais públicos e três privados em Curitiba. Visou-se saber se o médico frentista questiona ao paciente sobre o uso de AO. Também, avaliou-se o conhecimento do profissional e seu interesse em saber mais sobre: AO (quais deles conhecia; exames para controle; sinergismo com AO; e manejo das complicações. Resultados: Dos 100 entrevistados, 60% declararam perguntar ao paciente sobre o uso de AO, 81% tinham conhecimento insuficiente a respeito do sinergismo de algumas substâncias apresentadas e os AO, 15% desconheciam qual exame é utilizado para acompanhamento dos pacientes anticoagulados, 50,7% não sabiam os nomes comercias dos AO, 4% desconheciam seu antídoto, e 92% manifestaram interesse em melhorar seus conhecimentos sobre os AO. Conclusão: É BAIXo o número de médicos que atende em pronto atendimentos que conhece sobre os AO e que sabe manejar pacientes anticoagulados. É alta a porcentagem de médicos que não perguntam aos pacientes sobre o uso de AO e que desconhecem princípios do sinergismo medicamentoso, sendo que a maioria se interessou em melhorar seus conhecimentos sobre os anticoagulantes.Background: Since its discovery, oral anticoagulants (OA have been increasingly studied and used to treat different diseases. However, OA may cause adverse drug interactions that bring risks for patients. Objective: To identify the emergency room doctors

  10. Application of electrical geophysics to the release of water resources, case of Ain Leuh (Morocco)

    Science.gov (United States)

    Zitouni, A.; Boukdir, A.; El Fjiji, H.; Baite, W.; Ekouele Mbaki, V. R.; Ben Said, H.; Echakraoui, Z.; Elissami, A.; El Maslouhi, M. R.

    2018-05-01

    Being seen needs in increasing waters in our contry for fine domestics, manufactures and agricultural, the prospecting of subterranean waters by geologic and hydrogeologic classic method remains inaplicable in the cases of the regions where one does not arrange drillings or polls (soundings) of gratitude (recongnition) in very sufficient (self-important) number. In that case of figure, the method of prospecting geophysics such as the method of nuclear magnetic resonance (NMR) and the method of the geophysics radar are usually used most usually because they showed, worldwide, results very desive in the projects of prospecting and evaluation of the resources in subterranean waters. In the present work, which concerns only the methodology of the electric resistivity, we treat the adopted methodological approach and the study of the case of application in the tray of Ajdir Ain Leuh.

  11. Water-rock interaction and geochemistry of groundwater from the Ain Azel aquifer, Algeria.

    Science.gov (United States)

    Belkhiri, Lazhar; Mouni, Lotfi; Tiri, Ammar

    2012-02-01

    Hydrochemical, multivariate statistical, and inverse geochemical modeling techniques were used to investigate the hydrochemical evolution within the Ain Azel aquifer, Algeria. Cluster analysis based on major ion contents defined 3 main chemical water types, reflecting different hydrochemical processes. The first group water, group 1, has low salinity (mean EC = 735 μS/cm). The second group waters are classified as Cl-HCO(3)-alkaline earth type. The third group is made up of water samples, the cation composition of which is dominated by Ca and Mg with anion composition varying from dominantly Cl to dominantly HCO(3) plus SO(4). The varifactors obtained from R-mode FA indicate that the parameters responsible for groundwater quality variations are mainly related to the presence and dissolution of some carbonate, silicate, and evaporite minerals in the aquifer. Inverse geochemical modeling along groundwater flow paths indicates the dominant processes are the consumption of CO(2), the dissolution of dolomite, gypsum, and halite, along with the precipitation of calcite, Ca-montmorillonite, illite, kaolinite, and quartz. © Springer Science+Business Media B.V. 2011

  12. Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

    Index Scriptorium Estoniae

    2007-01-01

    Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

  13. Evaluación de costo-efectividad de los nuevos anticoagulantes orales en pacientes con fibrilación auricular no valvular

    Directory of Open Access Journals (Sweden)

    Ángel Alberto García-Peña

    2017-03-01

    Full Text Available La fibrilación auricular es el trastorno más frecuente del ritmo cardíaco y una de las causas potencialmente tratables de cardioembolia y ataque cerebrovascular. La disponibilidad de nuevos anticoagulantes para pacientes con fibrilación auricular no valvular, plantea retos, derivados principalmente de los costos de su uso, perfiles de eficacia y seguridad, tolerancia y disponibilidad. Se llevó a cabo un análisis de costo-efectividad con base en un modelo de Markov, que permite comparar las estrategias de anticoagulación disponibles para fibrilación auricular no valvular en el país (apixabán, dabigatrán, rivaroxabán. La perspectiva empleada fue la del tercero pagador (sistema de salud colombiano, considerando solo costos médicos directos. Se siguieron las guías metodológicas para este tipo de estudios propuestas por ISPOR (International Society for Pharmacoeconomics and Outcomes Research e INAHTA (International Network of Agencies for Health Technology Assessment. El horizonte temporal fue de 5 años, 10 años y toda la vida, en tanto que la tasa de descuento fue del 3%. Luego de la evaluación del modelo, con base en los análisis de sensibilidad realizados y el umbral de costo-efectividad para Colombia, se encontró que para el caso base, las diferentes moléculas evaluadas, si bien son costo-efectivas, exceden el umbral propuesto para este trabajo, siendo rivaroxabán y dabigatrán las únicas estrategias costo-efectivas con un horizonte temporal a 10 años con una tasa de descuento del 3% y para un horizonte temporal de toda la vida y tasa de descuento del 3%, las tres moléculas alcanzan el umbral de costo-efectividad establecido para Colombia. Dichas consideraciones son altamente sensibles al costo de los medicamentos.

  14. Extraction and anticoagulant activity of sulfated polysaccharides from Caulerpa cupressoides var. lycopodium (Vahl C. Agardh (Chlorophyceae = Extração e atividade anticoagulante dos polissacarídeos sulfatados da clorofícea Caulerpa cupressoides var. lycopodium (Vahl C. Agardh = Extração e atividade anticoagulante dos polissacarídeos sulfatados da clorofícea Caulerpa cupressoides var. lycopodium (Vahl C. Agardh.

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2011-04-01

    Full Text Available The reportedly low standard quality of heparin (HEP for use in cardiac surgeries has led to concern in the Brazilian and international markets. Sulfated polysaccharides (SPs from seaweeds have been regarded as promising substitutes for HEP. The aim of this study was to sequentially extract total SPs (TSPs from Caulerpa cupressoides (Chlorophyceae with papain in 100 mM sodium acetate buffer (pH 5.0 containing 5 mM cysteine and 5 mM EDTA, followed byfractionation by ion-exchange chromatography (DEAE-cellulose, and then evaluate the anticoagulant potential of SP fractions by activated partial thromboplastin time (APTT using normal human plasma and compare it to standard HEP (193 IU mg-1. The obtained fractions were chemically characterized by chemical composition and agarose gel electrophoresis. The yield was 4.61%, and three fractions of SP (F I, F II and F III eluted with 0.50, 0.75 and 1.00 M of NaCl,respectively, were observed on chromatography profiles; however, differences in charge densities patterns and degree of resolution among them were revealed by electrophoresis. SPs were capable of modifying APTT only in fractions eluted with 0.75 M of NaCl, whose activities were 23.37 and 25.76 IU mg-1, respectively, and the charge density was prerequisite to activity. Therefore, C. cupressoides is a source of SPs possessing low anticoagulant potential compared to HEP.O baixo padrão de qualidade outrora declarado da heparina (HEP para o uso em cirurgias cardíacas tem levado preocupação nos mercados nacional e internacional. Os polissacarídeos sulfatados (PSs de algasmarinhas têm sido considerados como promissores substitutos para HEP. Objetivou-se a extrair sequencialmente PSs totais (PSTs da clorofícea Caulerpa cupressoides com papaína em tampão acetato de sódio 100 mM (pH 5,0 contendo cisteína 5 mM e EDTA 5 mM, fracionar por cromatografia de troca iônica (DEAE-celulose e avaliar o potencial anticoagulante das frações de PS por meio do

  15. Extracción de cromo con disolventes orgánicos. I parte. Extracción con DEHPA

    Directory of Open Access Journals (Sweden)

    de Juan, D.

    1998-06-01

    Full Text Available Chromium and its compounds give toxic and/or hazardous characteristics to all those industrial wastes, solids or liquids, that contain them. Organic solvent extraction is a technique that allows the recovery of chromium contained in these residues. In this work the extraction of Cr(III from aqueous solutions with solutions of a cationic reactive (DEHPA in kerosene is studied. In the same way the stripping process was studied. It has been found that Cr(III and DEHPA react in a 1/1 molar ratio, being the extraction kinetics very fast. Final aqueous phase final pH influence extraction yield, so that it is necessary to work with pH values between 3 and 4. It must be added a modifier (isodecanol to the organic phase to avoid the formation of a third phase in the stripping process. The concentration of isodecanol has to be higher than 15 %, so the organic phase used was a solution of 12.5 % v/v DEHPA in kerosene and 20 % v/v isodecanol. The stripping process is slow and must be carried out in an oxidant alkalyne medium, thus an aqueous solution of NaOH and H2O2 was used. An increase in the concentration of NaOH and H2O2 leads to an increase in the stripping yield initially, and becomes stable when concentrations of NaOH and H2O2 used are higher than 0.45 N and 4 % v/v respectively.

    El cromo y sus compuestos confieren un carácter tóxico y/o peligroso a los residuos industriales, sólidos o líquidos, que los contienen. Una técnica que permite recuperar el cromo existente en estas sustancias es la extracción con disolventes orgánicos. En el presente trabajo se estudia la extracción del Cr(III presente en disoluciones acuosas con disoluciones de un reactivo de carácter catiónico (DEHPA en queroseno. Igualmente se estudia el proceso de reextracción. Se ha encontrado que el Cr(III y el DEHPA reaccionan mol a mol, siendo la cinética de extracción muy rápida. El pH final de

  16. Evaluation of the impact of water harvesting techniques on the evolution of piezometric head of Ain El Bidha groundwater in Kairouan at the Central part of Tunisia

    Science.gov (United States)

    Mechergui, M. Mohamed; Henda Saoudi, Mme

    2016-04-01

    This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values

  17. Climate change and their consequences on coastal zone of Ain el Turck in Oran

    Directory of Open Access Journals (Sweden)

    Mohammed Tewfik Bouroumi

    2017-12-01

    Full Text Available Algeria does not escape the problem of the climate change, its geographical position in zone of transition, and its dry and semi-arid climate, in fact a very vulnerable space. In Algeria, approximately two thirds of the population is concentrated on the coast which represents only 4 % of the territory. The Mediterranean coast, in particular in Algeria, is subjected to pressures: financial stakes, climatic risks, pollutions and conservation of the water. It is on the basis of the critical and objective report with regard to a wild urbanization of the Algerian coast as well as the influence of the demographic pressure that the choice of the search for this article was held. This publication has for objective to raise (to draw up a current situation (inventory of fixtures of the sector of the environment in Algeria and to present through the case of the coastal city of Oran the consequences of climate change. We propose, to review the situation through the case of the municipality of Ain El Türck, by basing itself on data relative to the evolution of the temperatures and the sea level.

  18. Avaliação de anticoagulantes naturais e de fatores da coagulação em pacientes com distúrbios congênitos de glicosilação (DCG tipo I An evaluation of natural anticoagulants and coagulation factors in patients with congenital disorders of glycosylation type I

    Directory of Open Access Journals (Sweden)

    Anna Letícia Soares

    2010-01-01

    Full Text Available Defeitos na incorporação de N-glicanos nas proteínas humanas ocasionam um grupo de doenças multissistêmicas denominadas coletivamente distúrbios congênitos de glicosilação (DCG. Os DCG manifestam-se na infância com sintomas neurológicos que incluem principalmente atraso psicomotor, ataxia, hipotonia e episódios de acidente vascular cerebral. Várias proteínas do sistema hemostático somente tornam-se biologicamente ativas após a glicosilação. O objetivo deste estudo foi avaliar os anticoagulantes naturais (proteína S livre, proteína C e antitrombina e os fatores da coagulação (VIII, IX e XI em pacientes com DCG tipo I. Foram avaliados 11 pacientes com diagnóstico positivo para DCG tipo I (três do gênero masculino e oito do gênero feminino, idade média de 5,6 anos; e oito pacientes com diagnóstico negativo para DCG(quatro do gênero masculino e quatro do gênero feminino, idade média de 4,5 anos (grupo-controle. O diagnóstico de DCG tipo I foi realizado pela identificação do padrão de hipoglicosilação da transferrina plasmática. Na avaliação dos anticoagulantes naturais pode-se observar redução dos valores de PS livre e PC e uma redução marcante de AT, quando comparados com o grupo controle. Em relação aos fatores de coagulação não houve diferença significativa para os fatores VIII e IX e houve redução marcante do fator XI. Os resultados do presente estudo sugerem que a deficiência combinada de anticoagulantes naturais é responsável pelo estado pró-trombótico observado em pacientes com DCG. Sugerimos também que a análise dos parâmetros hemostáticos seja realizada para pacientes com DCG quando apresentarem sintomas clínicos de alteração do sistema hemostático e antes de procedimentos invasivos.Defects in the biosynthesis of N-linked human protein glycosylation leads to a group of multisystem disorders collectively called congenital disorders of glycosylation (CDG. CDG present in infancy

  19. Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES

    Directory of Open Access Journals (Sweden)

    Margarita Restrepo

    2000-02-01

    Full Text Available

    Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.

    Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.

    El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo

  20. Nuevos antitrombóticos. ¿Qué debe conocer el cirujano cardiovascular?

    Directory of Open Access Journals (Sweden)

    José A. Páramo

    2011-01-01

    Full Text Available La trombosis es una de las causas de muerte más importante en los países industrializados. La trombosis arterial es responsable del infarto de miocardio y de los accidentes cerebrovasculares y se genera en zonas de daño arterial. Los antiplaquetarios y anticoagulantes desempeñan un papel fundamental en la prevención y tratamiento. La enfermedad tromboembólica venosa, a través de la trombosis venosa profunda y la embolia pulmonar, es la tercera causa de muerte después de los eventos arteriales. Ésta suele tratarse con anticoagulantes. En este trabajo se revisan los nuevos fármacos antiplaquetarios y anticoagulantes y su impacto en la cirugía cardiovascular.

  1. Nuevos anticoagulantes orales en fibrilación auricular no valvular New oral ant icoagulants in nonvalvular atrial fibrillation

    Directory of Open Access Journals (Sweden)

    Andrés F Buitrago

    2012-08-01

    Full Text Available La fibrilación auricular es la arritmia cardiaca sostenida más común y su prevalencia se duplica cada decenio por encima de los cincuenta años. Entretanto, las condiciones clínicas que más se asocian con ésta son la hipertensión arterial, la insuficiencia cardíaca, la enfermedad valvular cardíaca y la diabetes mellitus. Como complicaciones está la falla cardiaca, pero tal vez una de las peores son los eventos cardioembólicos, que ocurren aproximadamente en 4,5% de los pacientes no anticoagulados. El tratamiento antitrombótico con antagonistas de la vitamina K fue, durante más de cincuenta años, la única alternativa disponible, a pesar de sus múltiples limitaciones, las mismas que llevaron al desarrollo de nuevos fármacos anticoagulantes que disminuyen muchos de los problemas de los antagonistas de la vitamina K. Pueden agruparse en dos clases: inhibidores orales directos de la trombina e inhibidores orales del factor X activado. Tanto dabigatrán, rivaroxabán como apixabán, cuentan ya con estudios clínicos controlados aleatorizados que apoyan su uso en el tratamiento antitrombótico de la fibrilación auricular y recientemente se incluyeron en las guías basadas en la evidencia como alternativa (ACC e incluso con un grado de recomendación superior (CCS, CHEST al de los antagonistas de la vitamina K.Atrial fibrillation is the most common sustained cardiac arrhythmia and its prevalence doubles every decade for people older than fifty years. Meanwhile, the clinical conditions most associated with it are hypertension, heart failure, valvular heart disease and diabetes mellitus. Complications include heart failure, but perhaps one of the worst ones are the stroke events, which occur in approximately 4.5% of not anticoagulated patients. Antithrombotic therapy with vitamin K antagonists was for over fifty years the only alternative available, despite its many limitations. These limitations led to the development of new

  2. Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates

    Science.gov (United States)

    2013-01-01

    Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected from the 142 schools in Al Ain, Abu Dhabi Emirate. Outcomes measured included serum concentrations of 25-hydroxy vitamin D (25OHD), plasma lipids, blood sugar, blood pressure and anthropometric data, nutrition and lifestyle variables. Results Fourty-one participants (19.7%) were vitamin D deficient (serum 25OHD level ≤15 ng/mL [≤37.5 nmol/L]. Using a cutoff level of 25(OH) D of ≤20 ng/ml [≤50 nmol/l] 143 participants (45.4%) were vitamin D insufficient. Overall 65.1% of study participants were either vitamin D deficient or insufficient. The prevalence of vitamin D deficiency varied between boys (10%) and girls (28%). In a final multivariate model, serum 25(OH) D concentrations were inversely correlated with female gender, consumption of fast food per week, and body mass index and positively correlated with physical activity scores after adjustment for age. Conclusions Vitamin D deficiency and insufficiency were highly prevalent in adolescents, and more common in girls. PMID:23311702

  3. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9; Aplicacion de un recubrimiento de TiAIN para el incremento de la resistencia al desgaste de una compuerta de paso fabricada en acero T9

    Energy Technology Data Exchange (ETDEWEB)

    Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx

    2009-07-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  4. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9

    International Nuclear Information System (INIS)

    Montes de Oca, J.; Gonzalez, H. J.; Solis, E.; Moreno, J.; Munoz S, J.

    2009-01-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  5. EXIGENCES TECHNIQUES DANS LA CONSTRUCTION ET REGLEMENTATION : ETUDE D’UN EXEMPLE DE LOGEMENT COLLECTIF A AIN-SMARA (ALGERIE

    Directory of Open Access Journals (Sweden)

    B BENRACHI

    2002-12-01

    Full Text Available La construction d’un édifice de qualité standard et répondant aux exigences techniques est   obtenue grâce au développement du savoir-faire et au respect des règles de l’art et de la réglementation en vigueur.  Une étude détaillée sur les  exigences techniques et le respect de la réglementation  d’un logement en collectif  nouvellement construit et inhabité à Ain-Smara, nous a montré  qu’il y a une satisfaction pour certaines d'entre-elles et une non-conformité pour d’autres. Il en résulte que le degré de satisfaction de ce logement est inférieur à celui recommandé dans le cadre de la réglementation, ce qui diminue sa qualité par rapport au standard exigé.

  6. TRASTORNOS DEL ESPECTRO AUTISTA Y EXPOSICIONES OCUPACIONALES DE LOS PROGENITORES

    Directory of Open Access Journals (Sweden)

    Manuel Pino-López

    2013-01-01

    Full Text Available Fundamentos: Estudios con hermanos y gemelos sugieren un componente genético en el origen del autismo que no explica su crecimiento actual. El objetivo es investigar si factores ambientales como algunas exposiciones profesionales (trabajo nocturno, manejo de disolventes y/o campos electromagnéticos incrementan la probabilidad de trastornos del espectro autista (TEA en los hijos. Métodos: Estudio observacional de casos y controles mediante análisis de expedientes de 206 niños entre 16 y 36 meses de edad evaluados en el Servicio de Atención Temprana de Ciudad Real (70 con TEA y 136 no afectados. Para medir el riesgo de TEA asociado al trabajo nocturno, con disolventes y/o campos electromagnéticos se calculó la odds ratio (OR con un intervalo de confianza (IC del 95%. Resultados: El riesgo de TEA se multiplica por 2,22 cuando un progenitor trabaja en las ocupaciones estudiadas (OR=2,22, IC 95%=1,42-3,48, destacando trabajo con disolventes (OR=2,81, IC 95%=1,28-6,17 y nocturno (OR=2,18, IC 95%=1,21-3,93. El riesgo se multiplica por 3 si la madre trabaja en estas ocupaciones (OR=3, IC95%=1,44-6,26, destacando trabajo nocturno (OR=3,47, IC 95%=1,39-8,63 y con disolventes (OR=2,88, IC 95%=1,28-6,17. El riesgo se multiplica por 1,94 si el padre trabaja en estas ocupaciones(OR=1,94, IC 95%=1,07-3,53 y por 2,81 con disolventes (OR=2,81, IC 95%=1,01-7,86. Se encontró asociación positiva entre nivel educativo de los progenitores y TEA. Conclusiones: Encontramos relación significativa entre exposición de los progenitores a los riesgos estudiados y TEA en los hijos. Los resultados sugieren la participación de alteraciones genéticas ocasionadas por factores ambientales en el origen del trastorno.

  7. Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Nazirudeen Mohammad K

    2009-04-01

    Full Text Available Abstract Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7 after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5. Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3. Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3. Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management.

  8. Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

    Science.gov (United States)

    Baynouna, Latifa M; Revel, Anthony D; Nagelkerke, Nico JD; Jaber, Tariq M; Omar, Aziza O; Ahmed, Nader M; Nazirudeen, Mohammad K; Al Sayed, Mamdouh F; Nour, Fuad A; Abdouni, Sameh

    2009-01-01

    Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering) among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent associations can be explained by the metabolic syndrome according to ATP-III criteria. Method A community based survey, of conventional risk factors for cardiovascular disease was conducted among 817 national residents of Al Ain city, UAE. These factors were fasting blood sugar, blood pressure, lipid profile, BMI, waist circumference, smoking, or CHD family history. Odds ratios between risks factors, both unadjusted and adjusted for age and sex as well as adjusted for age, sex, and metabolic syndrome were calculated. Results Various risk factors were positively associated in this population; associations that are mostly unexplained by confounding by age and sex. For example, hypertension and diabetes were still strongly related (OR 2.5; 95% CI 1.7–3.7) after adjustment. An increased waist circumference showed similar relationship with hypertension (OR 2.3; 95% CI 1.5–3.5). Diabetes was related to an increased BMI (OR 1.5; 96% CI 1.0–2.3). Smoking was also associated with diabetes (OR 1.9, 95% CI 1.0–3.3). Further adjustment for metabolic syndrome reduced some associations but several remained. Conclusion In this population risk-factors cluster, but associations do not appear to be explained by the presence/absence of the ATP-III metabolic syndrome. Associations provide valuable information in planning interventions for screening and management. PMID:19371412

  9. Optimización de operaciones unitarias utilizando líquidos iónicos como agentes materiales de separación

    OpenAIRE

    Mur Sanz de Galdeano, Ramón

    2016-01-01

    En este trabajo se estudia la modelización y optimización de procesos industriales de separación mediante el empleo de mezclas de líquidos iónicos como disolventes. Los disolventes habitualmente empleados en procesos de absorción o extracción suelen ser componentes orgánicos muy volátiles y dañinos para la salud humana. Las innovadoras propiedades que presentan los líquidos iónicos, los convierten en alternativas adecuadas para solucionar estos problemas. La presión de vapor de estos co...

  10. A importância de reconhecer a síndrome antifosfolípide na medicina vascular

    Directory of Open Access Journals (Sweden)

    Andreas Funke

    Full Text Available Resumo A síndrome antifosfolipíde (SAF é uma doença autoimune sistêmica caracterizada por trombose arterial ou venosa recorrente e/ou morbidade gestacional e pela presença dos anticorpos antifosfolipídeos, podendo apresentar outras manifestações vasculares, como microangiopatia, arteriopatia crônica e SAF catastrófica. Determinados testes laboratoriais para a síndrome (por exemplo, o anticoagulante lúpico podem sofrer interferência do uso de medicações anticoagulantes, dificultando o diagnóstico. A fisiopatologia da SAF é complexa, sendo enumerados no texto diversos mecanismos patogênicos relacionados à coagulação, ao endotélio e às plaquetas. Por fim, discutimos o tratamento da SAF de acordo com a presença e o tipo de manifestações clínicas, o uso dos anticoagulantes orais diretos e o manejo perioperatório de pacientes com SAF.

  11. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Science.gov (United States)

    Grivna, Michal; Eid, Hani O; Abu-Zidan, Fikri M

    2013-01-01

    To study the mechanism of road traffic collisions (RTC), use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. All RTC injured children and youth (0-19-year-olds) who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37%) followed by front impact collision (32%). 32 (13%) of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170) vehicle passengers used seatbelts and 13% (3/23) motorcyclists a helmet. Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  12. Deformation history of the Neoproterozoic basement complex, Ain Shams area, Western Arabian Shield, Saudi Arabia

    Science.gov (United States)

    El-Fakharani, Abdelhamid; Hamimi, Zakaria

    2013-04-01

    Ain Shams area, Western Arabian Shield, Saudi Arabia, is occupied by four main rock units; gneisses, metavolcanics, metasediments and syn- to post-tectonic granitoids. Field and structural studies reveal that the area was subjected to at least three phases of deformation (D1, D2 and D3). The structural features of the D1 are represented by tight to isoclinal and intrafolial folds (F1), axial plane foliation (S1) and stretching lineations (L1). This phase is believed to be resulted from an early NW-SE contractional phase due to the amalgamation between Asir and Jeddah tectonic terranes. D2 deformation phase progressively overprinted D1 structures and was dominated by thrusts, minor and major F2 thrust-related overturned folds. These structures indicate a top-to-the-NW movement direction and compressional regime during the D2 phase. Emplacement of the syn-tectonic granitoids is likely to have occurred during this phase. D3 structures are manifested F3 folds, which are open with steep to subvertical axial planes and axes moderately to steeply plunging towards the E, ENE and ESE directions, L3 is represented by crenulation lineations and kink bands. These structures attest NE-SW contractional phase, concurrent with the accretion of the Arabian-Nubian Shield (ANS) to the Saharan Metacraton (SM) and the final assembly between the continental blocks of East and West Gondwana.

  13. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Directory of Open Access Journals (Sweden)

    Michal Grivna

    Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  14. Uso crônico de anticoagulante oral: implicações para o controle de níveis adequados Uso crónico de anticoagulante oral implicaciones para el control de niveles adecuados Constant use of oral anticoagulants: implications in the control of their adequate levels

    Directory of Open Access Journals (Sweden)

    Francieli Giachini Esmerio

    2009-11-01

    Full Text Available FUNDAMENTO: Dosagens inapropriadas e subterapêuticas anticoagulantes podem resultar em sérias complicações tromboembólicas. O uso dessa terapêutica requer especial atenção e precisa de um acompanhamento clínico e laboratorial rigoroso. OBJETIVO: Identificar fatores associados ao controle adequado dos níveis de anticoagulação oral, verificando o conhecimento e a percepção dos pacientes relacionados à terapêutica empregada. MÉTODOS: Estudo transversal que incluiu 140 pacientes acompanhados no ambulatório de anticoagulação oral, de novembro de 2005 a junho de 2006. Um questionário estruturado foi elaborado e aplicado para obtenção de características clínicas, conhecimento sobre a terapêutica, adesão ao tratamento (teste de Morisky e percepção do paciente. RESULTADOS: As principais indicações para uso do anticoagulação oral foram fibrilação atrial (61,4% e prótese metálica (55%. O tempo de uso variou entre 24 e 72 meses, e o femprocumona (58% foi o mais empregado. Em relaçãoà percepção da terapêutica, 95% dos pacientes mencionaram preocupação com o uso diário dessa medicação. A realização periódica de exames de sangue (21,4% e a tomada rigorosa de anticoagulação oral (12,8% foram compreendidas como limitantes. Observou-se conhecimento adequado entre os pacientes com international normalized ratio (INR fora da faixa (64% e na aderência entre os pacientes com INR dentro da faixa terapêutica (54%, porém sem significância estatística. CONCLUSÃO: Os resultados deste estudo demonstraram uma prevalência de pacientes em uso de anticoagulação oral com o INR dentro dos valores ideais, embora tenha sido grande a porcentagem de pacientes não-aderentes à terapêutica. O conhecimento insatisfatório quanto à terapêutica empregada e ao autocuidado torna-se evidente nessa população.FUNDAMENTO: Dosis inapropiadas y subterapéuticas anticoagulantes pueden resultar en serias complicaciones tromboemb

  15. Kinetics and thermodynamics of cottonseed oil extraction

    Directory of Open Access Journals (Sweden)

    Saxena, Devesh K.

    2011-06-01

    Full Text Available Petroleum derived n-hexane is commercially used in solvent extraction plants due to its higher extraction efficiency in spite of the fact that it is graded as highly toxic and hazardous. The present study is based on the use of both a much safer and non toxic solvent ethanol and n-hexane for the extraction of oil from cottonseed. The extraction data were obtained by varying temperature, solvent-solid ratio and particle size, to compare the extraction efficiency of both ethanol and n-hexane. The data show that nearly the same amount of extraction is possible at a higher solvent-solid ratio for both the solvents. This study has established that the kinetics of oil extraction follows a second order reaction mechanism. The thermodynamic analysis of the data shows that both ΔHº and ΔSº are positive, and ΔGº is negative indicating that the extraction process is endothermic, irreversible, and spontaneous.

    El n-hexano derivado del petróleo es comercialmente usado en plantas de extracción con disolventes debido a su mayor eficiencia de extracción, a pesar de que está calificado como altamente tóxico y peligroso. El presente estudio está basado en el uso de etanol, disolvente mucho más seguros y no tóxico, y n-hexano en la extracción de aceite de algodón. Los datos de extracción fueron obtenidos variando la temperatura, la proporción sólido-disolvente y el tamaño de partícula, para comparar la eficiencia de extracción del etanol y del hexano. Los datos muestran que casi la misma cantidad de extracción es posible para ambos disolventes a la proporción más alta de sólido-disolvente. Este estudio es capaz de establecer que las cinéticas de extracción de aceite siguen un mecanismo de reacción de segundo orden. El análisis termodinámico de los datos mostró que ΔHº and ΔSº son positivas, y ΔGº es negativa, indicando que el proceso de extracción es endotérmico, irreversible y espontáneo.

  16. Processing of spent nickel catalyst for fat recovery

    Directory of Open Access Journals (Sweden)

    Ibrahim Nasir, Mohammad

    2002-06-01

    Full Text Available Spent nickel catalyst (SNC have the potential of insulting the quality of the environment in a number of ways. The disposal of SNC will have a pollution effect. Optimum recovery of fat from SNC , could save the environment and reduce the oil loss. Hexane has been the solvent of choice for oil extraction. Alternative solvents that are considered safer have been evaluated. Hexane, isopropanol, ethanol, and heptane were examined using soxhlet extraction. While hexane was more efficient in oil recovery from SNC, isopropanol proved to be very good, to clarifying separation of oil from waste material and also provide high solvent recovery compared to other solvents. Isopropanol extraction with chill provided separation of miscella into two phases: lower oil–rich and an upper solvent – rich. It saved much energy of vaporization for distilling. An aqueous extraction process with immiscible solvent assisted was tested. Solvent like hexane added to SNC, and water added later with continuous stirring. The mixture was stirred for about 30 minutes, prior to centrifugation. Aqueous process extracted less amount of oil compared to solvent extraction.El catalizador agotado de níquel (SNC tiene el potencial de dañar la calidad del medio ambiente de diversas formas. El depósito de SNC tendrá un efecto de polución. La recuperación óptima de la grasa a partir del SCN, podría conservar el medio ambiente y reducir la pérdida de aceite. El hexano ha sido el disolvente elegido para la extracción del aceite. También se han evaluado disolventes alternativos que son considerados seguros. Se han examinado hexano, isopropanol, etanol y heptano usando extracción con soxhlet. Mientras que el hexano fue el mas eficaz en la recuperación del aceite, el isopropanol demostró ser muy bueno para aclarar la separación del aceite a partir de la materia residual y también proporcionó una alta recuperación del disolvente en comparación con los otros

  17. Trombosis venosa en el embarazo

    Directory of Open Access Journals (Sweden)

    DR. M. Fernando Ferrer

    2014-11-01

    El uso de anticoagulantes en pacientes obstétricas requiere de un plan de interrupción del embarazo lo más controlado posible. En la práctica clínica cotidiana esto no siempre es posible, debido a la incapacidad de predecir el momento de inicio del trabajo de parto. Por este motivo las recomendaciones relativas al manejo analgésico y anestésico del parto están basadas en el conocimiento de los cambios fisiológicos, farmacocinético y farmacodinámico de los anticoagulantes utilizados, lo que se analiza en extenso en esta revisión.

  18. Efecto de la luz, el oxígeno, el tiempo de reacción y el pH en el proceso de obtención de nitrosil hemocromo a partir de la sangre de res

    OpenAIRE

    Artiñano Hangen, Susanne; Herrera Ramírez, Carlos Hernán

    1997-01-01

    El propósito de este trabajo fue definir las condiciones de estabilización química de la sangre y evaluar el efecto de la luz, el oxígeno, el pH y el tiempo de reacción en el proceso de obtención de nitrosil hemocromo a partir de la sangre del ganado vacuno de la raza Brahman. Se encontró que el uso de una disolución anticoagulante de citrato de sodio (0,5%; m/w) y cloruro de sodio (0,9%; m/v) en proporción 9:1 (sangre:anticoagulante) es apropiada para la recolección y estabilización de la...

  19. Spatial and temporal variability in sedimentation rates associated with cutoff channel infill deposits: Ain River, France

    Science.gov (United States)

    Piégay, H.; Hupp, C.R.; Citterio, A.; Dufour, S.; Moulin, B.; Walling, D.E.

    2008-01-01

    Floodplain development is associated with lateral accretion along stable channel geometry. Along shifting rivers, the floodplain sedimentation is more complex because of changes in channel position but also cutoff channel presence, which exhibit specific overflow patterns. In this contribution, the spatial and temporal variability of sedimentation rates in cutoff channel infill deposits is related to channel changes of a shifting gravel bed river (Ain River, France). The sedimentation rates estimated from dendrogeomorphic analysis are compared between and within 14 cutoff channel infills. Detailed analyses along a single channel infill are performed to assess changes in the sedimentation rates through time by analyzing activity profiles of the fallout radionuclides 137Cs and unsupported 210Pb. Sedimentation rates are also compared within the channel infills with rates in other plots located in the adjacent floodplain. Sedimentation rates range between 0.65 and 2.4 cm a−1 over a period of 10 to 40 years. The data provide additional information on the role of distance from the bank, overbank flow frequency, and channel geometry in controlling the sedimentation rate. Channel infills, lower than adjacent floodplains, exhibit higher sedimentation rates and convey overbank sediment farther away within the floodplain. Additionally, channel degradation, aggradation, and bank erosion, which reduce or increase the distance between the main channel and the cutoff channel aquatic zone, affect local overbank flow magnitude and frequency and therefore sedimentation rates, thereby creating a complex mosaic of sedimentation zones within the floodplain and along the cutoff channel infills. Last, the dendrogeomorphic and 137Cs approaches are cross validated for estimating the sedimentation rate within a channel infill.

  20. MR imaging findings of anterior interosseous nerve lesions

    Energy Technology Data Exchange (ETDEWEB)

    Dunn, Andrew J. [Royal Liverpool University Hospital, Department of Medical Imaging, Liverpool (United Kingdom); Salonen, David C. [University of Toronto, Toronto Western Hospital, Department of Medical Imaging, Toronto, Ontario (Canada); Anastakis, Dimitri J. [University of Toronto, Toronto Western Hospital, Division of Plastic Surgery, Toronto, Ontario (Canada)

    2007-12-15

    To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

  1. MR imaging findings of anterior interosseous nerve lesions

    International Nuclear Information System (INIS)

    Dunn, Andrew J.; Salonen, David C.; Anastakis, Dimitri J.

    2007-01-01

    To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

  2. Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

    Directory of Open Access Journals (Sweden)

    Katre Talviste

    2013-12-01

    Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s. Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked

  3. Syntheses, structural variants and characterization of AInM′S4 (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS4 and KInSnS4 compounds

    International Nuclear Information System (INIS)

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru

    2016-01-01

    Ten AInM′S 4 (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS 4 (1-β), RbInGeS 4 (2), CsInGeS 4 (3-β), TlInGeS 4 (4-β), RbInSnS 4 (8-β) and CsInSnS 4 (9) compounds with three-dimensional BaGa 2 S 4 structure and CsInGeS 4 (3-α) and TlInGeS 4 (4-α) compounds with a layered TlInSiS 4 structure have tetrahedral [InM′S 4 ] − frameworks. On the other hand, LiInSnS 4 (5) with spinel structure and NaInSnS 4 (6), KInSnS 4 (7), RbInSnS 4 (8-α) and TlInSnS 4 (10) compounds with layered structure have octahedral [InM′S 4 ] − frameworks. NaInSnS 4 (6) and KInSnS 4 (7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS 4 and KInSnS 4 compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S 4 compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS 4 and KInSnS 4 compounds undergo facile topotactic ion-exchange at room temperature.

  4. Efecto in vitro del látex de Ficus insipida sobre la cascada de la coagulación sanguínea.

    Directory of Open Access Journals (Sweden)

    Fernando Concha-Benavente

    2010-07-01

    Full Text Available Es necesario investigar drogas naturales nuevas que aporten principios farmacológicos activos para ser utilizadas como una alternativa terapéutica. Por este motivo nos propusimos estudiar a Ficus insipida, cuyo látex ha sido usado como antihelmíntico durante muchos años en la amazonía, pero se investigó solo superficialmente su efecto anticoagulante in vitro. Objetivo: Comprobar el efecto anticoagulante in vitro y determinar la vía de la coagulación sobre la que actúa el látex de Ficus insípida. Material y métodos: Se obtuvo el látex de Ficus insipida y se prepararon diferentes concentraciones del mismo. Se obtuvieron muestras de sangre venosa periférica de 5 donantes voluntarios, anticoagulándolas con citrato de sodio. Luego, éstas se mezclaron con las diluciones del látex, se centrifugaron y se extrajo el plasma. Posteriormente, se obtuvo un pool de plasma para cada concentración del látex y se procedió a determinar el Tiempo de Protrombina (TP y el Tiempo de Tromboplastina Parcial activada (TTPa, respectivamente. Resultados: Se encontró que el látex de Ficus insipida prolongó el TP a una concentración mayor o igual a 0,03125% (V/V, y ambos, el TP y TTPa a una concentración mayor o igual a 0,15% (V/V. Conclusiones: Los resultados obtenidos nos permiten afirmar que el látex de Ficus insipida posee un efecto anticoagulante in vitro dosis dependiente sobre la vía extrínseca de la coagulación sanguínea a una concentración igual o mayor a 0,03125% (V/V y que a una concentración igual o mayor a 0,15% (V/V posee un potente efecto anticoagulante sobre ambas vías de la coagulación.(Rev Med Hered 2010;21:146-152.

  5. Some solvent extraction studies of trivalent metal halides; Quelques etudes sur l'extraction par solvant d'halogenures de metaux trivalents; Izuchenie ehkstraktsii nekotorykh rastvoritelej iz trekhvalentnykh metallicheskikh galoidov; Algunos estudios de la extraccion mediante disolventes de haluros de metales trivalentes

    Energy Technology Data Exchange (ETDEWEB)

    Dietz, Jr, R J; Mendez, J; Irvine, Jr, J W [Department of Chemistry and Laboratory for Nuclear Science, Massachusetts Institute of Technology, Cambridge, MA (United States)

    1962-03-15

    coefficients d'extraction pour une gamme de concentrations du metal superieure a 10{sup 10} et dans des conditions ou le coefficient varie selon un facteur de 10{sup 5}. Les donnees ont ete expliquees en termes d'ionisation de l'acide complexe HMX{sub 4} dans ces solvants a constante dielectrique relativement tres elevee. D'apres la variation du coefficient d'extraction en fonction de la concentration du metal, on a calcule la constante d'ionisation de l'electrolyte de support, HCl ou HBr, dans la phase non aqueuse, en appliquant une methode mise au point par Poskanzer. La variation du coefficient d'extraction en fonction de la concentration d'HX a ete utilisee pour calculer les constantes de stabilite, pour les especes completes MX{sub 3} et MX{sub 4}{sup -}. Etant donne que ces reactions ont lieu en phase aqueuse, elles sont independantes du solvant organique et l'on obtient une excellente concordance pour le systeme indium (III)-HCl en employant de l'ether bis (chloro-2-ethylique) et du nitrobenzene. Les efforts en vue d'evaluer les constantes de formation des complexes du chlorure et du bromure de gallium ont echoue, car la formation du complexe ne se produit qu'a l'interieur d'une gamme tres restreinte de concentrations de l'acide. Les resultats des calculs effectues d'apres les donnees d'extraction de la fraction (GaCl{sub 4}{sup -})/{Sigma} Ga(III), en fonction de la concentration d'HCl, correspondent quantitativement aux resultats obtenus par Kraus et Nelson au moyen des echanges d'ions. (author) [Spanish] Las tecnicas que emplean trazadores radiactivos permiten efectuar estudios quimico-fisicos de la distribucion del Ga (III) y del In (III) entre soluciones acuosas del HCl y HBr, y los disolventes organicos eter bis (2-cloroetilico) y nitrobenceno. Los autores han examinado empiricamente el comportamiento de estos sistemas midiendo los coeficientes de extraccion para concentraciones del metal que abarcan un intervalo superior a 10{sup 10} y en condiciones en las que

  6. High performance W-AIN cermet solar coatings designed by modelling calculations and deposited by DC magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Qi-Chu Zhang [The University of Sydney (Australia). School of Physics; Shen, Y.G. [City University of Hong Kong (Hong Kong). Department of Manufacturing Engineering and Engineering Management

    2004-01-25

    High solar performance W-AIN cermet solar coatings were designed using a numerical computer model and deposited experimentally. In the numerical calculations aluminium oxynitride (AlON) was used as ceramic component. The dielectric functions and then complex refractive index of W-AlON cermet materials were calculated using the Sheng's approximation. The layer thickness and W metal volume fraction were optimised to achieve maximum photo-thermal conversion efficiency for W-AlON cermet solar coatings on an Al reflector with a surface AlON ceramic anti-reflection layer. Optimisation calculations show that the W-AlON cermet solar coatings with two and three cermet layers have nearly identical solar absorptance, emittance and photo-thermal conversion efficiency that are much better than those for films with one cermet layer. The optimised calculated AlON/W-AlON/Al solar coating film with two cermet layers has a high solar absorptance of 0.953 and a low hemispherical emittance of 0.051 at 80{sup o}C for a concentration factor of 2. The AlN/W-AlN/Al solar selective coatings with two cermet layers were deposited using two metal target direct current magnetron sputtering technology. During the deposition of W-AlN cermet layer, both Al and W targets were run simultaneously in a gas mixture of argon and nitrogen. By substrate rotation a multi-sub-layer system consisting of alternating AlN ceramic and W metallic sub-layers was deposited that can be considered as a macro-homogeneous W-AlN cermet layer. A solar absorptance of 0.955 and nearly normal emittance of 0.056 at 80{sup o}C have been achieved for deposited W-AlN cermet solar coatings. (author)

  7. 18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz, Secrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

  8. Trombosis venosa profunda bilateral en una puérpera

    Directory of Open Access Journals (Sweden)

    Leydis Bárbara Ferreiro Hernández

    2015-05-01

    Full Text Available Se describe el caso clínico de una paciente de 29 años de edad, con antecedente de prolapso de la válvula mitral, quien a los 16 días de parida se le diagnosticó trombosis venosa profunda ileofemoral del lado derecho y a los 15 días, aúncon tratamiento anticoagulante, comenzó con trombosis venosa profunda del lado izquierdo, así como también con cuadro clínico sugestivo de tromboembolismo pulmonar.Se concluyó como una enfermedad tromboembólica venosa, dada por la presencia de trombosis venosa profunda bilateral.No hubo oclusión de la vena cava inferior, los resultados de la ecografía Doppler fueron positivos en ambos miembros y la respuesta al tratamiento anticoagulante resultó adecuada

  9. Download this PDF file

    African Journals Online (AJOL)

    Professor of Genetics (Cytogenetics), Faculty of Medicine, Ain Shams University, Cairo, Egypt. Hosam A Abdel-Ghany. Consultant of Medical Human Genetics, Medical Genetic Center, Ain Shams University, Cairo, Egypt. Nermin S Elsayed. Consultant of Medical Human Genetics, Medical Genetics Center, Ain Shams ...

  10. Concilier développement agricole et usage pérenne des eaux souterraines : un dialogue multi-acteurs dans la zone d’Ain Timguenay (province de Séfrou

    Directory of Open Access Journals (Sweden)

    Issam Sellika

    2016-10-01

    Full Text Available Au Maroc, l’utilisation des eaux souterraines pour l’irrigation a permis un développement agricole rapide dans de nombreuses régions, mais a aussi fait émerger des situations de baisse des niveaux piezométriques des nappes qui menacent la durabilité de cette agriculture irriguée. L’article présente une action de recherche portant sur la conception d’un projet de territoire agricole durable alliant développement agricole et usage pérenne des ressources en eau souterraine. L’étude a eu lieu dans la zone d’Ain Timguenay (province de Séfrou, qui connait un fort développement de la production de pommes et de prunes depuis une quinzaine d’années. Le programme de recherche a impliqué les agriculteurs, la commune rurale d’Ain Timguenay, les institutions du Ministère de l’Agriculture et l’Agence de bassin hydraulique du Sébou. Une analyse des dynamiques agricoles locales et des tendances nationales a servi de support aux discussions. L’étude de l’aquifère et de ses usages a permis d’établir un bilan sommaire et un ordre de grandeur des surfaces qui pourraient encore être plantées sans que les consommations en eau soient supérieures à la recharge de l’aquifère en année pluviométrique moyenne. Une réflexion prospective menée avec les agriculteurs a mis en évidence deux scénarios possibles à l’échelle locale: 1 un scénario où les difficultés économiques que rencontrent actuellement les exploitations de la zone se renforcent, conduisant à un ralentissement des nouvelles plantations, d’où une pression limitée sur la nappe ; 2 un scénario où les exploitations réussissent à faire face aux défis actuels de production et de commercialisation et de ce fait continuent à planter, ce qui conduit à une consommation en eau bien supérieure à la recharge de la nappe. L’ensemble des acteurs impliqués a participé à l’élaboration d’un troisième scénario permettant de concilier d

  11. Metal nitride coatings by physical vapor deposition (PVD) for a wear resistant aluminum extrusion die.

    Science.gov (United States)

    Lee, Su Young; Kim, Sang Ho

    2014-12-01

    The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.

  12. Quality assessment of Moringa concanensis seed oil extracted through solvent and aqueous-enzymatic techniques

    Directory of Open Access Journals (Sweden)

    Anwar, Farooq

    2008-03-01

    Full Text Available The composition and quality of the M. concanensis seed oil extracted through an aqueous-enzyme-assisted technique, using three commercial enzyme-mixtures (Natuzyme, Kemzyme, and Feedzyme was compared to those of the control-, (without enzymes and solvent-extracted oils. Aqueous enzyme-extracted M.concanensis seed oil content ranged from 23.54 to 27.46% and was significantly (P 0.05 variation in the contents of fiber and ash within the three extraction methods. However, the protein content of the meal obtained through the aqueous-enzyme and control methods was significantly (P M. concanensis seed oils extracted using the three methods. The specific extinctions at 232 and 270 nm, peroxide value, p-anisidine, free fatty acid contents and color values of the aqueous-enzyme-extracted oil were found to be lower than that of solvent-extracted oil and thus revealed good quality. The oils extracted through the three methods exhibited no significant (P En este estudio se compara la composición y la calidad del aceite de semilla de M. concanensis extraído mediante enzimas, utilizando tres enzimas comerciales (Natuzyme, Kemzyme, y Feedzyme con las de un control extraído sin enzimas y con las del aceite extraído con disolvente. El contenido en aceites de las semilla extraídas con enzimas osciló entre 23,54 a 27,46% y fue significativamente más elevado (P 0,05 en el contenido de fibra y ceniza para los tres métodos de la extracción. Sin embargo, el contenido proteínico de la harina obtenido por métodos enzimáticos y el control sin enzimas fue significativamente menor (P < 0,05 que el de la harina obtenida después de la extracción por disolvente. Las diferencias en el índice de yodo (67.1-68.0 g /100 g of oil, densidad en 24 °C (0,865-0,866 g/mL, índice de refracción a 40 °C (1,4622-1,4627 y fracción insaponificable (0,69-0,76 % no fueron significativamente diferentes para ninguna de las técnicas de extracción. Las extinciones espec

  13. Extraction of oil from pequi fruit (Caryocar Brasiliense, Camb. using several solvents and their mixtures

    Directory of Open Access Journals (Sweden)

    Antoniassi, R.

    2011-09-01

    Full Text Available In this study, the oil extraction process from pequi pulp using different solvents (hexane, acetone and ethyl alcohol and their mixtures was investigated, using a simplex-centroid design. The extraction occurred at 50°C, under stirring (22 Hz, for 16 hours. The solid-liquid ratio used was 1:10 (w/w. Higher yield values were obtained for extractions with acetone and hexane, especially their mixtures with ethanol. Iodine value, saponification value and refractive index did not differ significantly among the treatments. A higher acid value was obtained for the extraction with ethyl alcohol. Higher carotenoid contents were obtained for the extraction with acetone and ethyl alcohol as pure solvents. The fatty acid profile in the oil fraction of the extracts did not vary among the different types of solvents and their mixtures.En este trabajo fue estudiado el proceso de extracción de aceite de la pulpa de pequi utilizando diferentes disolventes (n-hexano, acetona y etanol y sus mezclas, empleando diseño central simplex. Las extracciones fueron realizadas a 50°C, durante 16 horas de agitación (22 Hz. La proporción sólido:líquido empleada fue 1:10 (p/p. Los mayores rendimientos fueron obtenidos para las extracciones con acetona y con hexano, especialmente cuando fueron mezclados con etanol. El índice de yodo, el índice de saponificación y el índice de refracción no difirieron significativamente entre los tratamientos. Los mayores valores de acidez se obtuvieron en la extracción con etanol. Los mayores contenidos en carotenoides se obtuvieron en las extracciones con acetona y etanol como disolventes puros. El perfil de los ácidos grasos en las fracciones de aceite de los extractos no presentó variación entre los diferentes tipos de disolventes y sus mezclas.

  14. Cambios en la etiología, resultados y características de los pacientes con hemorragia digestiva aguda grave a lo largo del periodo 1999-2005 Changes in the etiology, outcome, and characteristics of patients with acute gastrointestinal bleeding between 1999 and 2005

    Directory of Open Access Journals (Sweden)

    A. Garrido

    2007-05-01

    Full Text Available Objetivos: analizar la evolución, a lo largo del periodo 1999-2005, de las siguientes variables de los pacientes ingresados por hemorragia digestiva (HD en una Unidad de Sangrantes: etiología, patología de base, consumo de AINE/anticoagulación y mortalidad. Material y métodos: durante el periodo 1999-2005 se ha estudiado la evolución de las siguientes causas de HD que requirieron ingreso en la Unidad de Sangrantes: ulcus duodenal (UD, ulcus gástrico (UG, hipertensión portal (HPT y otros. De igual forma se ha analizado la evolución en el porcentaje de enfermos ingresados con patología de base, consumo de fármacos AINE/anticoagulantes y mortalidad. Resultados: se han incluido 1.611 pacientes en el estudio con una edad media de 60,45 años (59,7-61,2, 76,41% hombres (74,3-78,5. La UD fue responsable del 22,20% de episodios (20,2-24,3, la UG del 18,40% (16,6-20,4 y la HPT del 33,60% (31,3-36,0. De forma global realizaban tratamiento con AINE el 34,5% (32,6-37,3, anticoagulación el 7,1% (6,0-8,6, presentaban patología de base el 72,6% (70,4-74,8 y la mortalidad global fue del 6,27% (5,16-7,59. A lo largo del periodo estudiado se constató un aumento de los pacientes con patología de base (p Objectives: to analyze the evolution of the following variables in patients admitted to a Blood Unit for gastrointestinal bleeding throughout 1999-2005: etiology, comorbid diseases, use of NSAIDs/anticoagulants, and mortality. Material and methods: we analyzed the evolution of the following causes of GIB that required admission to the Blood Unit from 1999 to 2005: duodenal ulcer (DU, gastric ulcer (GU, portal hypertension (PHT, and others. We also analyzed changes in the percentage of patients admitted with comorbid disease, use of NSAIDs/anticoagulants, and mortality. Results: 1,611 patients with a mean age of 60.45 years (59.7-61.2 were included in this study; 76.41% were males (74.3-78.5. DU was the cause of bleeding in 22.20% of cases (20

  15. Allergic Interstitial Nephritis Manifesting as a Striated Nephrogram

    Directory of Open Access Journals (Sweden)

    Irfan Moinuddin

    2015-01-01

    Full Text Available Allergic interstitial nephritis (AIN is an underdiagnosed cause of acute kidney injury (AKI. Guidelines suggest that AIN should be suspected in a patient who presents with an elevated serum creatinine and a urinalysis that shows white cells, white cell casts, or eosinophiluria. Drug-induced AIN is suspected if AKI is temporally related to the initiation of a new drug. However, patients with bland sediment and normal urinalysis can also have AIN. Currently, a definitive diagnosis of AIN is made by renal biopsy which is invasive and fraught with risks such as bleeding, infection, and hematoma. Additionally, it is frequently unclear when a kidney biopsy should be undertaken. We describe a biopsy proven case of allergic interstitial nephritis which manifested on contrast enhanced Magnetic Resonance Imaging (MRI as a striated nephrogram. Newer and more stable macrocyclic gadolinium contrast agents have a well-demonstrated safety profile. Additionally, in the presentation of AKI, gadolinium contrast agents are safe to administer in patients who demonstrate good urine output and a downtrending creatinine. We propose that the differential for a striated nephrogram may include AIN. In cases in which the suspicion for AIN is high, this diagnostic consideration may be further characterized by contrast enhanced MRI.

  16. Risk Factors for the presence of anal intraepithelial neoplasia in HIV+ men who have sex with men

    NARCIS (Netherlands)

    Richel, Olivier; de Vries, Henry J. C.; Dijkgraaf, Marcel G. W.; van Noesel, Carel J. M.; Prins, Jan M.

    2013-01-01

    Anal Intraepithelial Neoplasia (AIN) is present in the majority of HIV+ men who have sex with men (MSM) and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. We screened 311 HIV+ MSM by high

  17. Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report

    Directory of Open Access Journals (Sweden)

    Abdulla Aljawder

    2016-01-01

    Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.

  18. Jebel Hafit and the Al Ain oases (Eastern Abu Dhabi, United Arab Emirates): an integrative approach of a cultural landscape through the scope of geodiversity

    Science.gov (United States)

    Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine

    2015-04-01

    human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.

  19. Acute interstitial nephritis with acetaminophen and alcohol intoxication

    Directory of Open Access Journals (Sweden)

    Alexopoulou Iakovina

    2011-04-01

    Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.

  20. En el sellado del catéter venoso central en hemodiálisis, ¿presenta el uso de citrato respecto al uso de heparina menos complicaciones de infección? Una revisión de la literatura

    Directory of Open Access Journals (Sweden)

    Mateu Nadal Servera

    Full Text Available Resumen Introducción: La heparina es el fármaco anticoagulante de elección y de uso habitual en los servicios de hemodiálisis, en el procedimiento de permeabilización de los catéteres venosos centrales, aunque su uso no está exento de riesgos como la hemorragia. La infección asociada al catéter, bien por colonización del catéter o por bacteriemia, es el evento más importante y la segunda causa de mortalidad tras la enfermedad cardiovascular en el paciente en hemodiálisis. En este sentido, el uso del citrato se está presentando como una alternativa para el sellado de los catéteres venosos centrales, dado que tiene propiedades tanto anticoagulantes locales como antimicrobianas y podría ser más eficiente en la prevención o la reducción de la infección asociada al catéter. Objetivos: Identificar qué anticoagulante de uso en el sellado del catéter venoso central, la heparina o el citrato, presenta menos complicaciones de bacteriemia asociada al catéter y de colonización del catéter; Material y Método: se realizó una búsqueda bibliográfica a través del metabuscador EBSCOhost (Academic Search Premier, CINAHL y las bases de datos PubMed, IME, Ibecs, LILACS, CUIDEN, Scopus y Cochrane Library, con la selección final de 15 documentos tras la aplicación de los límites de búsqueda, la eliminación de duplicados y la aplicación de los criterios de inclusión/exclusión. Los resultados más relevantes y actuales disponibles en la literatura científica presentaron cierta variabilidad, tanto en las concentraciones de anticoagulante como en la incidencia de infección. Resultados y Discusión: La numerosa evidencia sobre la bacteriemia asociada al catéter, tanto en relación con la concentración como en la combinación del anticoagulante de sellado, indica que el citrato 4% podría reducir la incidencia de bacteriemia, aunque el citrato asociado a antimicrobianos es más efectivo en la prevención de ésta respecto a la

  1. Syntheses, structural variants and characterization of AInM′S{sub 4} (A=alkali metals, Tl; M′ = Ge, Sn) compounds; facile ion-exchange reactions of layered NaInSnS{sub 4} and KInSnS{sub 4} compounds

    Energy Technology Data Exchange (ETDEWEB)

    Yohannan, Jinu P.; Vidyasagar, Kanamaluru, E-mail: kvsagar@iitm.ac.in

    2016-06-15

    Ten AInM′S{sub 4} (A=alkali metals, Tl; M′= Ge, Sn) compounds with diverse structure types have been synthesized and characterized by single crystal and powder X-ray diffraction and a variety of spectroscopic methods. They are wide band gap semiconductors. KInGeS{sub 4}(1-β), RbInGeS{sub 4}(2), CsInGeS{sub 4}(3-β), TlInGeS{sub 4}(4-β), RbInSnS{sub 4}(8-β) and CsInSnS{sub 4}(9) compounds with three-dimensional BaGa{sub 2}S{sub 4} structure and CsInGeS{sub 4}(3-α) and TlInGeS{sub 4}(4-α) compounds with a layered TlInSiS{sub 4} structure have tetrahedral [InM′S{sub 4}]{sup −} frameworks. On the other hand, LiInSnS{sub 4}(5) with spinel structure and NaInSnS{sub 4}(6), KInSnS{sub 4}(7), RbInSnS{sub 4}(8-α) and TlInSnS{sub 4}(10) compounds with layered structure have octahedral [InM′S{sub 4}]{sup −} frameworks. NaInSnS{sub 4}(6) and KInSnS{sub 4}(7) compounds undergo facile topotactic ion-exchange, at room temperature, with various mono-, di- and tri-valent cations in aqueous medium to give rise to metastable layered phases. - Graphical abstract: NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo, in aqueous medium at room temperature, facile topotactic ion-exchange with mono, di and trivalent cations. Display Omitted - Highlights: • Ten AInM′S{sub 4} compounds with diverse structure types were synthesized. • They are wide band gap semiconductors. • NaInSnS{sub 4} and KInSnS{sub 4} compounds undergo facile topotactic ion-exchange at room temperature.

  2. [Economic impact of etanercept and adalimumab biosimilars on hospitals scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products].

    Science.gov (United States)

    Berreur, B; Guerin, F; Christophe, B; Limido, G; Paubel, P

    2018-01-01

    To evaluate the economic impact of future prescriptions of etanercept and adalimumab biosimilars at the territorial scale covered by PharmAlp'Ain, a hospitals grouping of orders for health products. Determination of the number and status of patients (naive or in continuation of treatment) from the National Database "Datamart de Consommation Inter-Régimes" of health insurance, concerned by a dispensation in a pharmacy of etanercept or adalimumab in 2015. Calculation of potential savings in case of biosimilar requirements according to 3 hypotheses: 63% (rate observed in a previous study) of initiations are treated with biosimiliaries and the others by princeps (H 1 ); all initiations under biosimilars and continuation therapy with the princeps (H 2 ) or all patients are treated with biosimilars (H 3 ). The annual savings are estimated at 237,000 € with the H 1 hypothesis. In the case of H 2 , the expected savings would be 376,200 € per year. In the case of H 3 , savings for the community could reach almost 1,282,800 € per year. The arrival of biosimilars allows significant savings for medicines market. According to the French recommendations in 2016, the expected savings are between the H 1 and H 2 hypothesis. The rate of penetration of biosimilars depends on many factors such as the involvement of health professionals, patient adherence, or health authority recommendations. Copyright © 2017 Académie Nationale de Pharmacie. Published by Elsevier Masson SAS. All rights reserved.

  3. Trimethoprim-sulfamethoxazole induced acute interstitial nephritis in renal allografts; clinical course and outcome.

    LENUS (Irish Health Repository)

    Garvey, J P

    2009-11-01

    Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.

  4. Non-native acylated homoserine lactones reveal that LuxIR quorum sensing promotes symbiont stability

    Science.gov (United States)

    Ho, Jessica S.; Geske, Grant D.; Blackwell, Helen E.; Ruby, Edward G.

    2014-01-01

    SUMMARY Quorum sensing, a group behavior coordinated by a diffusible pheromone signal and a cognate receptor, is typical of bacteria that form symbioses with plants and animals. LuxIR-type acyl homoserine-lactone (AHL) quorum sensing is common in Gram-negative proteobacteria, and many members of this group have additional quorum-sensing networks. The bioluminescent symbiont Vibrio fischeri encodes two AHL signal synthases: AinS and LuxI. AinS-dependent quorum sensing converges with LuxI-dependent quorum sensing at the LuxR regulatory element. Both AinS- and LuxI-mediated signaling are required for efficient and persistent colonization of the squid host, Euprymna scolopes. The basis of the mutualism is symbiont bioluminescence, which is regulated by both LuxI- and AinS-dependent quorum sensing, and is essential for maintaining a colonization of the host. Here, we used chemical and genetic approaches to probe the dynamics of LuxI- and AinS-mediated regulation of bioluminescence during symbiosis. We demonstrate that both native AHLs and non-native AHL analogs can be used to non-invasively and specifically modulate induction of symbiotic bioluminescence via LuxI-dependent quorum sensing. Our data suggest that the first day of colonization, during which symbiont bioluminescence is induced by LuxIR, is a critical period that determines the stability of the V. fischeri population once symbiosis is established. PMID:24191970

  5. Views and experiences of mental health nurses working with undergraduate assistants in nursing in an acute mental health setting.

    Science.gov (United States)

    Cleary, Michelle; Horsfall, Jan; O'Hara-Aarons, Maureen; Mannix, Judy; Jackson, Debra; Hunt, Glenn E

    2012-04-01

    Undergraduate nurses are employed as assistants in nursing (AIN) in inpatient mental health settings; however, there is a paucity of published research exploring registered nurses' (RN) views about the AIN role in these settings. This qualitative study documents the views and experiences of RN working with undergraduate AIN. Fifty structured face-to-face interviews were analysed, and the results are discussed in three sections. The first section outlines RN perceptions of qualities and skills required of AIN in mental health, and the responses primarily focus on communication skills, initiative, and willingness to learn. The second section targets factors in the workplace that might enhance the interest of AIN in a mental health nursing career; the responses emphasize their need to work with experienced staff. The last section outlines RN expectations of AIN, most of which are met and involve physical observations and technical tasks; less fulfilled activities primarily cluster around interactions with patients. Findings highlight the advantages and disadvantages of drawing on undergraduate nursing students as AIN in mental health settings. Communication skills, personal initiative, safety training to prevent violence, and education to increase knowledge and awareness about mental illness, diagnosis, and mental status-related skills were all important concerns articulated by RN. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.

  6. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009-2013.

    Science.gov (United States)

    Azab, Sonya M S; Hirshon, Jon Mark; Hirshon, John Mark; Hayes, Bryan D; El-Setouhy, Maged; Smith, Gordon S; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. This retrospective study involved acutely poisoned patients, 0-18 years of age, who presented to the ASU-PTC between 1 January 2009 and 31 December 2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. During the 5-year study period, 38 470 patients meeting our criteria were treated by the ASU-PTC; 19 987 (52%) were younger than 6 years of age; 4196 (11%) were 6-12 years; and 14 287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29 174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents whereas poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agents leading to morbidity and mortality.

  7. Time Management and Its Relation To Students’ Stress, Gender and Academic Achievement Among Sample of Students at Al Ain University of Science and Technology, UAE

    Directory of Open Access Journals (Sweden)

    Ahmad Saleh Al Khatib

    2014-05-01

    Full Text Available The objective of the present study was to investigate the relationship between time management, perceived stress, gender and academic achievement among United Arab Emirates college students. The respondents were 352 college students from Al Ain University of Science and Technology. The sample was stratified by sex. Among the respondents, 52.5% were female students and 47.5% were male students. The mean age of the sample was 23.4 years ranging from 18 to 39. Time management was measured by Time Management Questionnaire” developed by Britton and Tesser (1991, while perceived stress was measured by The Perceived Stress Scale developed by Cohen (1985. The findings of the study showed that there was statistically significant negative relationship between time management and perceived stress. Females reported higher time management compared to their males counter mates. Higher time management and lower perceived stress were associated with high levels of academic achievement. However, time management was the most significant predictor of academic achievement accounting for 26 % of the variance while perceived stress accounted for an additional 11.2% of the variance in academic achievement. All three predictors explained 29.4% (R = .543 of total variance. The implications and limitations are reviewed as are the suggestions for future research.   Keywords: Time management, perceived stress, academic achievement, college students.

  8. Colonic aberrant crypt formation accompanies an increase of opportunistic pathogenic bacteria in C57BL/6 mice fed a high-fat diet.

    Science.gov (United States)

    Zeng, Huawei; Ishaq, Suzanne L; Liu, Zhenhua; Bukowski, Michael R

    2018-04-01

    The increasing worldwide incidence of colon cancer has been linked to obesity and consumption of a high-fat Western diet. To test the hypothesis that a high-fat diet (HFD) promotes colonic aberrant crypt (AC) formation in a manner associated with gut bacterial dysbiosis, we examined the susceptibility to azoxymethane (AOM)-induced colonic AC and microbiome composition in C57/BL6 mice fed a modified AIN93G diet (AIN, 16% fat, energy) or an HFD (45% fat, energy) for 14 weeks. Mice receiving the HFD exhibited increased plasma leptin, body weight, body fat composition and inflammatory cell infiltration in the ileum compared with those in the AIN group. Consistent with the gut inflammatory phenotype, we observed an increase in colonic AC, plasma interleukin-6, tumor necrosis factor-α, monocyte chemoattractant protein-1 and inducible nitric oxide synthase in the ileum of the HFD-AOM group compared with the AIN-AOM group. Although the HFD and AIN groups did not differ in bacterial species number, the HFD and AIN diets resulted in different bacterial community structures in the colon. The abundance of certain short-chain fatty acid (SCFA) producing bacteria (e.g., Barnesiella) and fecal SCFA (e.g., acetic acid) content were lower in the HFD-AOM group compared with the AIN and AIN-AOM groups. Furthermore, we identified a high abundance of Anaeroplasma bacteria, an opportunistic pathogen in the HFD-AOM group. Collectively, we demonstrate that an HFD promotes AC formation concurrent with an increase of opportunistic pathogenic bacteria in the colon of C57BL/6 mice. Published by Elsevier Inc.

  9. "Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire

  10. Fractal dimension and image statistics of anal intraepithelial neoplasia

    International Nuclear Information System (INIS)

    Ahammer, H.; Kroepfl, J.M.; Hackl, Ch.; Sedivy, R.

    2011-01-01

    Research Highlights: → Human papillomaviruses cause anal intraepithelial neoplasia (AIN). → Digital image processing was carried out to classify the grades of AIN quantitatively. → The fractal dimension as well as grey value statistics was calculated. → Higher grades of AIN yielded higher values of the fractal dimension. → An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.

  11. Influência de frações da parede celular de levedura (Saccharomyces cerevisiae sobre os índices séricos de glicose e lipídios, microbiota intestinal e produção de ácidos graxos voláteis (AGV de cadeias curtas de ratos em crescimento Influence of yeast (Saccharomyces cerevisiae cell wall fractions on serum indexes of glucose and lipids, intestinal microbiota and production of short-chain volatile fatty acids (VFA in growing rats

    Directory of Open Access Journals (Sweden)

    Saula Goulart Chaud

    2007-06-01

    Full Text Available Os índices séricos de glicose e lipídios, a microbiota intestinal e a produção de ácidos graxos voláteis de cadeias curtas (AGV foram determinados em ratos Wistar submetidos às dietas: padrão (AIN-P, padrão modificada (AIN-M e às dietas contendo frações de parede celular de levedura: glicana insolúvel (GI, manana (M e glicana mais manana (G+M, como única fonte de fibra alimentar. O fracionamento da parede celular (PC foi realizado por processos físicos e químicos de extração, centrifugação e secagem em "spray dryer". Os índices séricos foram dosados através de "kits" comerciais. A microbiota e a produção de AGV foram determinadas nos conteúdos intestinais, incluindo cólon, ceco e reto. Considerando os níveis de colesterol no tempo (T0 e no tempo 28 (T28, as dietas AIN-P, AIN-M e M apresentaram efeito hipocolesterolêmico, tendo em vista que a composição das dietas eram de natureza hipercolesterolêmica. Em relação à glicose sérica, no tempo (T0 observou-se uma elevação geral da glicemia, sugerindo um efeito hiperglicêmico das dietas estudadas. A dieta G+M foi a que apresentou valores significantemente mais elevados de lipídios séricos no tempo T14, e os níveis mais baixos foram observados na dieta M e na dieta GI no T14 e nas dietas AIN-M e AIN-P. A dieta AIN-P foi a que apresentou valor significantemente mais elevado de triacilgliceróis nos tempos T14 e T28. Os níveis mais baixos nos tempos T14 foram constatados para as dietas G+M e GI e no tempo T28 para as dietas AIN-M e M. De um modo geral, não houve modificações significativas na microbiota intestinal dos animais em nenhuma das dietas. Dentre os AGV, o ácido acético foi o predominante, seguido do propiônico e do butírico, em todas as dietas estudadas.The blood serum indexes of glucose and lipids, the intestinal microbiota and the production of volatile fatty acids (VFA were determined in Wistar rats which were fed a standard (AIN-P diet, a

  12. Production of biosurfactant on crude date syrup under saline conditions by entrapped cells of Natrialba sp. strain E21, an extremely halophilic bacterium isolated from a solar saltern (Ain Salah, Algeria).

    Science.gov (United States)

    Kebbouche-Gana, Salima; Gana, Mohamed Lamine; Ferrioune, Imen; Khemili, Souad; Lenchi, Nesrine; Akmouci-Toumi, Sihem; Bouanane-Darenfed, Nabila Amel; Djelali, Nacer-Eddine

    2013-11-01

    A bacterial strain E21 was isolated from a sample of water collected in the salt lake located close to Ain Salah, Algeria. The analysis of 16S rRNA gene sequence had indicated that the strain had 93 % sequence similarity with the genus Natrialba sp. strain E21 (GenBank, FR750525.1) and was considered extremely halophilic. Production of biosurfactant by the strain E21 with free and entrapped cells was investigated using soluble starch in the saline conditions. Biosurfactant synthesis was followed by measuring the surface tension and emulsifying index 9 days under optimal conditions (40 °C, pH 7). Some diffusional limitations in alginate and agar beads affected the kinetics of biosurfactant production when compared to that obtained with free cells culture. The minimum values of surface tension were 27 and 30 mN m(-1) achieved after 9 days with free and immobilized cells, respectively, while the corresponding maximum E24 values were 65.3 and 62.3 %, respectively. The re-use of bacterial cells along with the limited cell losses provided by the immobilized system might lead to significant reduction of the biosurfactant production cost.

  13. Microstructure of Nitrided Aluminum Alloys Using an Electron-Beam-Excited-Plasma (EBEP)

    Institute of Scientific and Technical Information of China (English)

    L. Liu; A. Yamamoto; T. Hishida; H. Shoyama; T. Hara; T. Hara

    2004-01-01

    Nitriding of surface of aluminum alloys was carried out with using an electron-beam-excited-plasma (EBEP)technique. The EBEP is sustained by electron impact ionization with energetic electron beam. Two kinds of substrates,aluminum alloys AA5052 and AA5083, were exposed to the down flow of EBEP source at 843 K for 45min. The specimens were characterized with respect to following properties: crystallographic structure (XRD), morphology (SEM) and the cross sectional microstructures of the nitrided layer was observed using a scanning electron microscopy (SEM). There are some Al2O3 particles on the surface of the nitrided AA5052 and AA5083. The AIN layers were formed on the substrates with the thickness of 4.5 μ m for AA5052 and 0.5 μ m for AA5083. A relatively uniform nitrided surface layer composed of AIN can be observed on the AA5052 substrate. The grains size near the interfaces between the substrate and AIN layer were smaller than that near the surface. On the surface of AIN layer, the concentration of nitrogen was high and in the middle of AIN layer it had a constant concentration like the aluminum and the concentration was decreased with approaching to the interface. On the surface of nitrided AA5083, a uniform AIN layer was not formed as the reason for the high nitriding temperature.

  14. Epidemiology of acute poisoning in children presenting to the poisoning treatment center at Ain Shams University in Cairo, Egypt, 2009–2013

    Science.gov (United States)

    Azab, Sonya M. S.; Hirshon, Jon Mark; Hayes, Bryan D.; El-Setouhy, Maged; Smith, Gordon S.; Sakr, Mahmoud Lotfy; Tawfik, Hany; Klein-Schwartz, Wendy

    2016-01-01

    Introduction Pediatric poisonings represent a major and preventable cause of morbidity and mortality throughout the world. Epidemiologic information about poisoning among children in many lower- and middle-income countries is scarce. This study describes the epidemiology of acute poisonings in children presenting to Ain Shams University's Poisoning Treatment Center (ASU-PTC) in Cairo and determines the causative agents and characteristics of acute poisoning in several pediatric age groups. Methods This retrospective study involved acutely poisoned patients, 0 to 18 years of age, who presented to the ASU-PTC between 1/1/2009 and 12/31/2013. Data were extracted from electronic records maintained by the ASU-PTC. Collected data included demographics, substance of exposure, circumstances of the poisoning, patient disposition, and outcome. Results During the 5-year study period, 38,470 patients meeting our criteria were treated by the ASU-PTC; 19,987 (52%) were younger than 6 years of age; 4,196 (11%) were 6 to 12 years; and 14,287 (37%) were >12 years. Unintentional poisoning accounted for 68.5% of the ingestions, though among adolescents 84.1% of ingestions were with self-harm intent. In all age groups, the most frequent causative drugs were non-opioid analgesics, antipyretics, and antirheumatics. The most common nonpharmaceutical agents were corrosives in preschool children and pesticides in adolescents. Most patients had no/minor effects (29,174 [75.8%]); hospitalization rates were highest among adolescents. There were 119 deaths (case fatality rate of 0.3), primarily from pesticide ingestion. Conclusion Poisoning in preschool children is mainly unintentional and commonly due to nonpharmaceutical agents while poisoning in adolescents is mainly intentional (self-harm). Pesticides, mainly organophosphorous compounds and carbamates, were the most frequent agent leading to morbidity and mortality. PMID:26653953

  15. In situ EELS and TEM observation of Al implanted with nitrogen ions

    International Nuclear Information System (INIS)

    Hojou, K.; Furuno, S.; Kushita, K.N.; Otsu, H.; Izui, K.

    1995-01-01

    Formation processes of Aluminum nitride (AIN) in Aluminum (AI) implanted with nitrogen were examined by in situ EELS and TEM observations during nitrogen ion implantation in an electron microscope at room temperature and 400 deg C. AIN phase was identified both by EDP and EELS after nitrogen ion implantation to 6 x 10 20 (N + )/m 2 . The observed peak (20.8 eV) in EELS spectra was identified as plasmon loss peak of AIN formed in AI. The binding energy of N ls in AI was found to shift by about 4 eV to the lower side with increasing nitrogen-ion fluence. Unreacted AI was also found to remain in the AIN films after high fluence implantation both at room temperature and 400 deg C. (authors). 11 refs., 5 figs., 2 tabs

  16. Teatrilugu nendest, kes teatris ei käi / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2000-01-01

    Nr. 52/1999. Martin McDonaghi "Mägede iluduskuninganna" Vanemuises, lavastaja Ain Mäeots. Esietendus oli 5. nov. Ka Ain Mäeotsa ja näitlejate Liina Tennosaare ning Margus Jaanovitsi arvamusi näidendist

  17. Caracterización del aceite de semilla de uva extraído con dióxido de carbono supercrítico

    Directory of Open Access Journals (Sweden)

    Molero Gómez, A.

    1995-02-01

    Full Text Available In this work the quality of grape seed oil obtained by extraction with supercritical carbon dioxide was studied. At the optimun operating conditions (313 K and 25 MPa, the yield of supercritical extraction is similar to the conventional extraction by liquid solvent, but the quality of the grape seed oil extracted by supercritical carbon dioxide is higher.
    Furthermore, supercritical extraction could be more economical than liquid extraction because the solvent removal by distillation is not necessary and several steps of the subsequent oil refining process can be eliminated.

    En este trabajo se realiza un estudio de la calidad del aceite de semillas de uva obtenido por extracción con dióxido de carbono supercrítico. En las condiciones operativas óptimas del proceso (313 K y 25 MPa el rendimiento de la extracción supercrítica es similar al de la extracción con disolventes líquidos, pero la calidad del aceite es muy superior.
    En consecuencia, el proceso supercrítico resulta competitivo con el convencional al reducir las etapas de refinado del aceite y eliminar la destilación del disolvente, las más costosas desde el punto de vista energético.

  18. Comparison of imiquimod, topical fluorouracil, and electrocautery for the treatment of anal intraepithelial neoplasia in HIV-positive men who have sex with men: an open-label, randomised controlled trial.

    Science.gov (United States)

    Richel, Olivier; de Vries, Henry J C; van Noesel, Carel J M; Dijkgraaf, Marcel G W; Prins, Jan M

    2013-04-01

    Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and side-effects of imiquimod, topical fluorouracil, and electrocautery for the treatment of AIN. In this open-label randomised trial, we included HIV-positive MSM older than 18 years visiting the HIV outpatient clinic of the Academic Medical Center, Amsterdam, Netherlands. Patients with histologically confirmed AIN were randomly assigned to receive either 16 weeks of imiquimod (three times a week), 16 weeks of topical fluorouracil (twice a week), or monthly electrocautery for 4 months. Randomisation was done with random block sizes of three and six, stratified for AIN grade (AIN grades 1, 2, or 3) and AIN location (peri-anal or intra-anal). Participants were assessed by high-resolution anoscopy 4 weeks after treatment. Responding patients returned for follow-up 24 weeks, 48 weeks, and 72 weeks after treatment. The primary endpoint was histological resolution of AIN measured 4 weeks after treatment and AIN recurrence at week 24, week 48, and week 72 after treatment. The primary analysis was done in a modified intention-to-treat population, including all patients who had received their assigned treatment at least once. The trial is registered at the Netherlands Trial Register, number NTR1236. Between Aug 12, 2008, and Dec 1, 2010, we screened 388 HIV-positive MSM for AIN by high resolution anoscopy. Of the 246 (63%) patients who had AIN, 156 (63%) were randomly assigned to either receive imiquimod (54 patients), topical fluorouracil (48 patients), or electrocautery (46 patients) following withdrawing of consent by eight patients. Modified intention-to-treat analysis showed a complete response in 13 (24%, 95% CI 15-37) patients in the imiquimod group, eight (17%, 8-30) of patients

  19. Determination of aluminium nitride or free nitrogen in low carbon steel

    International Nuclear Information System (INIS)

    Guetaz, V.; Soler, M.; Massardier, V.; Merlin, J.; Ravaine, D.

    2001-01-01

    As the aluminium nitrides play an important role in the manufacturing of steel sheets, a specific methodology was developed based on the thermoelectric power (TEP) technique, in order to determine the AIN nitrogen by an indirect method. The free nitrogen was determined and then the AIN nitrogen was calculated by the difference between the total nitrogen and the free nitrogen. Indeed, it is easier to determine the dissolved nitrogen, the content of which gradually decreases during the AIN precipitation, than the AIN nitrogen. A low carbon aluminium killed steel was employed with 580 ppm of aluminium and 50 ppm of nitrogen. A comparison of the results obtained by TEP with those obtained by other techniques (hot hydrogen extraction, electrochemical dissolution followed by a mineralization, electrochemical dissolution followed by a sodic decomposition and the Beeghly method) was conducted, in order to determine a reliable technique likely to quantify the amount of aluminium nitrides in aluminium killed steels. With these techniques, it is possible to determine either free nitrogen or precipitated nitrogen. From an experimental point of view, the precipitation kinetics of AIN was followed during an annealing performed at 973 K (700 C) by TEP and then different precipitation states of AIN were investigated to compare the different techniques: three annealing states (when no nitrogen, half the nitrogen and the total nitrogen has precipitated) and two soaking states (1403 and 1523 K). Thus, it was possible to compare states where the AIN precipitates are in various forms (different shapes, crystallographic structures, sizes, distributions in the matrix). This work showed that the quantification by TEP, hot hydrogen extraction and electrochemical dissolution followed by a mineralization seem reliable whereas the Beeghly method gives good results only for the precipitates formed at high temperatures. In contrast, the quantification by electrochemical dissolution followed by

  20. GW182-Free microRNA Silencing Complex Controls Post-transcriptional Gene Expression during Caenorhabditis elegans Embryogenesis.

    Directory of Open Access Journals (Sweden)

    Guillaume Jannot

    2016-12-01

    Full Text Available MicroRNAs and Argonaute form the microRNA induced silencing complex or miRISC that recruits GW182, causing mRNA degradation and/or translational repression. Despite the clear conservation and molecular significance, it is unknown if miRISC-GW182 interaction is essential for gene silencing during animal development. Using Caenorhabditis elegans to explore this question, we examined the relationship and effect on gene silencing between the GW182 orthologs, AIN-1 and AIN-2, and the microRNA-specific Argonaute, ALG-1. Homology modeling based on human Argonaute structures indicated that ALG-1 possesses conserved Tryptophan-binding Pockets required for GW182 binding. We show in vitro and in vivo that their mutations severely altered the association with AIN-1 and AIN-2. ALG-1 tryptophan-binding pockets mutant animals retained microRNA-binding and processing ability, but were deficient in reporter silencing activity. Interestingly, the ALG-1 tryptophan-binding pockets mutant phenocopied the loss of alg-1 in worms during larval stages, yet was sufficient to rescue embryonic lethality, indicating the dispensability of AINs association with the miRISC at this developmental stage. The dispensability of AINs in miRNA regulation is further demonstrated by the capacity of ALG-1 tryptophan-binding pockets mutant to regulate a target of the embryonic mir-35 microRNA family. Thus, our results demonstrate that the microRNA pathway can act independently of GW182 proteins during C. elegans embryogenesis.

  1. Wireless intelligent network: infrastructure before services?

    Science.gov (United States)

    Chu, Narisa N.

    1996-01-01

    The Wireless Intelligent Network (WIN) intends to take advantage of the Advanced Intelligent Network (AIN) concepts and products developed from wireline communications. However, progress of the AIN deployment has been slow due to the many barriers that exist in the traditional wireline carriers' deployment procedures and infrastructure. The success of AIN has not been truly demonstrated. The AIN objectives and directions are applicable to the wireless industry although the plans and implementations could be significantly different. This paper points out WIN characteristics in architecture, flexibility, deployment, and value to customers. In order to succeed, the technology driven AIN concept has to be reinforced by the market driven WIN services. An infrastructure suitable for the WIN will contain elements that are foreign to the wireline network. The deployment process is expected to seed with the revenue generated services. Standardization will be achieved by simplifying and incorporating the IS-41C, AIN, and Intelligent Network CS-1 recommendations. Integration of the existing and future systems impose the biggest challenge of all. Service creation has to be complemented with service deployment process which heavily impact the carriers' infrastructure. WIN deployment will likely start from an Intelligent Peripheral, a Service Control Point and migrate to a Service Node when sufficient triggers are implemented in the mobile switch for distributed call control. The struggle to move forward will not be based on technology, but rather on the impact to existing infrastructure.

  2. Cirugía de preservación valvular aórtica en los aneurismas de la raíz aórtica en el síndrome de Marfan

    Directory of Open Access Journals (Sweden)

    Alberto Forteza

    2010-10-01

    Conclusiones: La técnica de reimplante de la válvula aórtica ofrece unos resultados excelentes a corto y medio plazo. Elimina las complicaciones asociadas a las prótesis valvulares y al tratamiento anticoagulante, por lo que debe considerarse el tratamiento de elección para los aneurismas de la raíz de aorta en pacientes con SM.

  3. Asociación entre el consumo de antiinflamatorios no esteroideos y la aparición o descompensación de insuficiencia cardíaca congestiva : estudio de casos y controles

    OpenAIRE

    Rodríguez Bernardino, Ángel

    2003-01-01

    La insuficiencia cardiaca congestiva (ICC) es una patología con una alta prevalencia en nuestro medio. Se ha establecido una posible relación entre la acción de los antiinflamatorios no esteroideos (AINEs) sobre la síntesis de prostaglandinas y la aparición de ICC en individuos susceptibles. Nuestro objetivo fue evaluar la asociación entre el ingreso hospitalario por ICC y el consumo previo de AINEs, estimado la contribución individual de los distintos de AINEs. Se realizó un estudio multicén...

  4. Resonance April Cover Pg TP

    Indian Academy of Sciences (India)

    Admin

    word possibly having its origin in Sanskrit). W hat is ... History and Some Perspectives on Intermolecular Forces. E Arunan. Keywords van der Waals forces, hydrogen bonding. ... A tom s have rem ained a dom ain of physics, rather than.

  5. Sistemas supramoleculares en la determinación de drogas terapéuticas: nuevos métodos de extracción y cuantificación

    OpenAIRE

    Costi López, Esther María

    2011-01-01

    Los trabajos de investigación realizados en la Tesis Doctoral titulada: SISTEMAS SUPRAMOLECULARES EN LA DETERMINACIÓN DE DROGAS TERAPEÚTICAS: NUEVOS MÉTODOS DE EXTRACCIÓN Y CUANTIFICACIÓN, han demostrado que sistemas supramoleculares de diferente naturaleza (agregados en disolución, adsorbentes y disolventes) tienen la capacidad de interaccionar fuertemente con moléculas de drogas terapéuticas, dadas las similitudes estructurales existentes entre estos compuestos y los tensioactivos que const...

  6. Pärast kõike / intervjueerinud Veiko Märka

    Index Scriptorium Estoniae

    1998-01-01

    Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar

  7. Eeslid / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2003-01-01

    Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'

  8. Turundusteenistus / Ain Kaljurand

    Index Scriptorium Estoniae

    Kaljurand, Ain, 1965-

    2004-01-01

    Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

  9. A comparative study of solvent and supercritical Co2 extraction of Simarouba gluaca seed oil; Estudio comparativo de la extracción con solvente y CO2 supercrítico de aceites de semillas de Simarouba glauca.

    Energy Technology Data Exchange (ETDEWEB)

    Anjaneyulu, B.; Satyannarayana, S.; Kanjilal, S.; Siddaiah, V.; Prasanna Rani, K.N.

    2017-07-01

    In the present study, the supercritical carbon dioxide (Co2) extraction of oil from Simarouba gluaca seeds was carried out at varying conditions of pressure (300–500 bar), temperature (50–70 °C) and CO2 flow rate (10–30 g·min-1). The extraction condition for maximum oil yield was obtained at 500 bar pressure, 70 °C and at 30 g·min-1 flow rate of CO2. The extracted oil was analyzed thoroughly for physico-chemical properties and compared with those of conventional solvent extracted oil. An interesting observation is a significant reduction in the phosphorus content of the oil (8.4 mg·kg-1) extracted using supercritical CO2 compared to the phosphorous content of the solvent extracted oil (97 mg·kg-1). Moreover, the content of total tocopherols in supercritically extracted oil (135.6 mg·kg-1) was found to be higher than the solvent extracted oil (111 mg·kg-1). The rest of the physico-chemical properties of the two differently extracted oils matched well with each other. The results indicated the possible benefits of supercritical CO2 extraction over solvent extraction of Simarouba gluaca seed oil. [Spanish] En el presente estudio se llevó a cabo la extracción con dióxido de carbono supercrítico (CO2) de aceites de semillas de Simarouba gluaca en diversas condiciones de presión (300–500 bar), temperatura (50–70 °C) y el caudal de CO2 (10–30 g·min-1). La condición de extracción para obtener el máximo rendimiento de aceite se obtuvo a una presión de 500 bares, una temperatura de 70 °C y un caudal de CO2 de 30 g·min-1. Al aceite extraido se determinó sus propiedades fisicoquímicas y se comparó con las del aceite extraído con disolvente convencional. Una observación interesante es la reducción significativa del contenido de fósforo (8,4 mg·kg-1) del aceite extraído utilizando CO2 supercrítico en comparación con el del aceite extraído con disolvente (97 mg·kg-1). Además, el contenido de tocoferol total en el aceite extra

  10. Exegi monumentum ehk palee Tallinnas / Siim Sultson

    Index Scriptorium Estoniae

    Sultson, Siim

    2007-01-01

    Tallinnas Narva mnt. 7 endisest Tsentrosojuzprojektist ümber ehitatud Triumph Plazast (arhitektid Vilen Künnapu ja Ain Padrik). Maja kavandati 1981. a. büroohooneks (arhitektid Olga Bruns ja Mart Kalling). Kommenteerivad Mart Port, Dmitri Bruns, Kristiina Möldre ja Ain Padrik

  11. Automating the AFROTC Four-Year Scholarship Program.

    Science.gov (United States)

    1986-04-01

    ATCH 2 b1 C -d C4 4" %C N 0" cl4 es C4 CN 1 onin %DG C1 06 0 -0 40 V 44-4 LIU-4- c4 A: U. -4 La 4 E vt a-’ iv El "l 04 0 0.I t b U El 4 V do v 0 CoU. -4...CEEB CLAS~S BOARD 1ST 2ND DCF QEP/ STRT,"’ HWFADC CfI3; PEL SCORES SCORE COMP SCOPE STAND RAMK".,H~DC ’ PREF PREF RACE PREY" rTL B1 = 46/1 C hiroms...A/N 88 Fencing 4 AIN 89 La Crosse 4 AIN 90 Rifle/Pistol 4 AIN 91 Rugby 4 AIN 92 Track 4 A/N 93 Wrestling 4 A/N 94 Others (Name and Codes) 15 A/N 95

  12. Secretory leukocyte protease inhibitor expression and high-risk HPV infection in anal lesions of HIV positive patients

    Science.gov (United States)

    NUOVO, Gerard J.; GRINSZTEJN, Beatriz; FRIEDMAN, Ruth K.; VELOSO, Valdiléa G.; CUNHA, Cynthia B.; COUTINHO, José R.; VIANNA-ANDRADE, Cecilia; OLIVEIRA, Nathalia S.; WOODHAM, Andrew W.; DA SILVA, Diane M.; KAST, W. Martin

    2016-01-01

    Objective The aim of the current study was to evaluate secretory leukocyte protease inhibitor (SLPI) expression in anal biopsies from HIV-positive (HIV+) individuals, and compare that to anal intraepithelial neoplasia (AIN) diagnoses and human papillomavirus (HPV) status. Design This is a cross-sectional study of a cohort of 54 HIV+ (31 males and 23 females) from an AIDS clinic in Rio de Janeiro, Brazil. Methods The study material consisted of anorectal tissue biopsies obtained from HIV+ subjects, which were used to construct tissue microarray paraffin blocks for immunohistochemical analysis of SLPI expression. Biopsies were evaluated by an expert pathologist and classified as low-grade anal intraepithelial neoplasia (AIN1), high-grade anal intraepithelial neoplasia (AIN2/3), or normal squamous epithelium. Additionally, DNA from the biopsies was extracted and analyzed for the presence of low- or high-risk HPV DNA. Results Histologically normal squamous epithelium from the anorectal region showed strong positive SLPI staining in 17/20 (85%) samples. In comparison, 9/17 (53%) dysplastic squamous epithelial samples from AIN1 patients showed strong SLPI staining, and only 5/17 (29%) samples from AIN2-3 patients exhibited strong SPLI staining, which both were significantly fewer than those from normal tissue (p=0.005). Furthermore, there was a significantly higher proportion of samples in which oncogenic high-risk HPV genotypes were detected in low SLPI expressing tissues than that in tissues with high SLPI expression (p=0.040). Conclusion Taken together these results suggest that low SLPI expression is associated with high-risk HPV infections in the development of AIN. PMID:27149102

  13. One lesion, one virus: individual components of high-grade anal intraepithelial neoplasia in HIV-positive men contain a single HPV type

    NARCIS (Netherlands)

    Richel, Olivier; Quint, Koen D.; Lindeman, Jan; van Noesel, Carel J. M.; de Koning, Maurits N. C.; van den Munckhof, Henk A. M.; de Vries, Henry J. C.; Prins, Jan M.; Quint, Wim G. V.

    2014-01-01

    High-grade anal intraepithelial neoplasia (AIN) is present in many human immunodeficiency virus (HIV)-positive men who have sex with men. The major etiologic factor is infection with an oncogenic human papillomavirus (HPV) genotype. We investigated whether individual components of high-grade AIN are

  14. Avaliação do perfil antiinflamatório e analgésico, e dos efeitos colaterais da administração oral de meloxicam em equinos: avaliação física, laboratorial e gastroscópica

    OpenAIRE

    Veronezi, Regina de Cássia [UNESP

    2007-01-01

    Os antiinflamatórios não esteroidais (AINEs) são rotineiramente usados na medicina eqüina como analgésicos e antiinflamatórios, sendo potentes controladores da dor. Entretanto, estes fármacos provocam alguns efeitos indesejáveis, como por exemplo, lesões renais e gastrointestinais. Os efeitos adversos dos AINEs ocorrem com a inibição da COX-1, enquanto os efeitos benéficos são observados com a inibição da enzima COX-2. Com o surgimento dos AINEs seletivos para COX-2, os efeitos adversos são c...

  15. Graphene–poly(5-aminoindole) composite film as Pt catalyst support for methanol electrooxidation in alkaline medium

    International Nuclear Information System (INIS)

    Yue, Ruirui; Zhang, Qiang; Wang, Caiqin; Du, Yukou; Yang, Ping; Xu, Jingkun

    2013-01-01

    Highlights: • Electropolymerization of 5-aminoindole (AIn) in the presence of graphene (GE). • Significant catalytic effect of GE on the polymerization of AIn. • PAIn/GE/GC used as Pt catalyst support. • The enhanced catalytic activity of Pt/PAIn/GE/GC for methanol electrooxidation. -- Abstract: 5-Aminoindole (AIn) was electropolymerized on graphene (GE) modified glass carbon (GC) electrode in 0.5 M H 2 SO 4 aqueous solution containing 0.01 M AIn. Because of the catalytic effect of GE, the polymerization efficiency of AIn and the electrochemical activity of as-formed poly(5-aminoindole) (PAIn) were significantly improved on GE/GC electrode as compared to that on the bare GC electrode. The prepared PAIn/GE/GC electrode was used as substrate for Pt particle electrodeposition. SEM, EDX and Raman spectral were used to characterize the prepared electrodes. Electrocatalytic experiments demonstrate that the Pt/PAIn/GE/GC electrode possesses high catalytic activity toward methanol electrooxidation in alkaline medium, due to the good dispersion of Pt particles on PAIn/GE/GC and the electronic interactions between the metal particles and the polymer matrixes. Thus, PAIn can be a promising alternative for polymeric catalyst support in direct alcohol fuel cells

  16. Qualidade de vida de usuários do sistema público de saúde em uso de varfarina

    Directory of Open Access Journals (Sweden)

    Jaqueline Dalpiaz

    2017-08-01

    Full Text Available Justificativa e Objetivos: A varfarina é o agente anticoagulante oral cujo tratamento requer cuidados que podem interferir na qualidade de vida. Este estudo tem como objetivo avaliar a qualidade de vida de usuários de varfarina do sistema público segundo o método Duke Anticoagulation Satisfaction Scale (DASS. Métodos: Para a avaliação da qualidade de vida utilizou-se o método DASS, a esse instrumento foram acrescentadas questões para avaliação sociodemográfica e do tempo de uso de varfarina. Este trabalho possui aprovação no comite de ética da UNIJUÍ sob parece numero 875.206/2014. Resultados: Foram entrevistados 49 usuários, 53,06% do sexo masculino, sendo a idade média 63,16 ±13,18 anos. 65,31% dos usuários possuem ensino fundamental incompleto e a renda declarada com mais frequência pelos entrevistados foi de um salário mínimo. No domínio total de DASS o resultado encontrado foi de 71,85 ± 18,48, menores valores refletem maior qualidade de vida e maior satisfação com o uso do anticoagulante, os menores valores foram encontrados no domínio limitações com, 19,20 ±8,59, variando de 9 a 63, já os maiores valores foram encontrados no domínio impacto psicológico, com média de 32,87 ±6,55, variando de 8 a 56. Não foram encontrados significância estatística da qualidade de vida com as características demográficas e clínicas, observando-se significância apenas quanto ao tempo de uso de anticoagulante, sendo que pacientes que fazem uso há mais tempo apresentam pior qualidade de vida. Conclusão: Observou-se que os usuários do presente estudo apresentaram baixa qualidade de vida necessitando o desenvolvimento de estratégias para auxiliar esses pacientes.

  17. Trends in incidence of anal cancer and high-grade anal intraepithelial neoplasia in Denmark, 1978-2008

    DEFF Research Database (Denmark)

    Nielsen, Ann; Plum, Christian Edinger Munk; Kjaer, Susanne K

    2012-01-01

    The aim of the study was to determine the incidences of anal cancer and high-grade anal intraepithelial neoplasia (AIN2/3) over time in Danish women and men. Describing the burden of anal cancer and AIN may be valuable in future evaluations of the human papillomavirus (HPV) vaccine. We included all...... anal cancers in the Danish Cancer Register in the period 1978-2008 and all cases of AIN2/3 in the Danish Registry of Pathology. Overall and age-, period- and histology-specific incidence rates were estimated. During the 30-year period, 2187 anal cancers were identified, two thirds of which were...... in women. Between 1978-1982 and 2003-2008, the age-standardized incidence rate of anal cancer increased from 0.68 to 1.48 per 100 000 person-years in women and from 0.45 to 0.80 per 100 000 person-years in men. Although there is no systematic screening for AIN in Denmark, we nevertheless identified 608...

  18. Surface morphology of Al0.3Ga0.7N/Al2O3-high electron mobility transistor structure.

    Science.gov (United States)

    Cörekçi, S; Usanmaz, D; Tekeli, Z; Cakmak, M; Ozçelik, S; Ozbay, E

    2008-02-01

    We present surface properties of buffer films (AIN and GaN) and Al0.3Gao.zN/Al2O3-High Electron Mobility Transistor (HEMT) structures with/without AIN interlayer grown on High Temperature (HT)-AIN buffer/Al2O3 substrate and Al2O3 substrate. We have found that the GaN surface morphology is step-flow in character and the density of dislocations was about 10(8)-10(9) cm(-2). The AFM measurements also exhibited that the presence of atomic steps with large lateral step dimension and the surface of samples was smooth. The lateral step sizes are in the range of 100-250 nm. The typical rms values of HEMT structures were found as 0.27, 0.30, and 0.70 nm. HT-AIN buffer layer can have a significant impact on the surface morphology of Al0.3Ga0.7N/Al2O3-HEMT structures.

  19. Tunable magnetic properties by interfacial manipulation of L1(0)-FePt perpendicular ultrathin film with island-like structures.

    Science.gov (United States)

    Feng, C; Wang, S G; Yang, M Y; Zhang, E; Zhan, Q; Jiang, Y; Li, B H; Yu, G H

    2012-02-01

    Based on interfacial manipulation of the MgO single crystal substrate and non-magnetic AIN compound, a L1(0)-FePt perpendicular ultrathin film with the structure of MgO/FePt-AIN/Ta was designed, prepared, and investigated. The film is comprised of L1(0)-FePt "magnetic islands," which exhibits a perpendicular magnetic anisotropy (PMA), tunable coercivity (Hc), and interparticle exchange coupling (IEC). The MgO substrate promotes PMA of the film because of interfacial control of the FePt lattice orientation. The AIN compound is doped to increase the difference of surface energy between FePt layer and MgO substrate and to suppress the growth of FePt grains, which takes control of island growth mode of FePt atoms. The AIN compound also acts as isolator of L1(0)-FePt islands to pin the sites of FePt domains, resulting in the tunability of Hc and IEC of the films.

  20. Pap smears for men: a vision of the future?

    LENUS (Irish Health Repository)

    Oon, S F

    2012-02-01

    BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.

  1. Hypothyroidism could be the only manifestation of mitochondrial ...

    African Journals Online (AJOL)

    Hoda Tomoum

    2012-11-24

    Nov 24, 2012 ... Hypothyroidism could be the only manifestation of mitochondrial T8993C mutation in Leigh syndrome. Hoda Tomoum a. , Solaf M. Elsayed b,. *, Elizabeth Berry-Kravis c a Department of Pediatrics, Ain Shams University, Cairo, Egypt b Genetics Unit, Department of Pediatrics, Ain Shams University, Cairo, ...

  2. AVALIAÇÃO DA DISPENSAÇÃO DE FÁRMACOS PARCIALMENTE SELETIVOS PARA COX-2

    Directory of Open Access Journals (Sweden)

    Cícero Cardoso VALLE FILHO

    2015-12-01

    Full Text Available Uma pesquisa foi realizada com o objetivo de avaliar um potencial aumento na venda de fármacos anti-inflamatórios não esteroidais (AINEs parcialmente seletivos para a COX-2 durante o período de julho de 2009 a junho de 2011, em uma drogaria localizada no município de Itaperuna, estado do Rio de Janeiro. Durante o período estudado foi dispensado um total de 802 AINEs parcialmente seletivos para a COX-2, dentre os quais 59,85% foram de nimesulida, 5,74% de etodolaco e 34,41% de meloxicam.   No primeiro semestre avaliado a dispensação total de AINEs parcialmente seletivos foi equivalente a 92, no segundo semestre a dispensação total foi equivalente a 159, no terceiro semestre a dispensação total foi de 219 AINEs parcialmente seletivos para COX-2 e no quarto semestre foram dispensados 332.  Os resultados indicaram maior dispensação dos medicamentos desta classe no mês de abril de 2011 sendo que tanto a nimesulida, quanto o meloxicam e o etodolaco foram mais dispensados no último semestre do estudo. De acordo com a metodologia utilizada pode-se concluir que a dispensação dos AINEs parcialmente seletivos vem crescendo a cada ano e que a nimesulida apresenta o maior índice de crescimento; a maior indicação da nimesulida tem sido para crianças; os meses correspondentes ao período de inverno apresentam maior dispensação de AINEs parcialmente seletivos para a COX-2.

  3. Equipo Portátil para Análisis Químicos del Suelo

    Directory of Open Access Journals (Sweden)

    Jaramillo Madarriaga G.

    1939-12-01

    Full Text Available En estos últimos años, principalmente en los Estados Unidos, ha surgido una gran variedad de equipos portátiles para el examen rápido de suelos, basados la mayor parte en reacciones calorimétricas para fósforo, potasio, nitratos y algunos otros elementos considerados de importancia para la vida de la planta. El factor que determina la gran variedad de resultados obtenidos con tales equipos es la naturaleza del disolvente empleado para extraer los elementos de la muestra de suelo, disolvente que consiste, por lo general en soluciones de distinta concentración de ácido clorhídrico, sulfúrico, acético. etc. Si se admite que estos exámenes rápidos en el campo pueden ser útiles en países donde los agricultores cuentan con grandes facilidades para hacer verificar análisis completes de sus tierras, con mayor razón debemos admitir que en nuestro país, donde no abundan los laboratorios especializados, los equipos portátiles son casi una necesidad para la orientación de los agrónomos oficiales que operan en regiones apartadas. Debido a esto, la Facultad Nacional de Agronomía se ha interesado en el desarrollo de un equipo portátil lo más compacto posible para el uso de los agrónomos.

  4. Hydrogeological and isotopic studies for selected springs in Sinai Peninsula

    Energy Technology Data Exchange (ETDEWEB)

    Hamza, M S; Awad, M A; El-gamal, S A [Atomic Energy Authority, Cairo Egypt and Middle Eastern Regional Radioisotope Center for The Arab Countries, Dokki, 12311, Cairo (Egypt); Hammad, F A [Desert Research Centre, Materia, Cairo, (Egypt)

    1995-10-01

    This paper deals with the hydrogeology and isotopic composition of water samples collected from selected spring in sinai (e.g. Algudierate, Alqusiema, qidis and Isram) in order to identify their genesis, their interaction with the host rocks and mixing trend. Results of isotopic composition have indicated the similarity in the hydrogeologic situation of Ain qidis and Ain-al-gudierate, while Ain Isram has shown a marked difference in its stable isotope and this could be due to evaporation effect. The isotopic and hydrochemical constituents of the studied springs reflect eater of a meteoric origin with a possible contamination from surficial materials (evaporates) and deeper aquifers. 6 figs., 2 tabs.

  5. Ressources et partage de l'eau dans l'oasis de Kenadsa (Sud-Ouest Algerien; approche historique et constat

    Directory of Open Access Journals (Sweden)

    YOUCEF BENMOUSSA

    2015-07-01

    Full Text Available Resources And Water Sharing In The Oasis Of Kenadsa (Southwest Algeria; Historical Approach And Findings. Kenadsa, a peaceable oasis in southwestern Algeria, with the discovery and exploitation of coal (1917 - 1956, underwent graft of Western models for its development. That has cleared the oasis of the spatial dimension and tr ansformed into a mining village by excellence. These networks of foggaras draining groundwater, enclosed in a multilayer aquifer, which becomes free on the northern border of the Ksar. There were 25 foggaras of sources (Ain, each of which had its own drai nage channels to downstream gardens of Ksar. The distribution of water from these sources was ensured by a complex network, fed by drainage galleries that meander the alleys of Ksar and gives place to access points for domestic uses. The right to water is generally private property; one could dispose of according to modes of transmission of a property. It’s sharing for irrigation is governed by the volume and time. Currently, only some ten foggaras of sources that are still alive (Ain Sidi Mbarek, Ain Dir, Belkaid Ain, Ain Sheikh ..... These waters are characterized by mediocre quality (pH 7.31, CE: 4.88 ms / cm, RS 2420 mg / l Ca ++: 288.2 mg / l, SO4 -- : 468 83 mg / l..

  6. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Laboratoire de Physique Fondamentale et Applique (LPFA), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 Mâarif, Casablanca, Maroc; Laboratoire de Physique des Matériaux, Micro-électronique, Automatique et Thermique (LPMMAT), Faculté des Sciences Ain Chock, Université Hassan II, B.P. 5366 ...

  7. Kinetics and Mechanism of the Iron(II-Iron(III) Electron-Exchange Reaction in Mixed Solvent Media; Cinetique et Mecanisme de l'Echange d'Electrons entre Fer (II) et Fer (III), dans des Melanges de Solvants; Ikinetika i mekhanizm reaktsii ehlektronnogo obmena zheleza (I) - zheleza (III) v smeshannoj rastvoryayushchej srede; Cinetica y Mecanismo del Intercambio de Electrones Entre Fe{sup II} Y Fe{sup lII} en Mezclas de Disolventes

    Energy Technology Data Exchange (ETDEWEB)

    Horne, R. A. [Arthur D. Little, Inc. Cambridge, MA (United States)

    1965-10-15

    de intercambio electronico entre Fe{sup II} y Fe{sup III} a diversas temperaturas, grados de acidez y fuerzas ionicas, en soluciones de aguaacetona, agua-metanol y agua-etanol. La velocidad de reaccion disminuye apreciablemente al aumentar la concentracion de agua en el ultimo de estos sistemas, tendiendo a cero con la concentracion. La energfa de activacion del intercambio es la misma en mezclas de disolventes que en solucion acuosa. La constante dielectrica efectiva que interviene entre los reactivos sigue siendo la misma que en agua pura, incluso par a soluciones en agua-etanol bastante pobres en agua. Las mediciones espectroscopicas y del intercambio electronico reflejan las alteraciones de la composicion de la vaina de solvatacion del Fe{sup III} en disolventes mixtos. Estos resultados corroboran la teoria de que el intercambio electronico se efectua por intermedio de puentes agua. (author) [Russian] Byli izmereny udel'nye kon stanty skorosti reakcii jelektronnogo obmena Fe{sup II} - Fe{sup III} n pri razlichnyh temperaturah kislotnostjah i ionnyh silah v sredah: voda - aceton, voda - metanal i voda - jetanol. Sko rost' reakcii zametno snizhaetsja s umen'sheniem koncentracii vody v poslednej sistem i priblizhaetsja k nulju, kogda koncentracija vody priblizhaetsja k nulju. Jenergija aktivaci obmena javljaetsja toj zhe samoj v.smeshannom rastvore, kak i v vodnom rastvore. Jeffektiv naja dijelektricheskaja konstanta, kotoruju 'vidjat' reagirujushhie veshhestva, prodolzhaet byt konstantoj chistoj vody dazhe v rastvorah - jetanol, vpolne rastvorimyh v vode. Iz menenija v sostave obolochki sol'vatacii Fe{sup III} v smeshannoj srede otrazhajutsja kak v jelek tronnom obmene, tak i v spektroskopicheskih izmerenijah. Jeti vyvody, poluchennye na osnov rezul'tatov v smeshannoj rastvorjajushhej srede, podtverzhdajut teoriju vodjanogo mostika pr jelektronnom obmene. (author)

  8. Phospholipid Syndrome and Vasculitis as a presentation of Systemic Lupus Erythematosus. Case report.

    Directory of Open Access Journals (Sweden)

    Sila Castellón Mortera

    2013-09-01

    Full Text Available The systemic Lupus Erythematosus is presented, generally, as a poli articular syndrome, with a long period of fever nephritico or nephrotico; other clinical ways are: neuropsychiatry, vasculitis, etc. They appeared in a progressive manner; but in rare cases as a sickness debutant. It has not being reported in Sancti Spiritus Province patients in which matches the debut of the systemic Lupus Erythematosus with the manifestations of phospholipid syndrome. A Woman with 24 years of age is hospitalized having vasculitis, articular pains, thrombose in her right foot, detecting anticoagulante lupico and possitive Rematoideo factor with periferic pattern diffused in the Inmunoelectroforesis. 5 years later was hospitalized again with poliserositis. She had a positive evolution with a dose in a month of Intacglobin and anticoagulante treatment. Two years later she was hospitalized with articular pains proving she had livedo reticular on her left knee and Raynaud phenomenon on her foot. Beta Prebeta Index and high triglycerides. Lupico anticoagulant positive again. A treatment with Intacglobin and Prednisona was given to the patient with a better clinic without being hospitalized again. There is no evidence (at 17 years of age of a sickness debut of renal dissorder. It is about a Systemic Lupus Eritematoso which debut was a vasculitis and a Phospholipid Syndrome associated.

  9. A Strong Impact of Genetic Background on Gut Microflora in Mice

    Directory of Open Access Journals (Sweden)

    R. Steven Esworthy

    2010-01-01

    Full Text Available Genetic background affects susceptibility to ileocolitis in mice deficient in two intracellular glutathione peroxidases, GPx1 and GPx2. The C57BL/6 (B6 GPx1/2 double-knockout (DKO mice have mild ileocolitis, and 129S1/Sv (129 DKO mice have severe inflammation. We used diet to modulate ileocolitis; a casein-based defined diet with AIN76A micronutrients (AIN attenuates inflammation compared to conventional LabDiets. Because luminal microbiota induce DKO ileocolitis, we assessed bacterial composition with automated ribosomal intergenic-spacer analysis (ARISA on cecal DNA. We found that mouse strain had the strongest impact on the composition of microbiota than diet and GPx genotypes. In comparing AIN and LabDiet, DKO mice were more resistant to change than the non-DKO or WT mice. However, supplementing yeast and inulin to AIN diet greatly altered microflora profiles in the DKO mice. From 129 DKO strictly, we found overgrowth of Escherichia coli. We conclude that genetic background predisposes mice to colonization of potentially pathogenic E. coli.

  10. Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis

    Directory of Open Access Journals (Sweden)

    Moreno A.

    2003-01-01

    Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 ? (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.

  11. Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste?

    Directory of Open Access Journals (Sweden)

    Luciano Passamani Diogo

    Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.

  12. Equilibrio entre fases para la aplicación de solventes verdes en tecnología de alimentos

    OpenAIRE

    Hernández, Elvis J.

    2010-01-01

    [ES]: En este trabajo se presentan los resultados obtenidos del estudio (experimental y teórico) del equilibrio entre fases de compuestos alimentarios y solventes verdes, aportando nuevos resultados a los fundamentos de los procesos de separación por contacto en equilibrio de la tecnología de alimentos. Se obtuvieron nuevos datos de equilibrio entre fases, aplicando métodos experimentales a altas presiones (equilibrio líquido – fluido supercrítico, para el disolvente dióxido de carbono) y ...

  13. Comportamiento electroquímico de colorantes antraquinónicos en solución de solventes orgánicos

    OpenAIRE

    Martínez Suárez, Jaime Fernando; Caram, José Alberto; Mirífico, María Virginia

    2016-01-01

    Se analizaron las condiciones en que varios colorantes antraquinónicos Alizarina (ALZ), Purpurina (PP) y Ácido Carmínico (AC) pueden ser transformados electroquímicamente por voltamperometría cíclica. Se observo numerosos procesos electrorreducción y electro-oxidación en condiciones neutras, ácidas y básicas en varios disolventes. Para el sistema ALZ/DMF, se propone un mecanismo probable. El número, la corriente y el potencial de los procesos observados pueden ser racionalizados sobre la base...

  14. Determinación de bismuto por flotación de un par iónico con ioduro y rivanol.

    OpenAIRE

    López Erroz, Carmen; Hernández Córdoba, Manuel

    1987-01-01

    El Bi{III) origina complejos aniónicos con ligandos inorgánicos, preferentemente ioduro y tiocianato, que son extraíbles en los disolventes orgánicos. Utilizando esta propiedad se han derivado aplicaciones analíticas para la determinación del ion metálico, generalmente mediante el empleo de la técnica espectrofotométrica. La sensibilidad de estos procedimientos no es elevada, pero puede aumentarse si el complejo aniónico de bismuto se extrae como un compuesto d...

  15. Exposición laboral a solventes en empresas afiliadas a una administradora de riesgos laborales 2011 - 2014

    OpenAIRE

    Martínez Toro, Aixa Liliana; Madrigal, Diana Marcela

    2016-01-01

    Introducción: En Colombia la exposición a solventes orgánicos se ha caracterizado como un problema de Salud Pública, por la gran utilización en la industria, por las formas inapropiadas de manipulación y disposición de estos productos, los cuales generan contaminación ambiental y laboral. Los solventes o disolventes más utilizados industrialmente son Benceno, Xileno, Tolueno y Estireno (Hidrocarburos Aromáticos) los cuales pueden producir graves efectos sobre la salud. Objetivo: Caracterizar ...

  16. Análisis de la actividad antioxidante de las nueces y su relación con la prevención de la enfermedad de Alzheimer

    OpenAIRE

    Badía de Antonio, Laura

    2017-01-01

    El objetivo de este trabajo es determinar y comparar el contenido total de polifenoles, la capacidad antirradicalaria, los ácidos grasos y la vitamina E de cinco nueces de diferente origen; optimizar el proceso de extracción y realizar una búsqueda bibliográfica que relacione las propiedades de las nueces con la prevención de la enfermedad Alzheimer. Las extracciones se realizan por triplicado y con dos disolventes distintos, agua y etanol/agua (1:1, v/v). Mediante el ensayo Fo...

  17. Anaerobic biodegradation of solvents from the packaging industry: study and enhancement

    OpenAIRE

    Vermorel, Nadine

    2017-01-01

    Con el desarrollo de la política ambiental de la Unión Europea, la calidad del aire en Europa ha mejorado considerablemente. No obstante, la contaminación atmosférica continúa siendo importante lo que hace necesario el desarrollo continuo de soluciones tecnológicas de depuración del aire para mitigar los problemas de calidad ambiental. Con objeto de preservar el medio ambiente y evitar problemas de salud pública, las emisiones industriales de disolventes están estrictamente ...

  18. Control of volatile organic compounds from air emissions by anaerobic bioscrubber: process performance and process simulation

    OpenAIRE

    Bravo Martínez, Daniel

    2017-01-01

    La contaminación atmosférica es un problema para la salud humana y para el medio ambiente. Dentro de los posibles contaminantes atmosféricos, los compuestos orgánicos volátiles son una de las causas asociadas al empeoramiento de la calidad ambiental. Una gran parte de estos compuestos son emitidos a la atmosfera por industrias que utilizan disolventes en su proceso productivo, estando reguladas estas emisiones industriales por la Directiva Europea de Emisiones Industriales (2010/75/EU). La in...

  19. Heparinoides naturais isolados de rodofíceas (Halymenia sp. arribadas na costa cearense - doi: 10.4025/actascibiolsci.v32i3.6282 Natural heparinoids isolated from Halymenia sp. (Rhodophyceaes delivery on the Ceará coast - doi: 10.4025/actascibiolsci.v32i3.6282

    Directory of Open Access Journals (Sweden)

    Wladimir Ronald Lobo Farias

    2010-09-01

    Full Text Available A crescente carência de heparina (HEP motiva a busca por fontes alternativas de novos anticoagulantes naturais. Objetivou-se avaliar a atividade anticoagulante dos polissacarídeos sulfatados (PS isolados de uma rodofícea do gênero Halymenia, nativa do litoral cearense, Brasil. Os PS totais foram obtidos por digestões consecutivas com papaína em tampão acetato de sódio 0,1 M (pH 5,0, contendo cisteína 5 mM e EDTA 5 mM, seguidas por cromatografia de troca iônica em coluna de DEAE-celulose. As frações obtidas foram concentradas por liofilização e submetidas à eletroforese em gel de agarose a 0,5%. Os ensaios anticoagulantes foram realizados pelo tempo de tromboplastina parcial ativada (TTPA, usando-se plasma de coelho e uma curva padrão de HEP (100 UI MG-1. As extrações (53,96% mostraram diferenças marcantes durante o fracionamento e no grau de resolução dos PS. A espécie apresentou PS com atividade anticoagulante superior a HEP. O TTPA das frações modificou-se acentuadamente entre as extrações, expressando-se de maneira dose-dependente e sofrendo um acréscimo de 110,40 (1ª extração para 143,10 UI MG-1 (3ª extração. Os resultados sugerem que a atividade anticoagulante dos PS isolados de Halymenia sp. foi promovida pela inibição da via intrínseca e/ou comum da cascata de coagulação. As modificações no TTPA possivelmente serão elucidadas pelos mecanismos de ação envolvidos na coagulação e caracterização estrutural desses compostos. Portanto, a rodofícea Halymenia sp. é uma boa fonte de heparinoides e sugerem-se estudos relacionados ao cultivo da espécie, em proteção aos bancos de algas.The increasing demand for heparin (HEP has led to a search for alternative sources of natural anticoagulants. This study aimed to evaluate the anticoagulant activity of sulfated polysaccharides (SP isolated from a Halymenia rhodophyceae genus native to the coast of Ceará, Brazil. Total SP were obtained by consecutive

  20. Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe

    Index Scriptorium Estoniae

    Mäe, Aarne, 1967-

    2008-01-01

    7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"

  1. Pose de la première pierre du bâtiment SMA18 du Cern

    CERN Multimedia

    CERN Press Office. Geneva

    1999-01-01

    On 30 April 1999, Jean Pépin, Sénateur for the Department of the Ain and President of the Conseil Général, and Professor Luciano Maiani the Director-General of CERN will lay the foundation stone of Building SMA18, financed by the Department of the Ain in the framework of France's special contribution to CERN's Large Hadron Collider (LHC) project.

  2. Hirm, raha ja armastus / Margot Visnap, Kadi Herkül, Immo Mihkelson

    Index Scriptorium Estoniae

    Visnap, Margot, 1959-

    1999-01-01

    Teleteatri aastaringist - ETV kaheksa lavastust seitsmelt lavastajalt : Toomas Hussar/Ervin Õunapuu "Linnapea ehk Hirmu põhivormid". Rezh. T. Hussar. Eetris 1. jaan. 1998; A.H. Tammsaare/Ain Prosa "Ma armastasin sakslast". Rezh. A. Prosa. Eetris 24. veebr. 1998; Dennis Potter "Sa oled koor minu kohvis". Rezh. Vilja Palm. Eetris 1. jaan. 1999; Ain Prosa/Karl Ristikivi "lihtne lugu, lõpuga". Rezh. Ain Prosa. Eetris 28. nov. 1998; Betti Alver/Margus Kasterpalu "Tuulearmuke". Rezh. Elo Selirand. Eetris 23. mail 1998; Faama Filmi ja ETV teleteatri koostöö "Isa", sts. ja rezh. Mart Kivastik. Eetris 28. märtsil 1998; "Lilled Leale", sts. ja rezh. Olle Mirme Toomas Vindi novelli põhjal; Rein Saluri "Andke neile andeks", lav. Talvo Pabut. Eetris 19. okt. 1998

  3. Studies on drying kinetics of olive foot cake

    Directory of Open Access Journals (Sweden)

    Hamlat, M. S.

    2002-06-01

    Full Text Available The olive foot cake is a very important by-product of olive oil industry since it can contain until 12 % of oil which can be extracted using solvent. The used solvent is often immiscible with water. This is the reason why its effect is limited by the moisture of olive foot cake making its drying imperative. In this paper, we present the behaviour of olive foot cake subjected to convective drying. The experimental results show that the drying rate versus moisture presents only one period of decreasing rate. The influence of the main parameters on drying kinetics is studied.El orujo es un importante subproducto de la industria del aceite de oliva ya que puede contener hasta el 12 % del aceite, el cual puede ser extraído usando un disolvente apropiado. El uso del disolvente es a menudo inmiscible con el agua. Esta es la razón por la que su efecto está limitado por la humedad del orujo, haciendo su secado imperativo. En este artículo se presenta el comportamiento del orujo sometido a un secado por convección. Los resultados experimentales mostraron que la velocidad de secado frente a la humedad, presenta un solo período de disminución de dicha velocidad. Se ha estudiado la influencia de los principales parámetros sobre la cinética de secado.

  4. Caracterización del aceite de germen de trigo extraído con dióxido de carbono líquido y supercrítico.

    Directory of Open Access Journals (Sweden)

    Molero Gómez, A.

    1997-04-01

    Full Text Available In this work the quality of wheat germ oil obtained by extraction with liquid and supercritical carbon dioxide was studied. At the optimum operating conditions, the yield of supercritical extraction is similar to the conventional extraction by organic solvent, but the quality of the wheat germ oil extracted by supercritical carbon dioxide is higher. Furthermore, supercritical extraction could be more economical than organic extraction because the solvent removal by distillation is not necessary and several steps of the following oil refining process can be simplified.

    En el presente trabajo se realiza un estudio de la calidad del aceite de germen de trigo obtenido mediante la extracción con dióxido de carbono a alta presión. En las condiciones operativas óptimas del proceso, el rendimiento de la extracción con dióxido de carbono líquido y supercrítico es similar al de la extracción con disolventes orgánicos, si bien la calidad del aceite obtenido es superior. De ello se desprende el hecho de que el proceso de extracción utilizando dióxido de carbono, en condiciones sub- y supercríticas, puede resultar competitivo con el convencional al simplificar sustancialmente las etapas de refinado del aceite y eliminar la destilación del disolvente, las más costosas desde el punto de vista energético.

  5. Concentração de anticoagulante, tempo e temperatura de armazenagem sobre os parâmetros hematológicos no hemograma automatizado Anticoagulant concentration, time and storage temperature on hematological parameters in automated blood count

    Directory of Open Access Journals (Sweden)

    Aécio Carlos de Oliveira

    2010-12-01

    Full Text Available O estudo teve como objetivo identificar os efeitos do tempo de estocagem, da temperatura de armazenamento e da quantidade de anticoagulante sobre parâmetros hematológicos de cães. Foram utilizadas amostras do sangue de dez cães de raças variadas, clinicamente hígidos. As alíquotas foram colhidas com 1,8mg; 3,6mg; 7,2mg e 14,4mg de ácido etilenodiaminotetracético (EDTA por mL de sangue, distribuídas em dois grupos: de 2°C a 8°C e temperatura ambiente. Após a coleta, foram avaliadas em quatro tempos: 0, 12, 24 e 48 horas. Usando um contador automático de células, foram avaliados leucócitos, eritrócitos, hemoglobina, hematócrito, volume corpuscular médio (VCM, índice de anisocitose eritrocitária (RDW, plaquetas e plaquetócrito (PCT. O valor do VCM diminuiu nas maiores concentrações de EDTA (7,2mg mL-1 e 14,4mg mL-1, com decréscimo de 2,36% na maior concentração. A temperatura e o tempo de armazenagem também ocasionaram alteração nesse parâmetro, ou seja, houve decréscimo no tempo 12 horas à temperatura de 2 a 8°C e aumento nos tempos 24 e 48 horas à temperatura ambiente (PThe study aimed to identify the effects of time, temperature of storage and excess of anticoagulant on hematological parameters of dogs. Blood samples of ten, clinically healthy dogs, of different breeds were utilized. Aliquots were stored with 1.8mg, 3.6mg, 7.2mg and 14.4mg of ethylenediaminetetraacetic acid (EDTA per mL of blood, divided into two groups: 2°C to 8°C and room temperature. Right after collection, they were evaluated in four times: 0h, 12h, 24h and 48h. White blood cells, red blood cells, hemoglobin, packed cell volume (PCV, mean corpuscular volume (MCV, red cell distribution width (RDW, platelet and thrombocrit (PCT were evaluated in the automatic cell counter. In the automatic cell counter analysis, the MCV increased significantly with higher concentrations of EDTA (7.2mg mL-1 and 14.4mg mL-1 peaking at 2.36%, in the highest

  6. Rahvusvaheline turismikonverents / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2011-01-01

    Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist

  7. Consent ain't anything

    DEFF Research Database (Denmark)

    Di Nucci, Ezio

    2016-01-01

    I argue against various versions of the 'attitude' view of consent and of the 'action' view of consent: I show that neither an attitude nor an action is either necessary or sufficient for consent. I then put forward a different view of consent based on the idea that, given a legitimate epistemic ...

  8. Keelatud ained / Ave Oit

    Index Scriptorium Estoniae

    Oit, Ave

    2012-01-01

    Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

  9. Estudio farmacoepidemiológico de uso de antiinflamatorios no esteroideos en pacientes de alto riesgo cardiovascular

    Directory of Open Access Journals (Sweden)

    Jorge Enrique Machado-Alba

    Full Text Available Con el objetivo de determinar la frecuencia de uso prolongado de antiinflamatorios no esteroideos (AINES en pacientes colombianos de alto riesgo cardiovascular (ARC se desarrolló un estudio retrospectivo en el cual se identificaron pacientes de ARC que usaron AINES por más de cinco meses continuos entre enero de 2011 y marzo de 2013. Se identificó a los pacientes que recibían crónicamente nitratos, digitálicos, y clopidogrel y ácido acetil salicílico (ASA, quienes fueron identificados como de ARC. Se realizó un análisis de frecuencias de uso según la comedicación recibida. Se encontró uso concomitante de AINES en el 0,35% de los consumidores de nitratos (tiempo promedio: 9,5 ± 4,4 meses, en el 0,36% de los consumidores de clopidogrel y ASA (tiempo promedio: 9,3 ± 3,4 meses, y en el 0,4% de los consumidores de digitálicos (10,2 ± 4,6 meses. Se concluye que existe una baja proporción de uso de AINES de manera crónica en pacientes de alto riesgo cardiovascular.

  10. Tromboflebitis extensa como causa de fiebre insidiosa puerperal

    OpenAIRE

    Charco Roca, Luisa María; Bonmatí García, Lorena; Rubio Postigo, Gem

    2015-01-01

    Los eventos tromboembólicos son factores contribuyentes esenciales de morbilidad y mortalidad materna. La enfermedad tromboembólica complicada en el periodo puerperal a menudo se presenta con fiebre de causa desconocida y un dolor abdominal que puede confundirse con síntomas del postparto (1). El diagnostico de estos procesos deben hacerse por tomografía axial computerizada (TAC) (1,2). La terapia antiinflamatoria, antibiótica y anticoagulante oportuna y eficaz puede mejorar significativament...

  11. Síntesis de nuevos materiales para el desarrollo de sistemas de liberación controlada

    OpenAIRE

    Liván Alba-Gutierrez; Adolfo Brown-Gómez; Yeily Seruto-Milá; Mercedes Guerra-Rodríguez; Milaydis Reina-Hernández; Deborah Crespo-Zayas; Gretel Mieres-Balmaceda; Jorge L. García-González; Arelys Rodríguez-Padrón

    2011-01-01

    El estudio abarcó la síntesis y caracterización de materiales con potencialidades para su empleo en sistemas de liberación controlada (SLC) para el sector agrícola, incorporando derivados de la agroindustria azucarera cubana como celulosa microcristalina, acetato de celulosa y dextrana. Se utilizó una técnica de síntesis no convencional por medio de la irradiación ultrasónica que permitió la obtención de poliuretanos poco solubles en agua y en disolventes orgánicos como: dimetilsulfóxido, dim...

  12. Repercusiones multiorgánicas de la inhalación de alcohol isopropílico y cloruro de metileno como substancias de abuso

    OpenAIRE

    JC Trullás; S Nogué; O Miró; S Mondón; V Navarro; J Jou

    2005-01-01

    En España el consumo de substancias de abuso está muy extendido. Entre las drogas ilegales destaca, en el momento actual, la prevalencia de consumidores de cannabis, derivados anfetamínicos y cocaína. Los inhalables volátiles, como las colas, pegamentos, gasolina y disolventes, representan otra forma de consumo de drogas, pero que está poco arraigada en nuestro medio. Se presenta el caso de una mujer snifadora crónica de una laca para el pelo, que contenía alcohol isoprop...

  13. Immune profile and Epstein-Barr virus infection in acute interstitial nephritis: an immunohistochemical study in 78 patients.

    LENUS (Irish Health Repository)

    Mansur, Abdurrezagh

    2011-01-01

    Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.

  14. Efecto de la precipitación de nitruros de aluminio en la recristalización de aceros de bajo carbono recocidos convencionalmente

    Directory of Open Access Journals (Sweden)

    Monsalve, A.

    2005-10-01

    Full Text Available An important feature of aluminium killed steels is the strong influence that aluminium nitride precipitates produce in both the mechanical properties and the final microstructural characteristics of the steel. This influence is related to the different stages of the fabrication process. This paper deals with a study of the effects of aluminium nitrides on the kinetics of recrystallisation. Different heat treatments were carried out, in one case to dissolve AIN, and in the other in order to precipitate AIN. These steels were subjected to cold rolling, followed by a batch annealing process. The recrystallised fraction was measured, thus obtaining the kinetic curves. The activation energy for recrystallisation was computed in each case. The results showed that AIN precipitation during recrystallisation produces a delay in recrystallisation kinetics through a change in the activation energy value.

    Los aceros calmados con aluminio presentan como característica importante, la gran influencia que ejercen los nitruros de aluminio en las propiedades mecánicas y características microestructurales finales. Esta influencia está, a su vez, relacionada con cada una de la etapas del proceso de fabricación. En el presente trabajo se ha abordado el estudio del efecto de los nitruros de aluminio sobre la cinética de recristalización. Para ello, se han llevado a cabo diversos tipos de tratamientos térmicos, con el objeto de disolver todo el AIN y, en el otro caso, de precipitar todo el AIN. A continuación, los aceros estudiados se deformaron en frío y se les realizó un recocido convencional. Se midió la fracción recristalizada evaluando la energía de activación para la recristalización. Los resultados mostraron que la precipitación de AIN durante la recristalización produce un retraso en la cinética de recristalización, a través del cambio en el valor de la energía de activación

  15. Teatriekspressiga Äksist Põltsamaale / Riina Mägi

    Index Scriptorium Estoniae

    Mägi, Riina, 1957-

    2007-01-01

    Jõgevamaa harrastus- ja projektitruppide vabaõhulavastuste esietendustest 2006. aastal : Priit Aimla "Saadjärve saamise lugu" (Tabivere Harrastusteater, lavastaja Tõnis Lepp), Oskar Lutsu loomingust inspireeritud Veiko Märka "Sabani sõlmes Luts" (Palamuse Amatöörteater, lavastaja Raivo Adlas), Marina Carri "Kassirabal" projektitrupi esituses, lavastaja Ain Saviauk, Mati Tiku "Legend" (Saare Valla Metsateater, lavastaja autor), Ain Saviaugu "Ulm ehk Unistus Liivimaast" (Põltsamaa teater Ellunäod, lavastaja autor)

  16. O que devemos saber sobre a anticoagulação em portadores de doença valvar e fibrilação atrial - parte 1

    Directory of Open Access Journals (Sweden)

    Paulo de Lara Lavítola

    2010-03-01

    Full Text Available A indicação do anticoagulante oral é frequente nos pacientes com fibrilação atrial e disfunção valvar operados ou não. É tratamento prolongado e seu manuseio ao longo do tempo é complexo por estar atrelado a normas muitas vezes difíceis de serem obedecidas. Sua suspensão diante de procedimentos cirúrgicos é motivo de preocupação, aumentando ainda mais a complexidade do tratamento.

  17. AnAnalytical Study of Chinese Salt (MSG: Is it Halal or Haram (Urdu

    Directory of Open Access Journals (Sweden)

    Dr. Junaid Akbar

    2017-01-01

    Full Text Available Monosodium Glutamate is the scientific name of Chinese salt, which also called Ajinomoto. Monosodium Glutamate was first discovered by the Japanese chemist Ikeda Kibunae in 1908. The MSG was firstly derived from seaweed. Later on MSG was got from meat, gluten,and vegetables etc. It can be derived from Najasul‘ain and GherNajasul‘ain things. If it was got from Najasul ‘ain, then there is a question about MSG that is it Halal(permissible/ lawful or Haram(non-permissible/unlawful. This research in this article is concluded that if the culture of MSG is Halal or the properIsti Halah has been done in Najas; MSG will be Halal(permissible/ lawful. However, where no such details are available about the culture of MSG, it should be avoid, although it cannot be declared Haram as per Islamic Jurisprudence rules

  18. Dual-sided electrosurgery handpiece for simultaneous tissue cutting and coagulation: first report on a conceptual design validated by an animal experiment

    OpenAIRE

    Tawfik, Hatem A; Fouad, Yousef A; Hafez, Rashad

    2015-01-01

    Hatem A Tawfik,1 Yousef A Fouad,2 Rashad Hafez3 1Department of Ophthalmology, Oculoplastics Service, Ain Shams University, 2Faculty of Medicine, Ain Shams University, 3Eye Subspecialty Centre, Cairo, Egypt Objective: To introduce and evaluate the safety of a novel dual-sided electrosurgery handpiece design for simultaneous tissue cutting and coagulation. Methods: We designed a prototype double-sided handpiece allowing automatic switching between two electrodes with a simple handpiece flip. T...

  19. Relevancia clínica de las interacciones medicamentosas entre antiinflamatorios no esteroideos y antihipertensivos

    Directory of Open Access Journals (Sweden)

    Juan Villa

    2014-11-01

    Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.

  20. Protocolo de atención a niños y adolescentes con cardiopatía congénita en odontopediatría. Revision bibliográfica

    OpenAIRE

    Juan Manuel de Jesús Cortes de la Torre; Raúl Arturo Cortes de la Torre; Laura Otilia Salazar; Alfredo Salazar de Santiago; Celia Elizabeth Luna Pacheco

    2015-01-01

    Introducción. Las cardiopatías congénitas son las malformaciones más habituales en el desarrollo de los niños los cuales, además, son susceptibles a desarrollar infecciones sistémicas microbianas secundarias a infecciones locales polimicrobianas como consecuencia de procedimientos dentales invasivos o toman fármacos, por ejemplo anti-coagulantes, antiarrítmicos, u otros, que pueden interferir con el manejo odontológico. Objetivo. Proponer un protocolo de manejo odontológico que permita detect...

  1. Estudio del efecto de enoxaparina sobre la cirrosis e hipertensión portal experimental

    OpenAIRE

    Fortea Ormaechea, José Ignacio

    2016-01-01

    La administración de anticoagulantes en pacientes con cirrosis hepática es controvertida debido a que esta enfermedad ha sido considerada durante mucho tiempo un estado hipocoagulante. Sin embargo, en las últimas dos décadas se ha puesto de manifiesto que la hemostasia mantiene un equilibrio precario en pacientes con cirrosis hepática, pudiendo presentar tanto un fenotipo hipocoagulante como uno protrombótico, y que la anticoagulación en pacientes con cirrosis hepática no se asocia a un mayor...

  2. nuevos desafíos en espectroscopia vibracional

    OpenAIRE

    Cascant Vilaplana, Mari Merce

    2017-01-01

    El principal objetivo de la Química Analítica Verde es la sustitución de metodologías contaminantes por otras más limpias, mediante:  La reducción de reactivos y disolventes empleados en el pre-tratamiento y análisis de las muestras.  Minimizar las cantidades y de la toxicidad de los compuestos empleados en las etapas de preparación y medida, especialmente mediante automatización y miniaturización.  El desarrollo de metodologías directas de análisis sin uso de reactivos o disolven...

  3. Procesos de oxidación avanzada para el tratamiento de aguas residuales industriales contaminadas con 1,4 dioxano

    OpenAIRE

    Barndok, Helen

    2016-01-01

    La mayor concienciación medio ambiental, una legislación cada vez más rigurosa, la optimización de los circuitos de agua, la reutilización de los efluentes industriales, así como los nuevos métodos de monitorización y control, obligan al desarrollo de nuevas tecnologías, cada vez más avanzadas, que permitan una mejor depuración de las aguas residuales industriales. Entre los contaminantes comunes en las aguas residuales industriales están los disolventes orgánicos, usados como productos de li...

  4. El efecto del entorno en la emisión de fluorescencia . Modelos teóricos y aplicaciones analíticas

    OpenAIRE

    Delgado Camón, Mª Arantzazu

    2012-01-01

    En esta Tesis Doctoral se abordan aspectos teóricos y prácticos de la fluorescencia molecular, en medio líquido y sólido, que pueden resumirse en: 1.- Estudio y utilización del efecto del entorno molecular en la intensidad de fluorescencia, que se refiere a cómo las interacciones no covalentes que sufre un fluoróforo en presencia de un analito y un disolvente afectan a su emisión y a la utilización de esos cambios para obtener información analítica del entorno. Para ello se ha desarrollad...

  5. Composición de polímeros y nanotubos de carbono, procedimiento de obtención y sus usos

    OpenAIRE

    Benito, Ana M.; Jiménez Manero, Pablo; Martinez, M. Teresa; Maser, Wolfgang K.

    2008-01-01

    Composición de polímeros y nanotubos de carbono, procedimiento de obtención y sus usos. Composición de nanotubos de carbono y polímero, obtenible mediante un procedimiento que comprende: la sonicación de una dispersión de nanotubos de carbono en un disolvente ácido; la adición de monómeros en la dispersión de nanotubos; y la adición rápida de un iniciador de radicales a la dispersión anterior de nanotubos y monómero, manteniendo la mezcla obtenida a una temperatura ...

  6. Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride

    International Nuclear Information System (INIS)

    Adlassnig, A.; Schuster, J. C.; Smetana, W.; Reicher, R.

    1997-01-01

    A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)

  7. Solvent extraction of jojoba oil from pre-pressed jojoba meal

    Directory of Open Access Journals (Sweden)

    El Haron, Dalia E.

    2004-06-01

    Full Text Available The solvent extraction process of jojoba oil from the meal cake obtained after the mechanical pressing of jojoba seeds was studied. Commercial hexane and petroleum ether were used as solvents and the extraction was carried out at temperatures ranging from 30 to 55 °C using solvent-to-solid ratios, R between 2 and 15 L/kg. The equilibrium compositions of the solvent and solid phases were determined. Based on the equilibrium data, the partition coefficient or distribution ratio, D of the oil between both phases was estimated. Also, the number of extraction stages necessary to achieve a certain degree of oil recovery has been determined using different hexane-to-meal ratios. Jojoba oil was also tested for its physical and chemical properties including chemical composition, percentage fatty acid, peroxide value, flash point, fire point, pour point, refractive index, saponification and iodine values. The stability of jojoba oil during storage at room temperature and during heat treatment was also studied.Se ha estudiado el proceso de extracción con disolventes del aceite contenido en la harina residual del prensado mecánico de las semillas de jojoba. Como disolventes se han utilizado hexano técnico y éter de petróleo, habiéndose efectuado extracciones a temperaturas comprendidas entre 30 ºC y 55 ºC , con relaciones de disolvente a sólido, R, de entre 12 y 15 L/kg. Se han determinado las composiciones del extracto y del residuo sólido en el equilibrio y a partir de los datos de equilibrio, se ha estimado el coeficiente de partición o cociente de distribución, D, del aceite entre ambas fases. Asimismo, se ha determinado el número de etapas de extracción necesarias para conseguir un cierto grado de recuperación del aceite, utilizando diferentes relaciones entre hexano y harina. También se han determinado las propiedades físicas y químicas del aceite de jojoba, incluyendo la composición química, el porcentaje de ácidos grasos

  8. P-type doping of GaN

    International Nuclear Information System (INIS)

    Wong, R.K.

    2000-01-01

    After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover

  9. P-type doping of GaN

    Energy Technology Data Exchange (ETDEWEB)

    Wong, Raechelle Kimberly [Univ. of California, Berkeley, CA (United States)

    2000-04-01

    After implantation of As, As + Be, and As + Ga into GaN and annealing for short durations at temperatures as high as 1500 C, the GaN films remained highly resistive. It was apparent from c-RBS studies that although implantation damage did not create an amorphous layer in the GaN film, annealing at 1500 C did not provide enough energy to completely recover the radiation damage. Disorder recovered significantly after annealing at temperatures up to 1500 C, but not completely. From SIMS analysis, oxygen contamination in the AIN capping layer causes oxygen diffusion into the GaN film above 1400 C. The sapphire substrate (A1203) also decomposed and oxygen penetrated into the backside of the GaN layer above 1400 C. To prevent donor-like oxygen impurities from the capping layer and the substrate from contaminating the GaN film and compensating acceptors, post-implantation annealing should be done at temperatures below 1500 C. Oxygen in the cap could be reduced by growing the AIN cap on the GaN layer after the GaN growth run or by depositing the AIN layer in a ultra high vacuum (UHV) system post-growth to minimize residual oxygen and water contamination. With longer annealing times at 1400 C or at higher temperatures with a higher quality AIN, the implantation drainage may fully recover.

  10. Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste? ¿Hay una asociación entre antiinflamatorios no esteroides y nefropatía inducida por contraste? Is there an association between non-steroidal anti-inflammatory drugs and contrast nephropathy?

    Directory of Open Access Journals (Sweden)

    Luciano Passamani Diogo

    2010-12-01

    Full Text Available FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com desenvolvimento de NIC, através da alteração dos níveis de creatinina sérica ou taxa de filtração glomerular em 48 ou 72 horas. RESULTADOS: No período de julho de 2005 a julho de 2006, 236 pacientes foram incluídos no estudo, dos quais 29 foram posteriormente excluídos. A incidência de NIC foi 10,37% (20 de 207 e 42% dos pacientes estavam recebendo AINEs até o momento da avaliação. Não houve associação entre o uso de AINEs e o desenvolvimento de NIC com OR de 1,293; IC95% (0,46-4,2. O estudo detectou fatores de risco conhecidos para o desenvolvimento de NIC, tais como diabete, com OR de 2,77; IC95% (1,05-7,47 e insuficiência renal crônica com OR de 3,48; IC95% (1,1-11,07 e também sugeriu uma ação protetora da hidratação com solução salina com OR de 0,166; IC95% (0,03-0,92. CONCLUSÃO: Com base nos dados obtidos, concluímos que não houve associação entre NIC e uso prévio de AINEs, pelo menos com um OR > 2,85, o qual nossa amostra detectou.FUNDAMENTO: La asociación entre el uso de antiinflamatorios no esteroides (AINEs e insuficiencia renal aguda o crónica está bien documentada, pero evidencias sobre la asociación entre AINEs y nefropatía inducida por contraste (NIC no son encontradas en la literatura. OBJETIVO: Evaluar una posible asociación entre AINEs y NIC. MÉTODOS: En un estudio de cohorte, a través de la entrevista clínica de pacientes que fueron sometidos a cateterismo cardíaco, analizamos el

  11. Hematoma masivo esofágico con compromiso supraglótico: Reporte de un caso y revisión de la literatura

    OpenAIRE

    Pardo J,Javiera; Abarca A,Alfredo; Walker J,Katherine; Celedón L,Carlos

    2010-01-01

    Se presenta el caso de un paciente de 67 años de sexo masculino, hipertenso, diabético y usuario de aspirina en dosis anticoagulante, que consulta en el servicio de urgencia por un cuadro de inicio súbito de dolor retroesternal asociado a disnea severa y estridor. La evaluación mediante nasofibroscopfa muestra una gran masa supraglótica que obstruye el 80% del lumen, compatible con una masa esofágica. La tomograffa computarizada de tórax muestra una imagen compatible con un hematoma disecante...

  12. Hemorragias intracraneales asociadas a fármacos en pacientes con fibrilación auricular no reumática

    OpenAIRE

    García Luque, Amelia

    2008-01-01

    Numerosos ensayos clínicos aleatorizados (ECA) han demostrado el beneficio del uso de antirobóticos, fundamentalmente anticoagulantes orales (ACO), para la profilaxis de accidentes cerebrovascualres (ACV) isquémicos entre los pacientes con fibrilación auricular no reumática (FANR), siendo recomendado su uso por la mayoría de guías de práctica clínica (GPC), lo cual ha provocado un aumento del consumo de este grupo farmacológico. La prevalencia de fibrilación auricular (FA) aumenta con la eda...

  13. A modification of QuEChERS method to analyse anticoagulant rodenticides using small blood samples

    OpenAIRE

    P Gómez-Ramírez; E Martínez-López; I Navas; P María-Mojica; AJ García-Fernández

    2012-01-01

    El uso de rodenticidas anticoagulantes es el método más frecuentemente utilizado para el control de plagas de roedores. Debido a sus características físico-químicas y particular mecanismo de acción, la utilización de estos compuestos en zonas rurales puede suponer un riesgo de intoxicación secundaria de sus depredadores. Para evaluar el riesgo a estos compuestos para la fauna silvestre, especialmente en aves rapaces que se alimentan de roedores, se llevan a cabo los programas de biomonitoriza...

  14. Impôts Français : CRDS - French version only

    CERN Document Server

    2003-01-01

    Avis de dégrèvements IMPORTANT : Cette note d'information concerne uniquement : - les membres du personnel de nationalité française ou résidents permanents1 , domiciliés en France dans le département de l'Ain et rémunérés par le CERN (titulaires, boursiers, attachés payés et de projet) ; - Les anciens membres du personnel de l'Organisation, bénéficiaires de la Caisse de Pensions du CERN, domiciliés ou ayant été domiciliés en France dans le département de l'Ain. Ces personnes ont récemment reçu, ou sont sur le point de recevoir, un avis de dégrèvement émanant de la Direction des Services Fiscaux de l'Ain (DSFA) et portant sur la Contribution au Remboursement de la Dette Sociale (CRDS). I. Informations général...

  15. Külmetav haigekassa / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2008-01-01

    Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi. Graafik: Haigekassa kulude suhteline muutus

  16. Zamerzajushtshaja Bolnitshnaja kassa / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2008-01-01

    Autori hinnangul on suur oht, et Eesti patsiente ootab ees Läti saatus, kus on 40-50% tervishoiukuludest patsientide endi kanda. Eesti ees seisvaid valikuid analüüsides oleks parim valik ravikindlustuse reservide läbimõeldud kasutuselevõtt, kuid eeldusel, et otsitakse ravikindlustuse rahastamisele pikaajalisi sisulisi lahendusi

  17. Lahesõjas viik / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2001-01-01

    Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

  18. Health related quality of life of patients undergoing oral anticoagulation therapy Calidad de vida relacionada a la salud de pacientes que usan anticoagulación oral Qualidade de vida relacionada à saúde de pacientes em uso de anticoagulação oral

    Directory of Open Access Journals (Sweden)

    Inaiara Scalçone Almeida Corbi

    2011-08-01

    Full Text Available This is a descriptive cross-sectional study, which aimed to analyze the health related quality of life (HRQoL and its relationship with gender, age, duration and indication for the use of oral anticoagulants. A total of 178 patients were interviewed and the HRQoL was assessed through eight domains of the SF-36. The descriptive statistics used were, the Student's t, ANOVA and Tukey's tests for the comparison of the means between the groups. The indication for use was predominantly the metallic prosthetic heart valve (50% with warfarin the most widely prescribed anticoagulant (83.3%. The means of the domains of the SF-36 ranged from 82 (Social aspects to 54.8 (Physical aspects. Women, elderly, patients diagnosed with atrial fibrillation and with less than one year of medication use, presented a worse HRQoL evaluation. The results obtained can guide nursing actions, in that they indicate possible associations between the HRQoL and the sociodemographic and clinical variables of the patients.Se trata de un estudio descriptivo, de tipo corte transversal, que tuvo como objetivo analizar la calidad de vida relacionada a la salud (CVRS y su relación con sexo, edad, tiempo e indicación de uso de anticoagulantes orales. Fueron entrevistados 178 pacientes y la CVRS fue evaluada por los ocho dominios del SF-36. Fue utilizada estadística descriptiva, las pruebas: t Student, ANOVA y Tukey, para comparación de los promedios entre los grupos. La indicación para el uso fue predominantemente la prótesis cardíaca metálica (50% y la warfarina el anticoagulante más prescrito (83,3%. Los promedios de los dominios del SF-36 variaron de 82 (Aspectos sociales a 54,8 (Aspectos físicos. Mujeres, ancianos, y pacientes con diagnóstico de fibrilación atrial y con menos de un año de uso del medicamento, presentaron peor evaluación de la CVRS. Los resultados obtenidos pueden orientar acciones de enfermería, en la medida en que indican posibles asociaciones entre

  19. Heparinoides naturais isolados de rodofíceas (Halymenia sp. arribadas na costa cearense =Natural heparinoids isolated from Halymenia sp. (Rhodophyceaes delivery on the Ceará coast

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2010-07-01

    Full Text Available A crescente carência de heparina (HEP motiva a busca por fontes alternativas de novos anticoagulantes naturais. Objetivou-se avaliar a atividade anticoagulante dos polissacarídeos sulfatados (PS isolados de uma rodofícea do gênero Halymenia, nativa do litoral cearense, Brasil. Os PS totais foram obtidos por digestões consecutivas com papaína em tampão acetato de sódio 0,1 M (pH 5,0, contendo cisteína 5 mM e EDTA 5 mM, seguidas por cromatografia de troca iônica em coluna de DEAE-celulose. As frações obtidas foram concentradas por liofilização e submetidas à eletroforese em gel de agarose a 0,5%. Os ensaios anticoagulantes foram realizados pelo tempo de tromboplastina parcial ativada (TTPA, usando-se plasma de coelho e uma curva padrão de HEP (100 UI mg-1. As extrações (53,96% mostraram diferenças marcantes durante o fracionamento e no grau de resolução dos PS. A espécie apresentou PS com atividade anticoagulante superior a HEP. O TTPA das frações modificou-se acentuadamente entre as extrações, expressando-se de maneira dose-dependente e sofrendo um acréscimo de 110,40 (1a extração para 143,10 UI mg-1 (3a extração. Os resultados sugerem que a atividadeanticoagulante dos PS isolados de Halymenia sp. foi promovida pela inibição da via intrínseca e/ou comum da cascata de coagulação. As modificações no TTPA possivelmente serão elucidadas pelos mecanismos de ação envolvidos na coagulação e caracterização estrutural desses compostos. Portanto, a rodofícea Halymenia sp. é uma boa fonte de heparinoides e sugerem-se estudos relacionados ao cultivo da espécie, em proteção aos bancos de algas.The increasing demand for heparin (HEP has led to a search for alternative sources of natural anticoagulants. This study aimed to evaluate the anticoagulant activity of sulfated polysaccharides (SP isolated from a Halymenia rhodophyceae genus native to the coast of Ceará, Brazil. Total SP were obtained by consecutive

  20. Piperazine side-effects in a patient with pre-existing renal insufficiency

    Directory of Open Access Journals (Sweden)

    Majid Malaki

    2014-01-01

    Full Text Available Piperazine as an antihelminth has many adverse effects, especially on patients with renal insufficiency. We report the use of piperazine in a girl with a moderately severe kidney disease due to Biedl Bardet syndrome. She developed coma and acute kidney injury due to acute interstitial nephritis (AIN, anemia and thrombocytopenia. The presence of fever, proteinuria, acidosis, anemia, sterile pyuria and non-oliguric renal failure strongly suggested AIN. Her problems abated mostly by discontinuing of piperazine and supportive therapy, except anemia and thrombocytopenia.

  1. Gene : CBRC-GGOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSA...PSTSGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSA...PSTPGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSTPGTSA...PSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL

  2. Study of the improvement of cellulose processing in ionic liquid by using Carbon Dioxide

    OpenAIRE

    Lopes, Joana Maria Cristóvão

    2016-01-01

    Se han revisado y analizado varios aspectos del procesado de celulosa en líquidos iónicos. Las ventajas y desventajas del uso de líquidos iónicos en la producción de derivados de celulosa se discutieron para la esterificación y eterificación de celulosa. El dióxido de carbono se presenta como un co-disolvente prometedor para el procesado de lignocelulosa en líquido iónico ya que es un gas inerte sin limitación ambiental que presenta altas solubilidades en líquidos iónicos incluso a bajas pres...

  3. Asociación de pranoprofeno a sistemas nanoestructurados para administración tópica

    OpenAIRE

    Abrego Escoba, Guadalupe

    2015-01-01

    En el presente trabajo, pranoprofeno (PF) fue asociado a nanopartículas (NPs) poliméricas de ácido poli-láctico-co-glicólico (PLGA), preparadas por la técnica de desplazamiento del disolvente. Las PF-NPs fueron optimizadas usando un diseño factorial. Las formulaciones optimizadas fueron aquellas que se prepararon con un pH de la fase acuosa de 4.5 ó 5.5; una concentración de PF de 1.0 ó 1.50 mg/mL; tensoactivo 5 ó 10 mg/mL y PLGA 9.0 ó 9.5 mg/mL. En estas condiciones experimentales, las PF-NP...

  4. Analysis of volatile compounds in breads and related products: Improvement of gluten-free breads aroma

    OpenAIRE

    Pico Carbajo, Joana

    2018-01-01

    Inicialmente se desarrolló una metodología de extracción con disolvente y se comparó con la metodología SAFE. Posteriormente se hicieron estudios del tiempo máximo de congelación de las muestras y de inhibición de la fermentación residual para el aroma de masas de pan. Se continuó con la evolución del perfil aromático desde la masa hasta la miga de panes sin gluten. A continuación se analizaron migas de panes sin gluten por SHS-GC/MS y DHS-GC/MS, concluyéndose que mezclas de harina de quinoa ...

  5. Aluminium nitrate ceramics: A potential UV dosemeter material

    DEFF Research Database (Denmark)

    Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.

    2002-01-01

    The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... dosimetry applications. The features are: (1) the spectral sensitivity covers the 200-350 nm range, in the UV-B region it is similar to that of human skin: (2) the angular dependence of the incident radiation follows the cosine law; (3) high yields of both UVR-induced OSL and TL signals compared to those...

  6. Effect of reproductive tract scoring on reproductive efficiency in beef heifers bred by timed insemination and natural service versus only natural service.

    Science.gov (United States)

    Gutierrez, K; Kasimanickam, R; Tibary, A; Gay, J M; Kastelic, J P; Hall, J B; Whittier, W D

    2014-04-15

    The objective was to determine the effects of reproductive tract score (RTS) on reproductive performance in beef heifers bred by timed artificial insemination followed by natural service (AI-NS) or by natural service only (NSO). Angus cross beef heifers (n = 2660) in the AI-NS group were artificially inseminated at a fixed time (5- or 7-day CO-Synch + controlled internal drug release protocol) once, then exposed to bulls 2 weeks later (bull-to-heifer ratio = 1:40-1:50) for the reminder of the 85-day breeding season. Angus cross beef heifers (n = 1381) in NSO group were submitted to bulls (bull-to-heifer ratio = 1:20-1:25) for the entire 85-day breeding season. Heifers were reproductive tract scored from 1 (prepubertal) to 5 (cyclic) 4 weeks before, and were body condition scored (BCS) from 1 (emaciated) to 9 (obese) at the beginning of breeding season. Pregnancy diagnosis was performed 70 days after AI for AI-NS group and 2 months after the end of breeding season for both groups. Heifers in both groups were well managed and of similar age (14.9 ± 0.4 [AI-NS] and 14.7 ± 0.8 [NSO] months). Pregnancy rates (PRs) and number of days to become pregnant were calculated using PROC GLIMMIX and PROC LIFETEST procedures of SAS. Adjusting for BCS (P = 0.07), expressed estrus (P < 0.05), year (P < 0.05), and BCS by year interaction (P < 0.05), the AI-PR was greater for heifers in AI-NS group with higher RTS (P < 0.0001; 40.7%, 48.3%, 57.6%, and 64.6% for RTS of 2 or less, 3, 4, and 5, respectively). Controlling for BCS (P < 0.05), year (P < 0.05) and the breeding season pregnancy rates (BS-PRs) were greater for heifers in the AI-NS group with higher RTS (P < 0.01; 81.2%, 86.5%, 90.4%, and 95.2% for RTS of 2 or less, 3, 4, and 5, respectively). Similarly, adjusting for BCS, year (P < 0.05), the BS-PR was greater for heifers in NSO group with higher RTS (P < 0.01; 79.7%, 84.3%, 88.4%, and 90.2% for RTS of 2 or less, 3, 4, and 5, respectively). Heifers with higher RTS

  7. Potenciais interações entre fármacos e produtos à base de valeriana ou alho

    Directory of Open Access Journals (Sweden)

    Rodrigo F. Alexandre

    Full Text Available Atualmente, as potenciais interações entre fármacos e plantas medicinais e/ou medicamentos fitoterápicos são objetos de inúmeros estudos. Tais estudos são motivados pelo fato de que a fitoterapia é amplamente utilizada em associação com diversos fármacos. Nesta revisão, as informações sobre as principais interações entre produtos elaborados com valeriana ou alho foram localizadas, avaliadas e sistematizadas. Verificou-se que tais plantas podem alterar os perfis farmacocinéticos e/ou farmacodinâmicos de diversos fármacos, podendo provocar conseqüências graves aos pacientes. A valeriana pode aumentar os efeitos adversos dos benzodiazepínicos, reduzir a biodisponibilidade dos fármacos metabolizados pelo sistema P450-CYP3A4 e provocar hemorragias graves quando utilizada juntamente com anticoagulantes orais e antiplaquetários. O alho pode aumentar a biodisponibilidade dos relaxantes musculares, potencializar os efeitos terapêuticos e adversos dos hipoglicemiantes, provocar hemorragias quando administrado juntamente com anticoagulantes orais e antiplaquetários e reduzir a biodisponibilidade dos anti-retrovirais inibidores de protease. Porém, tais potenciais interações não são consensos na literatura, visto que há limitações metodológicas e diferenças significativas entre os estudos localizados. Mesmo assim, o uso de produtos à base de valeriana ou alho, associado com determinados fármacos, deve ser adequadamente monitorado por um profissional da área da saúde.

  8. Desodorización de la base proteica de pescado (BPP con ácido fosfórico Desodorização de base proteica de pescado (BPP com ácido fosfórico

    Directory of Open Access Journals (Sweden)

    Deise R. S. Simões

    2004-03-01

    Full Text Available Se evaluó el efecto del ácido fosfórico en la desodorización de la base proteica de pescado (BPP. La carne de pescado (Macrodon ancylodon fue homogeneizada en un multiprocesador doméstico y sometida a la extracción de compuestos nitrogenados. Fueron experimentadas las relaciones de solución:disolvente en la proporción 1:3 y 1:2 por tres ciclos de extracciones, por dos minutos. El disolvente experimentado fue H3PO4 0,05% comparativamente a agua destilada. Los parámetros utilizados en la observación fueron nitrógeno total (Kjeldhal, nitrógeno no proteico y nitrógeno proteico, proteinas solubles evaluadas según la reacción del biureto y la evaluación sensorial referida en un test de ordenación. En las condiciones experimentales los resultados permiten concluir que las relaciones solución:disolvente utilizadas presentan diferencia en cuanto a la eficiencia de extracción; el ácido fosfórico en la concentración evaluada demostró mayor eficiencia de extracción en relación al agua destilada y la evaluación sensorial indica que no es necesario más que dos ciclos de lavado para eliminar el olor a pescado.Se avaliou o efeito do ácido fosfórico na desodorização de uma base protéica de pescado (BPP. A carne da pescada (Macrodon Ancylodon foi homogeneizada em um microprocessador doméstico e submetida à extração de compostos nitrogenados. Foram testadas soluções solventes em diferentes concentrações 1:3 e 1:2 por três ciclos de extrações, por dois minutos. O dissolvente experimentado foi o H3PO4 0,05% comparativamente com a água destilada. Os parâmetros utilizados foram o nitrogênio total (Kjeldhal, nitrogênio não protéico e nitrogênio protéico, proteínas solúveis avaliadas pela reação do biureto e a avaliação sensorial mencionada em um teste de ordenação. Nas condições experimentais, os resultados permitiram concluir que os dissolventes utilizados apresentaram diferença com relação à efici

  9. Low Median Nerve Palsy as Initial Manifestation of Churg-Strauss Syndrome.

    Science.gov (United States)

    Roh, Young Hak; Koh, Young Do; Noh, Jung Ho; Gong, Hyun Sik; Baek, Goo Hyun

    2017-06-01

    Anterior interosseous nerve (AIN) syndrome is typically characterized by forearm pain and partial or complete dysfunction of the AIN-innervated muscles. Although the exact etiology and pathophysiology of the disorder remain unclear, AIN syndrome is increasingly thought to be an inflammatory condition of the nerve rather than a compressive neuropathy because the symptoms often resolve spontaneously following prolonged observation. However, peripheral neuropathy can be 1 of the first symptoms of systemic vasculitis that needs early systemic immunotherapy to prevent extensive nerve damage. Churg-Strauss syndrome (CSS; eosinophilic granulomatosis with polyangiitis) is 1 type of primary systemic vasculitis that frequently damages the peripheral nervous system. CSS-associated neuropathy usually involves nerves of the lower limb, and few studies have reported on the involvement of the upper limb alone. We report on a rare case of low median nerve palsy as the initial manifestation of CSS. The patient recovered well with early steroid treatment for primary systemic vasculitis. Copyright © 2017 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

  10. ORF Alignment: NC_003212 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ain Clip11262) ... Length = 200 ... Query: 88 ... NAGLIKIGISEPSASLVLPQILKQFLTDFP...KLMVNVSVDDANTCSQKLIDGEIDFAICGE 147 ... NAGLIKIGISEPSASLVLPQILKQFLTDFPKLMVNVSVDDANTCSQKLIDGEIDFAICGE Sbjct: 1 ... NAGLIKIGISEPS

  11. Anti-inflamatórios não esteroides: Efeitos cardiovasculares, cérebro-vasculares e renais Antiinflamatorios no esteroides: efectos cardiovasculares, cerebrovasculares y renales Nonsteroidal anti-inflammatory drugs: cardiovascular, cerebrovascular and renal effects

    Directory of Open Access Journals (Sweden)

    Michel Batlouni

    2010-04-01

    Full Text Available Os anti-inflamatórios não esteroides (AINEs encontram-se entre os medicamentos mais prescritos em todo o mundo. Essa classe heterogênea de fármacos inclui a aspirina e vários outros agentes inibidores da ciclo-oxigenase (COX, seletivos ou não. Os AINEs não seletivos são os mais antigos, e designados como tradicionais ou convencionais. Os AINEs seletivos para a COX-2 são designados COXIBEs. Nos últimos anos, tem sido questionada a segurança do uso dos AINEs na prática clínica, particularmente dos inibidores seletivos da COX-2. As evidências sobre o aumento do risco cardiovascular com o uso de AINEs são ainda incompletos, pela ausência de ensaios randomizados e controlados com poder para avaliar desfechos cardiovasculares relevantes. Entretanto, os resultados de estudos clínicos prospectivos e de meta-análises indicam que os inibidores seletivos da COX-2 exercem importantes efeitos cardiovasculares adversos, que incluem aumento do risco de infarto do miocárdio, acidente vascular cerebral, insuficiência cardíaca, insuficiência renal e hipertensão arterial. O risco desses efeitos adversos é maior em pacientes com história prévia de doença cardiovascular ou com alto risco para desenvolvê-la. Nesses pacientes, o uso de inibidores da COX-2 deve ser limitado àqueles para os quais não há alternativa apropriada e, mesmo assim, somente em doses baixas e pelo menor tempo necessário. Embora os efeitos adversos mais frequentes tenham sido relacionados à inibição seletiva da COX-2, a ausência de seletividade para essa isoenzima não elimina completamente o risco de eventos cardiovasculares, de modo que todos os fármacos do largo espectro dos AINEs somente devem ser prescritos após consideração do balanço risco/benefício.Los antiinflamatorios no esteroides (AINEs se encuentran entre los medicamentos más prescriptos en todo el mundo. Esta clase heterogénea de fármacos incluye la aspirina y varios otros agentes

  12. High Prevalence of Anal Human Papillomavirus-Associated Cancer Precursors in a Contemporary Cohort of Asymptomatic HIV-Infected Women.

    Science.gov (United States)

    Heard, Isabelle; Etienney, Isabelle; Potard, Valérie; Poizot-Martin, Isabelle; Moore, Catherine; Lesage, Anne-Carole; Ressiot, Emmanuelle; Crenn-Hebert, Catherine; Fléjou, Jean-François; Cubie, Heather; Costagliola, Dominique; Darragh, Teresa M

    2015-05-15

    Although human immunodeficiency virus (HIV)-infected women are at high risk for anal cancer, few data have been published on prevalence of and risk factors for anal precancer and potential screening strategies in this risk group. A cross-sectional anal screening study was nested in a gynecological cohort of HIV-infected women. Anal swab specimens were collected for cytology and human papillomavirus (HPV) testing. High-resolution anoscopy, with biopsy when indicated, was systematically performed. Among the 171 enrolled women, median age was 47.3 years and 98% were receiving combination antiretroviral therapy. Median CD4(+) count was 655 cells/µL and HIV load was associated with increased risk of HG-AIN+. Abnormal anal cytology and HPV-16 infection performed best as a screening strategy for HG-AIN+ histology, with positive likelihood ratios of 3.4 (95% CI, 2.3-5.1) and 4.7 (95% CI, 2.5-8.7) and negative likelihood ratios of 0.2 (95% CI, .07-.8) and 0.4 (95% CI, .2-.9), respectively. HIV-infected women with a history of HPV-associated cervical disease are at increased risk for HG-AIN+ and should be offered anal cancer screening. Anal cytology and HPV-16 genotyping had the best screening performance. Anal cytology is easy to perform routinely; it may be the best candidate for screening for HG-AIN among HIV-infected women. © The Author 2015. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  13. Abnormal structure and functional connectivity of the anterior insula at pain-free periovulation is associated with perceived pain during menstruation.

    Science.gov (United States)

    Dun, Wang-Huan; Yang, Jing; Yang, Ling; Ding, Dun; Ma, Xue-Ying; Liang, Feng-Li; von Deneen, Karen M; Ma, Shao-Hui; Xu, Xiao-Ling; Liu, Jixin; Zhang, Ming

    2017-12-01

    Neuroimaging studies have demonstrated the critical role of the insula in pain pathways and its close relation with the perceived intensity of nociceptive stimuli. We aimed to identify the structural and functional characteristics of the insula during periovulatory phase in women with primary dysmenorrhea (PDM), and further investigate its association with the intensity of perceived pain during menstruation. Optimized voxel-based morphometry and functional connectivity (FC) analyses were applied by using 3-dimensional T1-weighted and resting functional magnetic resonance imaging (fMRI) in 36 patients at the peri-ovulation phase and 29 age-, education-, and gender-matched healthy controls (HC). A visual analogue scale (VAS) was used to examine the intensity of the abdominal pain at periovulation and menstruation. In our results, PDM patients had significant higher VAS-rating during menstruaion than periovulation. Compared with the HC, PDM patients had lower gray matter density in the left anterior insula (aINS). Taken the left aINS as a seed region, we further found hypoconnectivity between aINS and medial prefrontal cortex (mPFC), which showed negative relation with the VAS during menstruation. As the aINS is a key site of the salience network (SN) and the mPFC is a critical region in the default mode network (DMN), it's implicated a trait-related central-alteration that communications between pain attention and perception networks were disrupted without the ongoing menstrual pain. Moreover, result of correlation analysis, at least in part, suggested a possible role of altered FC (pain-free period) in predicting pain perception (menstruation).

  14. Clonixinato de lisina injetável intravenoso para o tratamento agudo das enxaquecas: um estudo piloto aberto

    OpenAIRE

    KRYMCHANTOWSKI, ABOUCH V.; BARBOSA, JACKELINE

    1999-01-01

    Alguns antinflamatórios não esteroidais (AINE) orais são eficientes para o tratamento dos ataques de migrânea ou enxaqueca. A despeito de sua eficiência para o tratamento destas cefaléias e de outras dores, existem comercialmente poucos antinflamatórios não esteroidais disponíveis para administração parenteral. O clonixinato de lisina (CL) é um AINE derivado do ácido nicotínico que foi comprovadamente eficiente em vários tipos de síndromes álgicas como cólica renal, dor de compressão nervosa,...

  15. [Acute severe colitis with recto-vaginal fistula during treatment with non-steroidal anti-inflammatory agents].

    Science.gov (United States)

    Tissot, B; Lamy, A; Perraudeau, F; Manouvrier, J L; Imbert, Y

    2002-07-13

    We report the case of severe colitis occurring during treatment with non-steroid anti-inflammatories (NSAI). A 57 year-old woman was hospitalized for lumbar pain that had not been relieved by AINS, tramadol and then morphine. The patient presented with septic shock and peritonitis by rectal perforation, followed by acute rectorrhagia. The endoscopic aspect evoked Crohn's disease with a recto-vaginal fistula. Progression was further complicated by two episodes of collapse because of acute rectorrhagia, requiring hemostasis colectomy and abdominal-perineal amputation. The diagnosis retained was AINS-induced colitis complicated by acute colectasia on a fecaloma with recto-vaginal fistula.

  16. Insecticidal and repellent effect of extracts of Pluchea sericea (Nutt. on adults of Bemisia tabaci (Genn.

    Directory of Open Access Journals (Sweden)

    Carlos Enrique Ail-Catzim

    2015-01-01

    Full Text Available Para el control de Bemisia tabaci (Genn. en los cultivos agrícolas se usan repetidas aplicaciones de insecticidas, lo que ha provocado problemas de resistencia y contaminación ambiental. Los insumos provenientes de especies vegetales son una alternativa para reducir esta problemática. Las plantas son una fuente de químicos bioactivos, que pueden tener efecto insecticida, repelente, atrayente, antialimenticio o regulador de crecimiento. El objetivo fue determinar la actividad insecticida y repelente de extractos etanólicos, acetónicos y acuosos, tanto de hojas como de tallos de Pluchea sericea (Nutt. sobre Bemisia tabaci (Genn.. Se estimó la CL50 de cada uno de los extractos, mediante bioensayos con la técnica de película residual, sobre adultos de mosquita blanca. Además, se evaluó el efecto repelente a partir de la CL50 de cada extracto, se estimó el índice de repelencia (IR, si IR = 1 el efecto es neutro, IR 1, el efecto es atrayente. Los extractos de hoja-etanol, hoja-agua y hoja-acetona presentaron valores menores de CL50 700, 1,190 y 1,250 ppm respectivamente, lo que indica alta eficiencia sobre B. tabaci, seguidos del extracto tallo-agua, por último los extractos tallo-etanol y tallo-acetona presentaron menor efectividad. Todos los extractos tuvieron acción repelente, independientemente del disolvente y órgano de la planta a 24 y 48 h. Sin embargo, los extractos a base de agua podrían tener mayor potencial para el control de la mosquita blanca en sistemas de manejo integrado de plagas, debido a que presentaron efecto insecticida y repelente, además el disolvente es inocuo y de bajo costo.

  17. ORF Alignment: NC_003212 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ain ... Clip11262) ... Length = 73 ... Query: 8 ... ASALLELIGGKENISSVTHCATRMRFV...LLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 67 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQ...VIIG Sbjct: 1 ... ASALLELIGGKENISSVTHCATRMRFVLLDPDNADVEAIEDIPAVKGTFTQAGQFQVIIG 60 ...

  18. Pacientes con trastornos de la hemostasia: Un grupo de riesgo en la atención estomatológica

    Directory of Open Access Journals (Sweden)

    Marta María Alcalde Dueñas

    2002-08-01

    Full Text Available Los pacientes con alteraciones de la hemostasia constituyen un grupo de riesgo en la atención estomatológica cuando tienen que ser sometidos a procederes que presuponen sangramiento. La hemostasia está determinada por una serie de eventos complejos que evitan que se pierda sangre del torrente circulatorio, y la falla de cualquiera de estos mecanismos provocará salida de sangre de los vasos sanguíneos, máxime si el proceder estomatológico que se va a aplicar conlleva sangramiento de tejidos. Por tal motivo se debe solicitar un estudio del caso antes de proceder, con el fin de diagnosticar qué tipo de trastorno presenta el paciente e indicar tratamiento específico en su caso. Es propósito de este trabajo incursionar en aquellos trastornos de la hemostasia que involucran a las plaquetas y alargan el tiempo de sangramiento, así como abordar las deficiencias de factores de la coagulación que afectan este importante mecanismo; por otro lado, dada su importancia, abarcaremos los efectos antiinflamatorios no esteroideos (AINES y anticoagulantes en pacientes que necesitan un tratamiento quirúrgico estomatológico, de manera que se facilite la labor del profesional de la salud que a diario se enfrenta con problemas de esta índole y dotarlo de un conocimiento valioso en cada uno de los aspectos tratados.Patients with hemostatic disorders are a risk group in dental care when they should undergo dental procedures that presupposes bleeding. Hemostasis is determined by a series of complex events that prevent the loss of blood, so, if any of these mechanisms fails, blood will come out of the blood vessels, especially if the dental procedure to be applied involves tissue bleeding. Before performing the procedure, one should request a study of the case to diagnose what type of disorder the patient might present with and give the specific treatment. This paper is aimed at studying those hemostatic disorders that involve platelets and extend the

  19. EFFETS D’UN ALIMENT EXTRUDE SUR LES PERFORMANCES DE CROISSANCE DE LA TRUITE ARC-EN-CIEL (ONCORHYNCHUS MYKISS WALBAUM, 1792 ET SUR LA QUALITE DE L’EAU DE L’OUED OUM ER-RBIA (STATION AIN AGHBAL, AZROU-MAROC

    Directory of Open Access Journals (Sweden)

    Khadija OUAISSA

    2017-05-01

    Full Text Available The objective of our study is to test the efficacy of an extruded food on the growth performance of rainbow trout (Oncorhynchus mykiss Walbaum, 1792 at the fish farm Ain Aghbal in Azrou (Morocco. Generally, only the biochemical composition (percentages of moisture, proteins, lipids and carbohydrates and the (digestible and crude energies of the food are previously known, which is insufficient for the choice of the food in terms of growth performance and quality/environment. The rainbow trout breeding tanks used for this test are 222 days (15 June 2015 - 28 February 2016 are fed with water directly taken from the water of the Oum Er-Rbia sources according to an open circuit with a Renewal of water every half hour. The flow rate is 11.04m3/h. The initial breeding conditions, the density (Kg per volume 1.58kg/m3 and the initial charge with respect to the flow rate is 1.05 m3 / h. Fish are fed by ratios two to three times per day depending on the rearing stage. The frequency of sampling is biweekly where we measured the zootechnical performances of the fish and taken water samples for physicochemical analyzes in order to assess the quality of the waters of exit of the basins before their rejection in the Oum-Er-Rbia river. The results show that the test food shows a better growth of the rainbow trout and a conversion index not exceeding 0.9 for a size of 1043 g of trout.

  20. Anterior Interosseous Nerve Neuropraxia Secondary to Shoulder Arthroscopy and Open Subpectoral Long Head Biceps Tenodesis

    Directory of Open Access Journals (Sweden)

    Jeremiah T. Steed

    2017-01-01

    Full Text Available Arthroscopic rotator cuff tendon repair is a common elective procedure performed by trained orthopaedic surgeons with a relatively low complication rate. Specifically, isolated neuropraxia of the anterior interosseous nerve (AIN is a very rare complication of shoulder arthroscopy. An analysis of peer-reviewed published literature revealed only three articles reporting a total of seven cases that describe this specific complication following standard shoulder arthroscopic procedures. This article reports on three patients diagnosed with AIN neuropraxia following routine shoulder arthroscopy done by a single surgeon within a three-year period. All three patients also underwent open biceps tenodesis immediately following completion of the arthroscopic procedures. The exact causal mechanism of AIN neuropraxia following shoulder arthroscopy with biceps tenodesis is not known. This case report reviews possible mechanisms with emphasis on specific factors that make a traction injury the most likely etiology in these cases. We critically analyze our operating room setup and patient positioning practices in light of the existing biomechanical and cadaveric research to propose changes to our standard practices that may help to reduce the incidence of this specific postoperative complication in patients undergoing elective shoulder arthroscopy with biceps tenodesis.

  1. Non-nitric oxide based metallovasodilators: synthesis, reactivity and biological studies.

    Science.gov (United States)

    Sá, Denise S; Fernandes, André F; Silva, Carlos D S; Costa, Paula P C; Fonteles, Manassés C; Nascimento, Nilberto R F; Lopes, Luiz G F; Sousa, Eduardo H S

    2015-08-14

    There is an increasing number of compounds developed to target one or more pathways involved in vasodilation. Some studies conducted with azaindole and indazole derivatives showed cardiovascular activity associated with these compounds. Fast and easy structural modification of these organic molecules can be achieved using metal complexes promoting a much larger spatial change than organic strategies, potentially leading to novel drugs. Here, we have prepared a series of complexes with a formula cis-[RuCl(L)(bpy)(2)]PF(6), where L = 7-azaindole (ain), 5-azaindole (5-ain), 4-azaindole (4-ain), indazole (indz), benzimidazole (bzim) or quinoline (qui), which were characterized by spectroscopic and electrochemical techniques (CV, DPV). These compounds showed reasonable stability exhibiting photoreactivity only at low wavelength along with superoxide scavenger activity. Cytotoxicity assays indicated their low activity preliminarily supporting in vivo application. Interestingly, vasodilation assays conducted in rat aorta exhibited great activity that largely improved compared to free ligands and even better than the well-studied organic compound (BAY 41-42272), with IC(50) reaching 55 nM. These results have validated this strategy opening new opportunities to further develop cardiovascular agents based on metallo-bicyclic rings.

  2. Investorid on dilemma ees / Ain Kivisaar

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe

  3. Euroopa abiraha igatseb taotlejaid / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Aastatel 2007-2013 saab Eesti Euroopa Liidult toetusi 78 miljardit krooni, millele toetudes on võimalik rasked ajad üle elada. Vt. samas: Tuhahoidlast asula jäätmepunktini; Suurima toetuse saab keskkond. Kommenteerivad Antti Tooming ja Kai Niels Willadsen

  4. Teacher Tenure "Ain't" the Problem.

    Science.gov (United States)

    Hansen, Kenneth; Ellena, William J.

    The concept of "tenure," with all its clumsy and confusing burden of historic and current misinterpretation, will probably soon disappear. However, what tenure laws intended, and have failed to do, will almost surely be preserved in other forms of administrative procedure. To be effective, administrative procedures must be (1) clear and detailed,…

  5. VJ annab muusikale visuaalsuse / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    Videograafikast. Video jockey ehk videokunstnik maalib kunstiteoseid piltide ja visuaalsete elementide abil, tehes seda muusika taustal, tavaliselt paralleelselt disco jockey'ga. Toomas Altnurme, Taavi Varmi, Sten Saluveeri ja Erki Kannuse kommentaare

  6. Makita kalmistu antropoloogiline aines / Luule Heapost

    Index Scriptorium Estoniae

    Heapost, Luule

    1993-01-01

    Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed

  7. Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

  8. You ain't seen nothing yet

    NARCIS (Netherlands)

    Walhof, Gert

    Omtrent technologiebedrijven konden we in december 2016 veel lezen over wat artificial intelligence, virtual reality, machine-to-machine automation, machine-to-machine learning en chatbots ons de komende jaren gaan brengen. Als inkoper zou je kunnen wachten tot duidelijk wordt wat de blijvertjes

  9. Brain damage associated with apraxia of speech: evidence from case studies.

    Science.gov (United States)

    Moser, Dana; Basilakos, Alexandra; Fillmore, Paul; Fridriksson, Julius

    2016-08-01

    The site of crucial damage that causes acquired apraxia of speech (AOS) has been debated in the literature. This study presents five in-depth cases that offer insight into the role of brain areas involved in AOS. Four of the examined participants had a primary impairment of AOS either with (n = 2) or without concomitant mild aphasia (n = 2). The fifth participant presented with a lesion relatively isolated to the left anterior insula (AIns-L), damage that is rarely reported in the literature, but without AOS. Taken together, these cases challenge the role of the AIns-L and implicate the left motor regions in AOS.

  10. Anticoagulant concentration, time and storage temperature on hematological parameters in automated blood count

    OpenAIRE

    Oliveira, Aécio Carlos de; Ribeiro Filho, José Dantas; Guimarães, José Domingos; Silva, André Ricardo e; Dantas, Waleska de Melo Ferreira; Bonfá, Laila de Paula; Farias, Sheila Kreutzfeld de

    2010-01-01

    O estudo teve como objetivo identificar os efeitos do tempo de estocagem, da temperatura de armazenamento e da quantidade de anticoagulante sobre parâmetros hematológicos de cães. Foram utilizadas amostras do sangue de dez cães de raças variadas, clinicamente hígidos. As alíquotas foram colhidas com 1,8mg; 3,6mg; 7,2mg e 14,4mg de ácido etilenodiaminotetracético (EDTA) por mL de sangue, distribuídas em dois grupos: de 2°C a 8°C e temperatura ambiente. Após a coleta, foram avaliadas em...

  11. Influência da concentração do EDTA, tempo e temperatura de armazenagem sobre parâmetros hematológicos de cães no hemograma automatizado e manual

    OpenAIRE

    Oliveira, Aécio Carlos de

    2009-01-01

    O estudo teve como objetivo identificar os efeitos do tempo, da temperatura de armazenamento e do excesso de anticoagulante sobre parâmetros hematológicos de cães. Foram utilizadas amostras do sangue de dez cães de raças variadas, clinicamente hígidos. As alíquotas foram colhidas com 1,8 mg, 3,6 mg, 7,2 mg e 14,4 mg de ácido etilenodiaminotetraacético (EDTA) por mL de sangue, distribuídas em dois grupos: de 2ºC a 8ºC e temperatura ambiente.Após a coleta, foram avaliadas em quatro tempos: 0, 1...

  12. Data of evolutionary structure change: 1ONAD-2GDFC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ONAD-2GDFC 1ONA 2GDF D C ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

  13. Data of evolutionary structure change: 1ONAD-2GDFA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ONAD-2GDFA 1ONA 2GDF D A ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT-NALHFMFNQFSKDQKDLILQGDATTGTDG...ain> 1ONA D 1ONAD

  14. Tratamento com antiinflamatórios tópicos na osteoartrite de joelho Topical anti-inflammatory drugs in osteoarthritis of the knee

    Directory of Open Access Journals (Sweden)

    Helena Lúcia Alves Pereira

    2006-06-01

    Full Text Available Os antiinflamatórios não-esteroidais (AINEs orais são eficazes no alívio da dor na osteoartrite (OA, porém têm o risco de efeitos adversos sistêmicos. Para diminuir a toxicidade é necessário reduzir a concentração plasmática uma vez que os efeitos adversos são dose-dependentes. Os AINEs de uso tópico, em teoria, alcançam altas concentrações nos tecidos-alvo com concentrações plasmáticas baixas, sendo portanto uma alternativa terapêutica, especialmente para pacientes de risco. Nossa revisão dos ensaios clínicos randomizados mostrou que os AINEs tópicos foram mais efetivos que o placebo e tão eficazes quanto os AINEs orais. Porém, o pequeno número de ensaios e falhas na metodologia nos impossibilita de fazer conclusões definitivas, sendo necessários estudos bem desenhados e de maior duração.Oral non-steroidal anti-inflammatories drugs (NSAIDs are effective in pain relief in osteoarthritis (OA, but are also associated with risks of adverse systemic side effects. In order to reduce its toxicity, it would be desirable to decrease the plasmatic levels of NSAIDs since those side effects are dose-dependent. Topical NSAIDs would be a therapeutic alternative in theory, because while they reach high levels in local tissues, they also produce low plasmatic levels. Our review analyzed clinical randomized and shown that topical NSAIDs were superior to placebo and have similar efficacy to oral NSAIDs, but due a few number of trials and methodological weaknesses we can't make definitive conclusions. Further well designed, long term studies are required.

  15. Anti-human neutrophil antigen-1a, -1b, and -2 antibodies in neonates and children with immune neutropenias analyzed by extracted granulocyte antigen immunofluorescence assay.

    Science.gov (United States)

    Onodera, Rie; Kurita, Emi; Taniguchi, Kikuyo; Karakawa, Shuhei; Okada, Satoshi; Kihara, Hirotaka; Fujii, Teruhisa; Kobayashi, Masao

    2017-11-01

    Anti-human neutrophil antigen (HNA) antibodies have been implicated in the development of neonatal alloimmune neutropenia (NAN) and autoimmune neutropenia (AIN). There are many conventional assay methods that detect anti-HNA antibodies. However, a method to measure multiple samples and detect several anti-HNA antibodies simultaneously is needed. We developed a new method, the extracted granulocyte antigen immunofluorescence assay (EGIFA), to analyze anti-HNA-1a, -1b, and -2 antibodies in sera. The results obtained by EGIFA were evaluated in comparison with those from several standard assay methods. Anti-HNA antibodies in serum samples from nine familial cases with suspected NAN (n = 19) and children with suspected AIN (n = 88) were also measured by EGIFA. The evaluation of nine serum samples with anti-HNA antibodies suggested that EGIFA demonstrated equivalent specificity and superior sensitivity to monoclonal antibody-specific immobilization of granulocyte antigens and had comparable sensitivity to the granulocyte indirect immunofluorescence test. EGIFA successfully detected anti-HNA-1a or -1b antibodies in seven of nine familial cases with suspected NAN. EGIFA detected anti-HNA antibodies in 40.9% of children with suspected AIN. Among them, isolated anti-HNA-1a or -1b antibody was detected in 4.5 or 12.5% of children, respectively, and anti-HNA-2 antibody was identified in 3.4% of children. The 30.8% (16 of 52) of children negative for anti-HNA antibody by EGIFA were positive for anti-HLA antibody. EGIFA facilitated the measurement of anti-HNA-1a, -1b, and/or -2 antibodies in sera. The prompt measurement of anti-HNA antibodies will improve the diagnosis and clinical management of patients with suspected NAN or AIN. © 2017 AABB.

  16. Influence of diet with kale on lipid peroxides and malondialdehyde levels in blood serum of laboratory rats over intoxication with paraquat.

    Science.gov (United States)

    Sikora, Elżbieta; Bodziarczyk, Izabela

    2013-01-01

    Organism's lipid peroxidation is one of the most often examined and known physiological process evoked by free radicals. It concerns oxidation reaction of unsaturated fatty acid and/or other lipids leading to lipid oxidation products (LOP), which as a result of further changes generate among others the malondialdehyde molecules. The aim of the work was an estimation if raw or cooked kale addition to rat's diet influences antioxidant defense efficiency in their organisms in comparison to rats fed with standard AIN-93G diet. The experiment was conducted with 36 Wistar strain, male rats over 21 days. The rats were divided into 3 groups (each 12 stuck) which were fed with: standard diet AIN-93G (2 groups), AIN-93G diet with 10% addition of raw kale (2 groups), and AIN-93G with 10% addition of cooked lyophilised kale. The total content of polyphenols (FC method) and antioxidant activity (ABTS+•) were previously determined in raw and then in cooked kale. On the 20th day of experiment, half of rats (6 stuck) of each kind of the diet were injected intraperitoneally by the solution of paraquat (PQ) in physiological salt to evoke the oxidative stress. The next day animals were stunned and blood from their hearts was sampled. In the obtained serum, the levels of lipid oxidation products (LOP) and malondialdehyde (MDA) were assessed. It was observed that in blood serum of rats fed with modified diet with raw and cooked lyophilised kale addition the lipid oxides level was lower in comparison to control group fed with standard diet (p kale addition. Diet with kale, both raw and cooked, efficiently inhibited the lipid peroxidation process in rats' organisms, ongoing during natural metabolism and during evoked oxidative stress.

  17. Drug-induced acute interstitial nephritis: A clinicopathological study and comparative trial of steroid regimens

    Directory of Open Access Journals (Sweden)

    R Ramachandran

    2015-01-01

    Full Text Available Steroids are used in the management of drug-induced acute interstitial nephritis (AIN. The present study was undertaken to compare the efficacy of pulse methyl prednisolone with oral prednisolone in the treatment of drug-induced AIN. Patients with biopsy-proven AIN with a history of drug intake were randomized to oral prednisolone (Group 1 1 mg/kg for 3 weeks or a pulse methyl prednisolone (Group II 30 mg/kg for 3 days followed by oral prednisolone 1 mg/kg for 2 weeks, tapered over 3 weeks. Kidney biopsy scoring was done for interstitial edema, infiltration and tubular damage. The response was reported as complete remission (CR (improvement in estimated glomerular filtration rate [eGFR] to ≥60 ml/min/1.73 m 2 , partial remission (PR (improvement but eGFR <60 ml/min/1.73 m 2 or resistance (no CR/PR. A total of 29 patients, Group I: 16 and Group II: 13 were studied. Offending drugs included nonsteroidal anti-inflammatory drugs, herbal drugs, antibiotics, diuretic, rifampicin and omeprazole. There was no difference in the baseline parameters between the two groups. The biopsy score in Groups I and II was 5.9 ΁ 1.1 and 5.1 ΁ 1.2, respectively. At 3 months in Group I, eight patients each (50% achieved CR and PR. In Group II, 8 (61% achieved CR and 5 (39% PR. This was not significantly different. Percentage fall in serum creatinine at 1 week (56% was higher in CR as compared to (42% those with PR. ( P = 0.14. Patients with neutrophil infiltration had higher CR compared to patients with no neutrophil infiltration ( P = 0.01. Early steroid therapy, both oral and pulse steroid, is equally effective in achieving remission in drug-induced AIN.

  18. Kaks debüüti / Lilian Vellerand

    Index Scriptorium Estoniae

    Vellerand, Lilian, 1932-

    1997-01-01

    "Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar

  19. Physical and mental health: from youth to age in Ohio prisons.

    Science.gov (United States)

    Lynd, Alice

    2014-01-01

    Who cares about health care in prisons? You do if you have a son or a granddaughter in prison. Maybe you care anyway if you have had to wait a long time to see a doctor or if you could not have the treatment you needed because it cost too much. Maybe you have run into the attitude, "You ain't bleedin', you ain't needin'." Maybe you have found it hard to face the future with little or no hope that you could ever be in a better place. Or maybe you, like some older prisoners, have been able to develop new interests, new skills, to review your life and review it, and to redefine what matters.

  20. Data of evolutionary structure change: 1ONAD-2D3PB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ONAD-2D3PB 1ONA 2D3P D B ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAK...WNMQNGKVGTAHIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLYKETNTILSWSFTSKLKT------NALHFMFNQFSKDQKDLILQGDAT...ain> 1ONA D 1ONAD TR

  1. Keratosis reduces sensitivity of anal cytology in detecting anal intraepithelial neoplasia.

    Science.gov (United States)

    ElNaggar, Adam C; Santoso, Joseph T; Xie, Huiwen Bill

    2012-02-01

    To identify factors that may contribute to poor sensitivity of anal cytology in contrast to the sensitivity of anoscopy in heterosexual women. We analyzed 324 patients with biopsy confirmed diagnosis of genital intraepithelial neoplasia (either vulva, vaginal, or cervical) from 2006 to 2011 who underwent both anal cytology and anoscopy. Cytology, anoscopy, and biopsy results were recorded. Biopsy specimens underwent independent analysis for quality of specimen. Also, biopsy specimens were analyzed for characteristics that may contribute to correlation, or lack thereof, between anal cytology and anoscopic directed biopsy. 133 (41%) patients had abnormal anoscopy and underwent directed biopsy. 120 patients with normal anal cytology had anoscopy directed biopsies, resulting in 58 cases of AIN (sensitivity 9.4%; 0.039-0.199). This cohort was noted to have extensive keratosis covering the entire dysplastic anal lesion. 18 patients yielded abnormal anal cytology. Of these patients, 13 had anoscopic directed biopsies revealing 6 with AIN and absent keratosis (specificity 88.6%; 0.78-0.95). The κ statistic for anal cytology and anoscopy was -0.0213 (95% CI=-0.128-0.086). Keratosis reduces the sensitivity of anal cytology. Furthermore, anal cytology poorly correlates with anoscopy in the detection of AIN (κ statistic=-0.0213). Copyright © 2011 Elsevier Inc. All rights reserved.

  2. Impact of Diet Composition in Adult Offspring is Dependent on Maternal Diet during Pregnancy and Lactation in Rats

    Directory of Open Access Journals (Sweden)

    Megan C. Hallam

    2016-01-01

    Full Text Available The Thrifty Phenotype Hypothesis proposes that the fetus takes cues from the maternal environment to predict its postnatal environment. A mismatch between the predicted and actual environments precipitates an increased risk of chronic disease. Our objective was to determine if, following a high fat, high sucrose (HFS diet challenge in adulthood, re-matching offspring to their maternal gestational diet would improve metabolic health more so than if there was no previous exposure to that diet. Animals re-matched to a high prebiotic fiber diet (HF had lower body weight and adiposity than animals re-matched to a high protein (HP or control (C diet and also had increased levels of the satiety hormones GLP-1 and PYY (p < 0.05. Control animals, whether maintained throughout the study on AIN-93M, or continued on HFS rather than reverting back to AIN-93M, did not differ from each other in body weight or adiposity. Overall, the HF diet was associated with the most beneficial metabolic phenotype (body fat, glucose control, satiety hormones. The HP diet, as per our previous work, had detrimental effects on body weight and adiposity. Findings in control rats suggest that the obesogenic potential of the powdered AIN-93 diet warrants investigation.

  3. Heat Transfer Characteristics in High Power LED Packaging

    Directory of Open Access Journals (Sweden)

    Chi-Hung Chung

    2014-03-01

    Full Text Available This study uses the T3Ster transient thermal resistance measuring device to investigate the effects to heat transfer performances from different LED crystal grains, packaging methods and heat-sink substrates through the experimental method. The experimental parameters are six different types of LED modules that are made alternatively with the crystal grain structure, the die attach method and the carrying substrate. The crystal grain structure includes the lateral type, flip chip type and vertical type. The die attach method includes silver paste and the eutectic structure. The carrying substrates are aluminum oxide (Alumina and aluminum nitride (AIN ceramic substrates and metal core PCB (MCPCB. The experimental results show that, under the conditions of the same crystal grain and die attach method, the thermal resistance values for the AIN substrate and the Alumina substrate are 2.1K/W and 5.1K/W, respectively and the total thermal resistance values are 7.3K/W and 10.8K/W. Compared to the Alumina substrate, the AIN substrate can effectively lower the total thermal resistance value by 32.4%. This is because the heat transfer coefficient of the AIN substrate is higher than that of the Alumina substrate, thus effectively increasing its thermal conductivity. In addition, under the conditions of the same crystal grain and the same substrate, the packaging methods are using silver paste and the eutectic structure for die attach. Their thermal resistance values are 5.7K/W and 2.7K/W, respectively, with a variance of 3K/W. Comparisons of the crystal grain structure show that the thermal resistance for the flip chip type is lower than that of the traditional lateral type by 0.9K/W. This is because the light emitting layer of the flip chip crystal grain is closer to the heat-sink substrate, shortening the heat dissipation route, and thus lowering the thermal resistance value. For the total thermal resistance, the crystal grain structure has a lesser

  4. Meie igapäevane paanika / Ott Karulin

    Index Scriptorium Estoniae

    Karulin, Ott, 1980-

    2007-01-01

    Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste

  5. Case C-182/15, Proceedings Relating to the Extradition of Aleksei Petruhhin / Filippo Fontanelli

    Index Scriptorium Estoniae

    Fontanelli, Fillippo

    2017-01-01

    Euroopa Kohtu lahendist, mis puudutab Venemaa ametiasutuste poolt Läti ametiasutustele saadetud Eesti kodaniku Aleksei Petruhhini väljaandmise taotlust seoses narkootilise aine turustamise süüteoga

  6. Paciente con trombocitopenia trombótica inducida por heparina en hemodiálisis: abordaje de la anticoagulación del circuito

    Directory of Open Access Journals (Sweden)

    Mirian García Martínez

    Full Text Available Resumen El tratamiento renal sustitutivo de hemodiálisis es una técnica de depuración sanguínea extraterrenal, que requiere proteger al circuito extracorpóreo del paciente. Actualmente la heparina es el anticoagulante endovenoso de elección para evitar este tipo de complicaciones intradiálisis, siendo necesaria la individualización de las dosis por paciente. La trombocitopenia trombótica inducida por heparina es uno de los posibles efectos secundarios producidos por la administración de heparina. La bivalirudina es un inhibidor directo y específico de la trombina, útil en diferentes procedimientos, siendo utilizado en pacientes con problemas con la heparina y con fracaso renal crónico terminal que requieren terapias de diálisis continuas. Caso clínico: Paciente de 46 años, con múltiples antecedentes personales. Al inicio de su proceso debutó con una Gangrena de Fournier secundaria a isquemia de extremidades inferiores, por lo que precisó tratamiento anticoagulante. Hasta la fecha no presentó alergias medicamentosas conocidas. Posteriormente se objetivó plaquetopenia progresiva con diagnóstico de trombocitopenia inducida por heparina tipo II por lo que se restringió la heparina de bajo peso molecular y la heparina sódica, indicándose anticoagulación con Sintrom y Bivalirudina en casos de procedimientos con alto riesgo de sangrado. Conclusiones: Los pacientes de hemodiálisis en nuestro hospital, tienen como pauta habitual de anticoagulación la heparina. En este caso el diagnostico precoz de la trombocitopenia trombótica inducida por la heparina, fue crucial para evitar daños mayores, siendo el equipo de enfermería la piedra angular en el tratamiento en la sala de hemodiálisis.

  7. Õpetaja professionaalse rolli internaliseerimise hindamine õpetajakoolituse esmaõppe üliõpilaste hulgas / Äli Leijen, Katrin Kullasepp, Aivar Ots

    Index Scriptorium Estoniae

    Leijen, Äli, 1979-

    2013-01-01

    Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis

  8. Professional preparation of teachers - problems and possibilities. The Estonian case / Katrin Poom-Valickis, Ülle Saarits, Helle Sikka... [jt.

    Index Scriptorium Estoniae

    2008-01-01

    Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul

  9. Pylephlebitis: case report and literature review

    Directory of Open Access Journals (Sweden)

    Lizeth Flores-Anaya

    2015-09-01

    Full Text Available Se presenta el caso de un paciente varón de 50 años que acude a la emergencia del Hospital Dos de Mayo, Lima, Perú, por presentar fiebre, dolor abdominal, diarrea e ictericia. Se plantea un cuadro de infección intestinal como diagnóstico inicial. Es derivado al área de Medicina Interna donde se realizan diversos exámenes de laboratorio y auxiliares, dentro de los cuales se indica realizar una tomografía computarizada abdominal. El estudio imagenológico confirmó el diagnóstico de pileflebitis, iniciando tratamiento con antibióticos y anticoagulantes. La respuesta y evolución fueron favorables.

  10. Rector's office as of 31 December 2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  11. Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm

    Index Scriptorium Estoniae

    Vaus-Tamm, Heili, 1961-

    2007-01-01

    Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko

  12. Stirlitzi leitmotiivist rõõmsalt süüdimatu jäneste lauluni / Jüri Aarma

    Index Scriptorium Estoniae

    Aarma, Jüri, 1951-

    2010-01-01

    Vene filmimuusika kontserdist "Seitseteist kevadist hetke", mis toimub Vanemuise kontserdimajas 2. aprillil, Jõhvi kontserdimajas 4. aprillil ja Estonia kontserdisaalis 6. aprillil, lavastaja Ain Mäeots. Näidatakse vastavaid filmilõike

  13. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2006-01-01

    Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"

  14. Politicians spin attacks against methadone, syringe replacement / Milda Seputyte

    Index Scriptorium Estoniae

    Seputyte, Milda

    2005-01-01

    Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat

  15. Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja

    Index Scriptorium Estoniae

    Iir Hermeliin, pseud., 1973-

    2000-01-01

    Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"

  16. Rektoraat seisuga 31.12.2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  17. CERN firemen share their expertise

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    Firemen from local fire brigades have been coming to CERN to learn modern fire-fighting techniques. The CERN fire brigade has some unique training equipment for two particularly dangerous fire hazards, flashover and backdraft. Flashover occurs when a room that is on fire reaches a temperature of 400 to 500°. Beyond this point, a fully developed fire breaks out. This series of photos shows recruits from the fire services of Ain (Service Départemental Incendie et Secours (SDIS)) taking part in a flashover training exercise at CERN. Photo 01: Christopher Griggs, Chief Instructor of the CERN fire brigade (seated in the centre), explains the technique of using a fire-hose during a flashover to the recruits from the Ain SDIS.

  18. Teater

    Index Scriptorium Estoniae

    2006-01-01

    Vanemuise teatri draamanäitlejad tunnistasid möödunud aasta parimaks lavastuseks augustis Setumaal Obinitsas etendunud "Taarka", mille lavastas Ain Mäeots. Parimaks naispeaosatäitjaks valiti Merle Jääger, parimaks meespeaosatäitjaks Indrek Taalmaa, parimaks naiskõrvalosatäitjaks Karin Tammaru, parimaks meeskõrvalosatäitjaks Tanel Jonas. Eesti Draamateatri 2005. aasta Antsud ehk kolleegipreemiate laureaadid : Ingomar Vihmar (parim lavastaja), Ervin Õunapuu (parim kunstnik), Ülle Kaljuste (parim naisnäitleja), Ain Lutsepp (parim meesnäitleja), Väikesed Antsud pälvisid Elina Reinold ja Taavi Teplenkov, Abi-Antsuks kuulutati teatri kirjandusala juhataja Ene Paaver. Endla 2005. aasta kolleegipreemiad said Lii Tedre (parim naisnäitleja), Tambet Seling (parim meesnäitleja), Tiit Palu (parim lavastaja) ja Silver Vahtre (parim kunstnik)

  19. Phytotoxic Activity of Stem Bark and Leaves of Blepharocalyx salicifolius (Myrtaceae on Weeds

    Directory of Open Access Journals (Sweden)

    Eduardo HABERMANN

    2015-01-01

    En este estudio se evaluó la fitotoxicidad de los extractos y fracciones de las cortezas del tallo (suber y de las hojas maduras de Blepharocalyx salicifolius Kuth O. Berg sobre el crecimiento inicial de Echinochloa crus- galli L. P. Beauv. (capim-arroz y Euphorbia heterophylla L. (amendoim-bravo. Estos extractos fueron obtenidos por extracción exhaustiva y fraccionamiento por coeficiente de partición con disolventes orgánicos. Posteriormente los extractos de acetato de etilo de las hojas y de la corteza del tallo (suber fueron fraccionados por cromatografía de columna con disolventes de polaridad creciente. Tanto los extractos como las fracciones se ensayaron sobre las plantas diana en concentraciones de 0,2, 0,4 y 0,8 mg/mL, como control positivo se utilizó el herbicida comercial Sanson® disuelto en las mismas condiciones y como control negativo agua destilada con DMSO (5uL/mL. Los extractos de acetato de etilo de hojas maduras y corteza así como el extracto de hexano de la corteza mostraron los efectos inhibitorios más pronunciados sobre el crecimiento de las especies diana. De las ocho fracciones del extracto de acetato de etilo de hojas, seis inhibieron el crecimiento de las raíces de capim-arroz y cuatro fracciones inhibieron el crecimiento de las raíces y de la parte aérea de amendoin-bravo en todas las concentraciones ensayadas. De las seis fracciones del extracto de acetato de etilo de corteza, cuatro fueron fitotóxicos sobre el crecimiento de la raíz de capim-arroz en todas las concentraciones. Los extractos y fracciones de la corteza y de las hojas maduras provocaron anomalías en las especies diana. Estos resultados demostraron un efecto fitotóxico pronunciado de los extractos y fracciones de corteza y hojas maduras y su potencial uso como herbicidas naturales.

  20. Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2003-01-01

    Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill

  1. Materjalide jagamisest võidavad kõik / Maarja Soone

    Index Scriptorium Estoniae

    Soone, Maarja

    2011-01-01

    Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele

  2. Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx

    Index Scriptorium Estoniae

    Marx, Karl

    2000-01-01

    Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist

  3. Tallinn pokupajet zemlju dlja prokladki shosse Põhjaväil

    Index Scriptorium Estoniae

    2007-01-01

    Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega. Kommenteerivad Alo Brandt ja Ain Valdmann

  4. Disease: H00536 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available oencephalopathy (CADASIL) CADASIL is a chronic cerebrovascular disorder characterized by recurrent ischemic attacks and frequent migr...aines associated with diffuse white-matter abnormalities. CADASIL is caused by muta

  5. AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2011-01-01

    2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008

  6. Vene elu hõng Pilistvere rehealuses / Margot Visnap

    Index Scriptorium Estoniae

    Visnap, Margot, 1959-

    2008-01-01

    Pilistvere rehehoones etendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas Indrek Saar

  7. Vek lovi - vek utshis / Hillar Jõõts ; interv. Kalju Hook

    Index Scriptorium Estoniae

    Jõõts, Hillar

    2005-01-01

    Keskkonnainspektsiooni Pärnumaa osakonna juhtivspetsialist Hillar Jõõts keskkonnaministeeriumi kalavarude osakonna juhataja Ain Soome, Eesti Kalurite Liidu juhatuse esimehe Andres Variku ja Eesti Mereinstituudi direktori Toomas Saati kohtumisest Pärnumaa kaluritega

  8. Yeast Interacting Proteins Database: YOR171C, YOR034C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous l...chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous

  9. Bez kota mõsham razdolje / Jevgeni Kapov

    Index Scriptorium Estoniae

    Kapov, Jevgeni

    2004-01-01

    Sillamäe linnapea Ain Kiviorgi ja Vaivara vallavanema Veiko Luhalaidi kohtumisest Politseiameti peadirektori Robert Antropovi ja Ida politseiprefekti Kalev Prillopiga, kus arutati seoses politseireformiga Sillamäe regioonis tekkinud korrakaitse probleeme

  10. President Meri annetas aumärke

    Index Scriptorium Estoniae

    1996-01-01

    Riigivapi I klassi orden Jaan Krossile ja Kalju Lepikule; Riigivapi III klassi orden Ain Kaalepile, Hilja Rüütlile (Aili Helm); Riigivapi IV klassi orden Voldemar Millerile, Juhan Peeglile ja Ants Viiresele

  11. Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov

    Index Scriptorium Estoniae

    Ivanov, Sergei, 1958-

    2005-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist

  12. Dgroup: DG01675 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available aine ... D01152 ... Oxethazaine (JP17/USAN); Oxetacaine (INN) ... D08311 ... Oxetacaine hydrochloride ... DG00801 ... Bupivacaine ... D07552 ... Bupiva...caine (USAN/INN) ... D01450 ... Bupivacaine hydrochloride (USP); Bupivacaine hydrochl

  13. Biznes i obshtshestvo : Sillamäe võhodit iz desjatiletnei spjatshki / Artur Tooman

    Index Scriptorium Estoniae

    Tooman, Artur, 1971-

    2006-01-01

    Sillamäe linna eluolu, sadama mõju linna arengule. Arvamust avaldavad linnavolikogu liige Sergei Rjabkov, linnapea Ain Kiviorg ja kohalikud ettevõtjad. Lisa: diagrammid linna eelarve ja ettevõtluse kasvu kohta

  14. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"

  15. Üliohtliku laadungiga rongid plaanitakse Tallinnast välja saata / Signe Kalberg

    Index Scriptorium Estoniae

    Kalberg, Signe, 1959-

    2006-01-01

    Valitsusele esitatakse kolm Tallinna raudteeümbersõidu varianti, analüüsi koostamisse kaasati AS Deloitte&Touche Eesti. Kaart: Tallinna raudteeümbersõit. Kommenteerivad: Raivo Uukkivi, Ain Kaljurand, Toomas Vitsut

  16. Moroz i rozõ / Lev Livshits

    Index Scriptorium Estoniae

    Лившиц, Лев, 1924-2013

    2006-01-01

    Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest

  17. Toodangu maht sõltub impordist / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2002-01-01

    Saematerjali tootjate TOP 30. Käibe TOP 10. Käibe kasvu TOP 10. Kasumi TOP 10. Kasumi kasvu TOP 10. Rentaabluse TOP 10. Varade tootlikkuse TOP 10. Kahjumi TOP 5. Saematerjali tootjate finantsnäitajad. Saematerjali tootjate üldandmed. Tabelid

  18. Terve mõistusega ahnuse vastu / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2005-01-01

    Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

  19. Rumsfeldi ei ole kunagi unustatud / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    Väljaandes Teheran Times ilmunud Kian Mokhtari artiklist, milles käsitletakse USA kaitseministri Donald Rumsfeldi poliitikukarjääri, tema süüdistamist Iraagile massihävitusrelvade ja nendega seotud tehnoloogia müümise soodustamises 1980-ndatel aastatel, Iraagi-poolset keemiarelva kasutamist Iraani vastu

  20. Puti povõshenija effektivnosti proizvodstva / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

  1. Norma Maja astub kindlalt tulevikku / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2000-01-01

    AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

  2. Extensive Degradation and Low Bioavailability of Orally Consumed Corn miRNAs in Mice

    Directory of Open Access Journals (Sweden)

    Haiqiu Huang

    2018-02-01

    Full Text Available The current study seeks to resolve the discrepancy in the literature regarding the cross-kingdom transfer of plant microRNAs (miRNAs into mammals using an improved miRNA processing and detection method. Two studies utilizing C57BL/6 mice were performed. In the first study, mice were fed an AIN-93M diet and gavaged with water, random deoxynucleotide triphosphates (dNTP or isolated corn miRNAs for two weeks (n = 10 per group. In the second study, mice were fed an AIN-93M diet, or the diet supplemented with 3% fresh or autoclaved corn powder for two weeks (n = 10 per group. Corn miRNA levels were analyzed in blood and tissue samples by real-time PCR (RT-PCR following periodate oxidation and β elimination treatments to eliminate artifacts. After removing false positive detections, there were no differences in corn miRNA levels between control and treated groups in cecal, fecal, liver and blood samples. Using an in vitro digestion system, corn miRNAs in AIN-93M diet or in the extracts were found to be extensively degraded. Less than 1% was recovered in the gastrointestinal tract after oral and gastric phases. In conclusion, no evidence of increased levels of corn miRNAs in whole blood or tissues after supplementation of corn miRNAs in the diet was observed in a mouse model.

  3. Interpersonal violence in the United Arab Emirates.

    Science.gov (United States)

    Osman, Ossama T; Abbas, Alaa K; Eid, Hani O; Salem, Mohamed O; Abu-Zidan, Fikri M

    2014-01-01

    We aimed to study the anatomical distribution, severity and outcome of hospitalised interpersonal violence-related injured patients in Al-Ain, United Arab Emirates so as to give recommendations regarding the magnitude of this problem, its causes and priorities of prevention. Data were retrieved from Al-Ain Hospital Trauma Registry, which was prospectively collected over three years. There were 75 patients (males = 85.3%) having a mean age of 30 years. Eighty-one percent had blunt trauma. The estimated annual injury hospitalisation of interpersonal violence in Al-Ain city was 6.7 per 100,000 population. Females were significantly more injured by a family member (p = 0.02), at home (p = 0.005), and had more severe injuries (p = 0.003). There was a trend for children less than 18 years old to have more penetrating trauma (p = 0.06) and to be injured by a family member (p = 0.09). There was only one case of woman sexual assault and two cases of child abuse. The mean (SD) hospital stay was 7.87 (14.1) days. Less than 3% (n = 2) were admitted to the intensive care unit with no deaths. In conclusion, the majority of patients in our study had minor injuries. Nevertheless, the psychological impact may be major. This highlights the need to develop suitable mental health services in support of victims of interpersonal violence.

  4. Structural and frequency dependencies of a.c. and dielectric ...

    Indian Academy of Sciences (India)

    6Thin Film Laboratory, Department of Physics, Faculty of Education, Ain Shams ... conductivity and its frequency exponents were interpreted in terms of correlated barrier hopping ... cations in high-electron-mobility and heterostructure bipolar.

  5. Drug Allergy

    African Journals Online (AJOL)

    EL-HAKIM

    Immunology Unit, Department of Pediatrics, Ain Shams University, Cairo ... the case with food allergies).7,8 The parentral route ..... molecular-weight agents. ... and lack positive controls. ..... Immunology; Joint Council of Allergy, Asthma and.

  6. Ainevaldkond "Kehakultuur" / Leila Oja

    Index Scriptorium Estoniae

    Oja, Leila, 1966-

    2006-01-01

    Ainevaldkonnast "Kehakultuur" Tartu Ülikooli õppekava arenduskeskuses väljatöötatud põhikooli ja gümnaasiumi riiklikus õppekavas - ainevaldkonna kirjeldus, läbivad teemad, aineõpetuse struktuur ning vajalikud ressursid

  7. R102G polymorphism of the complement component 3 gene in ...

    African Journals Online (AJOL)

    Nur Afiqah Mohamad

    a Malaysian Research Institute on Ageing, Universiti Putra Malaysia, Serdang 43400, Selangor ... Peer review under responsibility of Ain Shams University. ..... b Student t-test, P < 0.01. ... The International ARM Epidemiological Study Group.

  8. Analytical solutions for one-dimensional advection– dispersion ...

    Indian Academy of Sciences (India)

    Department of Mathematics, AinShams University, Cairo 0020, Egypt. ∗. Corresponding author. .... Applying Laplace transformation to equations (1 and 2) gives: D d2. ∼ ...... Land, Water & Environmental Management: Integrated. Systems for ...

  9. ETV uus seriaal "Vistrik" kavatseb nime muuta / Anne Vetik

    Index Scriptorium Estoniae

    Vetik, Anne

    2006-01-01

    Toimuvad ETV uue krimisarja "Vistrik" võtted, stsenarist Mihkel Ulman, režissöör Ain Prosa, produtsent Raivo Suviste, kesksetes rollides Marko Matvere, Jaan Rekkor, Elisabet Tamm, tootjaks OÜ Balti Video

  10. [Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva

    Index Scriptorium Estoniae

    Kaldmaa, Kätlin, 1970-

    2011-01-01

    Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30

  11. Ohtlikud lennud / Simo Meinert

    Index Scriptorium Estoniae

    Meinert, Simo

    2006-01-01

    ETV uus algupärane krimisari "Ohtlik lend" : stsenarist Mihkel Ulman : lavastaja Ain Prosa : produtsent Raivo Suviste : peaosades Elisabet Tamm, Marko Matvere : Balti Video. Sama ka : Teleleht nr. 38, lk. 6-7 : ill

  12. Anal high-risk human papillomavirus infection and high-grade anal intraepithelial neoplasia detected in women and heterosexual men infected with human immunodeficiency virus

    Directory of Open Access Journals (Sweden)

    Gandra S

    2015-01-01

    Full Text Available Sumanth Gandra, Aline Azar, Mireya WessolosskyDivision of Infectious Disease and Immunology, University of Massachusetts Medical School, Worcester, MA, USABackground: Although anal high-risk human papillomavirus (HR-HPV infection and anal cytological abnormalities are highly prevalent among human immunodeficiency virus (HIV-infected men who have sex with men (MSM, there are insufficient data on these abnormalities among HIV-infected heterosexual men (HSM and women. In this study, we evaluated the prevalence of anal HR-HPV, cytological abnormalities, and performance of these screening tests in detecting high-grade anal intraepithelial neoplasia (AIN2+ among our cohort of HIV-infected MSM and non-MSM (HSM and women.Methods: A single-center, retrospective cohort study was conducted with HIV-infected individuals who underwent anal cancer screening with anal cytology and HR-HPV testing from January 2011 to January 31, 2013.Results: Screening of 221 HIV-infected individuals for both HR-HPV and anal cytology showed the presence of HR-HPV in 54% (abnormal anal cytology 48% of MSM, 28% (abnormal anal cytology 28% of HSM, and 27% (abnormal anal cytology 34% of women. Among 117 (53% individuals with abnormal results (HR-HPV-positive and/or cytology was atypical squamous cells of undetermined significance or above, 67 underwent high resolution anoscopy. Of these 67 individuals, 22 individuals had AIN2+ (17 MSM, four women, and one HSM. HR-HPV correlated better with AIN2+ than with anal cytology on biopsy in both MSM (r=0.29 versus r=0.10; P=0.05 versus P=0.49 and non-MSM (r=0.36 versus r=-0.34; P=0.08 versus P=0.09.Conclusion: Given the presence of AIN2+ in screened HIV-infected HSM and women, routine anal cancer screening in all HIV-infected individuals should be considered. HR-HPV merits further evaluation for anal cancer screening among non-MSM.Keywords: human immunodeficiency virus, anal human papillomavirus, heterosexual men, women, anal cancer

  13. Evaluación in vitro de tabletas orales de complejos de cobre con antiinflamatorios no esteroideos

    Directory of Open Access Journals (Sweden)

    Julie Fernanda Benavides Arévalo

    Full Text Available Introducción: los antiinflamatorios no esteroideos (AINES, son un grupo diverso y químicamente heterogéneo de fármacos analgésicos, antipiréticos y antiinflamatorios; sin embargo, su funcionamiento se ve afectado por su baja solubilidad acuosa y por la incidencia de efectos secundarios gastrointestinales. Como una alternativa a este problema, la formulación de tabletas orales con complejos de cobre con AINES muestra un adecuado comportamiento in vitro y podría tener efectos secundarios reducidos comparados con el fármaco antiinflamatorio no complejado. Objetivo: evaluar los procesos de desintegración y de disolución de tabletas orales de complejos de cobre con AINES. Métodos: luego de la síntesis y la caracterización instrumental de los complejos, se evaluó por microscopia óptica el efecto de la morfología, el tamaño de partícula y las características superficiales en el proceso de disolución; estos resultados fueron considerados para la formulación de los complejos y permitieron junto con la adecuada elección de un desintegrarte, un modificador de flujo, un lubricante y un aglutinante, la obtención de tabletas por compresión directa. Finalmente, en los comprimidos se evaluaron propiedades fisicomecánicas y los procesos de desintegración y disolución. Resultados: las tabletas de los complejos mostraron tiempos de desintegración entre 5 y 15 min y una liberación in vitro del 75 al 93 %. Conclusiones: la disolución de los AINES se vio favorecida por la formación de complejos, el menor tamaño de partícula, la presencia de poros y grietas en la superficie de las partículas y la inclusión de excipientes para la formulación de tabletas orales.

  14. Kolhoosikeskus - oma ja võõras = Collective farm centre - familiar and alien / Liina Jänes ; tõlk. Liisi Ojamaa

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2000-01-01

    Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart

  15. Mis saab maaärist? / Ester Šank

    Index Scriptorium Estoniae

    Šank, Ester, 1956-

    2000-01-01

    Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad

  16. Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak

    Index Scriptorium Estoniae

    Juurak, Raivo, 1949-

    2001-01-01

    Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades

  17. Plaat

    Index Scriptorium Estoniae

    2008-01-01

    Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"

  18. Download this PDF file

    African Journals Online (AJOL)

    Pediatrics Department, Faculty of Medicine, Ain Shams University corresponding author: ..... imaging studies: The diagnosis of CMV pneumonia can be suggested by chest radiograph find- ... dictive value and can aid in identifying children who ...

  19. Lugedes Pilve ja Pazi / Mathura

    Index Scriptorium Estoniae

    Mathura, pseud., 1973-

    2007-01-01

    Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)

  20. Solvent-extraction methods applied to the chemical analysis of uranium. III. Study of the extraction with inert solvents; Metodos de extraccion con disolventes aplicados al analisis quimico del uranio. III. Estudio de la extraccion con disolvente inertes

    Energy Technology Data Exchange (ETDEWEB)

    Vera Palomino, J; Palomares Delgado, F; Petrement Eguiluz, J C

    1964-07-01

    The extraction of uranium on the trace level is studied by using tributylphosphate as active agent under conditions aiming the attainment of quantitative extraction by means of a single step process using a number of salting-out agents and keeping inside the general lines as reported in two precedent papers. Two inert solvents were investigated, benzene and cyclohexane, which allowed to derive the corresponding empirical equations describing the extraction process and the results obtained were compared with those previously reported for solvents which, like ethyl acetate and methylisobuthylketone, favour to a more or less extend the extraction of uranium. (Author) 4 refs.

  1. Analysis of two drying methods on the yield and activity of sulfated polysaccharides extracted from Halymenia sp. (Rhodophyceae=Análise de dois métodos de secagem sobre o rendimento e atividade de polissacarídeos sulfatados extraídos da rodofícea Halymenia sp.

    Directory of Open Access Journals (Sweden)

    Norma Maria Barros Benevides

    2012-01-01

    Full Text Available Sulfated polysaccharides (SPs have attracted growing interest for various biotechnological applications. We evaluated the efficiency of two methods of drying SPs (M I and II extracted from Halymenia sp Rhodophyceae in order to compare the yield, purification and anticoagulant activity. The total SPs (TSPs were first extracted with papain in 100 mM sodium acetate (pH 5.0 containing cysteine and EDTA (5 mM. The TSPs obtained were dried in an oven (M I or lyophilized (M II and then examined by ion exchange chromatography (DEAE-cellulose using the NaCl gradient technique. The fractions were analyzed by 0.5% agarose gel electrophoresis and the in vitro anticoagulant activity was evaluated by the activated partial thromboplastin time test using normal human plasma and compared to heparin (HEP (193.00 IU mg-1. There was a difference in TSP yield of 19.05% and similar chromatographic SP profiles. Electrophoresis revealed fractions with distinct resolutions. The fractions eluted with 0.75 M of salt (M I and II were the most active, measuring 27.40 and 72.66 IU mg-1, respectively, when compared to HEP. Therefore, obtaining SP with anticoagulant activity from Halymenia sp. is more efficient by freeze-drying.Os polissacarídeos sulfatados (PS têm despertado interesse crescente para diversas aplicações em biotecnologia. Avaliou-se a eficiência de duas metodologias de secagem de PSs (M I e II extraídos da rodofícea Halymenia sp. a fim de se comparar o rendimento, a purificação e a atividade anticoagulante. Inicialmente, os PS totais (PSTs foram extraídos com papaína em tampão acetato de sódio 100 mM (pH 5,0 contendo cisteína e EDTA (5 mM. Os PSTs foram secados em estufa (M I ou liofilizados (M II, seguido por cromatografia de troca iônica (DEAE-celulose utilizando um gradiente de NaCl. As frações foram analisadas por eletroforese em gel de agarose a 0,5% e a atividade anticoagulante “in vitro” avaliada por meio do teste do tempo de

  2. The effects of composition and firing cycle on sintering of aluminium nitride

    International Nuclear Information System (INIS)

    Hewett, C.; Trigg, M.B.

    1992-01-01

    A central composite design was used to evaluate the relative effects of temperature, time and Y 2 O 3 content on the densification behaviour of a commercial aluminium nitride (AIN). Over the range of the independent variables studied, temperature was found to exert the dominate influence. Low levels of Y 2 O 3 were found to be effective for the densification of AIN. After firing, cubic 3Y 2 O 3.5 Al 2O3 (YAG) was detected for the lower levels of Y 2 O 3 addition. At the higher levels both YAG and 2Y 2 O 3 .Al 2 O 3 were detected. For a dense sample the values obtained for hardness and fracture toughness were comparable to those reported in the literature. 11 refs., 1 tab

  3. Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis Cost-effectiveness analysis of the use of celecoxib for the treatment of osteoarthritis

    Directory of Open Access Journals (Sweden)

    A. Moreno

    2003-02-01

    Full Text Available Antecedentes: Los antiinflamatorios no esteroideos (AINE, utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2, ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en el tratamiento de la artrosis. Material y métodos: El análisis coste-efectividad se ha diseñado mediante un modelo farmacoeconómico, definiéndose como unidad de efectividad a cada año de vida ganado tras la toma de celecoxib o AINE. La probabilidad de que aparezcan los diferentes resultados clínicos se ha obtenido de artículos publicados y de asunciones incorporadas. Sólo se han valorado los costes directos médicos (medicación, hospitalización, pruebas complementarias, analíticas, visitas extras, etc., sin haberse incluido otros costes. La perspectiva del estudio ha sido la del Sistema Nacional de Salud y el horizonte temporal elegido ha sido de 6 meses. Resultados: El coste adicional por cada año de vida ganado secundario al uso de celecoxib frente a los AINE clásicos asciende a 8.017 € (1.333.834 ptas.. El análisis de sensibilidad muestra cómo estos valores son sensibles a la modificación del coste de AINE y gastroprotector, así como a la inclusión de grupos poblacionales con edades más bajas. Conclusiones: Celecoxib puede ser considerado como una opción coste-efectiva en el tratamiento de la artrosis, ya que va a evitar muertes y a ganar años de vida para los pacientes con un coste adicional razonable y moderado, cuando se compara con los AINE. Su eficiencia aumenta a medida que se utiliza en poblaciones con menor edad media y, probablemente, en aquellas con mayor riesgo de desarrollar complicaciones GI.Background: Non

  4. Technical Progress Report for "Optical and Electrical Properties of III-Nitrides and Related Materials"

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Hongxing

    2008-10-31

    Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.

  5. Sekulariseeruv sakraalarhitektuur / Piret Lindpere

    Index Scriptorium Estoniae

    Lindpere, Piret, 1963-

    2002-01-01

    Moodsatest kirikutest, sajandilõpu eesti sakraalarhitektuurist. Pikemalt Tallinna metodisti kirikust (Vilen Künnapu, Ain Padrik), Püha Brigitta keskusest (projekteerimist juhtis Ra Luhse) ja ehitama hakatavast Viimsi Püha Jaakobi kirikust (Erkki Ristoja, Martin Aunin)

  6. Popmuusika / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2006-01-01

    Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"

  7. Itaalia seadustab ainuõige pitsa / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2004-01-01

    Pizza Napolitana ained, valmistusviis ja tulemus peavad vastama nõuetele. Itaalia põllumajandusministeeriumis välja töötatud pitsareeglid on osa Itaalia pingutustest kaitsta oma kuulsat kööki. Lisaks: Pitsavalmistamise reeglid

  8. Rector's office as of 31 December 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  9. Sumerki klassitsizma / Iosef Kats

    Index Scriptorium Estoniae

    Kats, Iosef

    2004-01-01

    Tallinna Viru Keskuse juurde püstitatud Mare Mikofi kavandatud hiigelskulptuurist. Kuju on Mikofi versioon Weizenbergi "Hämarikust". Viru Keskuse arhitektide Vilen Künnapu ja Ain Padriku arvates peaks naiseskulptuur mahendama kaubakeskuse kubistlikku ja maskuliinset arhitektuuri

  10. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2005-01-01

    Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"

  11. Emajõe äärde kerkib Tartu tulevane sümbol : Kroodo-Tower / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2005-01-01

    ASi Linnaehitus nõukogu liige Alar Kroodo plaanib Emajõe äärde 23-korruselise kõrghoone ehitamist, mille ehitusmaksumuseks kujuneb 100 kuni 200 miljonit krooni. Kõrghoone on projekteerinud arhitektid Ain Padrik ja Vilen Künnapu

  12. "Arvuti koolis" ja arvutiõpetus õppekavas / Helen Vanganen, Jevgeni Košelev

    Index Scriptorium Estoniae

    Vanganen, Helen

    2002-01-01

    Ligi 1500 aineõpetajat osales 2001/2002 õppeaastal kursusel "Arvuti koolis". Õpetajad tutvusid Oxfordi Ülikooli jätkukursusega - originaalprogramm kannab nime "Intelʼ Teach to the Future", mis on otseselt seotud infotehnoloogia rakendamisega õppekavas

  13. Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju

    Index Scriptorium Estoniae

    Varju, Peep

    2008-01-01

    Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu

  14. Nigel saak ähvardab kalureid pankrotiga / Jüri E Kukk

    Index Scriptorium Estoniae

    Kukk, Jüri E., 1961-

    2004-01-01

    Tänavune kalasaak Võrtsjärvest on jäänud väga kesiseks. Võrtsjärve Limnologiajaama juhataja Ain Järvalt peab kalade vähesuse põhjuseks heitlikke ilmastikuolusid. Lisa: Kalasaagid [1999-2003

  15. Rektoraat seisuga 31.12. 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  16. Spordipreemiad leidsid omaniku / Anne Põder

    Index Scriptorium Estoniae

    Põder, Anne, 1973-

    2007-01-01

    Järvamaa omavalitsuste liit ja spordiliit tunnustasid maakonna parimaid sportlasi, kelleks osutusid Ain-Alar Juhanson, Mikko Vanaisak, Viktoria Leks ja Grit Shadeiko. Spordiedendaja preemia sai Tiit Kavak, spordi elutöö preemia pälvis Enn Sõmeri

  17. Teatrid murravad päid ja piike / Dea Martinjonis

    Index Scriptorium Estoniae

    Martinjonis, Dea

    2000-01-01

    Eesti Televisiooni ekraanile jõuab teatriteemaline teleturniir "Bläkkpoks" : stsenarist Villu Kangur : režissöör Ain Prosa : saatejuht Sepo Seeman : toimetaja Anne Tuuling : produtsent Priit Vaher. Ka : Teleleht nr. 50, lk. 36-37

  18. Download this PDF file

    African Journals Online (AJOL)

    rme

    1Medical Genetic Center, Faculty of Medicine, Ain Shams University,. 2Community ... indications for amniocentesis in 60.8% were history of having previous child .... best location for placing the needle ..... leukemia, 8.5% for neural tube defects.

  19. Geochemistry of dark coastal heavy-mineral beaches sand (Annaba ...

    African Journals Online (AJOL)

    Acer

    3 Institute of Earth and Environmental Science, University of Potsdam, ... Some beaches are characterized by a red-brownish sand colour, the Ain Achir and the ... The occurrence of clays has been determined using the methyl-blue method.

  20. Antiagregation and anticoagulation, relationship with upper gastrointestinal bleeding Antiagregación y anticoagulación, relación con la hemorragia digestiva alta

    Directory of Open Access Journals (Sweden)

    Philip Wikman-Jorgensen

    2011-07-01

    Full Text Available Introduction: the high prevalence of cardiovascular diseases in the modern society brings a high prescription of platelet antiaggregation and anticoagulant medications. These treatments have been related to an increased incidence of upper gastrointestinal bleedings (UGB. Our aim was to estimate the fraction of UGB's presented to our hospital that was related to this kind of treatments and describe their clinical features in our environment. Material and methods: a retrospective search was performed in the archives of our hospital of all the patients with diagnosis of UGB admitted during the period 2004-2007 both years inclusive. Patients on antiplatelet and/or anticoagulant treatment were included. We analyzed the information regarding the use of medication, the bleeding lesion, the severity of the bleeding, recurrences, mortality and their clinical features. Results: we found 523 episodes of UGB. Of these 137 (26.1% were patients receiving platelet antiaggregation or anticoagulant drugs. The patients were male 60.2%, and had a mean age of 75.6 (± 10.8 years. The 65.5% (74 had HBP, 43.4% (49 diabetes mellitus and 37.2% (42 dislypemia and 13.3% (22 dementia. The drug most frequently implicated was ASA in 36.3% (41, followed by acenocumarol in 27.4% (31, clopidogrel 18.6% (21, double therapy (ASA + clopidogrel in 6.2% (7, triple therapy (ASA + clopidogrel + acenocumarol in 0.9% (1, triflusal 4.4% (5, low molecular weight heparin 5.3% (5, and ticlopidine in one patient (0.9%. Only 36.3% (41 were on treatment with proton pump inhibitors. There were 24 recurrences and 4 deaths. Conclusions: the 26.1% of the UGB attended in our environment were of iatrogenic origin. We also found a low use of proton pump inhibitors.Introducción: la alta prevalencia de la patología cardiovascular en las sociedades modernas conlleva una elevada prescripción y uso de medicamentos antiagregantes y anticoagulantes. Estos tratamientos se han relacionado con un aumento

  1. 9. II avati taas von Krahli Akna galerii

    Index Scriptorium Estoniae

    2004-01-01

    Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid

  2. Алексий II 1929-2008

    Index Scriptorium Estoniae

    2008-01-01

    Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president

  3. Dgroup: DG00804 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available aine hydrochloride Neuropsychiatric agent ... DG02030 ... Anesthetics ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic... ... DG01675 ... Local anesthetic ... DG01673 ... Amide type local anesthetic ATC code: N01BB07 Local anesthetic

  4. deletion polymorphism of ACE gene and Alzheimerв€™s disease

    African Journals Online (AJOL)

    Omayma M. Hassanin

    2014-06-27

    Jun 27, 2014 ... ease, 45 males and 39 females aged 65 ± 7 years from the Geriatric Department at Ain-Shams Uni- ..... alternative therapy provided by the ACE protein. .... enzyme (ACE) gene polymorphism in relation to physical perfor-.

  5. Egyptian Journal of Pediatric Allergy and Immunology (The): Journal ...

    African Journals Online (AJOL)

    Publisher. Contact: Professor Ihab Z. El-Hakim. Email ihab.elhakim@gmail.com. Phone +201111224974. Fax … +202 33045060. Children's Hospital, Ain Shams University, Ramses Street, Abbassiya, Cairo 11566, Egypt. The Egyptian Society of Pediatric Allergy and Immunology ...

  6. Ahhaa teaduskeskus Tartus = The Ahhaa Science Centre in Tartu

    Index Scriptorium Estoniae

    2012-01-01

    Arhitektide Ain Padriku ja Vilen Künnaou projekteeritud Ahhaa teaduskeskuse (Sadama 1) ekspositsiooni ja sisekujundusest. Sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka), loetletud nende ühiselt tehtud töid. Infograafika: Alar Pikkorainen

  7. Keskerakonna nõrk PR-käik / Aivar Hundimägi

    Index Scriptorium Estoniae

    Hundimägi, Aivar, 1975-

    2008-01-01

    Seoses keskerakondlastest ettevõtjate Richard Siku ja Heldur Undi sattumisega bordelliskandaali on Keskerakonna aukohtu esimees Ain Seppik pöördunud järelpärimisega politseiameti peadirektori Raivo Aegi ja riigi peaprokuröri Norman Aasa poole

  8. Data of evolutionary structure change: 1WPWB-1XAAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1WPWB-1XAAA 1WPW 1XAA B A GFTVALIQGDGIGPEIVSKSKRILAKINELYSLPIEYIE...SDGVAVGMKIITRFASERIAKVGLNFALRRRKKVTCVHKANVMRITDGLFAEACRSVLKG--KVEYSEMYVDAAAANLVRNPQMFDVIVTENVYGDILSDEASQIAGS...LEU CA 502 1XAA A 1XAAA...R CA 306 1XAA A 1XAAA...ain>A 1XAAA KANVL-EVGEF -

  9. Tornkorteritega maja otse tulevikust / Ave Randviir

    Index Scriptorium Estoniae

    Randviir, Ave, 1981-

    2006-01-01

    Vilen Künnapu, Ain Padriku ja Kristi Alamaa ümberehitusprojekti järgi valminud modernsest kolme torniga elumajast Triumph Plaza Tallinnas Narva mnt. 7. Rekonstrueeriti Olga Brunsi ja Mart Kallingu 1981. a. valminud konterihoone. Kommenteerib Vilen Künnapu

  10. Uus eksamikord tõi 13 tudengi eksmati / Inga Uusmaa

    Index Scriptorium Estoniae

    Uusmaa, Inga

    2001-01-01

    Eesti Sisekaitseakadeemias kehtestatud vaheeksami süsteemist, mille järgi tuleb igas aines sooritada kaks eksamit, teine eksam ei anna küll ainepunkte, kuid selles läbikukkumine tähendab seniste ainetulemuste tühistamist

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 149 ... ... of Pediatric Asthma Review of Ain Shams Pediatric Hospital Chest Clinic ... Vol 15, No 1 (2017), Gastrointestinal manifestations in children ... Vol 6, No 1 (2008), Immunogenetics of type 1 diabetes mellitus, Abstract PDF.

  12. Rein Sillar : Kui argumente ei jätku, on hea KGB kaart välja tõmmata / Rein Sillar ; interv. Toomas Sildam

    Index Scriptorium Estoniae

    Sillar, Rein

    2001-01-01

    Eesti NSV KGB viimane esimees ei usu, et eestlased sooviksid minevikuhaavu lahti rebida. Vare-Shironini kokkuleppest KGB tegevuse lõpemisest Eestis, süümevandest, ENSV Riiklikust Julgeolekukomiteest. Kommenteerivad: Ain Kaalep, Peeter Olesk, Heinz Valk. Parlamendisaadik (P. Olesk)

  13. 90-aastane Tallinna Polütehnikum - ainus omataoline / Sirje Tohver

    Index Scriptorium Estoniae

    Tohver, Sirje

    2005-01-01

    Polütehnikumi vilistlastest õpetajate (Heiki Tähis, Andres Ojalill, Jüri Jakubovitš, Hugo Tartlan, Hergi Kruusimaa, Tiina Karja, Priit Kalman, Ardi Priks, Jaan Kuus, Jüri Puhang, Vello Vanem, Rein Kask, Kalle Sammal, Ain Saaret) meenutusi

  14. Obtention of differential sections in nuclear reactions using a thick target

    International Nuclear Information System (INIS)

    Chavez R, R.

    2000-01-01

    The nuclear reaction analysis (NRA) technique is used mainly for detecting the presence and concentration of light elements of great importance such as: carbon, nitrogen and oxygen. This work has the objective to obtain the differential sections of 16 O and 14 N starting from the irradiation with deuterons of TiSrO 3 samples, of AIN and AIN 2 at energies of 2000 KeV and 1800 KeV respectively. The present work have four chapters; chapter 1 is focused to the physical aspects which takes part in the NRA technique. The technical requirements as well as the necessary equipment for developing the techniques are described in the chapter 2. In chapter 3 it is described the algorithm developed for to obtain the differential sections starting from experimental data, and finally, in chapter 4 are given the results and conclusions. (Author)

  15. Fibre optique à la maison en Pays de Gex et de Bellegarde

    CERN Multimedia

    CERN. Geneva; Goy, Jean Paul

    2010-01-01

    Le Syndicat Intercommunal d’Electricité de l’Ain(SIEA) déploie un réseau FTTH (Fiber To The Home) de fibres optiques dans le département de l’Ain vers l’ensemble des habitations. Le déploiement sur la zone pilote du Pays de Gex et du Bassin Bellegardien arrive dans la phase terminale vers les habitations. Le SIEA présentera ses activités, l’état du développement du réseau, les implications d’une connexion fibre optique et les procédures d’abonnement. La présentation sera donnée en Français. -------------------------------------------------------------------------------------------------------------------------------Public conference "Optical fiber To The Home in Pays de Gex et de Bellegarde" Michel Chanel et Jean Paul Goy (SIEA) Wednesday, 19th May at 11.30 hrs., Counc...

  16. Portugalikeelse kirjanduse retseptsioon Eestis / Mele Pesti

    Index Scriptorium Estoniae

    Pesti, Mele, 1979-

    2011-01-01

    Portugalikeelse kirjanduse tõlgetest ja nende vastuvõtust alates esimese tõlke ilmumisest 1890. aastal kuni 2005. aastani ning retseptsiooni pärssinud teguritest. Ülevaade kahe olulisema tõlkija Aita Kurfeldti ja Ain Kaalepi tööst

  17. Neurofibromatosis type 1 and multiple sclerosis: Genetically related ...

    African Journals Online (AJOL)

    Solaf M. Elsayed

    2016-10-25

    Oct 25, 2016 ... a Genetics Unit, Children's Hospital, Ain Shams University, Egypt b Neurology Department ... Through the past 6 months, she started to develop short term memory loss with intact long term memory. There was no other motor ...

  18. Veel vene koolist ja krokodillipisaratest / Yana Toom

    Index Scriptorium Estoniae

    Toom, Yana, 1966-

    2011-01-01

    Artikli autori arvates ei ole eesti keele õpetamise kvaliteet piisav, et seada eesmärgiks eestikeelne aineõpe vene koolide gümnaasiumiastmes. Vastukaja artiklile: Priit Simson. Venekeelne kool ja krokodillipisarad. Eesti Päevaleht (2011) 9. sept., lk. 2

  19. Uurija Rita ja näitleja Elisabet / Jüri Laulik

    Index Scriptorium Estoniae

    Laulik, Jüri, 1959-

    2006-01-01

    ETV uues algupärases krimisarjas "Ohtlik lend" teeb kaasa ka Tallinna Linnateatri näitlejanna Elisabet Tamm. Sarja stsenarist on Mihkel Ulman, lavastaja Ain Prosa. Näitlejannast lähemalt. Sama : Teleleht, nr. 41, lk. 6-7 : ill

  20. Spielpläne

    Index Scriptorium Estoniae

    2007-01-01

    Laulja Annely Peebo ooperis "Jenufa" 2., 4., 6., 9., 11., 13. ja 15. mail Mailandis. Eesti Filharmoonia Kammerkoor esinemas 27. ja 28. mail Bergenis. Laulja Ain Anger 19. mail Placido-Domingo Galal ja 31. mail ooperis "Othello" Viini Riigiooperis

  1. Parts : ministrite minevik olgu avalik / Juhan Parts ; interv. Toomas Sildam

    Index Scriptorium Estoniae

    Parts, Juhan, 1966-

    2003-01-01

    Peaminister Juhan Parts vastab küsimustele, mis on seotud politseinike altkäemaksu andmise avalikuks tulekuga, komissar Indrek Sirgi ametist lahkumisega ja ministrite seadusrikkumiste avalikustamisega. Kommenteerivad: Margus Leivo, Tarmo Loodus, Ain Seppik. Vt. samas: Valik saladuses peetavast teabest

  2. City Plaza büroohoone edu üllatas asjatundjaid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2004-01-01

    Kuigi kinnisvaraspetsialistid olid City Plaza büroohoonesse äripindade rentnike leidmise suhtes skeptilised, on Tallinnas asuvas City Plaza kõrghoones 31 äripinnast rentimata veel vaid kaks. Vt. samas intervjuud Ain Kivisaarega. Lisa: City Plaza büroohoone

  3. Staff

    Index Scriptorium Estoniae

    2006-01-01

    TÜ teadustöötajaist ja õppejõududest on 2/3 doktorikraadiga. TÜ rektor Jaak Aaviksoo ja teadusprprektor Ain Heinaru valiti Euroopa kõrghariduspoliitika juhtorganitesse. Sotsiaalteaduskonna prof. Wolfgang Drechsler sai Saksa-Eesti akadeemiliste suhete arendamise eest Saksamaa Liitvabariigi Teeneteristi

  4. Challenges in diagnosis and counseling of a family with two ...

    African Journals Online (AJOL)

    Heba S. Abd-Elkhalek

    2015-12-29

    Dec 29, 2015 ... Genetics Unit, Childrens' Hospital, Ain Shams University, Cairo, Egypt. Available online 29 ... normal milestones of development in the first 6 months of life .... most important clue in family history that indicated the pres- ence of ...

  5. Hepatoadrenal syndrome in Egyptian children with liver cirrhosis ...

    African Journals Online (AJOL)

    Amel A.M. Elfaramawy

    2012-08-03

    Aug 3, 2012 ... E-mail address: amelhome4@gmail.com. Peer review under responsibility of Ain Shams University. Production and hosting by ..... [23] Ho JT, Al-Musalhi H, Chapman MJ, Quach T, Thomas PD, Bagley. CJ, et al. Septic shock ...

  6. Risk factors for autism: An Egyptian study

    African Journals Online (AJOL)

    Farida El-Baz

    IQ assessment using Stanford–Binrent intelligence scale, and assessment of severity ... All studied developmental milestones were delayed among autistic children than ... Peer review under responsibility of Ain Shams University. ..... Treatment and educa- ..... communication in people with autism and intellectual disability. J.

  7. Determination of thorium and uranium contents in soil samples ...

    Indian Academy of Sciences (India)

    Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egyp; Experimental Nuclear Physics Department, Atomic Energy Authority, Nuclear Research Center, Abu Zabaal, 13759 Cairo, Egypt; Faculty of Girls for Art, Science and Education, Ain-Shams ...

  8. Naised Ilvesenahkades / Agnes Nõu

    Index Scriptorium Estoniae

    Nõu, Agnes

    2006-01-01

    Jahtlaeva Santa Maria kapteni Ain Roosma soovist kogu jahtlaeva naiskond ühtsesse vormi riietada sündis tuntud Eesti spordiriiete tootjal AS-il Ilves-Extra uus tootegrupp - purjetamisrõivad. Vt. samas: Ilves-Extra valmistab nüüd purjetamisrõivaid

  9. 3 + 2 = 450 : 3+2 õppesüsteem tõi kaasa kuni 450 tudengiga hiigelloengud / Anu Mõistlik, Jüri Saar

    Index Scriptorium Estoniae

    Mõistlik, Anu, 1980-

    2002-01-01

    Vastne õppekord pakib loengusaali sadu noori. 3+2 tuleku otsustas kuue inimese hääletus. Vanade õppekavade ained kaovad järjestikku tunniplaanidest. Teadusmagistreid enam ei tule. Ainepunktide ülekandmiseks peab üliõpilane ise vaeva nägema

  10. Musta pesu pesemine / Ivar Tallo

    Index Scriptorium Estoniae

    Tallo, Ivar, 1964-

    2005-01-01

    Valitsuse korruptsioonivastase asjatundjate komisjoni juht aastatel 2002-2003 on seisukohal, et ajakirjandus on ainult üks võimalikest vahenditest tõe tuvastamisel ning lõpliku tõe Edgar Savisaare ja Ain Hanschmidti jt seotud skandaalide kohta peavad selgitama võimuinstitutsioonid

  11. Antibacterial, antioxidant and cytotoxic activities of extracts from the ...

    African Journals Online (AJOL)

    Unicellular green algal strains, identified as Cosmarium (Chlorophyta), were isolated from Ain-Echeffa hot spring in north Tunisia. Different extracts (methanol, hexane, acetone, acetone: methanol and water) obtained from both biomass and extracellular polysaccharides (EPS) were evaluated for their antibacterial, ...

  12. Väikesed inimesed kodumaises seebivahus / Margot Visnap

    Index Scriptorium Estoniae

    Visnap, Margot, 1959-

    2000-01-01

    Kanal 2 uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions

  13. Nad saidki hakkama / Jüri Laulik

    Index Scriptorium Estoniae

    Laulik, Jüri, 1959-

    2000-01-01

    Kanal 2 uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions

  14. Tallinn hakkab Põhjaväila tarvis maid ostma

    Index Scriptorium Estoniae

    2007-01-01

    Seoses Russalkast Ahtri tänavani ulatuva tee-ehitusega seisab linnal ees 16 maaküsimuse lahendamine. Probleemidest seoses väila osaliselt merre ehitamisega ja väila lõpuniehitamiseks lammutada tulevad hooned. Kommenteerivad Alo Brandt ja Ain Valdmann

  15. Reiljan, Savisaar show who's in charge / Joel Alas

    Index Scriptorium Estoniae

    Alas, Joel

    2006-01-01

    Eestimaa Rahvaliidu esimees Villu Reiljan ja Eesti Keskerakonna esimees Edgar Savisaar otsustavad uue presidendi üle. Villu Reiljan toetab Arnold Rüütlit. Edgar Savisaare, Ene Ergma, Toomas Hendrik Ilvese ja Riigikogu liikme Ain Seppiku väljaütlemised

  16. Pilistvere rehehoones tapetakse Rasputin / Kaarel Aluoja

    Index Scriptorium Estoniae

    Aluoja, Kaarel

    2008-01-01

    7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

  17. Rasputin - lugu rahva latvade juurimisest / Kati Murutar

    Index Scriptorium Estoniae

    Murutar, Kati, 1967-

    2008-01-01

    7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

  18. Pilistvere vana rehe all päästetakse Venemaad / Krista Valdvee

    Index Scriptorium Estoniae

    Valdvee, Krista, 1978-

    2008-01-01

    7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

  19. Pilistveres saab homme kohtuda Rasputiniga / Ülle Lätte

    Index Scriptorium Estoniae

    Lätte, Ülle, 1955-

    2008-01-01

    7. aug. Pilistvere vanas rehehoones esietenduvast Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse toob välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

  20. Ellunäod toovad välja "Rasputini" / Riina Mägi

    Index Scriptorium Estoniae

    Mägi, Riina, 1957-

    2008-01-01

    7. aug. Pilistvere vanas rehehoones esietenduvast Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse toob välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

  1. Pilistveres tegutseb Rasputin / Margus Haav

    Index Scriptorium Estoniae

    Haav, Margus, 1969-

    2008-01-01

    7. aug. Pilistvere vanas rehehoones esietenduvast Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse toob välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

  2. Rasputin : Rahvakese jaoks on vaja elada / Margus Mikomägi

    Index Scriptorium Estoniae

    Mikomägi, Margus, 1956-

    2008-01-01

    7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

  3. Naissoo ja Agan - 2 in 1 / Igor Garšnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2011-01-01

    15. mail Tallinnas Mustpeade majas toimunud kontserdist "Naissoo ja Agan 111", kus esinesid Tõnu Naissoo, Ain Agan, Teemu Viinikainen, Raul Sööt, Daniel Aljo, Joel-Rasmus Remmel, Mihkel Mälgand, Toomas Rull ja Tallinna Kammerorkester Jüri-Ruut Kanguri juhatusel

  4. Efficacious Oxime for Organophosphorus Poisoning: A Minireview

    African Journals Online (AJOL)

    Erah

    University, PO Box 17666, AlAin, United Arab Emirate. Abstract ... poisoning is a major health problem all over the world ... contaminated food in a social ceremony in. Magrawa, India [7] .... either gave null effect or possible harm [19]. According ...

  5. Pinning Down versus Density

    OpenAIRE

    Juhász, István; Soukup, Lajos; Szentmiklóssy, Zoltán

    2015-01-01

    The pinning down number $ {pd}(X)$ of a topological space $X$ is the smallest cardinal $\\kappa$ such that for any neighborhood assignment $U:X\\to \\tau_X$ there is a set $A\\in [X]^\\kappa$ with $A\\cap U(x)\

  6. Sapucaia nuts (Lecythis pisonis) modulate the hepatic inflammatory ...

    African Journals Online (AJOL)

    Mariella

    2016-06-22

    Jun 22, 2016 ... antioxidant and anti-inflamatory effects of this nut after its introduction into a control (AIN-93G) or ... fat diets increases the total amount of body lipids, and ..... physical exercise on lipid profile, oxidative stress and antioxidant.

  7. Research Article

    African Journals Online (AJOL)

    2017-05-01

    May 1, 2017 ... arid climate, it already suffers the problem of flash flooding during the last 100 years .... Location of Ain Sefra watershed in Algeria (ASTER, 30m resolution, Map datum .... Six methods are included fot Routing model (Kinematic ...

  8. Material and Phonon Engineering for Next Generation Acoustic Devices

    Science.gov (United States)

    Kuo, Nai-Kuei

    This thesis presents the theoretical and experimental work related to micromachining of low intrinsic loss sapphire and phononic crystals for engineering new classes of electroacoustic devices for frequency control applications. For the first time, a low loss sapphire suspended membrane was fabricated and utilized to form the main body of a piezoelectric lateral overtone bulk acoustic resonator (LOBAR). Since the metalized piezoelectric transducer area in a LOBAR is only a small fraction of the overall resonant cavity (made out of sapphire), high quality factor (Q) overtones are attained. The experiment confirms the low intrinsic mechanical loss of the transferred sapphire thin film, and the resonators exhibit the highest Q of 5,440 at 2.8 GHz ( f·Q of 1.53.1013 Hz). This is also the highest f·Q demonstrated for aluminum-nitride-(AIN)-based Lamb wave devices to date. Beyond demonstrating a low loss device, this experimental work has laid the foundation for the future development of new micromechanical devices based on a high Q, high hardness and chemically resilient material. The search for alternative ways to more efficiently perform frequency control functionalities lead to the exploration of Phononic Crystal (PnC) structures in AIN thin films. Four unit cell designs were theoretically and experimentally investigated to explore the behavior of phononic bandgaps (PBGs) in the ultra high frequency (UHF) range: (i) the conventional square lattice with circular air scatterer, (ii) the inverse acoustic bandgap (IABG) structure, (iii) the fractal PnC, and (iv) the X-shaped PnC. Each unit cell has its unique frequency characteristic that was exploited to synthesize either cavity resonators or improve the performance of acoustic delay lines. The PBGs operate in the range of 770 MHz to 1 GHz and exhibit a maximum acoustic rejection of 40 dB. AIN Lamb wave transducers (LWTs) were employed for the experimental demonstration of the PBGs and cavity resonances. Ultra

  9. Enhancement of biodiesel production from different species of algae

    Directory of Open Access Journals (Sweden)

    El-Moneim M. R. Afify, Abd

    2010-12-01

    Full Text Available Eight algal species (4 Rhodo, 1 chloro and 1 phaeophycean macroalgae, 1 cyanobacterium and 1 green microalga were used for the production of biodiesel using two extraction solvent systems (Hexane/ether (1:1, v/v and (Chloroform/ methanol (2:1, v/v. Biochemical evaluations of algal species were carried out by estimating biomass, lipid, biodiesel and sediment (glycerin and pigments percentages. Hexane/ ether (1:1, v/v extraction solvent system resulted in low lipid recoveries (2.3-3.5% dry weight while; chloroform/methanol (2: 1, v/v extraction solvent system was proved to be more efficient for lipid and biodiesel extraction (2.5 – 12.5% dry weight depending on algal species. The green microalga Dictyochloropsis splendida extract produced the highest lipid and biodiesel yield (12.5 and 8.75% respectively followed by the cyanobacterium Spirulina platensis (9.2 and 7.5 % respectively. On the other hand, the macroalgae (red, brown and green produced the lowest biodiesel yield. The fatty acids of Dictyochloropsis splendida Geitler biodiesel were determined using gas liquid chromatography. Lipids, biodiesel and glycerol production of Dictyochloropsis splendida Geitler (the promising alga were markedly enhanced by either increasing salt concentration or by nitrogen deficiency with maximum production of (26.8, 18.9 and 7.9 % respectively at nitrogen starvation condition.

    Ocho especies de algas (4 Rhodo, 1 cloro y 1 macroalgas phaeophycean, 1 cianobacteria y 1 microalga verde fueron utilizados para la producción de biodiesel utilizando dos sistemas de extracción con disolventes (hexano/éter (1:1, v/v y (Cloroformo / metanol (2:1, v/v. La evaluación bioquímica de las especies de algas se llevó a cabo mediante la estimación de los porcentajes de biomasa, de lípidos, de biodiesel y de sedimento (glicerina y pigmentos. El sistema extracción con el disolvente hexano/éter (1:1, v

  10. Chétoui olive leaf extracts: influence of the solvent type on phenolics and antioxidant activities

    Directory of Open Access Journals (Sweden)

    Abaza, Leila

    2011-03-01

    Full Text Available The aim of this study was to investigate the influence of the solvent type on the extraction of phenolics and the antioxidant properties of the extracts obtained from Chétoui olive leaves. Extraction was conducted at room temperature using four solvents: deionized water (ddH2O, 80% methanol (80% MeOH, 70% ethanol (70% EtOH, and 80% acetone. Total phenols and total flavonoids were measured using the Folin-Ciocalteau and aluminum chloride colorimetric methods, respectively. The antioxidant properties have been determined by two scavenging activity methods, DPPH and ABTS. The total phenol and flavonoid contents of the olive leaf extracts (OLEs ranged from 16.52 to 24.93 mg gallic acid g–1 DM and from 6.23 to 21.47 mg catechin g–1 DM, respectively. The IC50 values of DPPH varied from 0.17 to 0.97 mg mL–1 and the antioxidant activity values determined by ABTS (trolox equivalent antioxidant capacity were between 629.87 and 1064.25 μmol TE g–1 DM. Our results revealed that extracting solvents have a significant influence on the antioxidant properties of olive leaves and that a methanol mixture is recommended for extracts with high levels of flavonoids and important antioxidant activities. Moreover, it was noticed that the trolox equivalent antioxidant capacity (TEAC depends more on the flavonoids (r = 0.821 than on the total phenols (r = 0.399.

    El objetivo de este trabajo fue estudiar la influencia del disolvente usado en la extracción de los compuestos fenólicos y en las propiedades antioxidantes de los extractos obtenidos a partir de hojas de olivo procedente de la variedad Chétoui. La extracción se realizó a temperatura ambiente, usando cuatro disolventes: agua desionizada(ddH2O, metanol 80% (80% MeOH , etanol 70% (70% EtOH, y acetona 80%. Los fenoles totales y los flavonoides totales se midieron usando los métodos colorimétricos con Folin-Ciocalteau y cloruro de aluminio

  11. Fractionation of commercial hexane and use of its fractions as extracting solvent of cottonseed oil

    Directory of Open Access Journals (Sweden)

    Megahed, Ola A.

    2001-04-01

    Full Text Available The problem of producing off-graded cottonseed oil using locally produced commercial hexane as extracting solvent has explored this research. It was aimed in this work to investigate whether this problem can be solved by controlling the boiling range of the extracting solvent. Four different hexane fractions of different boiling ranges were prepared from commercial hexane. The boiling range of commercial hexane was 62-68ºC while the boiling ranges of the four fractions were 62- 64, 64-65, 65-66 and 66-68ºC. Commercial hexane and the prepared four hexane fractions were then used to extract cottonseed oil from a fixed seed sample. The five crude oil samples were then refined and bleached and their colours were measured. The results have shown that the heaviest hexane fraction ( b.r 66-68ºC produced the lightest coloured oils. The colour index of the bleached oil using this heavy cut was 190 compared to 350 using the original commercial hexane. However, the production of a commercial hexane cut having a narrow boiling range will be costly. Therefore, this research has been extended to investigate the suitability of a heavy petroleum cut which has a boiling range as wide as that of commercial hexane to extract cottonseed oil. The boiling range of this cut was 66-72ºC. The obtained results proved that the extraction of cottonseed oil using that heavy petroleum fraction produces much lighter oil than the use of conventional hexane solvent.En esta investigación se ha examinado el problema de producir aceite de semilla de algodón sin-clasificar usando hexano comercial producido localmente como disolvente. El objetivo de este trabajo fue investigar si este problema puede ser solucionado controlando el rango de ebullición del disolvente extractante. Cuatro fracciones diferentes de hexano de diversos rangos de ebullición fueron preparadas del hexano comercial. El rango al que ebullía el hexano comercial era 62-68ºC mientras que los

  12. Pt-catalyzed ozonation of aqueous phenol solution using high-gravity rotating packed bed

    International Nuclear Information System (INIS)

    Chang, Chia-Chi; Chiu, Chun-Yu; Chang, Ching-Yuan; Chang, Chiung-Fen; Chen, Yi-Hung; Ji, Dar-Ren; Tseng, Jyi-Yeong; Yu, Yue-Hwa

    2009-01-01

    In this study, a high-gravity rotating packed bed (HGRPB or HG) was used as a catalytic ozonation (Cat-OZ) reactor to decompose phenol. The operation of HGRPB system was carried out in a semi-batch apparatus which combines two major parts, namely the rotating packed bed (RPB) and photo-reactor (PR). The high rotating speed of RPB can give a high volumetric gas-liquid mass transfer coefficient with one or two orders of magnitude higher than those in the conventional packed beds. The platinum-containing catalyst (Dash 220N, Pt/γ-Al 2 O 3 ) and activated alumina (γ-Al 2 O 3 ) were packed in the RPB respectively to adsorb molecular ozone and the target pollutant of phenol on the surface to catalyze the oxidation of phenol. An ultra violet (UV) lamp (applicable wavelength λ = 200-280 nm) was installed in the PR to enhance the self-decomposition of molecular ozone in water to form high reactive radical species. Different combinations of advanced oxidation processes (AOPs) with the HGRPB for the degradation of phenol were tested. These included high-gravity OZ (HG-OZ), HG catalytic OZ (HG-Cat-OZ), HG photolysis OZ (HG-UV-OZ) and HG-Cat-OZ with UV (HG-Cat-UV-OZ). The decomposition efficiency of total organic compound (η TOC ) of HG-UV-OZ with power of UV (P UV ) of 16 W is 54% at applied dosage of ozone per volume sample m A,in = 1200 mg L -1 (reaction time t = 20 min), while that of HG-OZ without the UV irradiation is 24%. After 80 min oxidation (m A,in = 4800 mg L -1 ), the η TOC of HG-UV-OZ is as high as 94% compared to 82% of HG-OZ process. The values of η TOC for HG-Cat-OZ process with m S = 42 g are 56% and 87% at m A,in = 1200 and 4800 mg L -1 , respectively. By increasing the catalyst mass to 77 g, the η TOC for the HG-Cat-OZ process reaches 71% and 90% at m A,in = 1200 and 4800 mg L -1 , respectively. The introduction of Pt/γ-Al 2 O 3 as well as UV irradiation in the HG-OZ process can enhance the η TOC of phenol significantly, while γ-Al 2 O 3 exhibits

  13. Extracción de cromo con disolventes orgánicos. I parte. Extracción con DEHPA

    OpenAIRE

    de Juan, D.; Meseguer, V.; Lozano, L. J.

    1998-01-01

    Chromium and its compounds give toxic and/or hazardous characteristics to all those industrial wastes, solids or liquids, that contain them. Organic solvent extraction is a technique that allows the recovery of chromium contained in these residues. In this work the extraction of Cr(III) from aqueous solutions with solutions of a cationic reactive (DEHPA) in kerosene is studied. In the same way the stripping process was studied. It has been found that Cr(III) and DEHPA react in a 1/1 molar rat...

  14. Nucleus Accumbens Shell and mPFC but not Insula Orexin-1 Receptors Promote Excessive Alcohol Drinking

    Directory of Open Access Journals (Sweden)

    Kelly Lei

    2016-08-01

    Full Text Available Addiction to alcohol remains a major social and economic problem, in part because of the high motivation for alcohol that humans exhibit and the hazardous binge intake this promotes. Orexin-1-type receptors (OX1Rs promote reward intake under conditions of strong drives for reward, including excessive alcohol intake. While systemic modulation of OX1Rs can alter alcohol drinking, the brain regions that mediate this OX1R enhancement of excessive drinking remain unknown. Given the importance of the nucleus accumbens (NAc and anterior insular cortex (aINS in driving many addictive behaviors, including OX1Rs within these regions, we examined the importance of OX1Rs in these regions on excessive alcohol drinking in C57BL/6 mice during limited-access alcohol drinking in the dark cycle. Inhibition of OX1Rs with the widely used SB-334867 within the medial NAc Shell (mNAsh significantly reduced drinking of alcohol, with no effect on saccharin intake, and no effect on alcohol consumption when infused above the mNAsh. In contrast, intra-mNAsh infusion of the orexin-2 receptor TCS-OX2-29 had no impact on alcohol drinking. In addition, OX1R inhibition within the aINS had no effect on excessive drinking, which was surprising given the importance of aINS-NAc circuits in promoting alcohol consumption and the role for aINS OX1Rs in driving nicotine intake. However, OX1R inhibition within the mPFC did reduce alcohol drinking, indicating cortical OXR involvement in promoting intake. Also, in support of the critical role for mNAsh OX1Rs, SB within the mNAsh also significantly reduced operant alcohol self-administration in rats. Finally, orexin ex vivo enhanced firing in mNAsh neurons from alcohol-drinking mice, with no effect on evoked EPSCs or input resistance; a similar orexin increase in firing without a change in input resistance was observed in alcohol-naïve mice. Taken together, our results strongly suggest that OX1Rs within the mNAsh, but not the aINS, play a

  15. Effect and mechanism of micronutrient compound on swimming endurance in mice with nutritional deficiency

    Directory of Open Access Journals (Sweden)

    Jian-quan WU

    2012-07-01

    Full Text Available Objective To investigate the anti-fatigue effect and possible mechanisms of micronutrient compound. Methods One hundred and twenty-five male Kunming mice (SPF were fed following different feeding stuffs: sufficient feed, i.e. AIN-93M feed (corn starch 46.6%, casein 14%, dextrinized corn starch 15.5%, sucrose 10%, soybean oil 4%, fiber 5%, mineral mix 3.5%, vitamin mix 1%, L-cystine 0.18%, choline chloride 0.138% and tert-butylhydroquinone 8 ppm; insufficient feed (composed the same ingredients as the AIN-93M diet, replacing 30%, 50% or 70% of the content of mineral and vitamin mix with corn starch; compound micronutrient-added feed (CMAF, replacing 30% of the content of mineral and vitamin mix of AIN-93M diet with micronutrient compound composed of (g/kg Vit A 0.25, Vit B1 0.3, Vit B2 0.3, Vit B6 0.35, nicotinic acid 1.5, Vit D 0.05, Vit C 50, Vit E 10, calcium carbonate 180, ferrous glycine 1, zinc lactate 1 and corn starch 755.25. The mice were fed for 14 or 28 d, and then subjected to forced swim test with a load on their tails to exhaustion. The maximal swimming time was recorded. In another experiment, the Kunming mice were fed with corresponding feed for 28 d, and then subjected to forced swim test for 60 min, thereafter the samples of blood and liver were collected immediately. The serum contents of glucose, lactate, nonprotein nitrogen, nonesterified fatty acids and hepatic glycogen were measured. Results The dietary intake of 30% nutritional insufficient group (30% group was significantly decreased compared with normal control group (fed with AIN-93M diet, (P 0.05. The serum glucose and hepatic glycogen decreased and serum lactate, nonprotein nitrogen and nonesterified fatty acids increased in the control group, which were aggravated in nutrient insufficient group and reversed in micronutrient supplementation group. Conclusions Insufficient intake of micronutrients has significant influence on swimming endurance in mice and compound

  16. Data of evolutionary structure change: 1CF5B-1RTCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CF5B-1RTCA 1CF5 1RTC B A --------DVNFDLSTATAKTYTKFIEDFRATL-PFSHK...A 211 1RTC A 1RTCA...ain> 1RTC A 1RTCA SALYYYSTGGTQLPT...pdbChain> 1RTCA MRTRIRYNRRSA HHHHHH 1RTCA AYFFH-PDNQE

  17. Soomlased teevad silma Eesti toidutööstusele / Silva Männik

    Index Scriptorium Estoniae

    Männik, Silva, 1974-

    2004-01-01

    EL-iga liitumise eel plaanivad mitmed Soome ettevõtjad investeerida Eesti toiduainetööstustesse ja viia Eesti tooted Soome turule. Diagrammid: Soomlane sööb üha enam Eesti toitu. Kommenteerivad Joakim Helenius ja Ain Hanschmidt. Lisa: Näiteid soomlaste tehingutest

  18. File list: Oth.YSt.05.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.YSt.05.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.05.DNA-RNA_hybrids.AllCell.bed ...

  19. File list: Oth.YSt.50.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.YSt.50.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.50.DNA-RNA_hybrids.AllCell.bed ...

  20. File list: Oth.YSt.20.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.YSt.20.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.20.DNA-RNA_hybrids.AllCell.bed ...

  1. File list: Oth.YSt.10.DNA-RNA_hybrids.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.YSt.10.DNA-RNA_hybrids.AllCell sacCer3 TFs and others DNA-RNA hybrids Yeast str...ain http://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Oth.YSt.10.DNA-RNA_hybrids.AllCell.bed ...

  2. Eesti Kirjanike Liit praegu : ankeedivastused

    Index Scriptorium Estoniae

    1997-01-01

    Aut.: Ain Kaalep, Juhan Habicht, Valeria Ränik, Karl Muru, Mart Velsker, Janika Kronberg, Maie Kalda, Hannes Varblane, Toomas Raudam, Priidu Beier, Kati Murutar, Dagmar Normet, Enn Vetemaa, Henn-Kaarel Hellat, Vello Lattik, Kajar Pruul, Kauksi Ülle, Ene Mihkelson, Jüri Ehlvest

  3. Data of evolutionary structure change: 1M3DI-1T60W [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available tryIDChain>1M3DI APLPM--MPVAE ...> -- EEE> ATOM 14546 CA ALA I 86 32.542 22.976 78.017 1.00...ain>1T60W EPMPMSMAPITG > EEE> IECHG-RGTCN >EEEE - EEEE.../entryIDChain> IECNGARGTCH >EEEEGGGEEEE>

  4. Viis näitust haaravad eri aastasadu / Margus Haav

    Index Scriptorium Estoniae

    Haav, Margus, 1969-

    2009-01-01

    Viljandi uue kunsti muuseumis avati fotograaf Ain Kimberi aktinäitus "Igavene teema", Johann Christoph Brotze pärandit tutvustav näitus, Belgia fotokunstniku Patavoli "Taevariik", Valgevene kunstniku Valeri Slauki litograafiad ning kunstitudengite Eva Järve ja Liis Dvorjanski kineetilised heinakuhjad

  5. Genetic study of congenital limb anomalies among Egyptian children

    African Journals Online (AJOL)

    All cases were selected from among patients attending the outpatient medical genetics clinic, faculty of medicine, Ain-Shams university, Cairo-Egypt. Enrolled cases were subjected to a list of investigations including complete history with pedigree construction, anthropometric measurements and full clinical examination.

  6. Experiment list: SRX191034 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available scription=Adult 8 weeks || strain=C57BL/6 || strain description=C57 black 6, the most common inbred strain of labor...ain description=C57 black 6, the most common inbred strain of laboratory mouse http://dbarchive.biosciencedb

  7. 1090-IJBCS-Article-Fatiha Zidane

    African Journals Online (AJOL)

    DR GATSING

    1Laboratoire Science de l'Eau et d'Environnement, Département de Chimie, Faculté des Sciences Ain Chock,. Université ... élevée en divers types de polluants. ... Mots clés: traitement, hydroxyde, coagulation, demande chimique en oxygène.

  8. Aislamiento y caracterización parcial de una miotoxina del veneno de la serpiente Bothrops atrox (Ophidia: Viperidae

    Directory of Open Access Journals (Sweden)

    Sergio Huatuco

    2013-06-01

    Full Text Available Se ha purificado una miotoxina del veneno de la serpiente Bothrops atrox, empleando una columna de intercambio catiónico de CM-Sephadex C-50 equilibrada con buffer acetato de amonio 0,05M a pH 7. La miotoxina es una proteína básica, y por cromatografía de filtración y PAGE-SDS se ha determinado que tiene un peso molecular de 27 kDa, estando formada por dos cadenas polipeptídicas de 14 kDa cada una. La inoculación de la miotoxina en el músculo gastrocnemius de ratones albinos produce la liberación de creatina kinasa así como la necrosis del tejido. La miotoxina tiene actividad de fosfolipasa, anticoagulante y edemática, pero no hemolítica.

  9. Obtention of differential sections in nuclear reactions using a thick target; Obtencion de secciones diferenciales en reacciones nucleares usando un blanco grueso

    Energy Technology Data Exchange (ETDEWEB)

    Chavez R, R

    2000-07-01

    The nuclear reaction analysis (NRA) technique is used mainly for detecting the presence and concentration of light elements of great importance such as: carbon, nitrogen and oxygen. This work has the objective to obtain the differential sections of {sup 16} O and {sup 14} N starting from the irradiation with deuterons of TiSrO{sub 3} samples, of AIN and AIN{sub 2} at energies of 2000 KeV and 1800 KeV respectively. The present work have four chapters; chapter 1 is focused to the physical aspects which takes part in the NRA technique. The technical requirements as well as the necessary equipment for developing the techniques are described in the chapter 2. In chapter 3 it is described the algorithm developed for to obtain the differential sections starting from experimental data, and finally, in chapter 4 are given the results and conclusions. (Author)

  10. EVALUACIÓN DEL RIESGO OCUPACIONAL POR EXPOSICIÓN A BENCENO, TOLUENO Y XILENOS EN UNA INDUSTRIA DE PINTURAS EN BOGOTÁ, D.C.

    Directory of Open Access Journals (Sweden)

    María del Pilar Rubiano

    2010-11-01

    Full Text Available Se determinaron los niveles de benceno,tolueno y xilenos (BTX en el aire deuna industria de pinturas adscrita al InstitutoColombiano de Seguros Sociales,con el propósito de evaluar el riesgo ocupacional ocasionado por el uso de estos solventes; se compararon estos resultados con los valores límite umbral (Threshold Limit Valué , TLV. Se escogió como estrategia de muestreo la metodología de período parcial con muestras consecutivas y se utilizaron tubos de carbón activado como medio de captación de solventes. La extracciónse hizo con disulfuro de carbono y se utilizó como método de análisis la cromatografía de gases con detector de ionización de llama. Se encontró que el método es altamente selectivo porque aun en presencia de otros 10 solventes utilizados en la industria de pinturas, fue posible encontrar una buena separación para BTX. La precisión, expresada como coeficiente de variación, fue menor al 10%, la exactitud varió entre 85 y 99% para los tres disolventes. Se encontraron concentraciones en aire que variaron entre no detectable y 55,1 mg/m3 para el benceno; entre 18,3 y 253 mg/m3 para tolueno; entre 11,8 y 122,2 mg/m3 para xileno. Los valores TLV de benceno, tolueno y xilenos, corregidos de acuerdo con el modelo de Brief y Scala para una jornada diaria de 10 horas fueron de 1,1, 132 y 304 mg/m3 respectivamente. Se encontró que existe riesgo ocupacional por benceno en algunos puestos de trabajo, lo cual es preocupante si se tiene en cuenta que éste no es utilizado como materia prima en la fabricación de pinturas. El tolueno presenta riesgo ocupacional en menor proporción mientras que la presencia de xilenos no genera riesgo porque las concentraciones encontradas no superaron el valor TLV. Se determinó que existe riesgo ocupacional en la mayoría de los puestos de trabajo de la industria estudiada cuando se considera la mezcla de los tres disolventes.

  11. Rheological properties and physical stability of ecological emulsions stabilized by a surfactant derived from cocoa oil and high pressure homogenization

    Directory of Open Access Journals (Sweden)

    Trujillo-Cayado, L. A.

    2015-09-01

    Full Text Available The goal of this work was to investigate the influence of the emulsification method on the rheological properties, droplet size distribution and physical stability of O/W green emulsions formulated with an eco-friendly surfactant derived from cocoa oil. The methodology used can be applied to other emulsions. Polyoxyethylene glycerol esters are non-ionic surfactants obtained from a renewable source which fulfill the environmental and toxicological requirements to be used as eco-friendly emulsifying agents. In the same way, N,NDimethyloctanamide and α-Pinene (solvents used as oil phase could be considered green solvents. Emulsions with submicron mean diameters and slight shear thinning behavior were obtained regardless of the homogenizer, pressure or number of passes used. All emulsions exhibited destabilization by creaming and a further coalescence process which was applied to the coarse emulsion prepared with a rotor-stator homogenizer. The emulsion obtained with high pressure at 15000 psi and 1-pass was the most stable.El objetivo de este trabajo fue estudiar la influencia del método de emulsificación sobre las propiedades reológicas, la distribución de tamaños de gota y la estabilidad física de emulsiones verdes O/W formuladas con un tensioactivo derivado del aceite de coco respetuoso con el medioambiente. La metodología empleada puede ser aplicada a cualquier otro tipo de emulsiones. Los ésteres polietoxilados de glicerina son tensioactivos no iónicos obtenidos de fuentes renovables que cumplen requisitos medioambientales y toxicológicos para ser usados como agentes emulsionantes ecológicos. Del mismo modo, la N,N-dimetil octanamida y el α-Pineno (disolventes usados como fase oleosa pueden ser considerados como disolventes verdes. Se han obtenido emulsiones con diámetros medio submicrónicos y comportamiento ligeramente pseudoplástico independientemente del equipo, la presión o el número de pasadas empleados. Todas las

  12. Advokaadi kutse-eetika reason d’etre / Ain Alvin

    Index Scriptorium Estoniae

    Alvin, Ain, 1959-

    2014-01-01

    Advokaadi kohustus on kutsetegevuses järgida lisaks seadusele kutse-eetika nõudeid, häid kombeid ja südametunnistust. Mida sellised kohustused sisuliselt tähendavad, millest tuleneb vajadus kutse-eetika kutseühendusesisese reguleerimise järele ja milline on kutse-eetika normide sisu?

  13. Invsteeringutoetuste saajate ring väheneb / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2009-01-01

    Eestimaa talupidajate keskliit ei ole rahul mikropõllumajandusettevõtte arendamise investeeringutoetuse (meede 1.4.1) ja loomakasvatusehitiste investeeringutoetuse (meede 1.4.2) määruses tehtud muudatustega

  14. Kibuvits üllatab ja pakub leevendust / Ain Raal

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2005-01-01

    Taani teadlased avastasid-eraldasid kibuvitsaseemnetest ja viljakestadest uue põletikuvastase toimeaine galaktolipiidi (GOPO). Seda lipiidi sisaldub kõige enam koer-kibuvitsa alamliigis Hyben Vital Litos. Nüüdseks on GOPO saamisviis ja nimi patenteeritud nii Euroopas kui ka USAs

  15. Kevadelaul : [luuletused] / Federico Garcia Lorca ; tlk. Ain Kaalep

    Index Scriptorium Estoniae

    García Lorca, Federico, 1898-1936

    2006-01-01

    Sisu: Kevadelaul ; Uued laulud ; Unenägu ; Uus süda ; Rõske siseõu ; Risttee : "Oh valu: mu värsid võtnud..." ; Ballaad mereveest ; Huile ; Vaikus ; Risttee : "Tuul puhub läänest..." ; Sevilla ; Kuus keelt ; Memento ; Kolm linna : Malaguena ; Cordoba agul ; Tants ; Kitarrimõistatus ; Poolkuu ; Neli kollast ballaadi ; Aadam ; Tasakaal ; Friis ; Maha raiuti kolm puud ; Teokarp ; Rumal laul ; Õhtu ; Ratsaniku laul ; Debussy ; Kuu tõuseb ; Kaks õhtust kuud ; Serenaad ; Laul lahkuvast päevast ; Kuuba neegrilaul ; Itk Ignacio Sanchez Mejiase surma puhul ; Madrigal Santiago linnale ; Hällilaul surnud Rosalia Castrole ; Kuu tants Santiagos ; Gaseel kohutavast lähedusest ; Gaseel tumedast surmast ; Gaseel põgenemisest ; Gaseel saja-aastasest armastusest ; Kassiida okstest ; Kassiida selili lebavast naisest ; Kassiida unenäost vabas õhus ; Kassiida tumedaist tuvidest ; Vee süit ; Herbaariumid ; Omega ; Ood Salvador Dalile ; "Ma kardan, kas su imet ma ei kaota..." . Eluloolisi andmeid autori kohta lk. 879

  16. The cytometric future: it ain't necessarily flow!

    Science.gov (United States)

    Shapiro, Howard M

    2011-01-01

    Initial approaches to cytometry for classifying and characterizing cells were based on microscopy; it was necessary to collect relatively high-resolution images of cells because only a few specific reagents usable for cell identification were available. Although flow cytometry, now the dominant cytometric technology, typically utilizes lenses similar to microscope lenses for light collection, improved, more quantitative reagents allow the necessary information to be acquired in the form of whole-cell measurements of the intensities of light transmission, scattering, and/or fluorescence.Much of the cost and complexity of both automated microscopes and flow cytometers arises from the necessity for them to measure one cell at a time. Recent developments in digital camera technology now offer an alternative in which one or more low-magnification, low-resolution images are made of a wide field containing many cells, using inexpensive light-emitting diodes (LEDs) for illumination. Minimalist widefield imaging cytometers can provide a smaller, less complex, and substantially less expensive alternative to flow cytometry, critical in systems intended for in resource-poor areas. Minimalism is, likewise, a good philosophy in developing instrumentation and methodology for both clinical and large-scale research use; it simplifies quality assurance and compliance with regulatory requirements, as well as reduces capital outlays, material costs, and personnel training requirements. Also, importantly, it yields "greener" technology.

  17. Multivariate statistical characterization of groundwater quality in Ain ...

    African Journals Online (AJOL)

    Administrator

    blended water (group 3), based on the similarity of groundwater quality characteristics. Principal component analysis, applied to the data sets of the three different groups obtained from ...... from Butucatu aquifer in Sao Paulo State, Brazil.

  18. Natura 2000 sai tuule tiibadesse Raplamaal / Ain Aivela

    Index Scriptorium Estoniae

    Aivela, Ain

    2004-01-01

    Natura 2000 idee jõudis Eestisse 2000. aastal, mil pilootprojekti raames ning Taani riigi rahalisel toel alustati Natura-võrgustiku eelvalikualade mahamärkimist Lääne- ja Raplamaal. Kommenteerinud Aleksei Lotman

  19. Jõupaberi tootmine tagab Kehra vabriku kasumi / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Kehra paberivabrik on kodumaa metsaomaniku jaoks oluline okaspuu paberipuidu tarnija, kasutades umbes viiendiku sellise sortimendi aastasest raiemahust. Vabriku toodangust lõviosa moodustab pakendipaber. Selle tootmine tagab ka kasumi

  20. Geniaalne aines, hämmastav film / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2006-01-01

    Oktoobri algul Kuressaares peetud Saaremaalt pärit ameerika arhitekti Louis Kahni konverentsi raames Kuressaare Linnateatris näidatud dokumentaalfilmist "Minu arhitekt" ("My Architect") : režissöör Nathaniel Kahn : Ameerika Ühendriigid 2003

  1. Eesti ehitusturu kasv tipneb 2006. aastal / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Taanis asuva uuringufirma European Construction Research, mis jälgib ja prognoosib Ida- ja Lääne-Euroopa ning Lähis-Ida, Hiina ja Aasia ehitusturgu, ennustab Eestile jätkuvat kasvu. Diagramm: Eesti ehitusturu areng 1999-2010

  2. Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit

    Index Scriptorium Estoniae

    Kull, Ain, 1973-

    2005-01-01

    Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel

  3. Poliitiline areng / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  4. Political development / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  5. Multivariate statistical characterization of groundwater quality in Ain ...

    African Journals Online (AJOL)

    Administrator

    depends much on the sustainability of the available water resources. Water of .... 18 wells currently in use were selected based on the preliminary field survey carried out to ... In recent times, multivariate statistical methods have been applied ...

  6. Sensibilidade espécie-específica aos anti-inflamatórios não esteroidais: humanos X animais de companhia

    Directory of Open Access Journals (Sweden)

    E. Riboldi

    2012-02-01

    Full Text Available Este estudo forneceu subsídios para o melhor entendimento das intoxicações pelos anti-inflamatórios não esteroidais (AINES em humanos e animais de companhia. Os principais focos foram a diferença espécie-específica e os serviços prestados por Centros de Informação Toxicológica. Para tanto, foram utilizados dados referentes às intoxicações por AINES em pessoas, cães e gatos reportadas ao CIT/RS entre 2005 e 2009. Além disso, foram abordados, comparativamente, os dados do American Association of Poison Centers (AAPCC entre 2004 e 2008, bem como as referências na literatura acerca da sensibilidade espécie-específica. Constatou-se que a maioria das intoxicações por AINES, independentemente da espécie, abrangeu o cetoprofeno, o ibuprofeno e o diclofenaco, sendo 54% destes intencionais em humanos, destacando-se o diclofenaco. Em se tratando de animais de companhia, 73% das intoxicações em cães ocorreram pelo diclofenaco, e 60% dos acidentes em gatos foram ocasionados pelo ibuprofeno. Chama-se a atenção para a importância dos Centros de Informação Toxicológica como forma de assistência e prevenção desses acidentes, bem como para a venda indiscriminada desses fármacos, aliados à medicação extraprescrição - que leva, na maioria das vezes, cães e gatos ao óbito.

  7. Dietary fat composition influences tissue lipid profile and gene expression in Fischer-344 rats.

    Science.gov (United States)

    Zhou, Albert L; Hintze, Korry J; Jimenez-Flores, Rafael; Ward, Robert E

    2012-12-01

    The AIN-76A diet causes fatty liver in rodents when fed for long periods of time. The aim of this study was to utilize fatty acid analysis and transcriptomics to investigate the effects of different fat sources in the AIN-76A diet on tissue lipid profiles and gene expression in male, weanling Fischer-344 rats. Animals were fed isocaloric diets that differed only in the fat source: (1) corn oil (CO) (2) anhydrous milk fat (AMF), and (3) AMF supplemented with 10% phospholipids from the milk fat globule membrane (AMF-MFGM). There were no differences in food intake, body weight, growth rate, or body fat composition among the groups, and the fatty acid compositions of red blood cells (RBC), plasma, muscle, and visceral adipose tissues reflected the dietary fat sources. Modifying the fat source resulted in 293 genes differentially regulated in skeletal muscle, 1,124 in adipose, and 831 in liver as determined by analysis of variance (ANOVA). Although tissue fatty acid profiles mostly reflected the diet, there were several quantitative differences in lipid classes in the liver and plasma. The AMF diet resulted in the highest level of hepatic triacylglycerols, but the lowest level in plasma. The CO diet resulted in significant accumulation of hepatic unesterified fatty acids and decreased DGAT expression and activity, a potential trigger for steatohepatitis. These results indicate that the fatty acid composition and presence of polar lipids in the AIN-76A diets have significant effects on lipid partitioning, gene expression, and potentially the development of liver pathology.

  8. Clinical utility of dabigatran in United Arab Emirates

    Science.gov (United States)

    Shehab, Abdulla; Elnour, Asim A.; Sadik, Adel; Mandil, Mahmoud Abu; AlShamsi, Ali; Suwaidi, Aesha Al; Bhagavathula, AkshayaSrikanth; Erkekoglu, Pinar; Hamad, Farah; Nuaimi, Saif K. Al

    2015-01-01

    Objectives: To provide early data regarding clinical utility of dabigatran in Al-Ain, United Arab Emirates (UAE). Methods: This was an ethics approved retrospective cross sectional study. We retrieved a total of 76 patients who were using dabigatran from September to December 2014 in the Cardiology Clinic at Al-Ain Hospital, Al-Ain, UAE. The primary analysis was designed to test the frequency of bleeding events (rate) with dabigatran 75, 110, and 150 mg. Results: The mean age ± standard deviation of cohort was 67.9 ± 1.5 years (range; 29-98 years), composed of males (52.6%) with mean age of 66.3 ± 1.7 years, and females (47.4%) with mean age of 69.6 ± 1.1 years. The highest age group was those between 61-80 years (60.5%). Most comprised the age strata of ≤75 years (73.7%). The main indication for dabigatran use was atrial fibrillation. The rate of bleeding with dabigatran was 18/76 (23.7%), and melena was the leading cause of bleeding 8/76 (10.7%). The hospitalization rate was 67.1%, dabigatran withdrawal rate was 0.01%, and mortality rate was 6.5%. The cohort had exhibited incidences of minor bleeding with one fatal major bleeding, high co-morbidities, admission, and readmission, which was not directly linked to dabigatran. We did not identify any relation of death due to dabigatran. Conclusion: Dabigatran is a suitable alternative to warfarin obviating the need for repetitive international normalized ratio monitoring, however, it may need plasma drug monitoring. PMID:26593161

  9. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Department of Mathematics, Faculty of Sciences of Ain Chock, University of Hassan II, Casablanca, Morocco; Department of Mathematics, Keio University at Fujisawa, 5322 Endo, Kanagawa 252-8520, Japan; School of Science and Technology, Kwansei Gakuin University, 2-1 Gakuen, Sanda-City 6691337, Japan ...

  10. Lahkus juhmi Hundi ja kavala Jänese looja / Andri Maimets, Marko Lillemägi

    Index Scriptorium Estoniae

    Maimets, Andri, 1979-

    2006-01-01

    Suri vene animakunstnik, kuulsate tegelaskujude - Hundi ja Jänese looja joonisfilmisarjas (1969-1986) "Oota sa!" ("Nu, pogodi!") Svetozar Russakov (sünd. 3.04.1923). Filmi omaaegset mõju meenutab Rein Raamat. Kommenteerivad Raivo Järvi, Hendrik Normann, Ain Nurmela, Marika Korolev, Evelin Samuel

  11. Libman–Sacks endocarditis, and other echocardiographic findings in systemic lupus erythematosus: Case report

    OpenAIRE

    Hamza, Mohamed Atef; Allam, Lamyaa

    2012-01-01

    Case report of a 19 year-old female patient with systemic lupus erythematosus (SLE) who was presented to Ain Shams University Hospital complaining of dyspnea on moderate exertion. Echocardiography showed the presence of sterile vegetation on the mitral valve, Libman–Sacks endocarditis (LSE).

  12. Uus silt turul - clean label / Gunnel Koba

    Index Scriptorium Estoniae

    Koba, Gunnel

    2013-01-01

    Suurbritanniast alguse saanud clean labeli toiduainete märgis annab tarbijale kindlustunde, et tegemist on võimalikult puhta lihtsa ja arusaadava koostisega tootega. Samas pole märgisel ametlikku definitsiooni ning pole välistatud, et toiduaine koostises ei ole ka mõni e-aine

  13. Armusuhted tööl - meeleolu tõuseb, töökvaliteet langeb / Ketlin Priilinn

    Index Scriptorium Estoniae

    Priilinn, Ketlin, 1982-

    2005-01-01

    Ilmunud ka: Juhi ideelaegas. - Tallinn, 2006, lk. 77-79. A. Le Coqi juhatuse esimees Tarmo Noop, Alexela Oili tegevjuht Ain Kuusik ja Tööinspektsiooni õigusosakonna juhataja Niina Siitam isiklikest suhetest ja armumisest tööl. Kommenteerib BDA Estonia projektikonsultatsioonide juht Maria Kütt

  14. Mechanisms of Chinese Red Yeast Rice Inhibition of Prostate Cancer Growth

    Science.gov (United States)

    2009-10-01

    following treatment with LV and RYR. MATERIALS AND METHODS Extract and standard preparation Chinese RYR powder purchased from Botanica Bio- Science (Ojai...RYR diet contains 5% of RYR powder ( Botanica Bioscience, Ojai, CA) with the modified AIN93G diet. For lovastatin diet, lovastatin (Mylan

  15. Most "Druzhba" priobretajet politisheskoje znatshenije / Konstantin Vikentejev

    Index Scriptorium Estoniae

    Vikentejev, Konstantin

    2005-01-01

    Eesti ja Venemaa välisministrite Urmas Paeti ja Sergei Lavrovi kohtumisest Sloveenias, kus kinnitati ka vajadust Sõpruse sild rekonstrueerida. Arvamust avaldavad: Ago Silde, Sergei Jastrzhembski, Arnold Rüütel, Margus Leivo, Jaanus Õunapuu, Tiit Vähi, Ain Uiga, Vadim Gustov, Riho Sõrmus

  16. Data of evolutionary structure change: 1A5CB-2QUTC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 8 2QUT C 2QUTC ...ain>C 2QUTC ence>INKCPLLKPWA HH...T C 2QUTC ence>LKIGE--HTPSA...1A5CB-2QUTC 1A5C 2QUT B C ------LPADVAEELATTAQKLVQAGKGILAADESTQTI... 1A5CB LFGTK-GLGKFence> HHH - <

  17. Eesti Metodisti Kirik : Balti Misjoni Keskus, Narva mnt. 51, Tallinn = Estonian Methodist Church / Vilen Künnapu

    Index Scriptorium Estoniae

    Künnapu, Vilen, 1948-

    2000-01-01

    Projekteerija Arhitektuuribüroo Künnapu & Padrik. Arhitektid Vilen Künnapu, Ain Padrik. Konstruktsioonide autor Andres Laur. Sisekujundajad Argo ja Katrin Vaikla. Projekt 1994, valmis 2000. Kirik on klaasja pikliku koolitiivaga (teoloogiline seminar). 7 ill.: I korruse plaan, lõige, välis- ja sisevaated

  18. Data of evolutionary structure change: 1CG5A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5A-2ZLWD 1CG5 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...ne> GLN CA 254 2ZLW D 2ZLWD...ain> 2ZLW D 2ZLWD AR...fEVID> 2 2ZLW D 2ZLWD

  19. Topical 5-fluorouracil treatment of anal intraepithelial neoplasia in human immunodeficiency virus-positive men

    NARCIS (Netherlands)

    Richel, O.; Wieland, U.; de Vries, H. J. C.; Brockmeyer, N. H.; van Noesel, C.; Potthoff, A.; Prins, J. M.; Kreuter, A.

    2010-01-01

    Background Anal intraepithelial neoplasia (AIN), a human papillomavirus (HPV) induced potential precursor lesion of anal cancer, is frequent among human immunodeficiency virus (HIV)-positive men who have sex with men (MSM). So far, only a few prospective studies have been performed on the topical

  20. Methionine synthase A2756G and reduced folate carrier1 A80G ...

    African Journals Online (AJOL)

    Maha Moustafa

    2015-10-09

    Oct 9, 2015 ... folate carrier (RFC1) A80G gene polymorphisms on the maternal risk for DS. Patients: This ... Peer review under responsibility of Ain Shams University. ... Folate is the general term for a water-soluble B vitamin (vita- min B9) ...

  1. Häda nende meie Vaarikutega! / Andres Mesikäpp

    Index Scriptorium Estoniae

    Mesikäpp, Andres

    2000-01-01

    20. oktoobril algas Kanal 2s uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions

  2. Hakkama võib saada ka koomiliselt / Liivi Šein

    Index Scriptorium Estoniae

    Šein, Liivi

    2000-01-01

    20. oktoobril algab Kanal 2s uus teleseriaal "Me saame hakkama" : stsenarist Mihkel Ulman : režissöör Ain Prosa : helilooja Ardo-Ran Varres : mängivad Andrus, Maarika ja Marta Vaarik, Ülle Kaljuste, Maria Avdjushko, Hilja Varem jt. : Wireframe Productions

  3. Kinnisvaragurude ümarlaud / interv. Jaanika Merilo

    Index Scriptorium Estoniae

    2007-01-01

    Järg. Profit nr. 3 lk. 18-21. Eesti kinnisvaraturu olukorrast, vestlusringis osalevad investeerimisfirma EE-REIT juhatuse liige Ain Kivisaar, Arco Vara Eesti tegevjuht Kaido Kangur, Hansapanga makromajanduse analüütik Maris Lauri ja ASYIT Ehituse kinnisvaraosakonna müügijuht Tõnu Toompark

  4. Data of evolutionary structure change: 1F3XD-3EOEC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available IQDLK-FGVEQ >HHHHH-HHHH > ATOM 1...bID>3EOE C 3EOEC KHDILNFGIPM ...>HHHIIIII > ATOM 8495 CA LYS C 210 4.419 -1...ETT >E -- E> ATOM 7912 CA ASP C ...ain>D 1F3XD DNAYMEKCDENI > GGG EE E

  5. "Kalevipoeg" ja "Kalevala" / Märt Laarman

    Index Scriptorium Estoniae

    Laarman, Märt, 1896-1979

    1998-01-01

    Varem ilmunud: Tallinn : Kool, 1922. Autori pseudonüüm M. Salak. . Sisu: "Kalevipoja" saamislugu; "Kalevipoeg" ja "Kalevala"; Vead "Kalevipoja" värsitehnikas ja keeles; Eesti ained "Kalevalas"; "Kalevala" mõju "Kalevipojale"; Kalevipoja algupära; "Kalevipoja" kompositsioon ja tegelased; Kaunid kohad "Kalevipojas"; Kokkuvõte.

  6. Iidamast ja Aadamast ehk "Ahvide planeet" / Jaak Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Jaak

    2001-01-01

    Taas on ekraanile jõudnud Pierre Boulle'i raamatu ainetel "Ahvide planeet" ("Planet of the Apes") : režissöör Tim Burton : Ameerika Ühendriigid 2001. Autor võrdleb seda 1968.a. filmiga ning Ain Kaalepi näidendiga "Iidamast ja Aadamast"

  7. Precision and Purpose: Airpower in the Libyan Civil War

    Science.gov (United States)

    2015-01-01

    Civil War Zara after seeing leaflets emblazoned with attacking helicopters descend on the area. In Tripoli, residents recalled hearing a radio program...operational night flight (March 4, 1912); his colleague, Tenente Giulio Gavotti, dropped the first bombs on November 1, 1911, striking Ain Zara and

  8. Perfil sociodemográfico e clínico de pacientes em tratamento com anticoagulantes orais

    Directory of Open Access Journals (Sweden)

    Thaisa Remigio Figueirêdo

    2017-01-01

    Full Text Available Objective: to describe the sociodemographic and clinical profile of patients treated with oral anticoagulants. Methods: cross-sectional study, conducted in an anticoagulation outpatient facility of a teaching hospital which is reference in cardiology. One evaluated 222 patients, through individual interviews using a structured questionnaire. Data were analyzed using descriptive statistics. Results: the participants were characterized predominantly by the following characteristics: female (64.4%; brown (57.2%; low education (68.0%; poor (67.1%; most with values of the International Normalized Ratio outside the therapeutic range (57.2%; associated comorbidities and prolonged treatment time (65.8%. Conclusion: it was evident a predominantly female group, with low socioeconomic status, associated comorbidities and prolonged treatment time with oral anticoagulants. It constitutes the biggest part of a vulnerable group whose characteristics can affect the quality of the treatment, and with characteristics related to the particular culture of northeastern Brazil, not found in anticoagulation outpatient facilities in other regions of the country.

  9. Type 1 diabetes mellitus and atopic diseases in children.

    African Journals Online (AJOL)

    Ehab

    Nancy S. Elbarbary. Assistant Professor of Pediatrics, Faculty of Medicine, Ain Shams University, Cairo, Egypt. Background. Diabetes mellitus type 1 (T1DM) is a complex disease resulting from the interplay of genetic, epigenetic, and environmental factors.1 Worldwide,. T1DM epidemic represents an increasing global.

  10. Download this PDF file

    African Journals Online (AJOL)

    yakoub@AHMED

    We may tentatively suggest on the basis oř recent molecular evidence that induced elevation oř .... Ph.D.Thesis Faculty oř Sci. Ain Shams ... 23: 1389. 1395. Kim K N, Cheong YH, Grant JJ, Pandey GK & Luan S (2003) CIPK3, a calcium sensor.

  11. Libman–Sacks endocarditis, and other echocardiographic findings in systemic lupus erythematosus: Case report

    Directory of Open Access Journals (Sweden)

    Mohamed Atef Hamza

    2012-09-01

    Full Text Available Case report of a 19 year-old female patient with systemic lupus erythematosus (SLE who was presented to Ain Shams University Hospital complaining of dyspnea on moderate exertion. Echocardiography showed the presence of sterile vegetation on the mitral valve, Libman–Sacks endocarditis (LSE.

  12. Comparison of imiquimod, topical fluorouracil, and electrocautery for the treatment of anal intraepithelial neoplasia in HIV-positive men who have sex with men: an open-label, randomised controlled trial

    NARCIS (Netherlands)

    Richel, Olivier; de Vries, Henry J. C.; van Noesel, Carel J. M.; Dijkgraaf, Marcel. G. W.; Prins, Jan M.

    2013-01-01

    Anal cancer is an increasing issue in HIV-positive men who have sex with men (MSM). Screening for its precursor, anal intraepithelial neoplasia (AIN), is subject of discussion. Current treatment options are suboptimum and have not been compared in a prospective trial. We compared efficacy and

  13. Anal intraepithelial neoplasia in HIV+ men

    NARCIS (Netherlands)

    Richel, O.

    2014-01-01

    In this thesis we investigated several aspects of anal intraepithelial neoplasia (AIN) in HIV+ men who have sex with men (MSM). This condition has gained clinical interest because of the impressive increase of the anal cancer incidence in HIV+ MSM since the introduction of combination antiretroviral

  14. Suvehooaeg Emajõe Ateenas liidab lugusid mitmest sajandist / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2006-01-01

    Tartu suvelavastustest : Urmas Lennuki "Koidula" Andres Dvinjaninovi lavastuses (Emajõe Suveteater) ; Jan Rahmani "Sõit" Ain Mäeotsa lavastuses (Hansahoovi Teater), Raivo Adlase lavastus "Vaesed ja patused" August Jakobsoni ainetel Tartu raudteejaamas (Vilde Teater), G. Bizet' "Carmen" Ago-Endrik Kerge lavastuses (Muusikaline loomeühendus KaivConsort)

  15. Suvelavastuste hooaeg Tartus liidab endasse lugusid mitmest sajandist / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2006-01-01

    Tartu suvelavastustest : Urmas Lennuki "Koidula" Andres Dvinjaninovi lavastuses (Emajõe Suveteater) ; Jan Rahmani "Sõit" Ain Mäeotsa lavastuses (Hansahoovi Teater), Raivo Adlase lavastus "Vaesed ja patused" August Jakobsoni ainetel Tartu raudteejaamas (Vilde Teater), G. Bizet' "Carmen" Ago-Endrik Kerge lavastuses (Muusikaline loomeühendus KaivConsort)

  16. Koputajate kaitseks! / Ivar Tallo

    Index Scriptorium Estoniae

    Tallo, Ivar, 1964-

    2003-01-01

    Politoloog Ivar Tallo arvates võiks Riigikogu välja tulla initsiatiiviga luua ühiskonna esindajate osavõtul vigade ja pettuste paljastajate kaitse seadus. Küsimusele, kust läheb politseiametniku sõnavabaduse piir vastavad Ain Seppik, Tarmo Loodus ja Jaanus Rahumägi. Indrek Sirgi juhtum

  17. Can food addiction replace binge eating assessment in obesity ...

    African Journals Online (AJOL)

    Alaa Youssef Ahmed

    2016-07-26

    Jul 26, 2016 ... Peer review under responsibility of Ain Shams University. The Egyptian Journal of ... Studies on eat- ing disorders are relatively scarce particularly in adolescents in ... Preparatory and secondary schools in Cairo were distributed in its eastern ..... DS. Prevalence and treatment of mental disorders among US.

  18. Jõulukuine plaadisadu / Joosep Sang

    Index Scriptorium Estoniae

    Sang, Joosep

    2005-01-01

    Lühidalt eesti heliplaatidest: "Eesti hääled", "Hendrik Sal-Saller & Estonian Dream Big Band", "Ain Agan ja Tallinna Kammerorkester", "The Book's Burning", "Mu süda ärka üles", "Inimene õpib...", "You Stepped Out of a Dream", "Andke tagasi maa", "Jesli ljubish, naidi..."

  19. Hotell Radisson SAS = Radisson SAS Hotel / Inga Raukas

    Index Scriptorium Estoniae

    Raukas, Inga, 1967-

    2001-01-01

    Projekteerija Arhitektuuribüroo Künnapu & Padrik. Arhitektid Vilen Künnapu, Ain Padrik, Eero Palm, Tarmo Maiste. Sisekujundajad Christian Lundwall, Jan Öberg. Konstruktsioonid: Teuvo Meriläinen, Jyrki Rautamäki. Projekt ja hotell valmis 2000. 12 ill.: korruste plaanid, sise- ja välisvaated

  20. ERKI moe ülevaatus pakkus täismajale toreda õhtu / Tiiu Oga

    Index Scriptorium Estoniae

    Oga, Tiiu

    2007-01-01

    Eesti Kunstiakadeemia 13.01.2007 Salme kultuurikesksuses toimunud moeetendusest. Lavastaja Kaarel Väli, graafiline kujundus Eiko Ojala, videokunstnikud Taavi Varm ja Aleks Tenusaar koos RGB-ga, lavaline kujundus Ain Nurmela, valguskunstnik Meelis Lusmägi koos ET Valgusega. Korraldajad Jaanika Terasmaa ja Ester Kannelmäe

  1. Soy Components Genistein and Lunasin Regulate E-Cadherin and Wnt Signaling in Mammary Epithelial Cells

    Science.gov (United States)

    Enhanced Wnt/beta-catenin signaling and loss of E-cadherin expression are considered hallmarks of tumorigenesis. We previously showed by microarray gene profiling that dietary intake of soy-based AIN-93G diets altered components of Wnt/beta-catenin signaling in rat mammary epithelial cells. To furth...

  2. 76 FR 66964 - Certain Inkjet Ink Cartridges With Printheads and Components Thereof; Notice of the Commission's...

    Science.gov (United States)

    2011-10-28

    ... complaint named the following entities as respondents: MicroJet Technology Co., Ltd. of Hsinchu City, Taiwan (``MicroJet''); ain Asia Pacific Microsystems, Inc. of Hsinchu City, Taiwan (``APM''); Mipo Technology.... Respondent MicroJet defaulted. Respondent PTC did not participate in the hearing and failed to file post...

  3. Data of evolutionary structure change: 1BP2A-3DIHA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ain> CFSKV--PYNKE >HGGG -- GG> A 3DIHA CFRENLKTYNKK re...yIDChain>3DIHA VCGSS-TPCKK ture... >EEE HHHH> ATOM 640 CA THR A 83...>HHHH GGG GG> ATOM 722 CA CYS A 95 72.245 22.685 6.343 1.00 14.

  4. Epidemiological Pattern and Management of Pediatric Asthma ...

    African Journals Online (AJOL)

    EL-HAKIM

    Egypt J Pediatr Allergy Immunol 2008; 6(2): 51-56. 51. Epidemiological Pattern and Management of Pediatric Asthma. Review of Ain Shams Pediatric Hospital Chest Clinic Data. Cairo, Egypt 1995-2004. INTRODUCTION. Bronchial asthma is a major worldwide health problem, which has received increased attention in.

  5. Efeito da casca da berinjela (Solanum melongena) sobre as concentrações plasmáticas de triglicerídeos, colesterol total e frações lipídicas, em cobaias (Cavia porcellus) hiperlipidêmicos ( The effect of the eggplant core on blood lipid concentrations in hypercholesterolemic guinea pigs (Cavia porcellus) )

    NARCIS (Netherlands)

    Cherem, A.D.R.; Tramonte, V.L.C.G.; Fett, R.; Dokkum, W. van

    2007-01-01

    We investigated the effect of the eggplant core on the plasma concentrations of triglycerides, total- LDL- and HDL-cholesterol, in male guinea pigs, randomly assigned into five groups: 1 (N) - normolipidic diet AIN-93G, 2 (NB) - normolipidic diet, supplemented with eggplant core, halfway of the

  6. Eelarveheitlus sai eile riigikogus vihase avastardi / Kai Kalamees

    Index Scriptorium Estoniae

    Kalamees, Kai

    2004-01-01

    Ilmunud ka: Infopress, 1. okt. 2004, nr. 40, lk. 24. Peaminister Juhan Partsi kõnest Riigikogus 2005. aasta riigieelarve eelnõu üle andes. Riigikogu liikmete hinnanguid eelarve kohta. Diagrammid: Eelarve jõudis riigikokku. Lisa: Riigi tulud tuleval aastal. Kommenteerivad Eiki Nestor, Ain Seppik, Mart Laar

  7. Ainenõukogu tähelepanekuid / Ene Laanes

    Index Scriptorium Estoniae

    Laanes, Ene

    2003-01-01

    Üleriigiline kehalise kasvatuse ainenõukogu peab vajalikuks juhtida haridusametnike, koolijuhtide ja kooli omanike tähelepanu kehalise kasvatuse ainekava läbiviimisel üles kerkinud probleemidele: meditsiinilisse erigruppi kuuluvate õpilaste hindamine kehalise kasvatuse aines, kehalise kasvatuse tunniks vajalikud harjutuspaigad ja vahendid, nädalatundide arv

  8. Remont käib võidu etendustega / Raimu Hanson

    Index Scriptorium Estoniae

    Hanson, Raimu, 1957-

    2007-01-01

    Tartus Küütri tn. 1 asuva hoone ajaloost, sinna rajatavast Athena kultuuri- ja konverentsikeskusest ning Volga restoranist. Kinosaali kipsreljeefide autor on Ferdi Sannamees, restorani ajaloolise vitraažlae autor on Nikolai Willer. Kommenteerivad Margus Kasterpalu, Mart Kivastik, Anne Erm, Ain Mäeots ja projektijuht Maia Kurm

  9. Nanoscale Engineering of Multiferroic Hybrid Composites for Micro- and Nano-scale Devices

    Science.gov (United States)

    2012-09-14

    presented in Fig.1. In the case of laminate structures we proposed to use AIN as a piezoelectric phase [publication 4]. Although commonly used Pb...16-19, 2009, Zhengzhou, China. 30)L. Malkinski, "Magnetic heterostructures with convoluted architectures" (invited) 7th Workshop on Multifunction

  10. Melanoides tuberculata as intermediate host of Centrocestus ...

    African Journals Online (AJOL)

    SAM

    2014-07-02

    Jul 2, 2014 ... Melanoides tuberculata that naturally harbored trematode larvae were collected at the irrigation system in Ain Soltan's oasis (southwest of Tunisia), during malacological surveys conducted from January to. December 2013. From 2160 specimens of M. tuberculata collected, 31 (1.4%) were infected by the.

  11. Dual-sided electrosurgery handpiece for simultaneous tissue cutting and coagulation: first report on a conceptual design validated by an animal experiment

    Directory of Open Access Journals (Sweden)

    Tawfik HA

    2015-08-01

    Full Text Available Hatem A Tawfik,1 Yousef A Fouad,2 Rashad Hafez3 1Department of Ophthalmology, Oculoplastics Service, Ain Shams University, 2Faculty of Medicine, Ain Shams University, 3Eye Subspecialty Centre, Cairo, Egypt Objective: To introduce and evaluate the safety of a novel dual-sided electrosurgery handpiece design for simultaneous tissue cutting and coagulation. Methods: We designed a prototype double-sided handpiece allowing automatic switching between two electrodes with a simple handpiece flip. The concept of the system as a surgical instrument was assessed by an animal experiment. Results: The skin of 15 Wistar albino white rats could be successfully incised and coagulated using both ends of the handpiece, thereby confirming the prospects and clinical applications of the system. Conclusion: The dual-sided electrosurgery handpiece is a simple and safe alternative to the traditional electrosurgery pencil, allowing the simultaneous use of two electrodes without the hassle of frequent electrode replacement. Keywords: radiosurgery, ablative surgery, laser resurfacing, electrocautery, electrosurgery

  12. Ribbon-cutting ceremony for Building 774

    CERN Multimedia

    Corinne Pralavorio

    2015-01-01

    On Friday, 12 June, the brand-new Building 774 on the Prévessin site was officially opened by Rolf Heuer, Director-General of CERN, and Stéphane Donnot, sous-préfet of Gex, together with Serge Moulon, deputy mayor of Saint-Genis-Pouilly, and Aurélie Charillon, mayor of Prévessin-Moëns and a member of the Conseil départemental de l’Ain.     Left to right: Serge Moulon, deputy mayor of Saint-Genis-Pouilly, Stéphane Donnot, sous-préfet of Gex, Rolf Heuer, Director-General of CERN, and Aurélie Charillon, mayor of Prévessin-Moëns and a member of the Conseil départemental de l’Ain.   “Thanks to its innovative architecture, this iconic building is the jewel in the crown of the French site,” said Heuer. Prior to the ceremony, the Director-General had met the politicians to discuss relations between CERN a...

  13. Toxicity of so-called edible hijiki seaweed (Sargassum fusiforme) containing inorganic arsenic.

    Science.gov (United States)

    Yokoi, Katsuhiko; Konomi, Aki

    2012-07-01

    The UK Food Standards Agency and its counterparts in other countries have warned consumers not to eat hijiki (Sargassum fusiforme; synonym Hizikia fusiformis), a Sargasso seaweed, because it contains large amounts of inorganic arsenic. We investigated dietary exposure of hijiki in weaning male F344/N rats fed an AIN-93G diet supplemented with 3% (w/w) hijiki powder for 7 weeks, compared with those fed only an AIN-93G diet. Body weight, body temperature, blood and tissue arsenic concentrations, plasma biochemistry and hematological parameters were measured. We found that feeding rats a 3% hijiki diet led to a marked accumulation of arsenic in blood and tissues, and evoked a high body temperature and abnormal blood biochemistry including elevated plasma alkaline phosphatase activity and inorganic phosphorus, consistent with arsenic poisoning. These findings should prompt further investigations to identify the health hazards related to consumption of hijiki and related Sargassum species in humans. Copyright © 2012 Elsevier Inc. All rights reserved.

  14. Thermal conductivities of thin, sputtered optical films

    International Nuclear Information System (INIS)

    Henager, C.H. Jr.; Pawlewicz, W.T.

    1991-05-01

    The normal component of the thin film thermal conductivity has been measured for the first time for several advanced sputtered optical materials. Included are data for single layers of boron nitride (BN), aluminum nitride (AIN), silicon aluminum nitride (Si-Al-N), silicon aluminum oxynitride (Si-Al-O-N), silicon carbide (SiC), and for dielectric-enhanced metal reflectors of the form Al(SiO 2 /Si 3 N 4 ) n and Al(Al 2 O 3 /AIN) n . Sputtered films of more conventional materials like SiO 2 , Al 2 O 3 , Ta 2 O 5 , Ti, and Si have also been measured. The data show that thin film thermal conductivities are typically 10 to 100 times lower than conductivities for the same materials in bulk form. Structural disorder in the amorphous or very fine-grained films appears to account for most of the conductivity difference. Conclusive evidence for a film/substrate interface contribution is presented

  15. Technical Work Plan for: Fracture and Lithophysal Studies

    International Nuclear Information System (INIS)

    2006-01-01

    The primary objective of the work scope described in this technical work plan (TWP) is to enhance the descriptions of fracture and lithophysal parameters for the repository host horizon (RHH) over the repository footprint utilizing a predictive model. This work is planned to address U.S. Nuclear Regulatory Commission (NRC) additional information needs (AINs) associated with the Structural Deformation and Seismicity (SDS) Key Technical Issues (KTI) agreement SDS 3.03 (Schlueter 2000 [DIRS 166615]). The results of the planned work are expected to enhance the technical basis and confirm the results of the fracture analyses presented in ''Drift Degradation Analysis'' (BSC 2004 [DIRS 166107], Section 6.1.6). This model is not intended to provide an alternative for the unsaturated zone and saturated zone flow and transport models currently used by the Yucca Mountain Project (YMP). Nor are the outputs of this model intended to address the SDS 3.03 AINs related to the unsaturated zone and saturated zone flow and transport models

  16. Firms not established in France bringing in personnel to work on the French part of the site

    CERN Document Server

    Relations with the Host States Service

    2005-01-01

    In compliance with French legislation, firms not established in France must declare the employees they assign to work on French territory to the competent Labour Inspectorate office. At the request of the French authorities, CERN issues access cards to the employees concerned by the legislation exclusively on presentation of an acknowledgement of receipt relating to the declaration of their secondment. The Labour Inspectorate faxes, or failing that posts, this document bearing the seal of the Direction départementale du Travail, de l'Emploi et de la Formation professionnelle de l'Ain (Departmental Directorate of Labour, Employment and Occupational Training of the Ain) to the firm concerned. The model secondment declaration form and acknowledgement of receipt may be downloaded from the Web site of the Relations with the Host States Service (http://www.cern.ch/relations/). We would like to take the opportunity to remind you of the following: The letter of 31 July 2002, by which the French Labour Inspector...

  17. Technical Work Plan for: Fracture and Lithophysal Studies

    Energy Technology Data Exchange (ETDEWEB)

    n

    2006-09-11

    The primary objective of the work scope described in this technical work plan (TWP) is to enhance the descriptions of fracture and lithophysal parameters for the repository host horizon (RHH) over the repository footprint utilizing a predictive model. This work is planned to address U.S. Nuclear Regulatory Commission (NRC) additional information needs (AINs) associated with the Structural Deformation and Seismicity (SDS) Key Technical Issues (KTI) agreement SDS 3.03 (Schlueter 2000 [DIRS 166615]). The results of the planned work are expected to enhance the technical basis and confirm the results of the fracture analyses presented in ''Drift Degradation Analysis'' (BSC 2004 [DIRS 166107], Section 6.1.6). This model is not intended to provide an alternative for the unsaturated zone and saturated zone flow and transport models currently used by the Yucca Mountain Project (YMP). Nor are the outputs of this model intended to address the SDS 3.03 AINs related to the unsaturated zone and saturated zone flow and transport models.

  18. Determination of the Wetting Angle of Germanium and Germanium-Silicon Melts on Different Substrate Materials

    Science.gov (United States)

    Kaiser, Natalie; Croell, Arne; Szofran, F. R.; Cobb. S. D.; Dold, P.; Benz, K. W.

    1999-01-01

    During Bridgman growth of semiconductors detachment of the crystal and the melt meniscus has occasionally been observed, mainly under microgravity (microg) conditions. An important factor for detached growth is the wetting angle of the melt with the crucible material. High contact angles are more likely to result in detachment of the growing crystal from the ampoule wall. In order to achieve detached growth of germanium (Ge) and germanium-silicon (GeSi) crystals under 1g and microg conditions, sessile drop measurements were performed to determine the most suitable ampoule material as well as temperature dependence of the surface tension for GeSi. Sapphire, fused quartz, glassy carbon, graphite, SiC, pyrolytic Boron Nitride (pBN), AIN, and diamond were used as substrates. Furthermore, different cleaning procedures and surface treatments (etching, sandblasting, etc.) of the same substrate material and their effect on the wetting behavior were studied during these experiments. pBN and AIN substrates exhibited the highest contact angles with values around 170 deg.

  19. Article

    African Journals Online (AJOL)

    2012-12-04

    Dec 4, 2012 ... postgraduate students) and junior staff. ... Radiation Oncology Department, Ain Shams University Hospital, .... and one providing summary answers to the questions, between 4 - 10 .... no travel or hotel costs. ... more modules or a book with lots of tables and lists (as one ... its determinants in clinical practice.

  20. Grunge kodukujunduses / Ene Vool

    Index Scriptorium Estoniae

    Vool, Ene, 1948-

    2004-01-01

    Low-tech, campi ja grunge ehitus- ja sisustusstiilidest meil ja mujal - kommenteerivad Andro Kööp ja Ain Nurmela. Tutvustatakse ka Mari-Mira projekti Pariisis, mis kujutab endast nn. mutant-küla, putka- ja onnikultuuri koketeriid. Artikli lõpus kommenteerib kunstiteadlane Karin Paulus grungestiili muusikas, riietuses ja sisekujunduses.