WorldWideScience

Sample records for anticoagulantes disolventes aines

  1. Neuropatía hemorrágica tóxica aguda y fallo multiorgánico tras intoxicación por anticoagulantes, disolventes, AINES y antihistamínicos: A propósito de un caso fatal Acute toxic haemorrhagic neuropathy and multiorganic failure following poisoning by anticoagulants, solvents, nsaids and antihistaminic drugs: Report of a fatal case

    Directory of Open Access Journals (Sweden)

    A. Garfia

    2002-01-01

    Full Text Available Se presenta un caso de intoxicación mortal por ingestión del raticida Brodifacum, un anticoagulante superwarfarínico, junto con otros fármacos, entre los que se incluían antiinflamatorios no esteroideos y un disolvente orgánico de uso doméstico. El sujeto falleció en la UCI, con un cuadro de insuficiencia respiratoria aguda, seguida de fallo hepático y renal. En la autopsia se pusieron de manifiesto lesiones hemorrágicas circunferenciales que afectaban a diversos tejidos, entre los que se encontraban la grasa mesentérica, el epicardio, y la grasa perirrenal. El estudio microscópico demostró la existencia de una típica lesión hemorrágica aguda, circunferencial, en los nervios vegetativos epicárdicos y del área del esplácnico. La explicación de porqué los nervios periféricos vegetativos se constituyen en diana de los efectos tóxicos se atribuye a la acción combinada de los disolventes y de los anticoagulantes, sobre el sistema nervioso periférico. Se sabe que los disolventes orgánicos producen una lesión neuronal aguda, consistente en tumefacción axonal y del soma neuronal, que conlleva a la alteración del sistema de transporte a lo largo del axón. Creemos que -desde el punto de vista fisiopatológico- la vasodilatación reactiva de los vasa nervorum, producida a consecuencia de la lesión neuronal aguda inducida por los disolventes, unida al estado de hipocoagulabilidad sanguínea -dependiente de la ingestión de Brodifacum (superwarfarina y potenciada por los antiinflamatorios no esteroideos- constituyen los mecanismos íntimos que podrían explicar esta peculiar Neuropatía Hemorrágica Aguda Tóxica de los nervios periféricos del Sistema Nervioso Neurovegetativo. Desconocemos si los nervios periféricos mixtos se encontraban afectados por esta lesión, al carecer de muestras para un estudio definitivo.In this paper we describe a case of mortal poisoning by ingestion of the rodenticide Brodifacoum, a superwarfarin

  2. Anticoagulantes e tubos de colheita de sangue

    OpenAIRE

    Silva, João(CFTP, Departamento de Física, Instituto Superior Técnico, Universidade de Lisboa, Avenida Rovisco Pais 1, 1049, Lisboa, Portugal); Beato, Sílvia; Rodrigues, Francisco

    2011-01-01

    Actualmente, com o aumento do número de amostras de sangue colhidas, o uso ou não de anticoagulante (consoante o tipo de testes laboratoriais a executar), o modo como a colheita é efectuada e o estado psíquico do doente tem muita influência na mesma colheita. Por vezes as colheitas são efectuadas por pessoas, que na maior parte das vezes, poucos conhecimentos têm sobre anticoagulantes. Se não possuírem os conhecimentos certos sobre os anticoagulantes, o modo como o transporte das amostras são...

  3. Influencia del disolvente en las reacciones orgánicas

    OpenAIRE

    Alcalde Aragonés, Ana

    2012-01-01

    La mayoría de los procesos químicos industriales, particularmente de la Química fina, se realizan en disolución. El disolvente puede tener una influencia decisiva en la eficacia de la reacción y es, por tanto, un parámetro estratégico en la planificación de una síntesis. Los disolventes orgánicos, particularmente halogenados y/o aromáticos, plantean problemas en cuanto a su toxicidad, inflamabilidad e impacto medioambiental y por ello su reemplazo por medios alternativos con un menor impacto ...

  4. Ain Mediatheque (France)

    OpenAIRE

    Giorgi, Gianna

    2006-01-01

    The public Mediatheque in department of Ain in France is a public utility with the mission to contribute to the permanent learning, and to provide cultural activities to all the citizens. Nowadays this Mediatheque is one of the most information resources. A public Mediatheque is, like school, an institution which, in particular in France, should incarnate the principles contained in the currency constitution: liberté, égalité et fraternité. Keeping fixed the principles the librari...

  5. VALORES DO RNI DE PACIENTES SUBMETIDOS AO TRATAMENTO COM ANTICOAGULANTES

    Directory of Open Access Journals (Sweden)

    Simone Aparecida Matos de SOUZA

    2015-12-01

    Full Text Available Uma pesquisa exploratória de natureza qualitativa e quantitativa foi realizada durante o período de maio a agosto de 2013 no Laboratório de Análises Clínicas do Hospital das Clínicas localizado no município de Itaperuna, RJ. O objetivo foi analisar o perfil dos pacientes sob tratamento com anticoagulantes, demonstrando as potenciais variações nos valores da Relação Normalizada Internacional (RNI em comparação aos valores de referência bem como a frequência de realização de tais exames. Um questionário foi aplicado pouco antes da coleta do sangue, estabelecendo-se como critério de inclusão o uso de medicamentos anticoagulantes. Os resultados indicaram um total de 45 pacientes sob tratamento com anticoagulantes, sendo 32 do sexo feminino e 13 do sexo masculino. A maioria dos pacientes encontrava-se sob tratamento com o anticoagulante de uso oral varfarina e se encontrava com idade superior a 50 anos. O valor médio do RNI apresentou-se dentro dos limites considerados seguros, porém mais da metade dos pacientes apresentou RNI < 2,0 e a maioria dos pacientes sob tratamento com anticoagulantes não realiza a avaliação do RNI com frequência.

  6. Extraccion de aceite de coco a partir de la copra por medio de disolventes quimicos

    Directory of Open Access Journals (Sweden)

    J. Rosario Rivera Hernández

    2001-01-01

    Full Text Available Acetato de Etilo, alcohol Isopropílico, Hexano, Tetracloruro de carbono y xileno, fueron usados como disolventes para extraer de la copra aceite de coco. Se aplicaron dos procedimientos de extracción sólido-líquido a la temperatura de ebullición de los disolventes, así mismo se efectuaron tres corridas de extracción a tiempos de 1.0, 1.5 y 2.0 hrs. los resultados de las extracciones aparecen en las tablas 1 y 2.

  7. Coeficiente internacional normalizado, útil herramienta en la terapia anticoagulante oral

    OpenAIRE

    Dinorah Herenia Mulet Batista; Carlos Ramírez Pérez; Gladis Abreu Sera; Juan Pérez Mir; Jesús Alberto Pérez González

    2012-01-01

    El coeficiente internacional normalizado (international normalized ratio, INR por sus siglas en inglés) constituye la principal herramienta de evaluación de los pacientes sometidos a terapia anticoagulante oral; surgió por la necesidad de estandarizar los diferentes tipos de tromboplastinas, independientemente de su origen, de las  cuales dependen las cifras del verdadero estado de anticoagulación que desea el facultativo, fundamentalmente en los pacientes con riesgo de fenómenos tromboembóli...

  8. Ain Kivisaar : äärelinn pole kvaliteetne investeering / Ain Kivisaar ; interv. Enn Tosso

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti : Nedvizhimost 24. okt. lk. 2-3. Küsimustele kinnisvaraturu olukorra ja investeeringute kohta vastab Metro Capital Managementi finantsjuht Ain Kivisaar. CV: Ain Kivisaar

  9. Coeficiente internacional normalizado, útil herramienta en la terapia anticoagulante oral

    Directory of Open Access Journals (Sweden)

    Dinorah Herenia Mulet Batista

    2012-06-01

    Full Text Available El coeficiente internacional normalizado (international normalized ratio, INR por sus siglas en inglés constituye la principal herramienta de evaluación de los pacientes sometidos a terapia anticoagulante oral; surgió por la necesidad de estandarizar los diferentes tipos de tromboplastinas, independientemente de su origen, de las  cuales dependen las cifras del verdadero estado de anticoagulación que desea el facultativo, fundamentalmente en los pacientes con riesgo de fenómenos tromboembólicos. El objetivo de este trabajo es dar a conocer la sencilla técnica de determinación de dicha razón, para su extensión y aplicación en todas las unidades de salud. Además se define en cuales pacientes debe utilizarse el tradicional tiempo de protrombina y en cuales la razón internacional normalizada.

  10. Pautas de conducta frente a los pacientes bajo tratamiento anticoagulante en la clínica dental.

    OpenAIRE

    Bueno Lafuente, S.; Berini Aytés, Leonardo; Gay Escoda, Cosme

    1996-01-01

    Nuestro trabajo pretende dar unas ideas básicas para el manejo de pacientes sometidos a tratamiento anticoagulante dando a conocer las posibles pautas a seguir respecto a su medicación: mantener intacta la terapia anticoagulante, modificar la terapia anticoagulante o realizar tratamiento combinado de heparina con anticoagulantes orales. La decisión deberá tomarse conjuntamente con el hematólogo responsable del paciente valorando cada caso según la morbilidad intrínseca de la intervención, el ...

  11. Terapia anticoagulante en fibrilación auricular

    Directory of Open Access Journals (Sweden)

    Sebastián Prieto

    2011-06-01

    Full Text Available La fibrilación auricular es la taquiarritmia cardíaca más frecuente. Su incidencia aumenta con la edad, presentándose en un 1.5% entre los 50 a 59 años, y en un 8-10% entre los 80 a 89 años. Esta arritmia incrementa en cinco veces el riesgo de sufrir un evento cerebrovascular isquémico cardioembólico y causa el 15% de todos los accidentes cerebrovasculares isquémicos. Su manejo se enfoca en la prevención de los fenómenos tromboembólicos y el control de la frecuencia y ritmo cardíaco. El tratamiento anticoagulante ha demostrado ser la principal herramienta en la prevención de eventos cardioembólicos. Aunque las complicaciones hemorrágicas por el tratamiento son esperables y aumentan con la edad, el beneficio de usar anticoagulación sobrepasa por mucho al riesgo de sangrado. Precisamente debido a la heterogeneidad clínica de esta arritmia y a la dificultad de establecer un tratamiento adecuado para cada caso en particular, el American College of Cardiology, la American Heart Association, la European Society of Cardiology y el American College of Chest Physicians han establecido guías para mejorar el tratamiento de estos pacientes. La revisión de esta enfermedad y de las directrices propuestas puede facilitar y mejorar notablemente el tratamiento de los pacientes con fibrilación auricular.

  12. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2013-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  13. Baudelaire Eestis : märkmeid. III / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2004-01-01

    Ants Orase loodud eesti aleksandriinist. Artiklis tuuakse välja Charles Baudelaire luuletuse "Correspondances" eri tõlked (Ants Oras, Ain Kaalep) ja luuletuse "Le rêve d'un curieux" tõlked (Ilmar Laaban, Ain Kaalep)

  14. Tume aine ulatub lasteraamatuisse / Mari Niitra

    Index Scriptorium Estoniae

    Niitra, Mari, 1979-

    2007-01-01

    Lastekirjandusepäevast Tartu Linnaraamatukogus. Räägiti Philip Pullmani põnevustriloogiast "Tema tumedad ained" (Tiritamm, 2002-2005), kõrvutati J. K. Rowlingi Harry Potteri sarja Dmitri Jemetsi Tanja Grotteri lugudega, külalisesineja Peeter Sauter

  15. Comparación de disolventes para la extracción de materias grasas en hígado

    Directory of Open Access Journals (Sweden)

    Carril González-Barros, S. T.

    1996-10-01

    Full Text Available The efficiency of different organic solvents for extraction the fat of pork and veal liver were compared. Soxhlet extraction for 8 hours with n-Hexane: dichloromethane (1:1 was selected. Cv% was 1.9%.

    Se compara la eficacia de extracción de la materia grasa con diferentes disolventes en hígado de cerdo y de ternera. Los resultados más satisfactorios se obtuvieron utilizando un soxhlet con una mezcla de hexano: diclorometano (50:50 durante 8 horas. Se obtuvo un Cv% de 1.9%.

  16. Degradación de disolventes orgánicos de uso industrial en un reactor anaerobio de lecho expandido

    OpenAIRE

    Lafita Lopez, Carlos

    2016-01-01

    La contaminación atmosférica constituye actualmente una seria amenaza para el medio ambiente y la salud. En este sentido, las emisiones de compuestos orgánicos volátiles (COV) pueden contribuir de forma importante a la contaminación atmosférica. Una gran parte de estos compuestos se emiten en procesos productivos en los que se utilizan disolventes, de forma que las industrias que realizan estas actividades han de reducir su emisión hasta los límites establecidos en la legislación mediante cam...

  17. Ain Aaviksoo : arengukava jännis selgete vastuste andmisega / Ain Aaviksoo ; interv. Violetta Riidas

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2008-01-01

    Sügisel sotsiaalministrile kinnitamiseks saadetav esmatasandi tervishoiu arengukava on praegu veel olukorras, kus olulised sõlmkohad on lahendamata. Selleteemalistele küsimustele vastab poliitikauuringute keskuse PRAXIS juhatuse esimees Ain Aaviksoo, kelle sõnul võib arengukavas planeeritud tegevuste realiseerimiseks kuluda kaks korda enam raha kui praegu. Vt. samas: Traditsioonilisest patsiendirollist tuleb loobuda

  18. Hemodiálisis para remover el anticoagulante dabigatrán en situaciones de urgencia

    OpenAIRE

    2014-01-01

    El dabigatrán es un nuevo inhibidor directo de la trombina, de administración oral, empleado para la prevención de eventos tromboembólicos en pacientes con fibrilación auricular no valvular. A diferencia de la warfarina, no se dispone de un antídoto conocido. La hemodiálisis ha sido sugerida como un método para remover el dabigatrán y reducir el efecto anticoagulante. Se presenta el caso de un paciente con antecedente de fibrilación auricular y medicado con dabigatrán, que fue admitido en el ...

  19. Ain' Jesus korjaa syntiset (4/4 G)

    OpenAIRE

    2011-01-01

    Laulun sanat: Ain' Jesus korjaa syntiset, Ja sitoo niiden haavat. Ain' levottomat syntiset Häneltä levon saavat, Jotk' tuten heidän syntiäns' Juur' kauhistuvat itsiäns', Niit' Jesus ylös auttaa.

  20. Avances recientes en la investigación de los mecanismos celulares de acción de los disolventes de abuso

    OpenAIRE

    Nayeli Páez Martínez; Carolina López Rubalcava; Cruz, Silvia L.

    2003-01-01

    El presente trabajo es una revisión de los hallazgos recientes acerca de los mecanismos de acción de disolventes orgánicos industriales en el nivel molecular. Se incluyen los efectos de algunos de los principales disolventes de abuso sobre los receptores a glutamato del tipo NMDA y no-NMDA, receptores a GABAA, glicina, 5-HT3, nicotínicos y muscarínicos, así como sobre el sistema de neurotransmisión mesolímbico dopaminérgico y sobre la formación de especies reactivas de oxígeno. La mayoría de ...

  1. Novos anticoagulantes orais no tromboembolismo venoso e fibrilhação auricular New oral anticoagulants in the treatment of venous thromboembolism and atrial fibrillation

    OpenAIRE

    Luís Silvestre; Augusto Ministro; Ana Evangelista; Luís Mendes Pedro

    2012-01-01

    Os antagonistas da vitamina K foram, durante mais de 50 anos, os únicos anticoagulantes orais disponiveis. A imprevisibilidade da farmacocinética e farmacodinâmica desta classe de fármacos, responsável pela dificuldade na sua utilização, conduziu à necessidade do desenvolvimento de novas moléculas anticoagulantes. Estão actualmente diponíveis os resultados dos estudos de novos anticoagulantes orais no tromboembolismo venoso e na fibrilhação auricular, que se revêem neste trabalho.For more tha...

  2. Presencia de rodenticidas anticoagulantes en cinco especies de aves rapaces de las Islas Canarias, 2003-2011

    Directory of Open Access Journals (Sweden)

    N Ruiz-Suárez

    2012-01-01

    Full Text Available Se determinó la presencia de residuos de rodenticidas anticoagulantes por cromatografía de líquidos acoplada a espectrometría de masas de triple cuadrupolo en el hígado de 61 aves rapaces muertas provenientes del Centro de Recuperación de Fauna Silvestre de Tafira (Gran Canaria, pertenecientes a 5 especies de las 11 presentes en el archipiélago canario. Se encontraron residuos en 42 animales (69% si bien en sólo 1 de ellos se consideró la intoxicación por rodenticidas como causa primaria de muerte, según los datos clínicos, analíticos y de necropsia. De las rapaces estudiadas, fueron las especies Tyto alba y Accipiter nisus las que más frecuentemente presentaron residuos de anticoagulantes (85% y 89% respectivamente. Se detectaron residuos de 5 anticoagulantes, todos ellos de segunda generación, siendo la bromadiolona las más frecuentemente detectada, seguida del brodifacoum y del difenacoum. Un elevado número de las muestras positivas (63% presentó más de un residuo de anticoagulantes en su hígado, habiéndose encontrado mezclas de hasta 4 productos diferentes. Llamó la atención que la mayoría de los animales que ingresaron en el centro de recuperación por politraumatismo por colisión presentaba residuos de uno o varios anticoagulantes, así como que rapaces que se alimentan principalmente de pájaros también presentaron frecuentemente residuos de estos compuestos. Los resultados de este estudio sugieren que el elevado uso de rodenticidas anticoagulantes en el medio natural implica su incorporación a la cadena trófica, viéndose afectadas especies de fauna silvestre en las que estos productos podrían producir efectos adversos. Esto implica que la aplicación de rodenticidas anticoagulantes en espacios abiertos supone una amenaza para el estado de conservación de la biodiversidad de las Islas Canarias.

  3. First principle study on AIN Nano wire

    International Nuclear Information System (INIS)

    We present a first-principle study on the atomic and electronic structure of AIN Nanowire and examine the dependence of surface stress on nanowire lateral size and shape. The hexagonal wire size ranging as 10-16-22 A. We investigate the unsaturated dangling bond state in the region of bandgap with varying the wires diameter. We also calculated the surface formation energy and find that it decreases with increasing the wire diameter and a greater stability (lower surface formation energy) comes with hexagonal wire. We also study the dependence of theoretical prediction on various density functional theory (DFT) treatment using DMOL3 local orbital density functional method with an effective core potential. (author)

  4. Caracterización farmacoterapéutica de los anticoagulantes orales utilizados en pacientes hospitalizados

    Directory of Open Access Journals (Sweden)

    José Miguel Chaverri-Fernández

    2015-03-01

    Full Text Available Justificación: los anticoagulantes orales requieren una estricta farmacovigilancia; describir y analizar la utilización de estos medicamentos es importante para editar guías, recomendaciones y advertencias ante el uso de esta terapia, y así brindar al personal médico una herramienta de apoyo para su adecuada utilización. Métodos: se seleccionaron pacientes a quienes durante su estancia hospitalaria se les prescribiera algún anticoagulante oral. Se recolectó la información específica que facilitara el análisis. Para validar lo recopilado se utilizaron las guías del Colegio Americano de Cirujanos Torácicos y las guías americanas y europeas de los colegios de cardiología. Resultados: se recopiló la información de un total de 176 pacientes. Los especialistas que prescriben estos medicamentos son ortopedistas (40%, internistas (14%, cardiólogos (13% e intensivistas (11%, para el tratamiento de tromboprofilaxis de accidente cerebrovascular, tromboprofilaxis postoperatoria, tratamiento del tromboembolismo pulmonar y de trombosis venosa profunda; el 84% de los pacientes que usó estos medicamentos, lo hizo en indicaciones aprobadas. Se reportó un 3,4% de sangrados. Conclusión: la mayoría de las prescripciones se realizaron de acuerdo con lo establecido por las guías; a pesar de esto, existe una evidente incongruencia con respecto a los exámenes solicitados y su monitorización. La mayor proporción de los sangrados reportados se asoció a warfarina; aún así, seguirá siendo el estándar para el manejo de este tipo de pacientes, hasta que se apruebe tratamientos de reversión para los nuevos anticoagulantes y métodos adecuados para su monitorización, en los casos que se requiera.

  5. Baudelaire Eestis : märkmeid. II / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2002-01-01

    Ants Orase aleksandriini tõlkepõhimõtetest. Ch. Baudelaire'i luuletuse Bénédiction ("Õnnistus") kahe esimese stroofi kolm tõlget eesti keelde - Johannes Semperi, Indrek Hirve ja Ain Kaalepi eestindused

  6. Dozhivjom do võborov / Ain Seppik ; interv. Tatjana Opekina

    Index Scriptorium Estoniae

    Seppik, Ain, 1952-

    2007-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Keskerakonna poliitikat, parlamendivalimisi, aprillisündmusi, korruptsiooni, riigieelarvet. Ain Seppik leiab, et Keskerakonna missiooniks on arendada riiki ja kaitsta nõrku

  7. Manejo de antiagregantes y anticoagulantes en procedimientos intervencionistas de dolor crónico

    Directory of Open Access Journals (Sweden)

    M. Herrero Trujillano

    2015-06-01

    Full Text Available Los especialistas en dolor crónico nos enfrentamos habitualmente a situaciones en las que los pacientes que van a ser sometidos a procedimientos intervencionistas están bajo tratamiento antiagregante o anticoagulante. Las complicaciones hemorrágicas pueden ser catastróficas cuando se trata de bloqueos profundos y técnicas dentro del canal espinal. Sin embargo, el riesgo de eventos tromboembólicos aumenta con la suspensión inadecuada de los fármacos antiagregantes y anticoagulantes en estos pacientes. A día de hoy no existen unos algoritmos o recomendaciones actualizadas para el manejo de estos pacientes en el área de dolor crónico. El objetivo de este documento es ofrecer unas recomendaciones de seguridad sobre el manejo de estos fármacos según el tipo de intervención y el tipo de paciente, con el objetivo de minimizar el riesgo de complicaciones hemorrágicas sin aumentar el riesgo de eventos tromboembólicos. Para ello, se han revisado las últimas publicaciones sobre el manejo fármacos que alteran la hemostasia en anestesia regional y otras técnicas de dolor crónico, incluyendo diferentes guías de manejo perioperatorio (ASRA, ESA, SEDAR.... Existe buena evidencia en el incremento del riesgo de eventos tromboembólicos en pacientes que suspenden la terapia antiagregante, y que este riesgo es mayor que el de la incidencia de hematomas epidurales en pacientes que continúan con el tratamiento, si bien ambos riesgos son significativos. Así mismo, existe buena evidencia de la incidencia de hematomas epidurales espontáneos asociados o no a punción traumática, en pacientes con o sin terapia antitrombótica. Estos hematomas epidurales espontáneos están asociados a factores favorecedores como la manipulación excesiva, el uso de agujas de mayor calibre, el uso de catéteres, los procedimientos sobre el canal cervical, la edad avanzada, y las anormalidades vasculares y anatómicas del paciente. Hay una tendencia menos

  8. Propriedades anticoagulantes e antitrombóticas de polissacarídeos quimicamente sulfatados de liquens

    OpenAIRE

    Martinichen, Juliana Curi

    2013-01-01

    Uma ß-glucana (1 - 6) foi obtida através de extração alcalina do líquen Parmotrema mantiqueirense Hale e sulfatada, utilizando 6 e 10 mols de ácido clorosulfônico por OH livre da molécula. Os derivados sulfatados resultantes apresentaram grau de substituição (D.S) de 0,63 e 1,95, sendo denominados de ß-G-S1 e b-G-S2, respectivamente. A atividade anticoagulante da molécula nativa e das moléculas sulfatadas ß-G-S1 e ß-G-S2, foi determinada in vitro através dos testes tempo de tromboplastina par...

  9. Effects of the InAIN growth temperature and In mole fraction on subband transport in InxAI1-xN/(AIN)/GaN/AIN heterostructures

    International Nuclear Information System (INIS)

    Subband transport properties of the two-dimensional electron gas in InxAI1-xN/(AIN)/GaN/AIN heterostructures were investigated by means of variable magnetic-field Hall measurement between 30 K and 290 K. The experimental data was analyzed by using quantitative mobility spectrum analysis technique. The 2-dimensional electron gas with 1 or 2 subbands and the 2-dimensional hole were detected with i-quantitative mobility spectrum analysis technique. Mobility of the second subband of 2DEG was found to be higher than that of the first subband. The sheet carrier density for Hall, the first and the second subband were reduced while Indium mole fraction was increasing. This behavior is a result of total bound interface sheet density. During In mole fraction was increasing, second subband mobility was decreased.The first subband and Hall mobility was decreased once InAIN growth temperature was increased

  10. Optimización de la adsorción en una planta recuperadora de disolventes en la industria gráfica

    OpenAIRE

    Meneses Pérez, Miguel

    2010-01-01

    Las empresas del sector de artes gráficas, y de huecograbado en concreto, son grandes consumidoras de tintas en base disolvente para ciertas aplicaciones a día de hoy. Debido a que existe normativa en materia medioambiental que fija valores límite de emisión de los compuestos orgánicos volátiles (COV) provenientes de tintas y de operaciones de limpieza de los equipos de impresión y laminado, dichas empresas deben tener instalaciones preferentemente de recuperación, o al menos d...

  11. Hemodiálisis para remover el anticoagulante dabigatrán en situaciones de urgencia

    Directory of Open Access Journals (Sweden)

    Aldo Carrizo

    2014-04-01

    Full Text Available El dabigatrán es un nuevo inhibidor directo de la trombina, de administración oral, empleado para la prevención de eventos tromboembólicos en pacientes con fibrilación auricular no valvular. A diferencia de la warfarina, no se dispone de un antídoto conocido. La hemodiálisis ha sido sugerida como un método para remover el dabigatrán y reducir el efecto anticoagulante. Se presenta el caso de un paciente con antecedente de fibrilación auricular y medicado con dabigatrán, que fue admitido en el hospital para una cirugía abdominal de urgencia. A las seis horas de la última dosis recibida, los estudios de coagulación mostraban alteración. Ante la falta de antídoto para revertir los efectos, se decidió realizar hemodiálisis. Luego de tres horas de diálisis los parámetros de coagulación tendieron a normalizarse y el paciente fue operado sin presentar hemorragias anormales durante la cirugía o en el postoperatorio.

  12. Turismihariduse Tuleviku 2. Ümarlaud / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2014-01-01

    Tallinna Teeninduskoolis koostöös Eesti Ettevõtluse Sihtasutusega 8. aprillil toimunud ümarlauast, kus käsitleti sektori tööjõuvajadust. Ettekannetega esinesid Marje Josing, Laura Kirss, Thomas Baum, Ain Hinsberg, Monika Karu, Heli Müristaja

  13. Kolmas võimalus : Veel JR 200 kirjanduselust / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1996-01-01

    Vastuseks Ott Arderi artiklile 'Laulu võimu täius ja viletsus', Looming, nr. 5, samuti Sirje Oleski artiklile 'Prooimion Ain Kaalepi elu- ja loominguloole', Looming, nr. 6. Ka Eerik Tederi uurimusest 'Suomenpojat Viron Kirjallisuudessa ja heidän teostensa vastaanotto Suomessa' (Jyväskylä, 1996)

  14. Keila Tervisekeskus. Ujula = Keila Health Club. Swimming Pool / Ain Padrik

    Index Scriptorium Estoniae

    Padrik, Ain, 1947-

    2001-01-01

    Projekteerija: Arhitektuuribüroo Künnapu & Padrik. Arhitektid Ain Padrik ja Kristi Alamaa, sisearhitekt Sirje Männik. Konstruktsioonid: Jaan Laks, A-Grupp. Ujulas on võistlus- ja lastebassein, suvel on avatud välibassein. 5 ill.: I korruse plaan, ristlõige, vaated

  15. Pancreatite aguda devida a hematoma intramural do duodeno por uso de anticoagulante Acute pancreatitis due to intramural hematoma of the duodenum by use of anticoagulant therapy

    OpenAIRE

    Samer FARHOUD; Simone Moraes STEPHANI; Sansom Henrique BROMBERG

    2001-01-01

    Racional - A hemorragia intramural espontânea do duodeno causada por complicações da terapêutica anticoagulante é rara e seu tratamento controverso. Objetivo -- Apresentar a experiência advinda do tratamento de doente com essa condição clínica. Relato do caso - Expõe-se o caso de uma mulher de 71 anos de idade, que há 3 meses fazia uso de anticoagulante oral para tratamento de trombose venosa profunda dos membros inferiores. Apresentou-se com cefaléia e dores abdominais intensas no andar supe...

  16. Efeito anticoagulante in vitro do extrato hidroetanólico de folhas e flores édulas de Tropaeolum majus L. (Tropaeolaceae) sobre o plasma humano

    OpenAIRE

    Santo, Ana P. E.; Martins, Ida S. S.; Tomy, Sandra C.; Vicente O. Ferro

    2007-01-01

    Este trabalho teve por objetivo avaliar o efeito anticoagulante in vitro dos extratos de flores e de folhas comestíveis da capuchinha, Tropaeolum majus L. (Tropaeolaceae), através de testes de tempo de trombina (TT), buscando identificar o grupo de compostos responsáveis pela atividade anticoagulante. A análise de variância e o teste Tukey-Kramer revelaram diferença significativa (p < 0,001) entre os grupos teste e controle. Foram dosados os teores de compostos fenólicos e flavonóides dos...

  17. Mielopatia induzida por medicação anticoagulante: relato de um caso com hematoma epidural espinhal

    OpenAIRE

    Lineu Cesar Werneck; João Cândido Araujo; Acir Rachid

    1982-01-01

    Relato do caso de uma paciente de 51 anos de idade, recebendo anticoagulante por tromboflebite e embolias pulmonares, com tempo de atividade de protrombina dentro do limite terapêutico, que desenvolveu súbita paraplegia. A investigação revelou bloqueio medular e a cirurgia comprovou ser um hematoma epidural espinhal, que foi evacuado. A paciente permaneceu com os mesmos déficits clínicos no post-operatório. São feitos comentários a respeito da etiologia dos hematomas espinhais epidurals, sua ...

  18. Novos anticoagulantes em cuidados intensivos New anticoagulants in critical care settings

    Directory of Open Access Journals (Sweden)

    Uri Adrian Prync Flato

    2011-03-01

    Full Text Available Eventos tromboembólicos são complicações comuns em pacientes críticos. Podem apresentar sinais e sintomas pouco específicos e estão associados a um substancial aumento na morbimortalidade dos pacientes internados em unidades de terapia intensiva. Os agentes antitrombóticos são o pilar no tratamento e prevenção do tromboembolismo. Esta classe é também utilizada na prevenção do acidente vascular encefálico, na fibrilação atrial, na prevenção de eventos embólicos da insuficiência cardíaca, em pacientes com próteses valvares e têm sido associados a antiplaquetários na prevenção secundária da síndrome coronária aguda. Agentes antitrombóticos, como aspirina, clopidogrel, antagonistas da vitamina K e foundaparinux (inibidor indireto do fator Xa já foram incorporados na prática clínica rotineira dos serviços de terapia intensiva. Recentemente, tem-se demonstrado grande interesse nos agentes que inibem seletivamente o fator Xa e a trombina. Estes apresentam estrutura molecular pequena e inibem simultaneamente o fator da coagulação livre no plasma e ligado ao trombo. Entre os novos anticoagulantes orais, dabigatran, rivaroxaban e apixaban são os que apresentam estudos clínicos em fases mais avançadas e uso na prática clínica já licenciado em alguns países. O objetivo desta revisão é salientar os principais estudos da literatura sobre novos anticoagulantes no cenário das unidades de terapia intensivaThromboembolic events commonly occur in critically ill patients, and although they do not consistently present with specific signs and symptoms, they are associated with high morbity and mortality. Antithrombotic agents are the mainstay of the prevention and treatment of venous thromboembolism, and they are also used for stroke prevention in atrial fibrillation, embolism prevention in heart failure, and anticoagulation of prosthetic valves. These drugs have been combined with antiplatelet therapy for the

  19. Extracción de cromo con disolventes orgánicos. I parte. Extracción con DEHPA

    Directory of Open Access Journals (Sweden)

    de Juan, D.

    1998-06-01

    Full Text Available Chromium and its compounds give toxic and/or hazardous characteristics to all those industrial wastes, solids or liquids, that contain them. Organic solvent extraction is a technique that allows the recovery of chromium contained in these residues. In this work the extraction of Cr(III from aqueous solutions with solutions of a cationic reactive (DEHPA in kerosene is studied. In the same way the stripping process was studied. It has been found that Cr(III and DEHPA react in a 1/1 molar ratio, being the extraction kinetics very fast. Final aqueous phase final pH influence extraction yield, so that it is necessary to work with pH values between 3 and 4. It must be added a modifier (isodecanol to the organic phase to avoid the formation of a third phase in the stripping process. The concentration of isodecanol has to be higher than 15 %, so the organic phase used was a solution of 12.5 % v/v DEHPA in kerosene and 20 % v/v isodecanol. The stripping process is slow and must be carried out in an oxidant alkalyne medium, thus an aqueous solution of NaOH and H2O2 was used. An increase in the concentration of NaOH and H2O2 leads to an increase in the stripping yield initially, and becomes stable when concentrations of NaOH and H2O2 used are higher than 0.45 N and 4 % v/v respectively.

    El cromo y sus compuestos confieren un carácter tóxico y/o peligroso a los residuos industriales, sólidos o líquidos, que los contienen. Una técnica que permite recuperar el cromo existente en estas sustancias es la extracción con disolventes orgánicos. En el presente trabajo se estudia la extracción del Cr(III presente en disoluciones acuosas con disoluciones de un reactivo de carácter catiónico (DEHPA en queroseno. Igualmente se estudia el proceso de reextracción. Se ha encontrado que el Cr(III y el DEHPA reaccionan mol a mol, siendo la cinética de extracción muy rápida. El pH final de

  20. Turism on/ei ole eksport?! / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2008-01-01

    Autor tõdeb, et riik ei soovi tunnistada turismi kui eksportiva sektori olulisust Eesti majanduses. Turismisektori konkurentsivõimele mõjuks pärssivalt majutusteenuste käibemaksu määra tõstmine, mida märkis oma kirjas Riigikogule ja valitsusele ka Eesti Hotellide ja Restoranide Liit. Vt. ka: Ain Hinsberg. Tunnustuseta kuuendik Eesti majandusest riigiga ümarlaua taga. Ärielu (2000) juuli, nr. 7-8, lk. 77-79

  1. AIN-Based Action Selection Mechanism for Soccer Robot Systems

    Directory of Open Access Journals (Sweden)

    Yin-Tien Wang

    2009-01-01

    Full Text Available Role and action selections are two major procedures of the game strategy for multiple robots playing the soccer game. In role-select procedure, a formation is planned for the soccer team, and a role is assigned to each individual robot. In action-select procedure, each robot executes an action provided by an action selection mechanism to fulfill its role playing. The role-select procedure was often designed efficiently by using the geometry approach. However, the action-select procedure developed based on geometry approach will become a very complex task. In this paper, a novel action-select algorithm for soccer robots is proposed by using the concepts of artificial immune network (AIN. This AIN-based action-select provides an efficient and robust algorithm for robot role selection. Meanwhile, a reinforcement learning mechanism is applied in the proposed algorithm to enhance the response of the adaptive immune system. Simulation and experiment are carried out to verify the proposed AIN-based algorithm, and the results show that the proposed algorithm provides an efficient and applicable algorithm for mobile robots to play soccer game.

  2. Extracción de hidrocarburos aromáticos de fracciones de petróleo utilizando mezclas de líquidos iónicos como disolvente

    OpenAIRE

    García Sánchez, Silvia

    2012-01-01

    El objetivo de esta Tesis Doctoral se centra en el desarrollo de una tecnología de separación de hidrocarburos aromáticos como benceno, tolueno, etilbenceno y xilenos (BTEX) de hidrocarburos alifáticos basada en el empleo de mezclas binarias de líquidos iónicos como disolventes extractivos. Los líquidos iónicos han mostrado ser en general una clase de disolventes que permitirían hacer más “verdes” los procesos químicos. Sin embargo, muy pocos de los líquidos iónicos ensayados hasta ahora para...

  3. Utilización profiláctica de anticoagulantes en un hospital de la ciudad de bogotá

    OpenAIRE

    Supelano, Sonia; Bustamante, Carlos; López, Julián

    2008-01-01

    Con el fin de conocer la prevalencia y tendencias de uso de los anticoagulantes en el servicio de Medicina Interna, se estudió una muestra representativa de 250 historias clínicas (136 hombres, 114 mujeres, mayores de 18 años, rango: 18 - 92) promedio 58 años, desviación estándar; 18., dados de alta entre el lº de enero de 1998 y el 31 de diciembre de 1998 de un hospital de tercer nivel de la ciudad de Bogotá. Se encontró que los siguientes factores inducen la prescripción profiláctica de ant...

  4. Mielopatia induzida por medicação anticoagulante: relato de um caso com hematoma epidural espinhal

    Directory of Open Access Journals (Sweden)

    Lineu Cesar Werneck

    1982-12-01

    Full Text Available Relato do caso de uma paciente de 51 anos de idade, recebendo anticoagulante por tromboflebite e embolias pulmonares, com tempo de atividade de protrombina dentro do limite terapêutico, que desenvolveu súbita paraplegia. A investigação revelou bloqueio medular e a cirurgia comprovou ser um hematoma epidural espinhal, que foi evacuado. A paciente permaneceu com os mesmos déficits clínicos no post-operatório. São feitos comentários a respeito da etiologia dos hematomas espinhais epidurals, sua patogenia, etiologia e chamada a atenção para o pronto diagnóstico e tratamento cirúrgico.

  5. Efectos de dos anticoagulantes sobre el recuento celular y parámetros de activación plaquetaria de plasma rico en plaquetas de equinos

    Directory of Open Access Journals (Sweden)

    CE Giraldo

    2015-01-01

    Full Text Available Los objetivos del estudio fueron 1 comparar el efecto de los anticoagulantes citrato de sodio (CS y ácido-citrato-dextrosa (ACD, solución A (ACD-A, sobreconteos de plaquetas (PLTs, leucocitos y variables de activación plaquetaria, volumen plaquetario medio (VPM y ancho de distribución del tamaño de las plaquetas (ADTP en sangre total, plasma rico en plaquetas (PRP y plasma pobre en plaquetas (PPP de equinos; 2 establecer eficiencias de colección de PLT y leucocitos para PRP obtenidos con ambos anticoagulantes y 3 correlacionar recuentos de PLT, leucocitos, VPM y ADTP de cada componente sanguíneo. Se recolectó sangre de 18 caballos con tubos de CS y ACD-A, elaborando PRP y PPP por cada anticoagulante por el método del tubo. Sangre total, PRP y PPP fueron evaluados mediante hemograma automatizado. Los conteos de PLT y leucocitos en sangre total, PRP y PPP no fueron afectados por ambos anticoagulantes. Conteos de PLT fueron significativamente mayores (P < 0,001 en PRP comparados con sangre total y PPP. Los conteos de leucocitos fueron similares entre sangre total y PRP, difiriendo significativamente (P < 0,001 del PPP. No hubo diferencias significativas para VPM y ADTP entre sangre total y PRP. Se observaron correlaciones significativas entre conteos de PLT y leucocitos (ρ: 0,73, P < 0,01, conteos de leucocitos y linfocitos (ρ: 0,76, P < 0,01, conteos de PLT y linfocitos (ρ: 0,60, P < 0,01, y correlación negativa moderada entre conteos de leucocitos y ADTP (ρ: -0,65, P < 0,01. Los anticoagulantes utilizados en la preparación del PRP equino no influyeron sobre concentración celular ni parámetros de activación plaquetaria. Así, los parámetros celulares no son útiles para discriminar cuál de los dos anticoagulantes es mejor para producir PRP equino.

  6. Efectos de dos anticoagulantes sobre el conteo celular y parámetros de activación plaquetaria de plasma rico en plaquetas de bovinos

    Directory of Open Access Journals (Sweden)

    JU Carmona

    2014-01-01

    Full Text Available El objetivo de este estudio fue comparar el plasma rico en plaquetas (PRP obtenido de sangre de vacas empleando citrato de sodio (CS o citrato, ácido cítrico, dextrosa-solución A (ACD-A como anticoagulantes con relación al contenido de plaquetas y leucocitos y el grado de activación de las plaquetas en la sangre entera (SE y plasma rico en plaquetas (PRP. Se recolectaron muestras de SE de 15 vacas Holstein clínicamente sanas en tubos con CS y ACD-A. Las muestras fueron procesadas por un método de centrifugación doble en tubo para obtener PRP. El PRP y la SE fueron analizados para hemograma y determinación automatizada del volumen plaquetario medio (VPM y la amplitud de distribución de las plaquetas (ADP. Los recuentos de plaquetas difirieron (P < 0,0001 entre SE y PRP para cada anticoagulante por separado. La concentración de plaquetas en el PRP fue 2,3 y 2,5 veces para CS y ACD-A, respectivamente, en comparación con los conteos de plaquetas en SE para ambos anticoagulantes. La concentración de plaquetas en PRP no difirió entre ambos anticoagulantes. Los valores del VPM y ADP fueron similares en los plasmas obtenidos posterior a las centrifugaciones independientemente del anticoagulante utilizado. Los conteos de leucocitos fueron mayores (P < 0,001, particularmente de linfocitos, en el PRP con CS en comparación con el PRP obtenido con ACD-A. En conclusión, los resultados obtenidos permitieron establecer que no existen diferencias para la obtención de PRP bovino, mediante el uso de CS o ACD-A como anticoagulantes. Los resultados sugieren la conservación de plaquetas homogéneas y estables estructuralmente en el PRP bovino, especialmente cuando se utilizó citrato de sodio.

  7. Aplicacions Industrials de la Nanotecnologia: IV Jornada AIN

    OpenAIRE

    Mora Casanova, Jordi

    2010-01-01

    El passat 9 de juny es va celebrar, a la Casa Llotja de Mar de Barcelona, la quarta edició de les jornades AIN sobre aplicacions industrials de la nanotecnologia. L'esdeveniment va comptar amb la participació de ponents del món acadèmic i empresarial, convertint-se en una plataforma per a la sinergia universitat-empresa. No només va servir per mostrar l'excel·lent estat de salut de què gaudeix la recerca en nanotecnologia a nivell estatal, també es va reivindicar com a eina per impulsar la no...

  8. Structural and optical characteristics of AlxGa1-xN/AIN superlattice

    Institute of Scientific and Technical Information of China (English)

    XIE ZiLi; SHI Yi; ZHENG YouDou; ZHANG Rong; JIANG RuoLian; LIU Bin; GONG HaiMei; XIU XiangQian; CHEN Peng; LU Hai; HAN Ping

    2009-01-01

    AIN/Al0.3Ga0.7N superlattices were grown on (0001) sapphire substrate by metal-organic chemical vapor deposition (MOCVD). The superlattice period varies from 6 to 30. The layer thickness of different period stack was designed. GaN or AiGaN template was employed for growing AIN/AIGaN superlattices. Re-flectivity, SEM, AFM and XRD data of the AlxGa1-xN/AIN superlattices are presented. It is found that the templates used have an intensive impact on surface roughness and interfacial properties of following AIN/AIGaN superlattices. The result of atomic force microscopy indicates that AIN/AIGaN superlattices grown on GaN template exhibit quasi-two-dimensional growth mode. The resulting superlattice has a smooth surface morphology and distinct interface. No crack is observed in the area of a 2-inch wafer.

  9. Effects of Microstructure Modification on Properties of AIN/BN Composites

    Institute of Scientific and Technical Information of China (English)

    LI Meijuan; ZHANG Lianmeng; SHEN Qiang; ZHANG Dongming

    2008-01-01

    It is very difficult to prepare full-densified aluminum nitride-boron nitride(AIN/BN)composite ceramics with homogeneous microstructure and high thermal conductivity.Spark plasma sintering(SPS)was used to fully densify the AIN/BN composites in this work.Microstructure,mechanical properties and thermal conductivity of the SPS sintered AIN/BN composites with 5-30 vol% BN were investigated.The results show that the microstructure of composites is fine and homogenous,and the AIN/BN composites exhibit high mechanical properties.To promote the growth of AIN grains and modify the distribution of grain boundary in AIN/BN composites,a heat treating methodology was introduced through gas pressure sintering(GPS).This processing was significantly beneficial to enhancing the thermal conductivity of the specimen.The thermal conductivity of AIN/BN composites with 5-30 vol% BN reached 60 W/m K after the samples were treated by GPS.

  10. Puente sobre el río Ain

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1963-02-01

    Full Text Available Owing to the construction of the new dam on the river Ain. the water of the river level has risen considerably above the earlier level of flow at the suspension bridge in the neighbourhood of Serrieres sur Ain. Hence it became necessary to substitute this structure by a more modern one, suitable to present day traffic demands. This paper summarises the main features of this new bridge. The new bridge spans the river by means of a reinforced concrete arch of 120 m span. The arch is circular, and the deck rests on a palissade supported by the arch. The maximum rise is 30 ms at the crown. The deck carries a roadway 7 ms wide and two sidewalks of 1 m width each, for pedestrians. The deck is supported by by four longitudinal beams, and the arch has a box section and 4 longitudinal stiffners. In the crown zone the stiffners, the deck and the cylindrical surfaces become integrated and enclose three hollow chambers. This structure has great stiffness. The depth of the arch is constant, except at the crown, and is 2.40 ms. This depth gives the arch a pleasing and slender aspect. The palissade consist of four rows of columns, of 0.80x0.20 ms section, at intervals of 12.50 ms. The radius of the arch is 78.80 ms, and its transversal box section has a total width of 8.60 ms. The thickness of the inner cylindrical surface is 0.20 ms. The springers consist of two large reinforced concrete blocks, of approximately 10 ms length and 4.70 ms height. The construction of the bridge was done with the aid of a Blondin cable, of 5 tns capacity, spanning 290 ms. The main constructional aid was a. wooden scaffolding, cantilevered from the sides, consisting of 10 trusses. The timber elements were nailed and bolted together. The top part of the framework supports a formwork, made with a double layer of boards, 27 mm in thickness, crossing each other at 45°. The scaffolding was erected in successive phases and a number of guy cables were employed to stabilise the structure

  11. Spark Plasma Sintered AIN-BN Composites and Its Thermal Conductivity

    Institute of Scientific and Technical Information of China (English)

    ZHAO Haiyang; WANG Weimin; WANG Hao; FU Zhengyi

    2008-01-01

    A series of samples of hexagonal boron nitride-aluminum nitride ceramic composites with different amounts of CaF2 as sintering aid were prepared by spark plasma sintered at 1700-1850 ℃ for 5 min.The addition of CaF2 effectively lowered the sintering temperature and promoted the densification of AlN-BN composites.With the increase of sintering temperature,the density increased,and the contiguity of AIN grains enhanced in AIN-BN composites.Thermal conductivity of AIN-BN composites increased with the increase in CaF2 content and sintering temat 1800 ℃.

  12. An integrated water resources management strategy for Al-Ain City, United Arab Emirates

    OpenAIRE

    Mohamed, M. M.

    2014-01-01

    Al-Ain is the second largest city in the Emirate of Abu Dhabi and the third in the UAE. Currently, desalination plants are the only source of drinking water in the city with an average daily supply of 170 MIG. Recently, Abu Dhabi Urban Planning Council (UPC) released Al-Ain 2030 Plan. Projects suggested in this plan, over and above the expected natural population growth, will certainly put additional stress on the water resources in the city. Therefore, Al-Ain city seems to be in urgent need ...

  13. Air quality in Ain Shams University Surgery Hospital.

    Science.gov (United States)

    El Awady, M Y; El Rahman, A T Abd; Al Bagoury, L S; Mossad, I M

    2014-12-01

    Through air sampling, it was possible to evaluate microbial contamination in environments at high risk of infection, and to check the efficiency of ventilation system and the medical team's hygiene procedures. This study measured the concentration of particulate matter (PM) 2.5 or less microns and microbiological organisms in operating rooms (OR), intensive care units (ICU) and emergency rooms (ER) in Ain Shams University Surgery Hospital, and to assess ventilation characteristics in operating rooms in the hospital. The passive air sampling was done from ICUs, ORs, and ERs in Ain Shams University Surgery Hospital. Also for each operating room, an observational checklist was done to record other factors that may affect air quality in the room. The evaluated air quality indices were: suspended (PM) 2.5 micrometer or less, culture media and microbial identification of bacteria and fungi, and temperature and relative humidity. The results showed that the highest mean found for bacterial (105.70±30.49) and fungi concentration (7.50±5.30) was in ER. The three settings did not differ statistically as regard levels of PM 2.5, temperature, and relative humidity. A positive correlation exits between bacteria and fungi concentration on one hand and relative humidity on the other. Diphteroid, CONS, MRSA, S. aureus, and Anthracoid were the most frequent isolated bacterial types, while Penicillium and Asperigillus fumigatus were the most frequent isolated fungi. In operating rooms, the percent of unmasked persons present and the temperature positively influence the bacterial count, while ventilation condition is negatively influencing fungi count, and the number of persons present in the operating room positively affects the PM level. PMID:25643516

  14. Tumedad ained kirjanduses ja päriselt / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2007-01-01

    Analüüsitud on Philip Pullmani triloogiasse "Tema tumedad ained" kuuluvaid romaane : Pullman, Philip. Kuldne kompass. Tallinn : Tiritamm, 2002; Pullman, Philip. Inglite torn. Tallinn : Tiritamm, 2004; Pullman, Philip. Vaigust kiiker. Tallinn : Tiritamm, 2005

  15. Üks väike kirjavahetus / H. G.; Ain Kaalep

    Index Scriptorium Estoniae

    G., H.

    2001-01-01

    Kirjavahetus H. G. ja Ain Kaalepi vahel ajendatuna Vello Helki (Kas Eesti Vabariik on 83-aastane - Akadeemia 2/2001) ja Jaan Isotamme (Kommentaar V. Šironini artiklile "Eesti KGB likvideerimine" - Akadeemia 3/2001) artiklitest

  16. TÜ osales Coimbra grupi üldkogul Sienas / Jaak Kangilaski, Ain Heinaru

    Index Scriptorium Estoniae

    Kangilaski, Jaak, 1939-

    2004-01-01

    Aprillis Itaalias Siena Ülikoolis toimunud Coimbra grupi üldkogul vahetasid ülikoolid kogemusi ja kooskõlastasid tegevuspõhimõtteid. Tartu Ülikoolist osalesid rektor Jaak Aaviksoo, prorektor Jaak Kangilaski ja teadusprorektor Ain Heinaru

  17. Aineüleste pädevuste koolitus Pestalozzi programmi raames / Tiia Pukk, Tiiu Vaher

    Index Scriptorium Estoniae

    Pukk, Tiia

    2011-01-01

    1969 alguse saanud Pestalozzi koolitusprogramm on suunatud Euroopa kultuurikonventsiooniga ühinenud 49 riigi haridustöötajatele. Seekordne üritus toimus Tartus, koolituse teemaks aineülesed pädevused

  18. Ain Hanschmidt jättis küsijad vastuseta / Andrus Karnau

    Index Scriptorium Estoniae

    Karnau, Andrus

    2005-01-01

    Ühispanga endise juhi Ain Hanschmidti 26. septembri pöördumine ei andnud vastuseid tema äritehingutega seoses esile kerkinud olulistele küsimustele: mille eest ta sai osalused laevakompaniis Tallink Grupp ja Haapsalu HRM-is. Lisa: Ain Hanschmidti argumendid. Küsimusele, kas Hanschmidti seletused olid piisavad vastavad Eesti Investorite Liidu juhatuse liige Heldur Meerits ja Sillamäe Soojuselektrijaama juhataja Väino Sarnet

  19. Hemorragias intracraneales de carácter evitable asociadas a anticoagulantes orales en pacientes con fibrilación auricular Avoidable intracranial hemorrhages associated with oral anticoagulants in patients with atrial fibrillation

    OpenAIRE

    A. García Luque; J. Torello Iserte; J.R. Castillo Ferrando

    2011-01-01

    Introducción y objetivo: El aumento de la prescripción de anticoagulantes orales ha provocado un aumento de hemorragias intracraneales, la reacción adversa más grave asociada a este grupo farmacológico. El objetivo del estudio es evaluar el carácter evitable de hemorragias intracraneales asociada a anticoagulantes orales que causan ingreso hospitalario en pacientes con fibrilación auricular. Método: Supervisión de las historias clínicas de los pacientes que ingresaron en los Hospitales Univer...

  20. Influência dos anticoagulantes e da temperatura de armazenamento sobre os níveis sanguíneos de nitrito Effects of anticoagulants and storage temperature on blood nitrite levels

    OpenAIRE

    Etiane Tatsch; Guilherme Vargas Bochi; Renata da Silva Pereira; Helena Kober; Jarbas Rodrigues de Oliveira; Rafael Noal Moresco

    2011-01-01

    A mensuração dos metabólitos do óxido nítrico pode ser útil para a melhor compreensão de diferentes processos fisiopatológicos. Este estudo avaliou a influência de diferentes anticoagulantes (ácido etilenodiaminotetracético [EDTA], citrato e heparina) e do armazenamento a -20ºC por quatro meses sobre os níveis de nitrito, sendo estes mensurados em amostras de soro e plasma pelo método de Griess. Os tipos de amostra utilizados (soro ou plasma) e de anticoagulante usado na coleta não influencia...

  1. Pancreatite aguda devida a hematoma intramural do duodeno por uso de anticoagulante Acute pancreatitis due to intramural hematoma of the duodenum by use of anticoagulant therapy

    Directory of Open Access Journals (Sweden)

    Samer FARHOUD

    2001-01-01

    Full Text Available Racional - A hemorragia intramural espontânea do duodeno causada por complicações da terapêutica anticoagulante é rara e seu tratamento controverso. Objetivo -- Apresentar a experiência advinda do tratamento de doente com essa condição clínica. Relato do caso - Expõe-se o caso de uma mulher de 71 anos de idade, que há 3 meses fazia uso de anticoagulante oral para tratamento de trombose venosa profunda dos membros inferiores. Apresentou-se com cefaléia e dores abdominais intensas no andar superior do abdome, associadas a náuseas e vômitos. Os exames laboratoriais e de imagem comprovaram o diagnóstico de surto agudo de pancreatite, decorrente de hematoma intramural de duodeno. Os valores de protrombina (49,7 s e o sangramento de tecidos moles cervicais e urinário, sugeriam complicação da terapêutica anticoagulante. Resultados - A terapêutica conservadora foi efetiva, tendo a doente recebido alta, assintomática, no 10º dia de internação. Conclusão - É recomendado o emprego do anticoagulante em doses menores nos doentes de risco e adequado controle dos parâmetros da coagulação. Acredita-se ser ideal a conduta conservadora e recomenda-se a cirurgia somente nos casos que evoluem com complicações.Background - Spontaneous intramural hemorrhage of the duodenum due to anticoagulant therapy is rare and the treatment is controversial. Objective - To present the acquired knowledge with the treatment of these disease. Case report - A 71-year-old women receiving for a 3 month period an anticoagulant therapy presented cervical bleeding of soft tissues and symptoms of acute pancreatitis and high small bowel obstruction. Early noninvasive diagnosis by computed tomographic scan was possible and conservative therapy proved successful in complete resolution of the pancreatitis and obstructive symptoms, with resumption of oral intake in the fourth day of treatment. The frequency of bleeding in high risk patients during warfarin therapy

  2. Conhecimento sobre anticoagulantes orais e seu manejo por médicos de pronto atendimento Emergency-room doctors' knowledge about oral anticoagulants and its management

    OpenAIRE

    Larissa Periotto Borlina; Ewerson Luiz Cavalcanti e Silva; Carolina Ghislandi; Jorge Rufino Ribas Timi

    2010-01-01

    Contexto: Desde sua descoberta, os anticoagulantes orais (AO) têm sido cada vez mais estudados e aplicados em diferentes doenças. No entanto, eles apresentam reações medicamentosas com fármacos que trazem riscos ao paciente. Objetivo: Identificar o nível de conhecimento dos médicos plantonistas de pronto atendimento sobre os AO e suas interações, medicamentosas ou não, e verificar se o médico frentista está preparado para integrar o conteúdo teórico com a rotina de urgências. Método: Aplicou-...

  3. International Normalized Ratio, a Useful Tool in Oral Anticoagulant Therapy Coeficiente internacional normalizado, útil herramienta en la terapia anticoagulante oral

    Directory of Open Access Journals (Sweden)

    Dinorah Herenia Mulet Batista

    2012-06-01

    Full Text Available The international normalized ratio (INR is the primary tool for assessing patients undergoing oral anticoagulant therapy. It was created from the need of standardizing the different types of thromboplastins, regardless of their origin, from which the figures of the true anticoagulation state desired by the physician depend, mainly in patients at risk of thromboembolic events. The objective of this work is to show the simple technique of determining this ratio so that it can be extended to and performed in all health units. It is also defined for which patients the traditional prothrombin time should be used and for which the international normalized ratio.

    El coeficiente internacional normalizado (international normalized ratio, INR por sus siglas en inglés constituye la principal herramienta de evaluación de los pacientes sometidos a terapia anticoagulante oral; surgió por la necesidad de estandarizar los diferentes tipos de tromboplastinas, independientemente de su origen, de las  cuales dependen las cifras del verdadero estado de anticoagulación que desea el facultativo, fundamentalmente en los pacientes con riesgo de fenómenos tromboembólicos. El objetivo de este trabajo es dar a conocer la sencilla técnica de determinación de dicha razón, para su extensión y aplicación en todas las unidades de salud. Además se define en cuales pacientes debe utilizarse el tradicional tiempo de protrombina y en cuales la razón internacional normalizada.

  4. Characterization of the Ain Khemouda halloysite (western Tunisia) for ceramic industry

    Science.gov (United States)

    Ben M'barek Jemaï, Moufida; Sdiri, Ali; Errais, Emna; Duplay, Joelle; Ben Saleh, Imed; Zagrarni, Mohamed Faouzi; Bouaziz, Samir

    2015-11-01

    White clays of Ain Khemouda (Western Tunisia), filling the post-Miocene palaeokarsts cavities dug in the intermediate limestones bed of the Douleb formation (Senonian system), were used as raw materials for the preparation of ceramic bodies. Natural clay samples, collected from the Ain Khemouda palaekarsts to the North of Jebel Semmama (Kasserine, Tunisia), were characterized by different techniques. Chemical and mineralogical analyses were carried out by atomic absorption spectroscopy (AAS) and X-ray diffraction (XRD), respectively. Thermal analysis was also performed by thermogravimetry (TG-DTA), dilatometry and Bigot's curve. Chemical analysis indicated that the studied clay was composed of silica and alumina as major elements with the ratio SiO2/(Al2O3 + Fe2O3) close to 2. Significant amounts of zinc and iron oxides subordinated the main alumino-silicates minerals. Mineralogical analysis showed that Ain Khemouda white clay consisted of halloysite and meta-halloysite mixture. Characteristic peaks of halloysite occurred near 10 Å and 7 Å. Transmission electron microscopy (TEM) images showed rolled wafers, characterizing the tubular shape of halloysite. From these results, it could be concluded that Ain Khemouda clay was Zn-aluminous hydrated halloysite (10 Å). In addition, cation exchange capacity (CEC) was relatively low (18 mEq/100 g), indicating insufficient edge valences. Industrial ceramic tests performed at the laboratory scale indicated that the Ain Khemouda clays have the required technical specifications to be used as raw materials for ceramic tiles and refractory ceramic manufacturing.

  5. Infant-feeding practices in Al-Ain, United Arab Emirates.

    Science.gov (United States)

    Osman, N A; el-Sabban, F F

    1999-01-01

    A survey was conducted to study the practices of infant-feeding and the influencing factors in Al-Ain, United Arab Emirates. It involved 375 mothers of different nationalities and backgrounds and 300 healthy infants. The mothers were interviewed at four primary health care clinics in Al-Ain. Results showed that 46% of infants were breastfed for 4-6 months. The mother's nationality and her educational status were significant influences on the mother's decision to exclusively breast-feed the infant, for how long and when to introduce supplementary food. Fresh cow and goat milk were the most common supplements. Inclusion of baby formula as a supplement generally occurred early, perhaps because of advertising and the affluence in Al-Ain. PMID:10793786

  6. Kurja lilled / Charles Baudelaire ; prantsuse k. tlk. Ain Kaalep ja Märt Väljataga

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Õnnistamine ; "Jumaldan Sind ma siin, öist taevavõlvi nägev / tlk. Ain Kaalep ; Palkon / tlk. Märt Väljataga ; Kodukäija ; Kassid / tlk. A. Kaalep ; Armastades valet / tlk. M. Väljataga ; Üksildase vein ; Päeva lõpp / tlk. Ain Kaalep. Orig.: Bénédiction ; "Je t'adore ̉ l'égal de la vo͠te nocturne ; Le balcon ; Les chats ; L'amour du mensonge ; Le vin du solitaire ; La fin de la journée

  7. Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES)

    OpenAIRE

    Margarita Restrepo; María del Rosario Osorio

    2000-01-01

    Los antiinflamatorios no esteroideos (AINES) son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos...

  8. Fabrication and performance of AIN insulator coatings for application in fusion reactor blankets

    International Nuclear Information System (INIS)

    The liquid-metal blanket concept for fusion reactors requires an coating on the first-wall structural material to minimize the magnetohydrodynamic pressure drop that occurs during the flow of liquid metal in a magnetic field. Based on the thermodynamics of interactions betwen the coating and the liquid lithium on one side and the structural V-base alloy on the other side, an AIN coating was selected as a candidate. Detailed investigations were conducted on the fabrication, metallurgical microstructure, compatibility in liquid Li, and electrical characteristics of AIN material obtained from several sources. Lithium compatibility was studied in static systems by exposing AIN-coated specimens to liquid Li for several time periods. Electrical resistance was measured at room temperature on the specimens before and after exposure to liquid Li. The results obtained in this study indicate that AIN is a viable coating from the standpoint of chemical compatibility in Li, electrical insulation, and ease of fabrication; for these reasons, the coating should be examined further for fusion reactor applications

  9. ISO sertifikaat kuulutab tootja mainet üle maailma / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 12. apr. lk. 24-25. ISO standardi rakendamine tagab toodangu kvaliteedi ja annab firmale usaldusväärsuse. Kommenteerib Ain Noormägi. Vt. samas: ISO 9001; ISO 14 001; Universaalne standard kohandub ettevõtte vajadustega

  10. HPV infection, anal intra-epithelial neoplasia (AIN and anal cancer: current issues

    Directory of Open Access Journals (Sweden)

    Stanley Margaret A

    2012-09-01

    Full Text Available Abstract Background Human papillomavirus (HPV is well known as the major etiological agent for ano-genital cancer. In contrast to cervical cancer, anal cancer is uncommon, but is increasing steadily in the community over the last few decades. However, it has undergone an exponential rise in the men who have sex with men (MSM and HIV + groups. HIV + MSM in particular, have anal cancer incidences about three times that of the highest worldwide reported cervical cancer incidences. Discussion There has therefore traditionally been a lack of data from studies focused on heterosexual men and non-HIV + women. There is also less evidence reporting on the putative precursor lesion to anal cancer (AIN – anal intraepithelial neoplasia, when compared to cervical cancer and CIN (cervical intraepithelial neoplasia. This review summarises the available biological and epidemiological evidence for HPV in the anal site and the pathogenesis of AIN and anal cancer amongst traditionally non-high risk groups. Summary There is strong evidence to conclude that high-grade AIN is a precursor to anal cancer, and some data on the progression of AIN to invasive cancer.

  11. GarcÍa Lorca luulest ja Ain Kaalepi tõlkest / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1998-01-01

    Arvustus: GarcÍa Lorca, Federico. Mu kätes põleb tuli : valitud luuletused / tlk. ja saateks: Ain Kaalep. 2. tr. Tallinn : Vagabund, 1997. Ilmunud ka kogumikus: Talvet, Jüri. Tõrjumatu äär. Tartu : Ilmamaa, 2005, lk. 442-453

  12. Heparina e K3EDTA como anticoagulantes para tambaqui (Colossoma macropomum Cuvier, 1816) Heparin and K3EDTA as anticoagulants for tambaqui (Colossoma macropomum Cuvier, 1816)

    OpenAIRE

    Santiago Benites de Pádua; Fabiana Pilarski; Róberson Sakabe; José Dias-Neto; Edsandra Campos Chagas; Márcia Mayumi Ishikawa

    2012-01-01

    Este estudo avaliou a eficácia da heparina sódica e do EDTA tripotássico como anticoagulantes e seus efeitos sobre os parâmetros hematológicos de tambaqui (Colossoma macropomum). Foram utilizados dez indivíduos de tambaqui com médias de 384,9 ± 85,71 g de peso e 27,90 ± 2,10 cm de comprimento total para avaliação da heparina 5.000 UI e 100 UI, bem como do K3EDTA 10%. Foram analisados a inibição da coagulação por 10 h, eritrograma e teste de fragilidade osmótica dos eritrócitos. Os resultados ...

  13. Cirurgias odontológicas em usuários de anticoagulantes orais Dental surgery in patients on oral anticoagulation therapy

    OpenAIRE

    Alessandra K. Dantas; Maria Cristina Z. Deboni; José Luiz Piratininga

    2009-01-01

    Em razão do crescimento do número de indivíduos submetidos à terapêutica anticoagulante também nos consultórios odontológicos, realizamos um levantamento retrospectivo de prontuários de pacientes anticoagulados com derivados cumarínicos e uma revisão sobre os protocolos de atendimento, a fim de procurar estabelecer diretrizes para um tratamento cirúrgico-odontológico adequado e seguro. A avaliação do paciente com relação ao seu nível de anticoagulação através do Índice Normatizado Internacion...

  14. Nuevos anticoagulantes orales en la prevención de fenómenos tromboembólicos en la fibrilación auricular no valvular

    OpenAIRE

    José Manuel Sosa Rosado

    2013-01-01

    La fibrilación auricular es la arritmia cardiaca más frecuente en la práctica clínica. El valor de la anticoagulación con antagonistas de la vitamina K -como la warfarina-en la prevención de los fenómenos embólicos está ampliamente demostrada, pero también su difícil manejo por las conocidas interacciones con otros fármacos e incluso los alimentos. En la búsqueda del anticoagulante ideal, en los últimos años han aparecido nuevos agentes antitrombóticos y otros se encuentran en fases avanzadas...

  15. Anticoagulante lúpico en Pediatría. Experiencia en nuestro centro Lupus anticoagulant in Pediatrics. Experience in our center

    Directory of Open Access Journals (Sweden)

    F.J. Álvarez Guisasola

    2013-01-01

    Full Text Available Objetivo.Estudio descriptivo de las formas de presentación, características biológicas y evolución de los pacientes pediátricos diagnosticados de anticoagulante lúpico en nuestro Hospital.Pacientes y métodos. Revisión retrospectiva de todos los pacientes que cumplieron los criterios establecidos por la Sociedad Internacional de Trombosis y Hemostasia para diagnóstico de anticoagulante lúpico.Resultados. Cumplieron los criterios establecidos 16 niños, 9 varones (53,6% y 7 mujeres, con una mediana de edad decimal al diagnóstico de 6,25 años (rango: 1,1-13. Los motivos del estudio de coagulación fueron: preoperatorio (n: 6, 37,5%, estudio por trombosis (n: 4, 25%, infección (n:3, 18,8%, hemorragia (n: 2, 12,5% e ingesta de raticida (n:1, 6,3%. Diez casos (62,5% permanecieron asintomáticos y correspondieron a los casos de preoperatorio, infecciones e ingesta de raticida. Cuatro de los pacientes presentaron trombosis (25%, en dos de ellos se encontraron además trombofilia primaria y patología inmunitaria o tumoral y en otro caso se cumplieron criterios de síndrome antifosfolípido primario, único de los casos en que el anticoagulante lúpico fue persistente. Dos casos (12,5% presentaron hemorragias asociadas a disminución de algún factor de coagulación (déficits transitorios de FII y FVIII. Conclusiones.El anticoagulante lúpico es un hallazgo poco frecuente en Pediatría. Se encuentra con más frecuencia en preoperatorio de procesos ORL y/o infecciones. La gran mayoría son transitorios y sin relevancia clínica. Cuando se asocia trombosis frecuentemente se asocia a trombofilia primaria y patología inmunitaria o tumoral y cuando lo hace a hemorragias, a déficit de factores procoagulantes. Objective. A descriptive study of the presentation forms, biological and evolution characteristics of the pediatric patients diagnosed of lupus anticoagulant in our hospital.Patients and methods. Retrospective review of all the patient who

  16. Vitamina K: metabolismo, fontes e interação com o anticoagulante varfarina Vitamin K: metabolism, sources and interaction with the anticoagulant warfarin

    Directory of Open Access Journals (Sweden)

    Karin Klack

    2006-12-01

    Full Text Available A vitamina K é lipossolúvel, principalmente, na coagulação sanguínea. Se apresenta sob as formas de filoquinona (K1-predominante, dihidrofiloquinona (dK, menaquinona (K2 e menadiona (K3. Os fatores que interferem em sua absorção são: má absorção gastrintestinal, secreção biliar, ingestão insuficiente e uso de anticoagulantes, entre outros. As principais fontes de vitamina K são os vegetais e óleos, sendo esses os responsáveis pelo aumento da absorção da filoquinona. Os alimentos folhosos verde escuro, os preparados à base de óleo, oleaginosas e frutas como o kiwi, abacate, uva, ameixa e figo contêm teores significantes de vitamina K, enquanto que os cereais, grãos, pães e laticínios possuem teores discretos. A ingestão diária de aproximadamente 1µg por quilo de peso é considerada a mais segura, inclusive para a utilização de anticoagulantes orais, em que a concentração estável da vitamina proporciona a eficácia no tratamento. A droga anticoagulante oral geralmente utilizada é a varfarina, administrada como profilática e para tratamento de fenômenos tromboembólicos. Essa intervenção medicamentosa é monitorada pelo tempo de protrombina expresso pela razão normalizada internacional, tendo como objetivo estabelecer a faixa terapêutica entre 2 e 3, minimizando o risco de hemorragias. O efeito anticoagulante pode ser reduzido por fatores como ganho de peso, diarréia, vômito, idade menor que 40 anos e consumo excessivo de vitamina K na dieta alimentar.Vitamin K is a fat-soluble substance, mainly involved in the blood coagulation. It is presented as Phylloquinone (K1-predominant, Dihydrophyloquinone (dK, Menaquinone (K2, and Menadione (K3. The factors that interfere with its absorption are: gastrointestinal malabsorption, biliary secretion, inadequate ingestion and anticoagulant use, among others. The main vitamin K sources are vegetables and organic lipids, that are involved in the increased absorption of

  17. Nuevos anticoagulantes orales

    Directory of Open Access Journals (Sweden)

    Alejandro Berkovits

    2011-10-01

    Full Text Available Thromboembolic disease (TED is the leading cause of morbidity and mortality worldwide. The hallmark of oral long-term anticoagulant therapy has been the use of vitamin K antagonists, whose anticoagulant effect is exerted inhibiting vitamin K epoxide reductase. Warfarin and acenocoumarol are the most commonly used. In the last five years several new drugs for long term anticoagulation have been developed, which can inhibit single clotting factors with the purpose of improving drug therapeutic range and, ideally, minimizing bleeding risks. This review addresses the state of the art on the clinical use of inhibitors of activated factor X and thrombin.

  18. Spekulatsioonid Ain Hanschmidti huvidest Tallink Grupis osutuvad tõeks / Aare Reivart

    Index Scriptorium Estoniae

    Reivart, Aare, 1968-

    2005-01-01

    Kui varem on oletatud, et Ühispanga juht Ain Hanschmidt on advokaat Aare-Heino Raigi kaudu Tallink Grupis kaudselt osalust omava Abante OÜ taga, siis alates 19. augustist on A. Hanschmidt Abante OÜ omanik. Abante on aasta jooksul soetanud AS-i Linandell ja OÜ Villore osaku. Abante seotusest teiste Tallinki grupi omanikfirmadega. Lisad: AS Tallink Grupp;Omanikering; Enn Pant hakaku rääkima; Signe Kalberg. Ka Lipstokil osalus Tallink Grupis

  19. Isolamento, fracionamento e atividade anticoagulante de iota-carragenanas da Solieria filiformis Isolation, fractionation and anticoagulant activity of iota-carrageenans from Solieria filiformis

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2010-11-01

    Full Text Available Este estudo teve como objetivo isolar, fracionar e avaliar o potencial anticoagulante de iota-carragenanas (i-CARs da rodofícea Solieria filiformis, quando obtidas por dois métodos de extração (M I e M II. As i-CARs foram isoladas com papaína bruta em tampão acetato de sódio 0,1M (pH 5,0, contendo cisteína 5mM e EDTA 5mM (M I ou água (80°C (M II e, em seguida, determinada sua composição química de carboidratos totais, sulfato livre (SL e proteínas contaminantes. As i-CARs foram submetidas à cromatografia de troca iônica (DEAE-celulose usando um gradiente de cloreto de sódio, sendo avaliado o tempo de tromboplastina parcial ativada (TTPA e tempo de protrombina das frações obtidas e comparadas à heparina (193UI mg-1. Uma fração anticoagulante também foi submetida ao procedimento de eletroforese em gel de agarose a 0,5%. A diferença no rendimento de i-CARs entre os métodos foi 10,14%. A composição química de SL (29,40% e o fracionamento, por DEAE-celulose, indicaram o M I mais eficiente na obtenção de i-CARs, comparado ao M II. O TTPA também foi somente alterado para as i-CARs do M I. Contudo, a atividade anticoagulante in vitro de uma fração rica (8,52UI mg-1 foi inferior à da heparina.This study aimed to isolate, fractionate and evaluate the anticoagulant potential of iota-carrageenans (i-CARs from Solieria filiformis when two extraction methods (M I and M II were used. i-CARs were isolated with papain in 0.1M sodium acetate (pH 5.0 containing 5mM cystein and 5mM EDTA (M I or water (80°C (M II, and then their chemical composition of total carbohydrates, free sulfate (FS and contaminant proteins were determined. i-CARs were submitted to anion-exchange chromatography (DEAE-cellulose using a sodium chloride gradient,being evaluated the activated partial thromboplastin time (APTT and prothrombin time of obtained fractions and compared to heparin (193IU mg-1. A rich fraction of anticoagulant was also submitted to 0

  20. Cirurgias odontológicas em usuários de anticoagulantes orais Dental surgery in patients on oral anticoagulation therapy

    Directory of Open Access Journals (Sweden)

    Alessandra K. Dantas

    2009-01-01

    Full Text Available Em razão do crescimento do número de indivíduos submetidos à terapêutica anticoagulante também nos consultórios odontológicos, realizamos um levantamento retrospectivo de prontuários de pacientes anticoagulados com derivados cumarínicos e uma revisão sobre os protocolos de atendimento, a fim de procurar estabelecer diretrizes para um tratamento cirúrgico-odontológico adequado e seguro. A avaliação do paciente com relação ao seu nível de anticoagulação através do Índice Normatizado Internacional (INR ou Tempo de Protrombina (TP e a classificação da amplitude do trauma cirúrgico são fatores importantes a serem avaliados antes do procedimento cirúrgico. Nosso levantamento mostrou que, em 47 cirurgias, sem alteração da medicação sistêmica, apenas um caso apresentou hemorragia pós-operatória, controlada por manobras de hemostasia local. Desse modo, observamos que, dentre os vários protocolos propostos na literatura, a manutenção da terapia anticoagulante, com a utilização de hemostáticos locais se necessário, parece o mais adequado à maioria dos casos cirúrgicos ambulatoriais.In the daily medical practice there has been an increase in the use of anticoagulant drugs; as a consequence, dental offices are receiving more individuals under this therapy. Nowadays dental surgeons need a broader knowledge of hemostasis and associated therapies in order to offer the best possible assistance. This article presents a retrospective study based on the clinical records of anticoagulated patients using dicoumarin who underwent dental surgical procedures. Twenty-six patients were submitted to forty-seven minor dental surgical procedures without any change to their doses of anticoagulants. Laboratorial evaluations of PT (pro-thrombin time based on the INR (International Normalized Ratio were performed for all patients. The results showed that only one patient reported postoperative bleeding which was controlled by local

  1. Anticoagulant properties of a crude sulfated polysaccharide from the red marine alga Halymenia floresia (Clemente C. Agardh = Propriedades anticoagulantes de um polissacarídeo sulfatado bruto da alga marinha vermelha Halymenia floresia (Clemente C. Agardh

    Directory of Open Access Journals (Sweden)

    Rodrigo César das Neves Amorim

    2011-07-01

    Full Text Available Alternative sources of anticoagulants have arisen as a result of the increasing demand for safer anticoagulant clinical therapy, and the sulfated polysaccharides of seaweeds have gained attention in biomedicine. In this study, crude sulfated polysaccharide fractions (denominated Hf1, Hf2 and Hf3 were obtained from the red marine algaHalymenia floresia and the anticoagulant properties of a soluble crude polysaccharide fraction (Hf2s were assayed. The three differential extractions yielded 38.6%. The polysaccharides are composed mainly of galactose, with small amounts of xylose and glucose. The anticoagulant properties of Hf2s containing 53.8% sulfate and 3% protein was also compared to those of heparin (193.0 IU mg-1 by assays of activated partial thromboplastin time (APTT and thrombin time (TT using normal human plasma. Hf2s showed a higheranticoagulant activity (68.4 IU mg-1 than those of Hf1s and Hf3s, whose activities were 37.6 and 36.6 IU mg-1, respectively. The compound was less active than heparin, but its anticoagulant mechanism suggested that it is dependent on cofactor heparin II to inhibit thrombin activity, but not on cofactors VIII and IX. Therefore, the polysaccharide from H. floresia interfered on coagulation cascade.O aumento da demanda por anticoagulantes para a terapia clínica tem motivado a busca por fontes alternativas de anticoagulantes mais seguros e os polissacarídeos sulfatados de algas marinhas têm ganhado atenção na biomedicina. Objetivou-se obter frações de polissacarídeossulfatados brutos (denominadas Hf1; Hf2 e Hf3 da alga marinha vermelha Halymenia floresia e para avaliar as propriedades anticoagulantes de uma fração polissacarídica bruta solúvel anticoagulante (Hf2s. As três extrações diferenciais renderam 38,60%. Os polissacarídeos são principalmente compostos de galactose com pequenas quantidades de xilose e glucose. As propriedades anticoagulantes da Hf2s, contendo 53,80% de sulfato e 3% de prote

  2. Hemorragias intracraneales de carácter evitable asociadas a anticoagulantes orales en pacientes con fibrilación auricular Avoidable intracranial hemorrhages associated with oral anticoagulants in patients with atrial fibrillation

    Directory of Open Access Journals (Sweden)

    A. García Luque

    2011-12-01

    Full Text Available Introducción y objetivo: El aumento de la prescripción de anticoagulantes orales ha provocado un aumento de hemorragias intracraneales, la reacción adversa más grave asociada a este grupo farmacológico. El objetivo del estudio es evaluar el carácter evitable de hemorragias intracraneales asociada a anticoagulantes orales que causan ingreso hospitalario en pacientes con fibrilación auricular. Método: Supervisión de las historias clínicas de los pacientes que ingresaron en los Hospitales Universitarios Virgen del Rocío (01/01/03 al 31/03/07 con hemorragia intracraneal y fibrilación auricular; considerando hemorragia intracraneal asociada a anticoagulantes orales aquellas con una relación ≥ posible al aplicar el algoritmo de causalidad del Sistema Español de Farmacovigilancia. Para valorar el carácter evitable de la hemorragia intracraneal se ha estudiado la relación beneficio/riesgo del uso de anticoagulantes orales. Resultados: Al menos 20/57 (35,1% hemorragias intracraneales asociadas a anticoagulantes orales pudieron ser potencialmente evitables, de las cuales en 7/20 (35% el desenlace fue mortal, presentando secuelas 8/13 (61,5% de los supervivientes. El fármaco sospechoso de interaccionar con anticoagulantes orales referenciado con mayor frecuencia fue el omeprazol, 11/57 (19%, a pesar de estar documentada esta interacción como altamente probable en la Bibliografía y en los protocolos del Hospital. Conclusiones: La relación beneficio/riesgo del uso de anticoagulantes orales, el control estricto del Índice Normalizado Internacional, junto con las posibles interacciones medicamentosas deben ser evaluadas de forma individualizada y periódicamente para minimizar el riesgo de hemorragia intracraneal, que en un porcentaje elevado de casos es una reacción adversa potencialmente evitable y mortal.Introduction and objectives: The increase in oral anticoagulants prescription has caused an increase in intracranial hemorrhages

  3. Monsieur Philippe Galli Préfet de l’Ain France

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    Photo 35: Le chef du département Physique P. Bloch, le porte-parole de la Collaboration CMS G. Tonelli,le Sous-Préfet de Gex O. Laurens-Bernard, le chef du département Technologie F. Bordry, le Péfet de l'Ain P. Galli et le Directeur-général R. Heuer. Photo 62: signature du livre d'or avec le Directeur de la recherche et de l'informatique S. Bertolucci.

  4. Awareness of Breast Cancer among Female Students at Ain Shams University, Egypt

    OpenAIRE

    Boulos, Dina N. K.; Ghali, Ramy R.

    2013-01-01

    The present study aimed to determine knowledge of breast cancer risk factors, symptoms and early detection methods and to identify knowledge and practice of breast self-examination among Ain Shams University female students. This is a descriptive cross sectional study. Most study participants had low level of knowledge of breast cancer risk factors. The most widely known risk factors by the students were smoking 66.9%, followed by radiation to the chest 63.7% and genetic factors 63.7%. Most o...

  5. Avaliação do desempenho dos reagentes do tempo de tromboplastina parcial ativada utilizados para detectar o anticoagulante lúpico Assessment of the performance of reagents of activated partial thromboplastin time used to detect the lupus anticoagulant

    Directory of Open Access Journals (Sweden)

    Fernanda Chiuso

    2005-06-01

    Full Text Available INTRODUÇÃO: O anticoagulante lúpico é uma imunoglobulina pertencente à família dos anticorpos antifosfolípides. A sua ação in vitro é interferir nos testes de coagulação dependentes de fosfolípides. O tempo de tromboplastina parcial ativada (TTPA é um teste utilizado como screening na pesquisa do anticoagulante lúpico. Os reagentes utilizados neste teste apresentam grandes variações quanto à sensibilidade. OBJETIVO: Avaliar o desempenho dos reagentes do TTPA e detectar a presença do anticoagulante lúpico através de diferentes testes da coagulação. MATERIAL E MÉTODO: A pesquisa do anticoagulante lúpico foi realizada em 50 amostras plasmáticas de pacientes do sexo feminino através dos testes do TTPA, do tempo de coagulação do caulim (TCC, do tempo de tromboplastina parcial ativada diluída (TTPAd e do tempo do veneno da víbora de Russel diluído (TVVRd. Três cefalinas comerciais foram avaliadas pelos testes do TTPA e do TTPAd. Na comparação entre os reagentes estudados foi aplicado o cálculo do intervalo de confiança (95%. RESULTADOS: Os três reagentes avaliados apresentaram boa concordância e os métodos utilizados responderam bem à pesquisa do anticoagulante lúpico. DISCUSSÃO E CONCLUSÃO: As três cefalinas comerciais avaliadas podem ser utilizadas na rotina laboratorial para a pesquisa do anticoagulante lúpico.INTRODUCTION: The lupus anticoagulant is an immunoglobin which belongs to the antiphospholid antibodies family. Its in vitro function is to interfere with coagulation tests that are dependent on phospholipids. The activated partial thromboplastin time (APTT is a test used as screening on lupus anticoagulant research. Reagents used in this test demonstrate wide sensitivity ranges. OBJECTIVE: To assess the performance of APTT reagents and detect the presence of lupus anticoagulant through various coagulation tests. MATERIAL AND METHOD: The lupus anticoagulant research was performed in plasma from 50

  6. The F-actin bundler α-actinin Ain1 is tailored for ring assembly and constriction during cytokinesis in fission yeast.

    Science.gov (United States)

    Li, Yujie; Christensen, Jenna R; Homa, Kaitlin E; Hocky, Glen M; Fok, Alice; Sees, Jennifer A; Voth, Gregory A; Kovar, David R

    2016-06-01

    The actomyosin contractile ring is a network of cross-linked actin filaments that facilitates cytokinesis in dividing cells. Contractile ring formation has been well characterized in Schizosaccharomyces pombe, in which the cross-linking protein α-actinin SpAin1 bundles the actin filament network. However, the specific biochemical properties of SpAin1 and whether they are tailored for cytokinesis are not known. Therefore we purified SpAin1 and quantified its ability to dynamically bind and bundle actin filaments in vitro using a combination of bulk sedimentation assays and direct visualization by two-color total internal reflection fluorescence microscopy. We found that, while SpAin1 bundles actin filaments of mixed polarity like other α-actinins, SpAin1 has lower bundling activity and is more dynamic than human α-actinin HsACTN4. To determine whether dynamic bundling is important for cytokinesis in fission yeast, we created the less dynamic bundling mutant SpAin1(R216E). We found that dynamic bundling is critical for cytokinesis, as cells expressing SpAin1(R216E) display disorganized ring material and delays in both ring formation and constriction. Furthermore, computer simulations of initial actin filament elongation and alignment revealed that an intermediate level of cross-linking best facilitates filament alignment. Together our results demonstrate that dynamic bundling by SpAin1 is important for proper contractile ring formation and constriction. PMID:27075176

  7. P16 and Ki67 Immunostains Decrease Intra- and Interobserver Variability in the Diagnosis and Grading of Anal Intraepithelial Neoplasia (AIN

    Directory of Open Access Journals (Sweden)

    Shikha Bose

    2008-01-01

    Full Text Available Background: Significant variation is reported in the diagnosis of HPV-associated AIN. We previously observed that bandlike positivity for p16 in >90% of contiguous cells coupled with Ki67 positivity in >50% of lesional cells is strongly associated with high grade AIN. This study was undertaken to determine if addition of p16 and Ki67 immunostaining would reduce inter- and intraobserver variability in diagnosis and grading of AIN.Design: H&E stained slides of 60 anal biopsies were reviewed by three pathologists and consensus diagnoses were achieved: 25 negative, 12 low (condyloma and/or AIN I and 23 high (9 AIN II and 14 AIN III grade lesions. The H&E stained slides were diagnosed independently by three additional (“participant” pathologists. Several weeks later they re-examined these slides in conjunction with corresponding p16 and Ki67 immunostains.Results: Addition of p16 and Ki67 immunostains reduced intra- and interobserver variability, improved concurrence with consensus diagnoses and reduced two-step differences in diagnosis. Negative and high grade AIN diagnoses showed the most improvement in concurrence levels.Conclusion: Addition of p16 and Ki67 immunostains is helpful in the diagnosis and grading of AIN.

  8. Evaluación del tripolifosfato de sodio como anticoagulante en determinaciones hematológicas en seres humanos Assessment of anticoagulant sodium tripolyphosphate used in hematologic determinations in human being

    OpenAIRE

    Lisbeth Rangel Matos; Maribel Quintero de Troconis; Anangelina Archile Contreras; Betty Benítez Payares; Maczy González Rincón; Ana Ruiz Medina; Enrique Márquez Salas; Jorge Herrera

    2009-01-01

    El propósito del presente estudio fue evaluar la utilidad del tripolifosfato de sodio (TPF) como anticoagulante en diferentes determinaciones hematológicas en seres humanos. Muestras de sangre venosa procedentes de adultos sanos de ambos sexos fueron anticoaguladas con TPF, sales dipotásicas del ácido etilendiaminotetraacético (EDTA) y citrato de sodio. Las muestras anticoaguladas con EDTA y citrato de sodio fueron utilizadas como controles. Al comparar los valores obtenidos en todas las prue...

  9. Conhecimento sobre anticoagulantes orais e seu manejo por médicos de pronto atendimento Emergency-room doctors' knowledge about oral anticoagulants and its management

    Directory of Open Access Journals (Sweden)

    Larissa Periotto Borlina

    2010-06-01

    Full Text Available Contexto: Desde sua descoberta, os anticoagulantes orais (AO têm sido cada vez mais estudados e aplicados em diferentes doenças. No entanto, eles apresentam reações medicamentosas com fármacos que trazem riscos ao paciente. Objetivo: Identificar o nível de conhecimento dos médicos plantonistas de pronto atendimento sobre os AO e suas interações, medicamentosas ou não, e verificar se o médico frentista está preparado para integrar o conteúdo teórico com a rotina de urgências. Método: Aplicou-se um questionário a 100 médicos atuantes em pronto atendimentos de dois hospitais públicos e três privados em Curitiba. Visou-se saber se o médico frentista questiona ao paciente sobre o uso de AO. Também, avaliou-se o conhecimento do profissional e seu interesse em saber mais sobre: AO (quais deles conhecia; exames para controle; sinergismo com AO; e manejo das complicações. Resultados: Dos 100 entrevistados, 60% declararam perguntar ao paciente sobre o uso de AO, 81% tinham conhecimento insuficiente a respeito do sinergismo de algumas substâncias apresentadas e os AO, 15% desconheciam qual exame é utilizado para acompanhamento dos pacientes anticoagulados, 50,7% não sabiam os nomes comercias dos AO, 4% desconheciam seu antídoto, e 92% manifestaram interesse em melhorar seus conhecimentos sobre os AO. Conclusão: É BAIXo o número de médicos que atende em pronto atendimentos que conhece sobre os AO e que sabe manejar pacientes anticoagulados. É alta a porcentagem de médicos que não perguntam aos pacientes sobre o uso de AO e que desconhecem princípios do sinergismo medicamentoso, sendo que a maioria se interessou em melhorar seus conhecimentos sobre os anticoagulantes.Background: Since its discovery, oral anticoagulants (OA have been increasingly studied and used to treat different diseases. However, OA may cause adverse drug interactions that bring risks for patients. Objective: To identify the emergency room doctors

  10. Analysis of Urban Expansion of the Resort City of Al Ain Using Remote Sensing and GIS

    Science.gov (United States)

    Issa, S.; Al Shuwaihi, A.

    2009-12-01

    The urban growth of AL Ain city has been investigated using remote sensing data for three different dates, 1972, 1990 and 2000. We used three Landsat images together with socio-economic data in a post-classification analysis to map the spatial dynamics of land use/cover changes and identify the urbanization process in Al Ain resort city, United Arab Emirates. Land use/cover statistics, extracted from Landsat Multi-spectral Scanner (MSS). Thematic Mapper (TM) and Enhanced Thematic Mapper plus (ETM +) images for 1972. 1990 and 2000 respectively, revealed that the built-up area has expanded by about 170.53km2. The city was found to have a tendency for major expansion in four different directions: along the Abu Dhabi highway, along Dubai highway, Myziad direction and Hafeet recreational area. Expansion in any direction was found to be governed by the availability of road network, suitability for construction, utilities, economic activities, geographical constraints, and legal factors (boundary with Sultanate of Oman). The road network in particular has influenced the spatial patterns and structure of urban development, so that the expansion of the built-up areas has assumed an accretive as well as linear growth along the major roads. The research concludes that the development is based on conservation of agricultural areas (oases) and reclamation of the desert for farming and agricultural activities. The integration of remote sensing and GIS was found to be effective in monitoring LULC changes and providing valuable information necessary for planning and research.

  11. Determinants of Diabetes and Hypertension Control in Ambulatory Healthcare in Al Ain, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Latifa M. Baynouna

    2014-05-01

    Full Text Available bjectives: This study aims to study determinants for the control of diabetes and hypertension in Al Ain Ambulatory Healthcare patients. Method: This is a cross sectional observational study of patients attending ambulatory healthcare centers in Al Ain, United Arab Emirates in 2009. From a yearly audit evaluating the care of patients with diabetes and hypertension, the determinants for improved diabetes and hypertension outcomes were identified from a total of 512 patients and its association with glycemic and blood pressure control were studied. Results: From all variables studied, only the clinic where the patient was treated helped predict both improved blood sugar and blood pressure control. For patients with diabetes, poor control the year before (p<0.001, the number of chronic disease clinic visits (p=0.042 and triglyceride levels (p=0.007 predicted worse control of diabetes. A predictor of poor control of blood pressure (p<0.001 for patients with hypertension was poor control of blood pressure in the year before. Conclusion: In this population, the healthcare system and the team played major roles as determinants in the control of patient’s diabetes and blood pressure more than any of the other factors examined.

  12. Novos anticoagulantes para a profilaxia do tromboembolismo venoso em cirurgias ortopédicas de grande porte New anticoagulants for the prophylaxis of venous thromboembolism

    Directory of Open Access Journals (Sweden)

    Ricardo de Alvarenga Yoshida

    2011-06-01

    Full Text Available Após cerca de 50 anos de experiência com a heparina e antagonistas da vitamina K (AVK, pesquisas e estudos com novos anticoagulantes vêm evoluindo de forma crescente nos últimos anos. Embora consagrados pelo uso, os anticoagulantes tradicionais têm limitações importantes em termos de controle laboratorial, complicações, efeitos colaterais, interações com medicamentos e dieta. A heparina não fracionada (HNF tem interação com proteínas plasmáticas e parede vascular, pode desencadear trombocitopenia induzida pela heparina (TIH, só pode ser administrada por via parenteral, exige controle laboratorial pelo teste da tromboplastina parcial ativada (TTPa, pode provocar osteoporose e alopecia quando usada por períodos prolongados e sua produção tem origem biológica. A AVK tem a vantagem de poder ser ministrada por via oral, mas o controle (feito pela razão normatizada internacional pode ser difícil em alguns casos, já que tem início de ação demorado, janela terapêutica estreita, interação com dieta e grande número de medicamentos, pode provocar necrose de pele em portadores de deficiência de antitrombina e de proteínas C e S, e pode induzir alterações fetais quando usada na gravidez. Na década de 1980, surgiram as heparinas de baixo peso molecular, que foram uma evolução da heparina não fracionada, pois apresentaram maior biodisponibilidade, dosagem por peso corporal, sem necessidade de controle laboratorial, administração por via subcutânea, menor risco de trombocitopenia induzida pela heparina, e eficácia e segurança similares à heparina não fracionada. Na última década surgiram, então, uma série de novos anticoagulantes no mercado, os quais têm apresentado resultados promissores em várias situações de profilaxia e tratamento do tromboembolismo venoso. Nesta revisão, são apresentados as novas heparinas de baixo peso molecular, as heparinas de ultrabaixo peso molecular, os pentassacarídeos, os

  13. Ain Naga

    OpenAIRE

    Grebenart, D.

    2013-01-01

    Située en Algérie entre Djelfa et Messad, Aïn Naga est une source entourée de jardins à proximité desquels on rencontre un important gisement pré- historique et plusieurs gravures rupestres. Orant et bélier à « sphéroïde » (photo G. Camps) Le gisement présente, en stratigraphie, deux niveaux : Capsien et Néolithique. Caractérisé par un outillage microlithique, le Capsien d’Aïn Naga est un des plus anciens actuellement connus et se situe, selon les datations par le Carbone 14, dans les VIIIe ...

  14. Tallinna Sadama konverents "1965-2015: Soome sild & valge laev kui tunnel läbi raudse eesriide" / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2015-01-01

    1965. aastal Tallinna ja Helsingi vahelise reisilaeva liikluse taasavamisele pühendatud ja kahe linna koostöö- ja majandussuhteid käsitlenud konverentsist, kus ettekannetega esinesid Tiit Kask, Pekka Linnainen, Kulle Raig, Kimmo Mäki, Joakim Helenius, Ain Hinsberg Toomas Danneberg

  15. Teaduskeskus Ahhaa = Ahhaa Science Centre / Vilen Künnapu, Ain Padrik, Malle Jürgenson, Tea Tammelaan ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    2012-01-01

    Tartus Sadama 1 auva Ahhaa teaduskeskuse arhitektuurist ja sisearhitektuurist. Arhitektid: Ain Padrik ja Vilen Künnapu, kaasa töötasid Kristjan Tõlk, Kristiin Keernik, Siim Tuksam, Hannes Tilk (Künnapu & Padrik). Sisearhitektid: Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Infograafika: Alar Pikkorainen

  16. Prevalence and correlates of childhood fears in Al-Ain, United Arab Emirates.

    Science.gov (United States)

    Mohammed, N A; Eapen, V; Bener, A

    2001-05-01

    The prevalence of fear was explored in 340 adolescents in Al-Ain, United Arab Emirates. More than 50% reported feeling extremely frightened of 6 out of 60 fear items surveyed. These items were: someone dying in the family (66.5%), parents getting divorced (65.3%), the devil (63.8%), breaking a religious law (61.5%), being kidnapped (53.2%) and being adopted (49.9%). The level of fear showed a significant positive correlation with female gender, parental death/divorce, living with a single parent/relatives, living in low income families and an adverse home environment. Nearly half of the children reported that the fear caused considerable distress and interfered with daily activities. PMID:12690762

  17. comparison entre la foret domanial d'ELHARKKTA(AIN EL BAIDA) et celle de HAFIR (TLEMCEN)

    OpenAIRE

    LALAOUNA, HASSINA; KHELIAFIA, CHAABANE

    2016-01-01

    Les Monts de Tlemcen comme celui d’Ain Beida offrent un modèle d'étude de l'évolution de la flore et de la végétation très intéressant. La variété des paysages, mais aussi leurs différences restent très remarquables ; leurs répartitionssont conditionnées par un nombre important de facteurs écologiques. Les longues périodes de sécheresse qu'ont connue les deuxrégions ont beaucoup influencé le faciès de la végétation naturelle provoquant chez celle-ci le phénomène de stress hy...

  18. Heparina e K3EDTA como anticoagulantes para tambaqui (Colossoma macropomum Cuvier, 1816 Heparin and K3EDTA as anticoagulants for tambaqui (Colossoma macropomum Cuvier, 1816

    Directory of Open Access Journals (Sweden)

    Santiago Benites de Pádua

    2012-06-01

    Full Text Available Este estudo avaliou a eficácia da heparina sódica e do EDTA tripotássico como anticoagulantes e seus efeitos sobre os parâmetros hematológicos de tambaqui (Colossoma macropomum. Foram utilizados dez indivíduos de tambaqui com médias de 384,9 ± 85,71 g de peso e 27,90 ± 2,10 cm de comprimento total para avaliação da heparina 5.000 UI e 100 UI, bem como do K3EDTA 10%. Foram analisados a inibição da coagulação por 10 h, eritrograma e teste de fragilidade osmótica dos eritrócitos. Os resultados foram submetidos à análise de variância e as médias comparadas pelo teste de Tukey (P 0,05 na contagem de eritrócitos, hematócrito, taxa de hemoglobina e CHCM, no entanto, houve aumento do VCM (P The efficacy of sodium heparin and tripotassium EDTA as anticoagulant and their effect on the hematological parameters of tambaqui (Colossoma macropomum were evaluated in this study. Ten fish weighing 384.9 ± 85.71 g and measuring 27.90 ± 2.10 cm were used for heparin 5.000 IU, heparin 100 IU and K3EDTA 10% evaluation. Clotting inhibition after 10 h, erythrogram and osmotic fragility of erythrocytes were observed. The results were submitted to variance analysis and means compared by Tukey test (P 0.05 in erythrocyte count, hematocrit, hemoglobin and MCHC. On the other hand, an increase in MCV (P < 0.05 in samples kept with K3EDTA10% was observed. This anticoagulant provoked a significant increase (P < 0.01 in the osmotic fragility of erythrocytes when compared to pure heparin, diluted heparin and the control group. Heparin as an anticoagulant is more appropriate for tambaqui since it was effective in preventing coagulation for more than 10 h, without causing hemolysis, changes on hematological parameters or osmotic fragility of erythrocytes.

  19. Concentração de anticoagulante, tempo e temperatura de armazenagem sobre os parâmetros hematológicos no hemograma automatizado Anticoagulant concentration, time and storage temperature on hematological parameters in automated blood count

    OpenAIRE

    Aécio Carlos de Oliveira; José Dantas Ribeiro Filho; José Domingos Guimarães; André Ricardo e Silva; Waleska de Melo Ferreira Dantas; Laila de Paula Bonfá; Sheila Kreutzfeld de Farias

    2010-01-01

    O estudo teve como objetivo identificar os efeitos do tempo de estocagem, da temperatura de armazenamento e da quantidade de anticoagulante sobre parâmetros hematológicos de cães. Foram utilizadas amostras do sangue de dez cães de raças variadas, clinicamente hígidos. As alíquotas foram colhidas com 1,8mg; 3,6mg; 7,2mg e 14,4mg de ácido etilenodiaminotetracético (EDTA) por mL de sangue, distribuídas em dois grupos: de 2°C a 8°C e temperatura ambiente. Após a coleta, foram avaliadas em...

  20. Sorption behavior of cesium on Ain Oussera soil under different physicochemical conditions

    International Nuclear Information System (INIS)

    In the present study, the sorption behavior of cesium was investigated in Ain Oussera soil around the Es-Salam reactor facility. This study was conducted using batch method under different physicochemical conditions including contact time, ionic strength, pH, solid/liquid ratio and temperature. The results showed that sorption followed pseudo-second-order kinetics with a good regression coefficients (R2 = 0.999). The activation energies were 11.26 and 15.21 kJ mol-1 which correspond to ion-exchange-type sorption mechanism. The adsorption was favored at low temperature and it was exothermic (ΔH0 -1) and spontaneous (ΔG0 -1 at 23 deg. C and -13.2 kJ mol-1 at 60 deg. C). The presence of competing cations such as K+ and Ca2+ ions in groundwater can significantly reduce the Cs adsorption onto soil. Desorption reaction was also investigated using three reagents with different ionic strengths (deionized water, groundwater and 0.1 M KCl solution). The results showed that Cs ions were preferentially distributed onto high affinity sorption sites.

  1. Pediatric and youth traffic-collision injuries in Al Ain, United Arab Emirates: a prospective study.

    Directory of Open Access Journals (Sweden)

    Michal Grivna

    Full Text Available AIM: To study the mechanism of road traffic collisions (RTC, use of safety devices, and outcome of hospitalized pediatric and youth RTC injured patients so as to give recommendations regarding prevention of pediatric RTC injuries. METHODS: All RTC injured children and youth (0-19-year-olds who were admitted to Al Ain City's two major trauma centers or who died after arrival to these centers were prospectively studied from April 2006 to October 2007. Demography of patients, road-user and vehicle types, crash mechanism, usage of safety devices, injured body regions, injury severity, Revised Trauma Score, Glasgow Coma Scale, intensive care unit admissions, hospital stay and mortality were analyzed. RESULTS: 245 patients were studied, 69% were vehicle occupants, 15% pedestrians, 9% motorcyclists and 5% bicyclists. 79% were males and 67% UAE citizens. The most common mechanism of RTC was rollover of vehicle (37% followed by front impact collision (32%. 32 (13% of vehicle occupants were ejected from car. 63% of ejected occupants and 70% of motorcyclists sustained head injuries. Only 2% (3/170 vehicle passengers used seatbelts and 13% (3/23 motorcyclists a helmet. CONCLUSIONS: Male drivers and UAE nationals were at high risk of RTC as drivers and as motorcyclists. Ejection rate was high because safety restraint use was extremely low in our community. More education and law enforcement focusing especially on car/booster seat use is needed.

  2. Sorption behavior of cesium on Ain Oussera soil under different physicochemical conditions.

    Science.gov (United States)

    Bouzidi, A; Souahi, F; Hanini, S

    2010-12-15

    In the present study, the sorption behavior of cesium was investigated in Ain Oussera soil around the Es-Salam reactor facility. This study was conducted using batch method under different physicochemical conditions including contact time, ionic strength, pH, solid/liquid ratio and temperature. The results showed that sorption followed pseudo-second-order kinetics with a good regression coefficients (R(2)=0.999). The activation energies were 11.26 and 15.21 kJ mol(-1) which correspond to ion-exchange-type sorption mechanism. The adsorption was favored at low temperature and it was exothermic (ΔH(0)<0, with average value of -1.97 kJ mol(-1)) and spontaneous (ΔG(0)<0, with average value of -11.97 kJ mol(-1) at 23°C and -13.2 kJ mol(-1) at 60°C). The presence of competing cations such as K(+) and Ca(2+) ions in groundwater can significantly reduce the Cs adsorption onto soil. Desorption reaction was also investigated using three reagents with different ionic strengths (deionized water, groundwater and 0.1M KCl solution). The results showed that Cs ions were preferentially distributed onto high affinity sorption sites. PMID:20869168

  3. Sorption behavior of cesium on Ain Oussera soil under different physicochemical conditions

    Energy Technology Data Exchange (ETDEWEB)

    Bouzidi, A., E-mail: bouzidiaek@yahoo.fr [Centre de Recherche Nucleaire de Birine, 17200 Ain Oussera (Algeria); Souahi, F. [Ecole Nationale Polytechnique, El Harrach, Algiers (Algeria); Hanini, S. [Universite Yahia Fares, 26000 Media (Algeria)

    2010-12-15

    In the present study, the sorption behavior of cesium was investigated in Ain Oussera soil around the Es-Salam reactor facility. This study was conducted using batch method under different physicochemical conditions including contact time, ionic strength, pH, solid/liquid ratio and temperature. The results showed that sorption followed pseudo-second-order kinetics with a good regression coefficients (R{sup 2} = 0.999). The activation energies were 11.26 and 15.21 kJ mol{sup -1} which correspond to ion-exchange-type sorption mechanism. The adsorption was favored at low temperature and it was exothermic ({Delta}H{sup 0} < 0, with average value of -1.97 kJ mol{sup -1}) and spontaneous ({Delta}G{sup 0} < 0, with average value of -11.97 kJ mol{sup -1} at 23 deg. C and -13.2 kJ mol{sup -1} at 60 deg. C). The presence of competing cations such as K{sup +} and Ca{sup 2+} ions in groundwater can significantly reduce the Cs adsorption onto soil. Desorption reaction was also investigated using three reagents with different ionic strengths (deionized water, groundwater and 0.1 M KCl solution). The results showed that Cs ions were preferentially distributed onto high affinity sorption sites.

  4. Purificação, caracterização físico-química e atividade anticoagulante de glicosaminoglicanos isolados da pele de tilápia do Nilo (Oreochromis niloticus - doi: 10.4025/actascitechnol.v33i3.9400

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2011-07-01

    Full Text Available Os glicosaminoglicanos (GAGs constituem a matriz extracelular de tecidos animais e os resíduos do processamento de peixes comercialmente cultivados podem oferecer novos agentes anticoagulantes em substituição à heparina (HEP nas ciências médicas. Objetivou-se purificar, caracterizar físico-quimicamente e avaliar a atividade anticoagulante dos GAGs isolados da pele da tilápia do Nilo, Oreochromis niloticus. Os GAGs foram extraídos com papaína em tampão acetato de sódio 100 mM (pH 5,0 contendo cisteína e EDTA (5 mM, seguido por cromatografia de troca iônica em coluna de DEAE-celulose, utilizando um gradiente de NaCl. As frações obtidas foram liofilizadas e submetidas à eletroforese em gel de agarose a 0,5%. A atividade anticoagulante foi avaliada por meio do tempo de tromboplastina parcial ativada (TTPA, usando-se plasma humano normal e HEP padrão (193 UI mg-1. O perfil cromatográfico mostrou a separação de duas diferentes frações de GAGs (F I e F II, eluídas com 0,50 e 0,75 M de NaCl, respectivamente, revelando, por eletroforese, frações distintas em densidade de cargas, porém ambas mostrando GAGs com mobilidades semelhantes ao dermatam sulfato (DS padrão, sugerindo-se a identificação preliminar desse GAG. Os GAGs modificaram o TTPA, cujas atividades perfizeram, respectivamente, 4,72 (F I e 23,80 (F II UI mg-1, e expressaram-se dose-dependente. Portanto, o DS anticoagulante da pele de O. niloticus sugere uma fonte interessante para estudos posteriores de atividade antitrombótica.

  5. BACTERIOLOGICAL ANALYSIS AND PUBLIC PERCEPTION ABOUT DRINKING WATER OF BOREHOLES IN ARIB (AIN DEFLA, ALGERIA

    Directory of Open Access Journals (Sweden)

    F. C. Hamaidi

    2016-05-01

    Full Text Available Water from boreholes in Arib (Ain Defla, south-west of Algeria was investigated to ascertain its quality status and suitability for drinking and domestic uses. Fifty six water samples were collected from four boreholes. The analyses of the Coliform counts obtained from various boreholes samples ranged between 0 and 200 CFU/ 100 ml with regard to total Coliforms and between 0 and 8 CFU/ 100 ml with regard to fecal Coliforms. Three of the boreholes samples showed contamination by Streptococcus sp. Pathogens like Salmonella were not identified but some low levels of sulfite-reducing bacteria was found. The interviews were done to assess perceptions on water taste problems, odour, colour, and turbidity and health problems. The respondents were taken from people in the community using random sampling technique. Sixty people were sampled at each area surrounding the boreholes. It was found out that 43.3% of the respondents rated their drinking water safe for consumption as well as absence of illness after drinking as indicators for judging the quality of the water. The others respondents (56.7% reported having at least some concerns with safety of their water.  More  than 20% of the households reported at least one household member having suffered some water related illness in the past two years. Respondents were asked to judge the quality of the water, based on four sensory characteristics of drinking water. Many respondents rated the smell (33.3%, taste (20%, colour (23.3% and turbidity (23.3%. These results showed that all the samples did not satisfy the WHO requirements for bacteriological characteristics in human consumption.

  6. Awareness of breast cancer among female students at Ain Shams University, Egypt.

    Science.gov (United States)

    Boulos, Dina Nabih Kamel; Ghali, Ramy R

    2014-01-01

    The present study aimed to determine knowledge of breast cancer risk factors, symptoms and early detection methods and to identify knowledge and practice of breast self-examination among Ain Shams University female students. This is a descriptive cross sectional study.Most study participants had low level of knowledge of breast cancer risk factors. The most widely known risk factors by the students were smoking 66.9%, followed by radiation to the chest 63.7% and genetic factors 63.7%. Most of the students (81.6%) identified breast lump as a symptom for breast cancer. However, non lump symptoms were less known and less than half were aware of other warning signs. Mass media such as TV and/or radio were identified as the main source of information on breast cancer by 89.1% of students followed by relatives 39.2%. Only 8.8% of students identified correctly the appropriate time to perform breast self examination and 1.3% reported performing it regularly every month. The most common reasons for not practicing BSE were" did not know how to perform it" (47.7%) and lack of interest (35%). The findings of this study showed that there is low level of knowledge on breast cancer risk factors, early warning signs and BSE among female university students and that only few students practice BSE monthly. Health care workers should develop effective breast health programs targeting youth to help females to gain healthy habits starting very early during their formative years. PMID:24373275

  7. Implementation of TiAIN and CrN coatings and ion implantation in the modern plastics moulding industry

    International Nuclear Information System (INIS)

    Two methods of surface improvement widely used in the modern plastics industry are compared, with a view to improving productivity and product quality. Ion implantation of plastics and physical vapour deposition coatings both offer surface engineering advantages. Each method is described and evaluated with reference to plastics moulding. TiAIN coatings are used to protect hard bulk materials, subjected to evenly distributed loads. The more ductile CrN coatings are used for softer materials which give less support to the coatings. (UK)

  8. Inclusión de AINEs en distintas matrices inorgánicas. Estudios de solubilidad y liberación

    OpenAIRE

    Fernández Díez, Alicia

    2008-01-01

    Se han incorporado diversos AINEs (acido mefenámico y meclofenámico, naproxeno y fenbufen) en distintas matrices inorgánicas: hidroxidos dobles laminares (LDHs de MgAl y de MgAlFe), sílice mesoporosa ordenada (MCM-41) y silicato cálcico para evaluar su posible aplicación como nuevas formulaciones farmacéuticas de liberación modificada. La síntesis de los distintos sistemas matriz-AINEs preparados se ha realizado utilizando distintas condiciones de temperatura, composición del medio de disoluc...

  9. AINEs como tratamiento coadyuvante de la enfermedad periodontal NSAIDs in the treatment of periodontal disease

    Directory of Open Access Journals (Sweden)

    T Beca

    2007-08-01

    Full Text Available Se presenta una revisión bibliográfica acerca de la aplicación de antiinflamatorios de forma coadyuvante en el tratamiento periodontal. Tras una breve introducción, se establecen las bases inmunológicas de la inflamación y destrucción periodontal, centrándonos en el metabolismo del ácido araquidónico y los cuatro mediadores más implicados actualmente en la destrucción periodontal: prostaglandina E2 (PGE2, prostaglandina F2a (PGF2a, leucotrieno B4 (LTB4 y factor activador de plaquetas (PAF, y estableciendo su mecanismo de acción, su relación con la destrucción periodontal a través de las metaloproteinasas (MMPs y su relación con algunas interleuquinas de la cascada inflamatoria también relacionadas con la destrucción tisular. Después se expone una relación de los fármacos más empleados en la literatura para la inhibición de todos estos mediadores (Antiinflamatorios no esteroideos o AINEs, ácidos grasos omega3, tetraciclinas y bifosfonatos, explicando su mecanismo de acción y los estudios que los han investigado y posteriormente se ha llevado a cabo una recopilación de los escasos estudios que realizan mediciones clínicas para finalizar estableciendo una serie de conclusiones.SUMMARY A review about the application of antiinflammatories as an aid for the periodontal treatment is presented. After a brief introduction, we explain the immunological bases of periodontal inflamation and tissue destruction, focusing on arachidonic acid metabolism and the four most important inflammatory mediators now in periodontal tissue resorption: prostaglandin E2 (PGE2, prostaglandin F2a(PGF2a, leucotriene B4 (LTB4 and platelet activation factor (PAF, and explaining their actions and role in inflammation through matrix metalloproteinase (MMPs and their relation with some other mediators in the inflammatory chain also related with tissue resorption. After, we expound some of the most used drugs for the inhibition of all of these mediators

  10. Estudio biofarmacéutico de geles antiinflamatorios no esteroideos (AINES

    Directory of Open Access Journals (Sweden)

    Margarita Restrepo

    2000-02-01

    Full Text Available

    Los antiinflamatorios no esteroideos (AINES son un grupo heterogéneo de compuestos con actividad analgésica, antipirética y antiinflamatoria que comparten efectos secundarios indeseables, tales como: ulceración gástrica e intestinal, anemia, bloqueo de la agregación plaquetaria, inhibición de la motilidad uterina e hipersensibilidad. Los AINES se utilizan por vía tópica con el fin de aliviar lesiones en tejidos blandos a los cuales puede llegarse directamente a través de la piel, evitando así los efectos colaterales indeseables.

    Actualmente para la gran mayoría de los medicamentos se exige valorar la Biodisponibilidad como criterio de calidad. Biodisponibilidad se define como la cantidad de fármaco que llega a sangre o plasma después de la administración del medicamento que lo contiene y la velocidad a la cual este proceso ocurre; esta determinación de Biodisponibilidad no resulta útil en el caso de medicamentos que se administran a través de la piel y no alcanzan circulación sistémica; la biodisponibilidad relativa o Bioequivalencia es la comparación de las biodisponibilidades de dos medicamentos para determinar si son similares en su comportamiento farmacocinético dentro del organismo.

    El presente trabajo pretende estandarizar y validar un método que permita determinar concentraciones de fármaco en tejidos, en este tipo de medicamentos administrados por vía tópica, que no alcanzan circulación sistémica y por lo tanto no pueden ser cuantificados en sangre o plasma; además pretendemos que esta metodología pueda ser propuesta como una técnica para determinar biodisponibilidad y/o bioequivalencia para este tipo de productos. Para lograr estos objetivos, inicialmente, se induce la inflamación a un grupo

  11. Mis mõtteid ja tundeid äratab teis sõnapaar "õpetaja palk"? / Vello Saliste, Elve Voltein, Gunnar Polma, Ain Saaret...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    Küsimusele vastavad Kosejõe Kooli direktor Vello Saliste, Tartu Ülikooli haridusteaduskonna õppejõud Elve Voltein, Tallinna Reaalkooli direktor Gunnar Polma, Tallinna Polütehnikumi arendusdirektor Ain Saaret ja Viimsi Keskkooli tugikeskuse abiõpetaja Ivi Talimäe

  12. Eripedagoogid ootavad poliitilisi otsuseid / Plado, Kaja; Karlep, Karl; Ostrat, Ain; Maila, Meelika; Binsol, Hene; Kontor, Ana; küsitlenud Martin Krõlov

    Index Scriptorium Estoniae

    2007-01-01

    Eripedagoogide vestlusringis osalevad: Tartu Ülikooli eripedagoogika osakonna juhataja Kaja Plado, emeriitdotsent pedagoogikadoktor Karl Karlep, Tartu Kroonuaia Kooli direktor Ain Ostrat ja õppealajuhataja Meelike Maila, Tartu Hiie Kooli õppealajuhataja Hene Binsol ning Tartu Nõustamis- ja õpiabi keskuse juhataja Ana Kontor

  13. Haematology and biochemistry values of captive sand cats (Felis margarita) in Al Ain Wildlife Park and Resort, United Arab Emirates

    Institute of Scientific and Technical Information of China (English)

    Stephen Chege; Arshad Toosy; Judith Howlett; Ahmed Saker; John Kagira

    2013-01-01

    Objective: To investigate the haematology and biochemistry values of apparently healthy captive sand cats kept in Al Ain Wildlife Park and Resort, United Arab Emirates, with a view to establishing baseline values.Methods:Blood was collected from the femoral vein using aseptic techniques, kept in a cool box and sent to laboratory for analysis. The blood was analysed for haematological and biochemical values using veterinary hematology and chemistry analysers (ABX ABC Vet, Horiba ABX SAS Montpellier, France). Results: Haematological values were within the normal ranges recorded in domestic cats and there was no statistical difference between values found in males and females. Aspartate aminotransferase values were higher (P0.05) between males and females values.Conclusions:Our results present reference ranges for haematology and biochemistry parameters in captive sand cats. These values will be important for diagnosis of various diseases and monitoring of treatments.

  14. Haematology and biochemistry values of captive sand cats (Felis margarita in Al Ain Wildlife Park and Resort, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Stephen Chege

    2013-09-01

    Full Text Available Objective: To investigate the haematology and biochemistry values of apparently healthy captive sand cats kept in Al Ain Wildlife Park and Resort, United Arab Emirates, with a view to establishing baseline values. Methods: Blood was collected from the femoral vein using aseptic techniques, kept in a cool box and sent to laboratory for analysis. The blood was analysed for haematological and biochemical values using veterinary hematology and chemistry analysers (ABX ABC Vet, Horiba ABX SAS ® Montpellier, France. Results: Haematological values were within the normal ranges recorded in domestic cats and there was no statistical difference between values found in males and females. Aspartate aminotransferase values were higher (P0.05 between males and females values. Conclusions: Our results present reference ranges for haematology and biochemistry parameters in captive sand cats. These values will be important for diagnosis of various diseases and monitoring of treatments.

  15. Contribution to the hydrogeological, geochemical and isotopic study of Ain El Beidha and Merguellil (Kairouan plain) aquifers: Implication for the dam-aquifer relationship

    International Nuclear Information System (INIS)

    In the semiarid central part of Tunisia the water resources are becoming increasingly rare because of the scarcity and irregularity of the precipitation and a steadily growing need for fresh water. This study addresses the use of geochemical and isotopic data to analyze the relationship between the El Haouareb dam and the Ain El Beidha and the Kairouan alluvial plain aquifers systems for durable groundwater management. In the Ain El Beidha basin the hydrogeological and geochemical investigations showed that: - The general direction of the groundwater flow is mainly from the SW to the NE, i.e. towards the hydraulic sill of El Haouareb which allows the connection between the Ain El Beidha basin and the Kairouan plain, - The salinity distribution displays a zonation in apparent relationship with the lithological variation of the aquifer formation, - Mineral exchange between groundwater and the aquifer matrix is the dominant process in determining groundwater salinity. The isotopic data confirm the flow directions of groundwater and shows that the recharge of Ain El Beidha aquifers takes place from the floods of the Khechem and Ben Zitoun wadies and also by preferential infiltration of runoff at the front of hill slopes area. Close to preferential recharge areas, groundwater 3H contents reflect a recent input of surface water, whereas the radiocarbon data indicate a longer residence time downstream. The isotopic characteristics of Ain El Beidha groundwater (small space and temporal changes) authorize the use of averaged values for the dam-aquifer water exchange. Under natural conditions, groundwater recharge of the alluvial aquifer of Kairouan plain occurs by infiltration of the Merguellil floods and from the Ain el Beidha groundwater flow close the karstic hydraulic sills. Since the construction of the El Haouareb dam, these natural mechanisms have been strongly modified: the dam waters infiltrate into the karst, mix with the Ain el Beidha groundwater, and feed the

  16. Aine või toote ravimina määratlemine Eestis Euroopa Liidu õiguse valguses : [magistritöö] / Kaili Lellep ; Tartu Ülikool, õigusteaduskond ; juhendaja Ants Nõmper

    Index Scriptorium Estoniae

    Lellep, Kaili

    2010-01-01

    Aine või toote määratlemisest toiduna, kosmeetikatootena, meditsiiniseadmena, ravimina. Määratlustest Eestis ja nende vastavusest Euroopa Liidu õigusega, määratluste tagajärgedest, ettepanekutest vastuolulise õigusakti muutmiseks

  17. Extraction and anticoagulant activity of sulfated polysaccharides from Caulerpa cupressoides var. lycopodium (Vahl C. Agardh (Chlorophyceae = Extração e atividade anticoagulante dos polissacarídeos sulfatados da clorofícea Caulerpa cupressoides var. lycopodium (Vahl C. Agardh = Extração e atividade anticoagulante dos polissacarídeos sulfatados da clorofícea Caulerpa cupressoides var. lycopodium (Vahl C. Agardh.

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2011-04-01

    Full Text Available The reportedly low standard quality of heparin (HEP for use in cardiac surgeries has led to concern in the Brazilian and international markets. Sulfated polysaccharides (SPs from seaweeds have been regarded as promising substitutes for HEP. The aim of this study was to sequentially extract total SPs (TSPs from Caulerpa cupressoides (Chlorophyceae with papain in 100 mM sodium acetate buffer (pH 5.0 containing 5 mM cysteine and 5 mM EDTA, followed byfractionation by ion-exchange chromatography (DEAE-cellulose, and then evaluate the anticoagulant potential of SP fractions by activated partial thromboplastin time (APTT using normal human plasma and compare it to standard HEP (193 IU mg-1. The obtained fractions were chemically characterized by chemical composition and agarose gel electrophoresis. The yield was 4.61%, and three fractions of SP (F I, F II and F III eluted with 0.50, 0.75 and 1.00 M of NaCl,respectively, were observed on chromatography profiles; however, differences in charge densities patterns and degree of resolution among them were revealed by electrophoresis. SPs were capable of modifying APTT only in fractions eluted with 0.75 M of NaCl, whose activities were 23.37 and 25.76 IU mg-1, respectively, and the charge density was prerequisite to activity. Therefore, C. cupressoides is a source of SPs possessing low anticoagulant potential compared to HEP.O baixo padrão de qualidade outrora declarado da heparina (HEP para o uso em cirurgias cardíacas tem levado preocupação nos mercados nacional e internacional. Os polissacarídeos sulfatados (PSs de algasmarinhas têm sido considerados como promissores substitutos para HEP. Objetivou-se a extrair sequencialmente PSs totais (PSTs da clorofícea Caulerpa cupressoides com papaína em tampão acetato de sódio 100 mM (pH 5,0 contendo cisteína 5 mM e EDTA 5 mM, fracionar por cromatografia de troca iônica (DEAE-celulose e avaliar o potencial anticoagulante das frações de PS por meio do

  18. Use of tritium for estimation of groundwater mean residence time, a case study of the Ain Al-Samak Karst springs (Central Syria)

    International Nuclear Information System (INIS)

    This work is an attempt to estimate the mean residence time of groundwater in the Ain Al-Tanour and Ain-Samak, which are the major karst springs in the Upper Orontes Basin (Central Syria). This estimate, which consists on the application of a mathematical modeling approach, was based on the use of tritium, as a natural radioisotope tracer and a tool for ground water age dating. By adopting a completely mixed reservoir model, linked with exponential time distribution function, the mean residence time (turnover time) of these two springs was evaluated to be about 50 years. This result is in good agreement with previous estimation obtained for the Figeh main spring, which belongs to the same aquifer (Cenomanian-Turonian complex) in the Damascus Basin. On the basis of this evaluation, a value of about 800 million m3 was obtained for the maximum groundwater reservoir size

  19. Comparative Hydrological and Geoelectrical Study on the Quaternary Aquifer in the Deltas of Wadi Badaa and Ghweiba, El Ain El Sukhna Area, Northwest Suez Gulf, Egypt

    OpenAIRE

    El Osta, M. M.; A. El. El Sheikh; Barseem, M. S.

    2010-01-01

    El Ain El Sukhna area was selected in the last ten years to initiate many governmental and investmental programs. The different activities in that area depend mainly on the groundwater of the Quaternary aquifer, which forms the main water bearing strata. In the present work, twenty one geoelctrical soundings using the Schlumberger configuration are carried out at selected sites especially in missing parts from wells to delineate the groundwater setting in such sites. Eight of them are conduct...

  20. Revised astrochronology for the Ain el Beida section (Atlantic Morocco): No glacio-eustatic control for the onset of the Messinian Salinity Crisis

    OpenAIRE

    Krijgsman, W.; Gaboardi, S.; F. J. Hilgen; Iaccarino, S.; Kaenel, E. de; Laan, Erwin

    2004-01-01

    Glacio-eustatic sea level lowering has often been proposed as a key mechanism for explaining the onset of the Mediterranean evaporites during the Messinian Salinity Crisis (MSC). To examine the role of glacio-eustacy during the progressive isolation of the Mediterranean in more detail, we reinvestigated the Ain el Beida quarry section that is located at the Atlantic margin of Morocco and therefore free of destructive MSC-related complications. The section consists of deep marine, cyclically b...

  1. Cirugía oral en pacientes bajo terapia anticoagulante: modelo experimental para la evaluación de la eficacia de la cola de fibrina Oral surgery in patients treated with anticoagulating therapy: experimental model for evaluation of fibrin glue efficiency

    Directory of Open Access Journals (Sweden)

    G Taormina

    2004-06-01

    Full Text Available Introducción: En la práctica de cirugía oral en los pacientes bajo terapia anti coagulante, el empleo de un sistema eficaz de acción hemostática es de extrema relevancia, porque puede evitar la alteración del régimen terapéutico anticoagulante y el riesgo de un exceso de sangrado. En el presente trabajo se investiga la capacidad hemostática de la cola de fibrina como presidio hemostático en los pacientes bajo terapia anticoagulante, exponiendo los resultados de la experimentación sobre la base de un Standard de referencia del trauma quirúrgico y de la intensidad de la terapia anticoagulante. Materiales y métodos: Han sido seleccionados 20 pacientes en terapia anticoagulante con una edad comprendida entre los 44 y 79 años, se han realizado, según las modalidades apropiadas, simples exodoncias o más complejas de dientes mono-, bi- y tri-radiculares. Tras la alveoloplastia se ha colocado una esponja de fibrina reabsorbible en forma de gel (Gingistat® y se ha realizado la sutura. El trauma quirúrgico ha sido clasificado por medio de una escala cuantitativa que puede expresar de forma unívoca el grado de trauma. La categoría de trauma por cada paciente se establece por la suma de los valores obtenidos de cada uno de los procedimientos unitarios. Ha sido posible evaluar el coeficiente de relación entre la intensidad del efecto anticoagulante (medido por medio del lNR y número de complicaciones hemorrágicas que se han verificado, además de entre el grado de trauma quirúrgico y el número de complicaciones que se han presentado. Resultados y Conclusiones: Se demuestra que el utilizo terapéutico de la cola de fibrina puede ser considerado como un válido soporte por la optimización de la hemostasis en los pacientes con alteraciones de la coagulación inducidas farmacológica menteAim of the work: The authors emphasize how an effective emostatic method is extremely important in patients treated with anticoagulating therapy

  2. Polissacarídeos sulfatados isolados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides – extração, fracionamento e atividade anticoagulante =Sulfated polysaccharides isolated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes – extraction, fractionation and anticoagulant activity

    Directory of Open Access Journals (Sweden)

    José Ariévilo Gurgel Rodrigues

    2010-04-01

    Full Text Available A incidência de doenças cardiovasculares e os efeitos adversos da heparinoterapia têm motivado a busca por novos agentes terapêuticos e os polissacarídeos sulfatados (PS de algas marinhas têm sido reportados como fontes alternativas para tal. Objetivou-se avaliar o potencial anticoagulante dos PS totais (PST isolados e fracionados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides. Inicialmente, os PST foram extraídos com papaína em tampão acetato desódio 0,1 M (pH 5,0 contendo cisteína 5 mM e EDTA 5 mM, seguidos de fracionamento em coluna de troca iônica de DEAE-celulose com gradiente de NaCl. As frações obtidas foram analisadas por eletroforese em gel de agarose a 0,5% e a atividade anticoagulante, mensurada pelo tempo de tromboplastina parcial ativada (TTPA, usando-se plasma humano normal e comparada a uma curva-padrão de heparina (193 UI mg-1. Verificaram-se semelhantes perfiscromatográficos entre os PS de ambas as espécies, porém com padrões de mobilidades distintas quando as frações foram comparadas por eletroforese. Os PS modificaram o TTPA, cujas atividades anticoagulantes foram de apenas 21,23 e 24,36 UI mg-1, quando eluídos com 0,75 M de sal para C. racemosa e C. cupressoides, respectivamente. Portanto, PS anticoagulantes isolados dasclorofíceas C. racemosa e C. cupressoides resultaram em efeitos anticoagulantes inferiores aos da heparina. Estudos comparativos dessas moléculas também são sugeridos como ferramentas auxiliares na identificação de algas do mesmo gênero.The incidence of cardiovascular diseases and adverse effects from heparintherapy have led to a search for new therapeutic agents, and the sulfated polysaccharides (SP of seaweeds have been reported as alternative sources. The aim of this work was to evaluate the anticoagulant potential of total SP (TSP isolated and fractionated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes. Initially, the TSP were extracted with papain

  3. Prótese de carbono de disco basculante com revestimento de material biológico em posição mitral com baixa dose de anticoagulante oral: 3 anos de experiência

    Directory of Open Access Journals (Sweden)

    Hélio Pereira de MAGALHÃES

    1998-01-01

    Full Text Available Introdução: Análise clínica após três anos de observação com a válvula de disco Magalhães - HP. Casuística e métodos: Receberam alta hospitalar, a partir de 1994, um total de 34 pacientes. Todos os sobreviventes foram contatados nos últimos três meses e o tempo médio de observação foi de 24,5 meses (variação de 2 a 35 meses, somando 834 meses-paciente (69,5 anos-paciente. Resultados: A curva atuarial de sobrevida foi de 85,3%. Houve uma complicação fatal não relacionada com a válvula (insuficiência renal (0,98 por 100 pacientes-ano (PCPA e três complicações fatais relacionadas com a válvula (trombose - 2,9 PCPA (1 caso em outro hospital, 1 caso reoperado e 1 caso tratado por estreptoquinase com bom resultado inicial evoluindo com complicação pulmonar. Houve três complicações hemorrágicas (2,94 PCPA de importância, sendo uma fatal (0,98 PCPA, uma complicação de grau moderado (0,98 PCPA e 8 casos de menor importância (7,8 PCPA. Houve nove complicações não fatais relacionadas com a válvula (8,8 PCPA: sopros, 6 casos (5,8 PCPA; Tromboembolismo sem seqüela, 2 casos (1,96 PCPA; trombose, 1 caso (0,98 PCPA, reoperado com boa evolução. Conclusão: O revestimento da válvula de disco com material biológico heterólogo com uso de menor dose de anticoagulante parece reduzir após o 1º ano a incidência de trombose, tromboembolia e acidentes hemorrágicos. Nos três primeiros meses houve maior incidência de trombose e acidentes hemorrágicos devido a desvios no protocolo de anticoagulação, quando há necessidade de anticoagulação plena e efetiva para propiciar mínima deposição de fibrina e cicatrização lenta e fina. A dose média semanal segura de fenprocumona foi de 4,5 comprimidos (mínimo de 2,5 e máximo de 7 comprimidos. O excelente resultado nos três últimos anos de observação clínica justifica plenamente o uso da válvula, porém redobrada atenção deve ser tomada nos três primeiros

  4. Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

    OpenAIRE

    Katre Talviste

    2013-01-01

    This article positions the translations of French verse works (plays and selected collections of individual poets) that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961), which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these...

  5. PI/AIN纳米复合薄膜结构与介电性能研究%Structure and Dielectric Properties of PI/AIN Hybrid Film

    Institute of Scientific and Technical Information of China (English)

    李广; 殷景华; 刘晓旭; 冯宇; 田付强; 雷清泉

    2011-01-01

    采用原位聚合法制备了聚酰亚胺/氮化铝(PI/AlN)纳米复合薄膜,用小角散射(SAXS)、扫描电镜(SEM)对薄膜进行表征,研究了不同纳米掺杂量对材料电阻率、介电常数(ε)和介质损耗因数(tanδ)的影响.结果表明,随着纳米AlN含量的增加,分形结构由质量分形转变为表面分形,当AlN含量为1%时,复合薄膜的介电常数达到最低值,电阻率提高了一个数量级;介质损耗在低频范围内明显增加;AlN的掺杂提高了纳米复合薄膜的绝缘性能.%A polyimide/aluminum nitride(PI/A1N) nano-composite film was prepared by in-situ poly merization method. The microscopic structure of the film was characterized by small angle scat tering (SAXS) and scanning electron microscope (SEM) . The effects of nano-AIN content on the volume resistivity, permittivity(e) and dielectric loss of the film were studied. The results show that with increasing the nano-AIN content, the fractal structure changes from quality fractal to surface fractal. The permittivity of the film attains the minimum value when the nano-AIN content is 1%. The volume resistivity is increased by one order of magnitude, and the dielectric loss in creases obviously in low frequency range, which indicates that the addition of A1N can improve the insulation performance.

  6. Monitorização de reações adversas de novos anticoagulantes orais através de um sistema de farmacovigilância ativa implementado nos Serviços Farmacêuticos do CHCB: experiência profissionalizante na vertente de farmácia comunitária e investigação

    OpenAIRE

    Pereira, Filipa Ferreira

    2013-01-01

    Este trabalho encontra-se dividido em duas partes distintas, sendo que a primeira incide sobre a vertente de investigação desenvolvida e a segunda sobre o relatório de estágio efetuado em farmácia comunitária. O primeiro capítulo do relatório relacionado com a vertente de Investigação pretende descrever o projeto intitulado em: “Monitorização de Reações Adversas de novos anticoagulantes orais através de um sistema de Farmacovigilância Ativa implementado nos serviços Farmacêuticos do ...

  7. BILAN DE SUIVI DES PERFORMANCES DE FONCTIONNEMENT D’UNE STATION D’EPURATION A BOUES ACTIVEES : CAS DE LA STEP AIN EL HOUTZ

    OpenAIRE

    Boumedienne, Mohammed El Amine

    2013-01-01

    Mon travaille a été fait au niveau de la station d’épuration STEP de AIN EL HOUTZ (TLEMCEN). Le but de mon travaille est de suivre les performances épuratoires de la station (rendements en élimination de la pollution : DBO5, DCO et MES), et d’autre paramètres qui peuvent influencer sur le traitement par boues actives (PH, température, la charge organique, la teneur en oxygène) par une série de données des analyses physico-chimique des eaux (brutes et traitées) et confirme...

  8. The local politics of Global Jihad: A study on the evolution of militant Islamism in the Palestinian refugee camp of Ain al-Hilwe.

    OpenAIRE

    Sogge, Erling Lorentzen

    2014-01-01

    Can Jihadists become pragmatics? In Palestinian refugee camp Ain al-Hilwe, located in Southern Lebanon, the Jihadi-Salafi militia Usbat al-Ansar has a long history of catering to the needs of the local refugee population. Integrated into the political system of the camp, the group shares the responsibility for what is now close to 90,000 refugees, as people at the time of writing keep pouring in from a war-stricken Syria. While Usbat al-Ansar might best be known for a wave of terrorism and as...

  9. The impact of weathering on the uranium-bearing phosphates of Ain Laylon in the Syrian coast, using radon and gamma ray surveys

    International Nuclear Information System (INIS)

    A combination of several exploration techniques was carried out at the main phosphatic outcrop of Ain Laylon in the Syrian coastal region. The survey was extended along an E-W profile parallel to Wadi Al-Mzeraa over a distance of about 23 km from Ain Laylon site towards the shoreline of the Mediterranean Sea. The techniques used in this survey included soil radon emanometry, gamma ray spectrometry and soil geochemistry, with the purpose of evaluating the effects of weathering and erosion on the uranium-hearing phosphate formations in the study ares. Soil radon concentration and gamma ray total count rates found to be ranging between 115-472 pCi/l and 52-520 cps over the main phosphate deposit of Ain Layton and between 16-241 pCi/l and 15-300 cps along the profile of Wadi Al-Mzeraa - Rwemiyeh respectively. Some suitable elements such as U, Zn, Pb, Cr, Fe and Sr were also analyzed to trace the dispersion pattern of uranium and its controls throughout the area. The results showed that the distribution of both radon emission and gamma ray activity, in accordance with chemical uranium and some associated trace elements, were almost identical over the study area. The anomalously high values in all cases were basically found to be related to the main phosphatic outcrop and to the reprecipitation processes at their vicinity following the alteration of the phosphates. The prevailing topographic conditions of the drainage system has probably played a crucial role in carrying the uraniferous solutions from its phosphatic source down to the nearby sedimentary environment. This appears to be sufficient enough to produce an anomalous halo resulting in the detection of some relatively high radon and gamma values of about 7 and 15 times the background respectively, especially close to the main phosphate outcrop. A notable gradual decrease was then observed at the following sampling sites along the pathway west of Ain Laylon site approaching the background level at a distance of

  10. SOME ASPECTS OF THE REPRODUCTIVE BIOLOGY OF THE THIN LIP GREY MULLET LIZA RAMADA (RISSO, 1826) IN AIN EL-GHAZALA LAGOON–EASTERN LIBYA

    OpenAIRE

    Yousef KA Abdalhafid and Mohammad El-mor*

    2014-01-01

    The reproductive biology of 250 specimens of Liza ramada (Family: Mugilidae) collected from catches by gill and trammel nets on Ain El-Ghazala lagoon (Eastern Libya) in the Mediterranean Sea was studied. There were monthly variations in sex ratio between females (159 fish = 63.6%) and males (91 fish = 36.4%). Sex ratio was (1: 1.75) for males to females respectively. The length at 50% maturity was 18.45 cm for females and 16.45 cm for males. The breeding season extends from September to Febru...

  11. Simultaneous antibacterial and anticoagulant properties of polypropylene non-woven textiles Elaboration d'un textile polypropylène non-tissé présentant simultanément des propriétés antibactériennes et anticoagulantes

    Directory of Open Access Journals (Sweden)

    Jimenez Maude

    2013-11-01

    Full Text Available The aim of this work was to prepare a non-woven Polypropylene (PP textile functionalized with bioactive molecules to improve simultaneously its anticoagulation and antibacterial properties. The immobilization of either heparin (anticoagulation agent or gentamicin (aminoglycoside antibiotic was already proven to be effective on non-woven PP textiles. This work details how we managed to immobilize both gentamicin and heparin on the textile [1]. The immobilization times were studied in order to determine the best compromise between cytocompatibility, anticoagulant effect and antimicrobial activity. Cetté étude décrit le procédé de fonctionnalisation d'un textile polypropylène (PP non-tissé afin d'améliorer à la fois ses propriétés antibactériennes et anticoagulantes. Dans des précédents travaux, l'immobilisation soit de l'héparine (agent anticoagulant, soit de la gentamicine (agent antibiotique aminoglycoside a déjà été reportée. Des effets respectivement anticoagulants et antibactériens ont été obtenus. Cette étude décrit la faç on d'immobiliser ces deux principes actifs sur un même textile. L'effet des temps d'imprégnation sur les propriétés antibactériennes et anticoagulantes a été étudié afin d'obtenir le meilleur compromis possible en termes de cytocompatibilité, effet anticoagulant et activité antimicrobienne.

  12. Concentração de anticoagulante, tempo e temperatura de armazenagem sobre os parâmetros hematológicos no hemograma automatizado Anticoagulant concentration, time and storage temperature on hematological parameters in automated blood count

    Directory of Open Access Journals (Sweden)

    Aécio Carlos de Oliveira

    2010-12-01

    Full Text Available O estudo teve como objetivo identificar os efeitos do tempo de estocagem, da temperatura de armazenamento e da quantidade de anticoagulante sobre parâmetros hematológicos de cães. Foram utilizadas amostras do sangue de dez cães de raças variadas, clinicamente hígidos. As alíquotas foram colhidas com 1,8mg; 3,6mg; 7,2mg e 14,4mg de ácido etilenodiaminotetracético (EDTA por mL de sangue, distribuídas em dois grupos: de 2°C a 8°C e temperatura ambiente. Após a coleta, foram avaliadas em quatro tempos: 0, 12, 24 e 48 horas. Usando um contador automático de células, foram avaliados leucócitos, eritrócitos, hemoglobina, hematócrito, volume corpuscular médio (VCM, índice de anisocitose eritrocitária (RDW, plaquetas e plaquetócrito (PCT. O valor do VCM diminuiu nas maiores concentrações de EDTA (7,2mg mL-1 e 14,4mg mL-1, com decréscimo de 2,36% na maior concentração. A temperatura e o tempo de armazenagem também ocasionaram alteração nesse parâmetro, ou seja, houve decréscimo no tempo 12 horas à temperatura de 2 a 8°C e aumento nos tempos 24 e 48 horas à temperatura ambiente (PThe study aimed to identify the effects of time, temperature of storage and excess of anticoagulant on hematological parameters of dogs. Blood samples of ten, clinically healthy dogs, of different breeds were utilized. Aliquots were stored with 1.8mg, 3.6mg, 7.2mg and 14.4mg of ethylenediaminetetraacetic acid (EDTA per mL of blood, divided into two groups: 2°C to 8°C and room temperature. Right after collection, they were evaluated in four times: 0h, 12h, 24h and 48h. White blood cells, red blood cells, hemoglobin, packed cell volume (PCV, mean corpuscular volume (MCV, red cell distribution width (RDW, platelet and thrombocrit (PCT were evaluated in the automatic cell counter. In the automatic cell counter analysis, the MCV increased significantly with higher concentrations of EDTA (7.2mg mL-1 and 14.4mg mL-1 peaking at 2.36%, in the highest

  13. Rahvusvaheline turismikonverents / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2011-01-01

    Radisson Blu Hotel Olümpias 28. aprillil korraldatud konverentsist "Läänemere regiooni turismiteadmuse toetus turismimajandusele ja -ettevõtlusele 2011-2026", millega tähistati Eesti Hotelli- ja Turismikõrgkooli EHTE 15. sünnipäeva. Thomas Mielke, Maritta Hiltuneni, Kristian Sieversi, Pauli Santala, Inese Šīrava, Maija Rozite ja Kestutis Ambrozaitise konverentsil peetud ettekannetest ja paneeldiskussioonist

  14. Keelatud ained / Ave Oit

    Index Scriptorium Estoniae

    Oit, Ave

    2012-01-01

    Öko- ja looduskosmeetikas keelatud või piirangutega lubatud koostisainetest: silikoonid, etoksüleeritud emulgaatorained (PEG-ühendid), toorõli baasil valmistatud rasvained ja emulgaatorid s.h mineraalõlid ja -vahad

  15. Eeslid / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    2003-01-01

    Sisu: Eeslid ; Luuletaja Koghazi ; Elav kuningas ; Neli legendi : Mungasuudlus ; Dorzhiin ; Legend meister Albrechtist ; Aafrika muld. Ballaad kombaini armastusest ; Kuningakatse ; Rapsoodiad : Draakoni talveuni ; Klaassepa poeg. Kaks indiaani metamorfoosi : Roti metamorfoos ; Ahvnaine. Paani surm ; Valgjärve legend ; Katsikõsõ'

  16. Turundusteenistus / Ain Kaljurand

    Index Scriptorium Estoniae

    Kaljurand, Ain, 1965-

    2004-01-01

    Ilmunud ka: 2003 : annual report : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20; 2003 : godovoi ottshjot : [Eesti Raudtee]. - Tallinn, 2004, lk. 15-20. Ülevaade AS-i Eesti Raudtee 2003. a. kaubaveost veomahtude ja kaubagruppide järgi, turundusteenistusest, hinnapoliitikast

  17. Narkootilise ja psühhotroopse aine suures koguses ebaseaduslik käitlemine suure varalise kasu saamise eesmärgil : [magistritöö] / Kerli Lepik ; Tartu Ülikool, õigusteaduskond ; juhendaja: Jaan Ginter

    Index Scriptorium Estoniae

    Lepik, Kerli, 1989-

    2013-01-01

    Suures koguses narkootilise ja psühhotroopse aine käsitlemisest, suure varalise kasu saamise eesmärgist, võrdlus teiste Euroopa riikidega (EL, Läti, Leedu, Soome, Norra, Tšehhi), suurest varalisest kasust kui koosseisutunnusest ja alternatiividest

  18. Jõekääru Jazz täitis eesmärgi nii korraldajate, esinejate kui publiku poolelt / Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan...[jt.] ; foto ja küsitl. Kaire Tensuda

    Index Scriptorium Estoniae

    2007-01-01

    Jõekääru Jazz'ile järgneval nädalal tõi ürituse peakorraldaja Allan Liik toimetusse seal esinenud muusikud. Vestlusringis olid: Allan Liik, Hedvig Hanson, Andre Maaker, Ain Agan, Raivo Tafenau ja Sergio Bastos

  19. Polissacarídeos sulfatados isolados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides – extração, fracionamento e atividade anticoagulante - doi: 10.4025/actascibiolsci.v32i2.5923 Sulfated polysaccharides isolated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes – extraction, fractionation and anticoagulant activity - doi: 10.4025/actascibiolsci.v32i2.5923

    Directory of Open Access Journals (Sweden)

    Norma Maria Barros Benevides

    2010-05-01

    Full Text Available A incidência de doenças cardiovasculares e os efeitos adversos da heparinoterapia têm motivado a busca por novos agentes terapêuticos e os polissacarídeos sulfatados (PS de algas marinhas têm sido reportados como fontes alternativas para tal. Objetivou-se avaliar o potencial anticoagulante dos PS totais (PST isolados e fracionados das clorofíceas Caulerpa racemosa e Caulerpa cupressoides. Inicialmente, os PST foram extraídos com papaína em tampão acetato de sódio 0,1 M (pH 5,0 contendo cisteína 5 mM e EDTA 5 mM, seguidos de fracionamento em coluna de troca iônica de DEAE-celulose com gradiente de NaCl. As frações obtidas foram analisadas por eletroforese em gel de agarose a 0,5% e a atividade anticoagulante, mensurada pelo tempo de tromboplastina parcial ativada (TTPA, usando-se plasma humano normal e comparada a uma curva-padrão de heparina (193 UI mg-1. Verificaram-se semelhantes perfis cromatográficos entre os PS de ambas as espécies, porém com padrões de mobilidades distintas quando as frações foram comparadas por eletroforese. Os PS modificaram o TTPA, cujas atividades anticoagulantes foram de apenas 21,23 e 24,36 UI mg-1, quando eluídos com 0,75 M de sal para C. racemosa e C. cupressoides, respectivamente. Portanto, PS anticoagulantes isolados das clorofíceas C. racemosa e C. cupressoides resultaram em efeitos anticoagulantes inferiores aos da heparina. Estudos comparativos dessas moléculas também são sugeridos como ferramentas auxiliares na identificação de algas do mesmo gênero.The incidence of cardiovascular diseases and adverse effects from heparintherapy have led to a search for new therapeutic agents, and the sulfated polysaccharides (SP of seaweeds have been reported as alternative sources. The aim of this work was to evaluate the anticoagulant potential of total SP (TSP isolated and fractionated from Caulerpa racemosa and Caulerpa cupressoides (Chlorophyceaes. Initially, the TSP were extracted with

  20. Avaliação de anticoagulantes naturais e de fatores da coagulação em pacientes com distúrbios congênitos de glicosilação (DCG tipo I An evaluation of natural anticoagulants and coagulation factors in patients with congenital disorders of glycosylation type I

    Directory of Open Access Journals (Sweden)

    Anna Letícia Soares

    2010-01-01

    Full Text Available Defeitos na incorporação de N-glicanos nas proteínas humanas ocasionam um grupo de doenças multissistêmicas denominadas coletivamente distúrbios congênitos de glicosilação (DCG. Os DCG manifestam-se na infância com sintomas neurológicos que incluem principalmente atraso psicomotor, ataxia, hipotonia e episódios de acidente vascular cerebral. Várias proteínas do sistema hemostático somente tornam-se biologicamente ativas após a glicosilação. O objetivo deste estudo foi avaliar os anticoagulantes naturais (proteína S livre, proteína C e antitrombina e os fatores da coagulação (VIII, IX e XI em pacientes com DCG tipo I. Foram avaliados 11 pacientes com diagnóstico positivo para DCG tipo I (três do gênero masculino e oito do gênero feminino, idade média de 5,6 anos; e oito pacientes com diagnóstico negativo para DCG(quatro do gênero masculino e quatro do gênero feminino, idade média de 4,5 anos (grupo-controle. O diagnóstico de DCG tipo I foi realizado pela identificação do padrão de hipoglicosilação da transferrina plasmática. Na avaliação dos anticoagulantes naturais pode-se observar redução dos valores de PS livre e PC e uma redução marcante de AT, quando comparados com o grupo controle. Em relação aos fatores de coagulação não houve diferença significativa para os fatores VIII e IX e houve redução marcante do fator XI. Os resultados do presente estudo sugerem que a deficiência combinada de anticoagulantes naturais é responsável pelo estado pró-trombótico observado em pacientes com DCG. Sugerimos também que a análise dos parâmetros hemostáticos seja realizada para pacientes com DCG quando apresentarem sintomas clínicos de alteração do sistema hemostático e antes de procedimentos invasivos.Defects in the biosynthesis of N-linked human protein glycosylation leads to a group of multisystem disorders collectively called congenital disorders of glycosylation (CDG. CDG present in infancy

  1. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9

    International Nuclear Information System (INIS)

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  2. Evaluation of the impact of water harvesting techniques on the evolution of piezometric head of Ain El Bidha groundwater in Kairouan at the Central part of Tunisia

    Science.gov (United States)

    Mechergui, M. Mohamed; Henda Saoudi, Mme

    2016-04-01

    This study aims to assess the impact of water harvesting constructed hydraulic structures (big and small dams, terraces, seuils for recharge…) on the evolution of piezometric head of Ain El Beidha groundwater table. The measurements of depth of water table, taken at the end of rain season and at the end of irrigation season, in many piezometers and monitoring wells, for a long period of observation before and after implementation of all the hydraulic structures, were used with the cumulative rain to the highest water table to diagnostic the effect of natural recharge and constructed hydraulic structures. According to the analysis of curves illustrating the evolution of piezometric head and rainfall over time, it was shown that despite the fact that the same amount of rain fall on the total area in the limits of Ain El Beidha groundwater table, the piezometers respond differently. This is because there are many sources of recharge and many factors affecting the recharge. First of all, the aquifer is divided in four compartments (the calcareous formation of Djebel El Houyareb, the plio-quaternary formation, the Miocene formation: Baglia and Saouaf). All those respond differently to the recharge by their capacity of infiltration and their hydrodynamic characteristics. The recharge of the groundwater table was increased by the implementation of small soil and water conservation structures, artificial lakes, El Haouareb Dam, run off in the natural Oued bads and seuils for recharge installed in the bads of oueds. The different piezometric drown maps were used to determine the flow direction and hydraulic gradient in order to identify the recharge areas, while tracking maps for three equal piezometric heads 210 m 300 m and 370 m established over different years made it possible to assess the impact of hydraulic structures, namely the effect of SWC and Ben Zitoun Lake. To illustrate the impact of El Houareb dam on the groundwater, the piezometric maps and local values

  3. Apport de la géomatique dans la protection des forêts contre les incendies (cas la forêt Fenouane Ain el Hdjar, Saida).

    OpenAIRE

    Hachemi, M’hamed Abdelillah

    2014-01-01

    Résumé L’objectif de ce travail porte sur l’apport de la télédétection et du SIG à la protection des forêts d’Ain El Hadjar contre les incendies. Pour cela nous avons utilisé un modèle de cartographie de risque d’incendie qui s’appuie sur un certain nombre de paramètres à savoir le type de végétation, la pente, l’exposition, la proximité des routes et la proximité des habitations. Les résultats obtenues ont révélés qu’environ 3027,91 Ha de notre zone de travail, présente un risque élevé...

  4. Impact of cooling condition on the crystal structure and surface quality of preferred c-axis-oriented AIN films for SAW devices

    Institute of Scientific and Technical Information of China (English)

    ZHANG Geng-yu; YANG Bao-he; ZHAO Jian; LI Cui-ping; LI Ming-ji

    2011-01-01

    AIN films with preferred c-axis orientation are deposited on Si substrates using the radio frequency (RF) magnetron sputtering method. The post-processing is carried out under the cooling conditions including high vacuum, low vacuum under deposition gas ambient and low vacuum under dynamic N2 ambient. Structures and morphologies of the films are analyzed by X-ray diffraction (XRD) and atomic force microscopy (AFM). The hardness and Young's modulus are investigated by the nanoindenter. The experimental results indicate that the (100) and (110) peak intensities decrease in the XRD spectra and the root-mean-square of roughness (Rrms) of the film decreases gradually with the increase of the cooling rate. The maximum values of the hardness and Young's modulus are obtained by cooling in low vacuum under deposition gas ambient. The reason for orientation variation of the films is explained from the perspective of the Al-N bond formation.

  5. Zn,O共掺杂实现p型AIN的第一性原理研究%First-principles study of Zn,O codoped p-type AIN

    Institute of Scientific and Technical Information of China (English)

    袁娣; 罗华锋; 黄多辉; 王藩侯

    2011-01-01

    基于密度泛函理论(density functional theory),采用第一性原理平面波超软赝势法,研究了纤锌矿AIN,Zn掺杂和Zn,O共掺杂AIN的晶体结构、能带、电子态密度、差分电荷分布及电荷布居数,计算结果表明:Zn,O共掺杂方法中引入激活施主O原子,能使受主能级向低能方向移动,形成了浅受主能级,同时,受主能带变宽、非局域化特征明显、从而提高了Zn原子的掺杂浓度和系统的稳定性,Zn,O共掺杂更有利于获得P型AIN.%The electronic structures of pure, Zn doped, and Zn, O codoped wurtzite AIN are calculated by using first-principles ultrasoft pseudopotential approach to the plane wave based on the density functional theory, and the crystal structure, the energy bands, the electronic density of states, the differential charge distribution and the charge population. The results show that in the Zn, O codoped method, the introduction of active donator, atom O, causes acceptor energy level to shift toward low energy, thereby forming the energy levels of shallow acceptor. At the same time, the energy band widens and nonlocal characteristics become significant, thereby increasing the doping concentration of Zn atoms and the stability of the system. Zn, O codoping is more conducible to obtaining the p-type AIN.

  6. Application of a TiAIN coating for the increase wear resistance of a passage floodgate manufactured in steel T9; Aplicacion de un recubrimiento de TiAIN para el incremento de la resistencia al desgaste de una compuerta de paso fabricada en acero T9

    Energy Technology Data Exchange (ETDEWEB)

    Montes de Oca, J.; Gonzalez, H. J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, IPN, Unidad Altamira, Km. 14.5 Carretera Tampico-Puerto industrial Altamira, 89600 Altamira, Tamaulipas (Mexico); Solis, E. [Hy-Teck Fluid Power, Blvd. A. Lopez Mateos No. 310, Col. Nuevo Aeropuerto, 89337 Tampico, Tamaulipas (Mexico); Moreno, J. [Departamento de Ingenieria Metalurgica, Escuela Superior de Ingenieria Quimica e Industrias Extractivas, IPN, UPALM Unidad Zacatenco, 07730 Mexico D. F. (Mexico); Munoz S, J. [Centro de Investigacion y de Estudios Avanzados, Unidad Queretaro, Libramiento Norponiente No. 2000, Fracc. Real de Juriquilla, 76230 Santiago de Queretaro, Queretaro (Mexico)], e-mail: jmontedeocav@ipn.mx

    2009-07-01

    The present work reports a study to increase wear resistance of a ball passage floodgate (steel type T9) trough the application of a thick film (coating). This study have included a material and process selection, synthesis of the coating on steel plates as substrates and spherical device, assembling of the coated floodgate on the ball valves, and finally an evaluation of the valves in the process of a thermoelectric power station. Taking into account the different requirements, a TiAIN coating prepared by cathodic arc evaporation was finally retained. The crystal structure, morphology and chemical composition of the coating were evaluated by x-ray diffraction (XRD) and scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS). Finally, mechanical properties such as hardness and Young modulus were determined by nano indentation. (Author)

  7. 不同厚度TiN和TiAlN涂层残留应力分析%Analysis on residual stress of various thickness of TiAIN and TiN coatings

    Institute of Scientific and Technical Information of China (English)

    王海洋; 曾传亮; 张祥林; 肖祥芷

    2011-01-01

    TiN and TiAIN coatings are often used in fine blanking dies. The phase variation of TiN and TiAIN coatings was analyzed by XRD in this research. The residual stress of TiN coating and substrate and TiAIN substrate was measured using sin2i|* method, and the microhardness of the coating was measured by microhardness tester. The results show that: there is obvious preferred orientation in the crystal surface of TiN coating (111) and (222), the residual stress of TiN coating ranges from -2 347 Mpa to-1920 Mpa, and that of the substrate from-154.9 Mpa to-69.21 Mpa, both of which decrease with the increase of coating thickness. The main phase composition of TiAIN coating is Ti3Al3N2 and there is preferred orientation in the crystal surface of (107). The residual stress of the substrate is between -123.7 Mpa to 469.5 Mpa, mainly in tensile stress state, which has a large influence on the die life and increases along with the coating thickness. The microhardness of TiN and TiAIN coatings also increases along with the film thickness.%TiN和TiAlN涂层常应用于精冲模,采用XRD技术分析了不同厚度TiN和TiAlN涂层的相变化,并采用Sin2Ψ法测量了TiN涂层和基体以及TiAlN基体的残留应力,应用显微硬度计测量了涂层的显微硬度.结果表明:TiN涂层(111)和(222)晶面存在明显择优取向,涂层残留应力分布在-2 347 ~ -1920MPa,基体残留应力分布在-154.9~-69.21 MPa,均随厚度增加而减小;TiAIN涂层主要相成分为Ti3Al3N2,且(107)晶面存在择优取向,基体残留应力分布在-123.7 ~ 469.5 MPa,主要呈拉应力状态,且随厚度增加而增大,对模具寿命有较大影响;TiN和TiAIN涂层显微硬度随厚度增加而增大.

  8. Influence of applied electric field on the absorption coefficient and subband distances in asymmetrical AIN/GaN coupled double quantum wells

    Institute of Scientific and Technical Information of China (English)

    Cen Long-Bin; Shen Bo; qin Zhi-Xin; Zhang Guo-Yi

    2009-01-01

    The influence of applied electric fields on the absorption coefficient and subband distances in asymmetrical AlN/GaN coupled double quantum wells (CDQWs) has been investigated by solving Schrodinger and Poisson equations self-consistently. It is found that the absorption coefficient of the intersubband transition (ISBT) between the ground state and the third excited state (1odd -2even) can be equal to zero when the electric fields are applied in asymmetrical A1N/GaN CDQWs,which is related to applied electric fields induced symmetry recovery of these states. Meanwhile,the energy distances between 1odd -2even and 1even - 2even subbands have different relationships from each other with the increase of applied electric fields due to the different polarization-induced potential drops between the lett and the right wells. The results indicate that an electrical-optical modulator operated within the opto-communication wavelength range can be realized in spite of the strong polarization-induced electric fields in asymmetrical AIN/GaN CDQWs.

  9. Comparative Hydrological and Geoelectrical Study on the Quaternary Aquifer in the Deltas of Wadi Badaa and Ghweiba, El Ain El Sukhna Area, Northwest Suez Gulf, Egypt

    Directory of Open Access Journals (Sweden)

    M. M. El Osta

    2010-01-01

    Full Text Available El Ain El Sukhna area was selected in the last ten years to initiate many governmental and investmental programs. The different activities in that area depend mainly on the groundwater of the Quaternary aquifer, which forms the main water bearing strata. In the present work, twenty one geoelctrical soundings using the Schlumberger configuration are carried out at selected sites especially in missing parts from wells to delineate the groundwater setting in such sites. Eight of them are conducted in the close vicinity of water wells, where lithologs and pumping test data of these wells are available to relate hydrologic and geoelctric measurements. The pumping tests data are analyzed by using AQTESOLV program and the geolectrical sounding data were interpreted by partial curve matching technique to obtain the initial parameters. The results indicated that, the transmissivity is found to be closely related with transverse resistance and the hydraulic conductivity with average transverse resistivity, while the salinity is inversely related with resistivity. Finally, priority map for drilling water wells is constructed to make the results more illustrative and useful for decision maker. The promising area for drilling is located at the western portion of the study region.

  10. Jebel Hafit and the Al Ain oases (Eastern Abu Dhabi, United Arab Emirates): an integrative approach of a cultural landscape through the scope of geodiversity

    Science.gov (United States)

    Giusti, Christian; Louchet, André; Beuzen-Waller, Tara; Ragala, Rachid; Pavlopoulos, Kosmas; Fouache, Éric; Cohen, Marianne; Desruelles, Stéphane; Gramond, Delphine

    2015-04-01

    human settlements and occupation, it is possible to characterize a threefold transition: first, the former transition between the pre-Islamic prehistoric societies and the development of Muslim societies; second, the more recent transition between the traditional historical society (farmers) and the contemporary society, characterized by the growth of urbanization, the creation of modern transport infrastructure and the concomitant growth of tourist flows; third, the current transition between the yesterday and tomorrow Al Ain City, due to the transformation of a local town centred on national economics all along the second half of the twentieth century, into an international town more open to the wider world with the management of a possible increased 20 % of tourist flow because of the inscription of Cultural Sites of Al Ain on the UNESCO's World Heritage List. It is not possible to completely ignore the fact that the Jebel Hafit and its foothills are partly crossed by an international boundary. In case of political tensions, this may cause some difficulties for the management of this territory, with contradictory requirements between security, tourism, traditional land use, and scientific research.

  11. Variaciones en la condición de venta según la concentración de activo por unidad posológica en AINES relacionados en las Normas Farmacológicas 2006

    OpenAIRE

    Solano Roa, Magda Vianneth

    2011-01-01

    Investigación desarrollada con el fin de evaluar las variaciones en la condición de venta según la concentración de activo por unidad posológica en AINEs (Analgésicos Antiinflamatorios No Esteroides) relacionados en las Normas Farmacológicas Colombianas 2006, a partir de la información de libre consulta suministrada por los Registros Sanitarios (RS) del INVIMA, consulta a expertos y comparación de la normatividad nacional e internacional sobre los criterios que gobiernan la condición de venta...

  12. Kui tervis streigib / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2007-01-01

    Poliitikauuringute keskuse Praxis tervishoiupoliitika programmi direktor analüüsib streikida kavatsevate tervishoiutöötajate väiteid ning avaldab arvamust kavandatava streigi kohta. Ta peab tõenäoliseks, et streikijatele antakse järele teatud ulatuses, eesmärk suurendada tervishoiukulutusi jääb aga uue koalitsiooni lahendada

  13. Endasse kapseldunud aine / Edgar Krull

    Index Scriptorium Estoniae

    Krull, Edgar, 1948-

    2002-01-01

    IEA (International Association for Evaluation of Educational Achievement = Rahvusvaheline Assotsiatsioon Haridussaavutuste Hindamiseks) kodanikuõpetuse uurimusest 28 riigis. Kodanikuõpetuse teadmiste, sellest arusaamise tasemest Euroopas, postsotsialistlikes riikides, Eestis

  14. Eesti luuletaja päris oma prantsuse luuleraamat. August Sanga, Jaan Krossi ja Ain Kaalepi loomingust 1960. aastail / An Estonian Poet’s Own Book of French Poetry. About the Works of August Sang, Jaan Kross and Ain Kaalep in the 1960s

    Directory of Open Access Journals (Sweden)

    Katre Talviste

    2013-12-01

    Full Text Available This article positions the translations of French verse works (plays and selected collections of individual poets that August Sang, Jaan Kross and Ain Kaalep made in the 1960s, onto the background of their own original works. At that time, August Sang translated four plays by Molière (The Misanthrope, Tartuffe, The School for Wives in 1961; Amphitryon in 1961, which have already been discussed in relation to the tradition of translating the French syllabic verse into Estonian, because these translations form a considerable part of the body of Estonian translations of French verse poetry. For Jaan Kross and Ain Kaalep, the wider context is created by the so-called free verse battles in the 1950s, to which we can link Kross’ translation of a selected collection of Éluard (Veel enne kostma peab, 1969 and Kaalep’s translation of a selected collection of Prévert (Kuidas portreteerida lindu, 1965. One of the two remaining translations by Kross, (Rostand’s Cyrano de Bergerac, 1964, can also be examined in relation to the problems of translating verse, but the other, (Béranger’s Laulud, 1963, should be discussed in the framework of intellectual and cultural resistance, a part of which was also the struggle put up for the existence of free verse in the 1950s and 1960s.Of August Sang’s original work, the article examines his collection of poems Võileib suudlusega (1963, written simultaneously with his translations of Molière’s plays and published right after them. Both the translations and the collection of original poems have attracted critics’ attention with their remarkable lack of linguistic constraint and simplicity. Although Sang has rarely voiced theoretical ideas about translation or explained his method, both his poetic image, outlined in the collection Võileib suudlusega, and his search for right words, reflected in the drafts of his translations, let us believe that the simplicity of expression and the avoidance of marked

  15. What You Need to Know When Taking Anticoagulantion Medication

    Science.gov (United States)

    ... provides detailed information on the Potential for Drug Food Interactions and Anticoagulants. Avoid making any dramatic changes to your diet when taking anticoagulation medication. This may present a challenge when you are ...

  16. Design of the wind velocity sensor based on AIN thermal isolation MEMS array%一种AIN基热隔离MEMS阵列风速传感器设计

    Institute of Scientific and Technical Information of China (English)

    赵文杰; 施云波; 罗毅; 李国龙; 周真

    2012-01-01

    采用微机电系统(micro-electro-mechanical system,MEMS)技术设计和制作了一种基于氮化铝(aluminum nitride,AIN)基热隔离四阵列热流量风速风向传感器,并同时集成了一个环境温度传感器.在厚度为0.2 mm的AlN基片上通过光刻剥离工艺和激光微加工工艺实现2D微结构风速风向传感器制备.传感器由中间加热器、4个温度探测器和1个温度传感器组成,4个温度探测器之间通过激光微加工刻蚀8个热隔离通孔以减少热传导损失,提高有效热流量交换.通过对传感器的ANSYS仿真及性能测试,验证了设计的合理性及工艺的可行性.分析得出采用热隔离通孔可有效提高4个探测器的灵敏度,降低了加热电极的热传导损失,减小了传感器设计尺寸,提高了设计的集成度.传感器测试结果表明:最大角度差为5°,速度误差小于0.5 m/s.加热功耗为120 mW,响应时间仅3 s.%In this paper,a thermal flow sensor of wind velocity and direction based on a luminum nitride(AIN)thermal isolation four arrays is designed and fabricated using micro-electro-mechanical system (MEMS) technique. Moreover, an environmental temperature sensor is integrated at the same time. The 2D micro structure wind velocity and direction sensor is prepared on an AIN substrate with thickness of 0.2 mm using the photolithography lift-off processing and laser micro processing technologies. The sensor is composed of a middle heater,four temperature detectors and a temperature sensor. In the four temperature detectors,8 thermal isolation holes are prepared using micro laser processing technique to reduce the heat conduction loss and enhance the effective exchange of thermal flow. The ANSYS simulation and performance test results on the proposed sensor verify the rationality of the design and the feasibility of the processing. A-nalysis results demonstrate that adopting thermal isolation holes can effectively improve the sensitivity of the four

  17. Effect of addition of dried healthy or diseased parsnip root tissue to a modified AIN-76A diet on cell proliferation and histopathology in the liver, oesophagus and forestomach of male Swiss Webster mice.

    Science.gov (United States)

    Mongeau, R; Brassard, R; Cerkauskas, R; Chiba, M; Lok, E; Nera, E A; Jee, P; McMullen, E; Clayson, D B

    1994-03-01

    Umbelliferous crop plants, including the parsnip (Pastinaca sativa L.), elaborate enhanced levels of furocoumarins, including psoralens, when subjected to biotic or abiotic stress. These furocoumarins are recognized to lead to phototoxicity. In this study, the effect of these agents, which are present in diseased parsnip root tissue, on the liver and two tissues on the route of entry to the body (the oesophagus and forestomach) were investigated. Young male Swiss Webster mice were fed for approximately 30 days with modified AIN-76A diets containing 32.5% dried healthy, 32.5% apparently healthy or 32.5% fungicide-treated parsnip root tissue, and 8, 16 or 32.5% dried diseased (Phoma complanata-infected) parsnip root tissue. As controls, three modified AIN-76A diets differing in their edible starch-to-sucrose ratios (C1-C3) were administered for an equal time. Dried healthy parsnip root tissue, compared with controls, did not significantly affect any of the indices of cellular proliferation or histopathological parameters that were assessed. Histopathological examination of the oesophagus and forestomach demonstrated no significant changes as a result of feeding any of the diets containing parsnip tissue. In the liver, the highest level (but neither of the two lower levels) of dried diseased parsnip root tissue led to swelling of the cytoplasm in cells surrounding the central vein of hepatic lobules, with consequent compression of the peripheral cells. Using [3H]thymidine radioautography, a dose-related increase in cell labelling with the level of diseased parsnip root tissue was demonstrated in the liver. Compared with control diet C2 only, the extent of [3H]thymidine labelling in the liver was increased in mice receiving apparently healthy parsnip tissue; a slight, not statistically significant, increase was also noted with fungicide-treated parsnip tissue. Increased [3H]thymidine labelling with the feeding of diseased parsnip tissue was also found in the greater

  18. Teras, mille armid ei roosteta / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Roostevaba terase kasutamine. Vt. samas: Roostevaba teras; Raual kolmekordne hinnavahe; Terase roostekindlust parandab legeerimine; Paide veetorud peavad kestma 25 aastat. Diagramm: Terasetootmine maailmas. Kommenteerib Taavi Pauri

  19. Investorid on dilemma ees / Ain Kivisaar

    Index Scriptorium Estoniae

    Kivisaar, Ain, 1978-

    2007-01-01

    Keskmise kuupalga eest ei saa enam ruutmeetritki elamispinda ei meil ega mujal. Aktiivsel investoril pole muud teha, kui heita kõrvale tavatarkus ja usaldada enda sisetunnet. Diagramm: Keskmise kuupalga ja korteri ruutmeetri hinna suhe

  20. It Ain't What You Do...

    Science.gov (United States)

    Davis, Sam

    2007-01-01

    When developing partnership work, the members of Wakefield Skills for Life Group drew up a protocol setting out what each partner expected of the others. The process helped create one of the most cohesive partnerships in the region. This article takes a closer look at that journey, reflecting upon the nature of partnerships in general, and looking…

  1. Lahesõjas viik / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2001-01-01

    Helsingi ja Tallinna vahel liikuvate laevafirmade konkurents: Silja Line, Nordic Jet Line, Tallink ja Linda Line. Tabelid: reisijad laevaliinil Helsingi-Tallinn 1998-2001; Helsingi-Tallinna liinil kiirlaevade turuosad 1999-2000

  2. VJ annab muusikale visuaalsuse / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    Videograafikast. Video jockey ehk videokunstnik maalib kunstiteoseid piltide ja visuaalsete elementide abil, tehes seda muusika taustal, tavaliselt paralleelselt disco jockey'ga. Toomas Altnurme, Taavi Varmi, Sten Saluveeri ja Erki Kannuse kommentaare

  3. Makita kalmistu antropoloogiline aines / Luule Heapost

    Index Scriptorium Estoniae

    Heapost, Luule

    1993-01-01

    Tabel : Makita koljude keskmised mõõtmed ; Tabel : 13.-15. sajandi Makita koljud ja võrdlusmaterjalid Eestist ; Tabel 3 : 13. -15. sajandi Makita koljud ning võrdlusandmeid soome-ugri hõimude asualadelt ; Tabel 4 : 15.- 17. sajandi Makita koljud ja võrdlusandmed ; Tabel 5 : Makita koljude võrdlusandmed (Pernose'i meetodil) ; Tabel 6 : Makita luustike pikkade luude keskmine pikkus ; Tabel 7 : Kehapikkuse võrdlusandmed

  4. Palmse haagised vallutavad Euroopat / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2016-01-01

    Peamiselt põllumajanduses kasutatavaid haagiseid tootev OÜ Palmse Metall kuulub Eesti metallitööstuses nende ettevõtete sekka, kes õnnestub toodangut ka piiri taga oma kaubamärgi all müüa. Vestlusest OÜ Palmse Metall juhatuse liikme ja osaniku Janar Kaldaga

  5. Norma Maja astub kindlalt tulevikku / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2000-01-01

    AS Norma Maja saavutas kõrged kasumi ja kasumi kasvu näitajad töötajate koondamisega. Tabel: Norma Maja valdused, AS Norma Maja areng, AS ETK Majad areng. Arvamused: Ero Toom, Ivar Lahi ja Rein Loo

  6. Globaalsus + lennundus = Star Alliance? / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2002-01-01

    Erinevad koostöövormid lennufirmade vahel, alliansside teke ja areng maailmas. Maailma juhtivad lennundusalliansid ja nende poolt kaetud riigid ja sihtkohad. Kommenteerib Estonian Airi president Erki Urva

  7. Terror kui õud / Karl Paks, Ain Oras

    Index Scriptorium Estoniae

    Paks, Karl

    2000-01-01

    Terrorismist läbi aegade, detailsem ülevaade 20. sajandist. Tuumarelvaterrorist, keemilisest ja bioloogilisest relvast, arvutikuritegudest ning erivägede kasutamisest võitluses terrorismiga. Terrorismist Venemaa ajaloos. 1918. a. Moskvas Saksamaa suursaadiku tapnud terrorist Jakov Bljumkin. Salman Radujevi tegudest. Lennukite kaaperdamisest

  8. Lennart Mere viiest raamatust / Ain Kaalep

    Index Scriptorium Estoniae

    Kaalep, Ain, 1926-

    1997-01-01

    Varem ilmunud: Edasi 1976, 8. august, nr. 187, lk. 2. Rets. rmt.: Meri, Lennart. Kobrade ja karakurtide jälgedes: Kesk-Aasia matkamärkmeid. Tallinn: ERK, 1959. 158 lk.; Meri, Lennart. Laevapoisid rohelisel ookeanil. Tallinn : ERK, 1961. 175 lk.; Meri, Lennart. Tulemägede maale : reisipäevik 160. meridiaanilt. Tallinn : ERK, 1964. 264 lk.; Meri, Lennart. Virmaliste väraval: reisiraamat Tallinnast Beringi väina eskimote juurde. Tallinn : Eesti Raamat, 1974. lk. 328 lk. Meri, Lennart. Hõbevalge: reisikiri tuulest ja muinasluulest. Tallinn : Eesti Raamat, 1976. 488 lk.

  9. Evolución del consumo y gasto farmacéutico público de anti-inflamatorios no esteroideos (aines en el período 2001 - 2005 Evolution of public consumption and spending on non-steroidal anti-inflammatory drugs (nsaids during the period 2001 to 2005

    Directory of Open Access Journals (Sweden)

    Patricia Barber Pérez

    2007-12-01

    Full Text Available Este estudio observacional retrospectivo analizó el consumo y gasto farmacéutico de AINEs (antiinflamatorios no esteroideos clásicos en Costa Rica en el periodo 2001-2005. Su objetivo es contribuir al conocimiento de la estructura de gasto y perfil de utilización y consumo farmacológico de este grupo de medicamentos con el fin de abordar con mayores garantías la gestión del irremediable proceso de aparición y previsible financiación pública de los AINEs de nueva generación en el país. Los AINEs son un grupo de fármacos asociados de forma especial a los nuevos estilos de vida cuyo nivel de consumo crece de forma ininterrumpida y cuya participación en el gasto farmacéutico es cada vez más relevante. En la actualidad, constituyen el cuarto grupo en gasto farmacéutico público con un incremento del 15% en términos reales en el periodo 2001-2004. El consumo de AINEs para 2005 en Costa Rica es de 21,02 DHD (dosis diaria por habitante y día y en el periodo 2000-2005 su consumo se ha incrementado un 48%. Respecto al consumo en 2005 de los principios activos que forman este grupo farmacológico destaca la Indometacina con un 6,36 DHD, Sulindaco con 6,06 DHD y el Ibuprofeno con 4,36 DHD y el Tenoxican con 3,25 DHD. El CTD (Coste de Tratamiento Diario varía entre 2 céntimos de dólar para el Ibuprofeno y 1,49 dólares para el Tenoxican.This observational, retrospective study analyzed the pharmaceutical consumption and expense of classic NSAIDs (non-steroidal anti-inflammatory drugs in Costa Rica during the period 2001 to 2005. Its objective was to contribute to knowledge regarding the expense structure as well as the pattern of use and pharmacological consumption of this group of medicines with the purpose of providing better support to the inexorable process of the appearance and foreseeable public financing of new-generation NSAIDs in our country. NSAIDs are a group of medicines associated in a special fashion to the new lifestyles

  10. Solvent-extraction methods applied to the chemical analysis of uranium. III. Study of the extraction with inert solvents; Metodos de extraccion con disolventes aplicados al analisis quimico del uranio. III. Estudio de la extraccion con disolvente inertes

    Energy Technology Data Exchange (ETDEWEB)

    Vera Palomino, J.; Palomares Delgado, F.; Petrement Eguiluz, J. C.

    1964-07-01

    The extraction of uranium on the trace level is studied by using tributylphosphate as active agent under conditions aiming the attainment of quantitative extraction by means of a single step process using a number of salting-out agents and keeping inside the general lines as reported in two precedent papers. Two inert solvents were investigated, benzene and cyclohexane, which allowed to derive the corresponding empirical equations describing the extraction process and the results obtained were compared with those previously reported for solvents which, like ethyl acetate and methylisobuthylketone, favour to a more or less extend the extraction of uranium. (Author) 4 refs.

  11. Treatment by water flooding of aquifers contaminated by halogenated solvents; Saneamiento mediante water flooding de acuiferos contaminados por disolventes halogenados

    Energy Technology Data Exchange (ETDEWEB)

    Navarro Flores, A.

    2004-07-01

    The treatment of PCE, TCE and DCE contaminated ground water by water flooding and the application to an industrial facility located near of Barcelona, are described in this publications. The installed system comprises three extraction wells located over the edge of contaminant plume, two reinjection wells located near the hypothetic contaminant focus, and a superficial treatment system of contaminated ground water by Air-Stripping (flow rate: 1m''3/h). The modeling of contaminant transport by codes BIOCHOLOR shows the importance of biodegradation process in the mobilization of different contaminants, calculating the disappearance of PCE; TCE and DCE by biodegradation in 61.9%, 64,1% and 72,3% respectively, of total mobilizated mass on a 15 years period. Moreover, modeling allowed the effectiveness of the treatment, indicating a decrease of contaminant concentration of 79.1% , 36.9% and 63.0% for PCE, TCE and DCE. (Author) 19 refs.

  12. Polimorfísmos genéticos de COX-1 y eNOS y hemorragias gastrointestinales: interacción con aire: Un estudio de casos y controles

    OpenAIRE

    Salado Valdivieso, María Inés

    2014-01-01

    La hemorragia gastrointestinal alta es un cuadro grave que está producido por medicamentos en un porcentaje elevado de los casos. Ciertos fármacos como los antiinflamatorios no esteroideos (AINE), los antiagregantes plaquetarios o los anticoagulantes orales, pueden dar lugar a una hemorragia que exija la hospitalización del paciente y, en ocasiones, provoque la muerte. Además de los fármacos, se han identificado otros factores que se asocian con la hemorragia gastrointestinal; entre ellos es...

  13. Novos anticoagulantes em cuidados intensivos New anticoagulants in critical care settings

    OpenAIRE

    Uri Adrian Prync Flato; Thais Buhatem; Thalita Merluzzi; Antonio Carlos Mugayar Bianco

    2011-01-01

    Eventos tromboembólicos são complicações comuns em pacientes críticos. Podem apresentar sinais e sintomas pouco específicos e estão associados a um substancial aumento na morbimortalidade dos pacientes internados em unidades de terapia intensiva. Os agentes antitrombóticos são o pilar no tratamento e prevenção do tromboembolismo. Esta classe é também utilizada na prevenção do acidente vascular encefálico, na fibrilação atrial, na prevenção de eventos embólicos da insuficiência cardíaca, em pa...

  14. Rising Skills Premia. You ain't seen nothing yet

    NARCIS (Netherlands)

    Nahuis, R.; de Groot, H.M.

    2003-01-01

    Increases in inequality between low and high-skilled workers are likely to affect welfare state policies in upcoming decades. Demand for redistribution puts pressure on marginal income-tax rates and other social security measures. We come to this conclusion by confronting expected supply and demand

  15. I-WARP: Individual Water mAin Renewal Planner

    Directory of Open Access Journals (Sweden)

    Y. Kleiner

    2010-05-01

    Full Text Available I-WARP is based upon a nonhomogeneous Poisson approach to model breakage rates in individual water mains. The structural deterioration of water mains and their subsequent failure are affected by many factors, both static (e.g., pipe material, pipe size, age (vintage, soil type and dynamic (e.g., climate, cathodic protection, pressure zone changes. I-WARP allows for the consideration of both static and dynamic factors in the statistical analysis of historical breakage patterns. This paper describes the mathematical approach and demonstrates its application with the help of a case study. The research project within which I-WARP was developed, was jointly funded by the National Research Council of Canada (NRC, and the Water Research foundation (formerly known as the American Water Works Association Research Foundation – AwwaRF and supported by water utilities from USA and Canada.

  16. Puti povõshenija effektivnosti proizvodstva / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Kulude kokkuhoid aitab saavutada kõrgemat tootlikkust. Vt. samas: Indeks rosta proizvoditelnosti za period 2000-2007gg., %. Kommenteerivad: Aleksandr Miina, Ants Pak, Kaul Aulasmägi, Veljo Haube ja Kuido Kuntro

  17. New Hollandi uued väledad putukad / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2016-01-01

    New Holland tõi avalikkuse ette kaks uut seeriat. Mõlema mudelivalik esindab praegu põllutraktorite tootmises valitsevat moodi - nutikaid, väledaid ja universaalseid masinaid võimsusvahemikus 100-200 hobujõudu

  18. Natura 2000 sai tuule tiibadesse Raplamaal / Ain Aivela

    Index Scriptorium Estoniae

    Aivela, Ain

    2004-01-01

    Natura 2000 idee jõudis Eestisse 2000. aastal, mil pilootprojekti raames ning Taani riigi rahalisel toel alustati Natura-võrgustiku eelvalikualade mahamärkimist Lääne- ja Raplamaal. Kommenteerinud Aleksei Lotman

  19. Kibuvits üllatab ja pakub leevendust / Ain Raal

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2005-01-01

    Taani teadlased avastasid-eraldasid kibuvitsaseemnetest ja viljakestadest uue põletikuvastase toimeaine galaktolipiidi (GOPO). Seda lipiidi sisaldub kõige enam koer-kibuvitsa alamliigis Hyben Vital Litos. Nüüdseks on GOPO saamisviis ja nimi patenteeritud nii Euroopas kui ka USAs

  20. Terve mõistusega ahnuse vastu / Ain Aaviksoo

    Index Scriptorium Estoniae

    Aaviksoo, Ain, 1974-

    2005-01-01

    Dokumentaalfilm "Ülisuur mina" ("Super Size Me") : režissöör Morgan Spurlock : Ameerika Ühendriigid 2004. Turumajandusest, dieedist ja toitumisest, filmi hoiatavast osast eelkõige teistmelistele ja nende kasvatajatele

  1. Invsteeringutoetuste saajate ring väheneb / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2009-01-01

    Eestimaa talupidajate keskliit ei ole rahul mikropõllumajandusettevõtte arendamise investeeringutoetuse (meede 1.4.1) ja loomakasvatusehitiste investeeringutoetuse (meede 1.4.2) määruses tehtud muudatustega

  2. Advokaadi kutse-eetika reason d’etre / Ain Alvin

    Index Scriptorium Estoniae

    Alvin, Ain, 1959-

    2014-01-01

    Advokaadi kohustus on kutsetegevuses järgida lisaks seadusele kutse-eetika nõudeid, häid kombeid ja südametunnistust. Mida sellised kohustused sisuliselt tähendavad, millest tuleneb vajadus kutse-eetika kutseühendusesisese reguleerimise järele ja milline on kutse-eetika normide sisu?

  3. Aktiivselt majandavad metsi vaid pooled omanikud / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    TNS Emori korraldatud uuringust selgus, et vaid veidi üle poolte metsaomanikest tegeleb süstemaatiliselt oma metsaga ning pea pooled eestimaalased sattuvad metsa keskmiselt kord kuus. Diagramm. Küsimusele vastab Mart Rebane. Vt. samas: Mets on Eestimaa ainus tõeline rikkus; Mari-Liis Eensalu. Metsade olukorda nähakse liialt mustades värvides; Marek Kase. Metsatööstuse roll Eesti majanduses on alahinnatud. Kommenteerivad Enn Pärt ja Elina Kink

  4. Saaremaa taotleb LIFE programmist 50 miljonit krooni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2001-01-01

    Vilsandi Rahvuspark ja Pärandkoosluste Kaitse Ühing esitasid EL Komisjonile LIFE programmi raames projektitaotlused. Ajalehe küsimustele vastab Vilsandi rahvuspargi kaitsekorralduskava spetsialist Enn Kaljo

  5. Geniaalne aines, hämmastav film / Tarmo Teder

    Index Scriptorium Estoniae

    Teder, Tarmo, 1958-

    2006-01-01

    Oktoobri algul Kuressaares peetud Saaremaalt pärit ameerika arhitekti Louis Kahni konverentsi raames Kuressaare Linnateatris näidatud dokumentaalfilmist "Minu arhitekt" ("My Architect") : režissöör Nathaniel Kahn : Ameerika Ühendriigid 2003

  6. Poliitiline areng / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  7. Political development / Vello Pettai, Daunis Auers, Aine Ramonaite

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2011-01-01

    Ülevaade demokraatlikust arengust Baltimaades - valitsuste stabiilsus, parlamendi usaldatavus, valimised, erakonnad, kodanikuühiskonna areng, poliitika läbipaistvus, huvi poliitika vastu ühiskonnas. Tabelid, joonised

  8. Eestis käis ilmataadi maapealne asemik / Ain Kallis

    Index Scriptorium Estoniae

    Kallis, Ain, 1942-

    2005-01-01

    Tänavu täitub 200 aastat pidevate instrumentaalsete ilmamõõtmiste algusest Eestis. Keskkonnaminister Villu Reiljan ja Euroopa Keskpika Ilmaennustuse Keskuse (European Centre for Medium-Range Weather Forecasts, ECMWF) direktor Dominique Marbouty kirjutasid alla koostöölepingule

  9. Bassilaulja Ain Anger lummas Viini publiku / Talvi Nurgamaa

    Index Scriptorium Estoniae

    Nurgamaa, Talvi

    2008-01-01

    1. aprillil Musikvereini klaassaalis Viinis toimunud laulja soolokontserdist sarjast "Lied. Bühne", klaveril Jendrik Springer. Samal ajal kudses saalis toimunud Tonkünstler Orchester kontserdist, dirigent Kristjan Järvi

  10. I-WARP: Individual Water mAin Renewal Planner

    OpenAIRE

    Y. Kleiner; B. Rajani

    2010-01-01

    I-WARP is based upon a nonhomogeneous Poisson approach to model breakage rates in individual water mains. The structural deterioration of water mains and their subsequent failure are affected by many factors, both static (e.g., pipe material, pipe size, age (vintage), soil type) and dynamic (e.g., climate, cathodic protection, pressure zone changes). I-WARP allows for the consideration of both static and dynamic factors in the statistical analysis of historical breakage patterns. This paper d...

  11. Tuuleenergia kasutamisvõimalused Eestis / Ain Kull, Valdur Tiit

    Index Scriptorium Estoniae

    Kull, Ain, 1973-

    2005-01-01

    Autorite hinnangul on seni Eestis ulatuslik tuulejõu kasutamine raskendatud nii finantsprobleemide, kodumaise tootmise puudumise, rannikupiirkondade elektriliinide väikese võimsuse kui ka Narva põlevkivijaamade alakoormatuse tõttu. Tabel

  12. Offline Prints via DIALMAIL: They Ain't Necessarily Cheap.

    Science.gov (United States)

    Durfee, Linda J.

    When DIALOG introduced DIALMAIL, its electronic mail service, online searchers were encouraged to use it as an alternative delivery method for offline prints. The new method of retrieval was considered to be fast and described in documentation and reviews as being much less expensive than online types. Performed in June 1987, this study compares…

  13. The cytometric future: it ain't necessarily flow!

    Science.gov (United States)

    Shapiro, Howard M

    2011-01-01

    Initial approaches to cytometry for classifying and characterizing cells were based on microscopy; it was necessary to collect relatively high-resolution images of cells because only a few specific reagents usable for cell identification were available. Although flow cytometry, now the dominant cytometric technology, typically utilizes lenses similar to microscope lenses for light collection, improved, more quantitative reagents allow the necessary information to be acquired in the form of whole-cell measurements of the intensities of light transmission, scattering, and/or fluorescence.Much of the cost and complexity of both automated microscopes and flow cytometers arises from the necessity for them to measure one cell at a time. Recent developments in digital camera technology now offer an alternative in which one or more low-magnification, low-resolution images are made of a wide field containing many cells, using inexpensive light-emitting diodes (LEDs) for illumination. Minimalist widefield imaging cytometers can provide a smaller, less complex, and substantially less expensive alternative to flow cytometry, critical in systems intended for in resource-poor areas. Minimalism is, likewise, a good philosophy in developing instrumentation and methodology for both clinical and large-scale research use; it simplifies quality assurance and compliance with regulatory requirements, as well as reduces capital outlays, material costs, and personnel training requirements. Also, importantly, it yields "greener" technology. PMID:21116998

  14. Rootslased tahavad kanepikasvatuseks Saaremaalt maad osta / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    Saaremaal viibis projekti Industri Hampe Gotland juht Tomas Persson, kes otsis kanepikasvatuseks sobilikke põllumaid ja lõi sidemeid ettevõtetega, kus on võimalik kanepit kasutada. Perssoni külaskäik on jätkuks Kuressaares toimunud seminarile "Tööstuslik kanep - Saaremaa jätkusuutliku arengu märksõna"

  15. E-Piim ja nutikas laut / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2014-01-01

    Piimandusühistu E-Piim juhatuse esimees Jaanus Murakas ühistu loomisest, arengust, eurotoetuste vajalikkusest põllumajandusele, vajadusest arendada Eesti piimandussektorit. Piimandusühistusse kuuluvast agrofirmast Orgita Põld, Haimre lüpsifarmist

  16. Kevadelaul : [luuletused] / Federico Garcia Lorca ; tlk. Ain Kaalep

    Index Scriptorium Estoniae

    García Lorca, Federico, 1898-1936

    2006-01-01

    Sisu: Kevadelaul ; Uued laulud ; Unenägu ; Uus süda ; Rõske siseõu ; Risttee : "Oh valu: mu värsid võtnud..." ; Ballaad mereveest ; Huile ; Vaikus ; Risttee : "Tuul puhub läänest..." ; Sevilla ; Kuus keelt ; Memento ; Kolm linna : Malaguena ; Cordoba agul ; Tants ; Kitarrimõistatus ; Poolkuu ; Neli kollast ballaadi ; Aadam ; Tasakaal ; Friis ; Maha raiuti kolm puud ; Teokarp ; Rumal laul ; Õhtu ; Ratsaniku laul ; Debussy ; Kuu tõuseb ; Kaks õhtust kuud ; Serenaad ; Laul lahkuvast päevast ; Kuuba neegrilaul ; Itk Ignacio Sanchez Mejiase surma puhul ; Madrigal Santiago linnale ; Hällilaul surnud Rosalia Castrole ; Kuu tants Santiagos ; Gaseel kohutavast lähedusest ; Gaseel tumedast surmast ; Gaseel põgenemisest ; Gaseel saja-aastasest armastusest ; Kassiida okstest ; Kassiida selili lebavast naisest ; Kassiida unenäost vabas õhus ; Kassiida tumedaist tuvidest ; Vee süit ; Herbaariumid ; Omega ; Ood Salvador Dalile ; "Ma kardan, kas su imet ma ei kaota..." . Eluloolisi andmeid autori kohta lk. 879

  17. Urve Paaver kaitses teadusmagistri väitekirja / Ain Raal

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2006-01-01

    18. aprillil kaitses Tartu Ülikoolis magistritööd orgaanilise keemia alal Tartu Ülikooli farmaatsia instituudi assistent Urve Paaver. Magistritöö teemaks oli "Eestis kasvava nõmm-liivatee eeterliku õli keemilise koostise analüüs ja droogi (Serpylli herba) vastavus Euroopa farmakopöa nõuetele"

  18. Quantum non-locality - It ain't necessarily so...

    CERN Document Server

    Zukowski, Marek

    2015-01-01

    Bell's theorem is 50 years old. Still there is a controversy about its implications. Much of it has its roots in confusion regarding the premises from which the theorem can be derived. Some claim that a derivation of Bell's inequalities requires just locality assumption, and nothing more. Violations of the inequalities are then interpreted as ``nonlocality'' or ``quantum nonlocality''. We show that such claims are unfounded and that every derivation of Bell's inequalities requires a premise -- in addition to locality and freedom of choice -- which is either assumed tacitly, or unconsciously, or is embedded in a single compound condition (like Bell's ``local causality''). The premise is equivalent to the assumption of existence of additional variables which do not appear in the quantum formalism (in form of determinism, or joint probability for outcomes of all conceivable measurements, or ``additional causes`'', or ``hidden variables'', ``complete description of the state'' or counterfactual definiteness, etc....

  19. AIN-Based Action Selection Mechanism for Soccer Robot Systems

    OpenAIRE

    Yin-Tien Wang; Zhi-Jun You; Chia-Hsing Chen

    2009-01-01

    Role and action selections are two major procedures of the game strategy for multiple robots playing the soccer game. In role-select procedure, a formation is planned for the soccer team, and a role is assigned to each individual robot. In action-select procedure, each robot executes an action provided by an action selection mechanism to fulfill its role playing. The role-select procedure was often designed efficiently by using the geometry approach. However, the action-select procedure devel...

  20. Lubatakse raha, higi ja hambaravi / Maris Jesse, Ain Aaviksoo

    Index Scriptorium Estoniae

    Jesse, Maris

    2007-01-01

    Ilmunud ka: Infopress 2. märts nr. 9 lk. 161. Autorid analüüsivad erakondade valimislubadusi tervishoiu valdkonnas. Nad jõuavad seisukohale, et kuna ükski partei terviknägemust ei paku, sõltub tervishoiu tulevik ennekõike ametnike tarkusest, tulevase sotsiaalministri poliitilisest kogemusest ja valitsusenamuse otsustustahtest

  1. 18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz, Secrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

    CERN Multimedia

    Anna Pantelia

    2013-01-01

    18 octobre 2013 - Le Préfet de l’Ain L. Touvet signe le livre d'or avec le Directeur général du CERN R. Heuer et le Chef du Département Technologie F. Bordry. Photo de groupe, de gauche à droite: T. Kupisz,\tSecrétaire général de la sous préfecture de Gex; L. Miralles, Chef du Département Infrastructure et services généraux; F. Eder, Délégué aux Relations avec les Etats hôtes; S. Donnot, Sous-préfet de Gex; L. Touvet, Préfet de l'Ain; E. Sches, Sous-préfète de Nantua; E.Gröniger-Voss, Conseiller juridique du CERN; R. Heuer, Directeur général; F. Bordry, Chef du Département Technologie et P. Bloch, Chef du Département Physique.

  2. Exclusión y Violencia disolvente en México. La reconstrucción populista de la Nación

    Directory of Open Access Journals (Sweden)

    Julio Aibar

    2012-01-01

    Full Text Available Se ha impuesto en México, en las últimas dos décadas, un sentido común neoliberal que apuesta al Estado débil. Sin embargo la tradición de la revolución mexicana era otra, y también la historia latinoamericana muestra que los Estados han sido más fuertes que las naciones (J. Aricó. De tal modo es imprescindible retomar estas tradiciones para superar la actual postración de México, donde la violencia imperante y la desesperanza en lo económico establecen un panorama lamentable, que algunos pretenden explicar apelando al falso argumento de que "las reformas liberales iniciadas han sido insuficientes".

  3. Estabilidad física de vehículos disolventes. parte iii. sistema agua – propilenoglicol – jarabe

    OpenAIRE

    Pérez, Sergio; Useche, José Manuel; Barbosa, Helber; Martinez, Fleming

    2009-01-01

    En este trabajo se reporta la variación de peso experimentada por mezclas representativas, de composición definida del sistema ternario: Agua Purificada – Propilenoglicol USP – Jarabe USP, en ambientes de Humedad Relativa (HR) controlada del 51.8% y 86.4% a 17.9 °C, determinados en cámara cerrada y en cámara abierta al ambiente. Se encontró mayor aumento de peso en los sistemas sometidos a HR del 86.4% en cámara cerrada, principalmente en mezclas con alta proporción de Propilenoglicol. En...

  4. Hematoma subdural de medula espinhal associada ao uso de anticoagulante oral Hematoma subdural de la médula espinal asociado al uso de anticoagulante oral Spine subdural hematoma: a rare complication associated with vitamin K antagonist (VKA

    Directory of Open Access Journals (Sweden)

    Uri Adrian Prync Flato

    2009-01-01

    Full Text Available O hematoma subdural de medula espinhal (HSDME é uma complicação rara decorrente do uso de antagonistas de vitamina K (AVK e de diagnostico difícil. Este artigo apresenta um caso com complicação ameaçadora à vida: um paciente octogenário portador de fibrilação atrial de início recente em uso de AVK. A história e o exame físico inicialmente se apresentavam normais, associados com a elevação dos valores de coagulograma supraterapêuticos (INR > 10. Após 24 horas da admissão hospitalar, o paciente apresentou tetraparesia progressiva, evidenciando na ressonância nuclear magnética (RNM de medula espinhal um HSDME (Figura 1. Após reversão completa da hipocoagulação e intervenção neurocirúrgica o paciente obteve melhora do quadro neurológico.El hematoma subdural espinal (HSE es una complicación rara proveniente del uso de antagonistas de vitamina K (AVK y de diagnostico difícil. Este artículo presenta un caso con complicación amenazadora para la vida: un paciente octogenario portador de fibrilación auricular de inicio reciente, en uso de AVK. Inicialmente, la historia y el examen físico se presentaban normales, asociados a la elevación de los valores de coagulograma supra terapéuticos (INR > 10. Tras 24 horas del ingreso hospitalario, el paciente presentó tetraparesia progresiva. Al realizarse una resonancia nuclear magnética (RNM de médula espinal, se evidenció un HSE (Figura 1. Tras reversión completa de la hipocoagulación e intervención neuroquirúrgica el paciente obtuvo mejora del cuadro neurológico.Spinal subdural hematoma (SSDH is a rare condition, which is difficult to diagnose, related to Vitamin K Antagonist. This a case report of a life-threatening situation in a octogenarian patient with a history of recent atrial fibrillation that received K-Vitamin Antagonist (KVA therapy. The history and the clinical assessment were normal at the admission, associated with increase in the coagulation parameters (INR >10. Twenty-four hours after the admission, the patient developed progressive tetraparesis and a Magnetic Resonance Imaging (MRI was performed, disclosing the evidence of a SSDH (Figure 1. An emergency neurosurgical intervention was performed associated with normalization of the coagulation parameters. After the procedure, the patient presented improvement of the neurological symptoms.

  5. International Normalized Ratio, a Useful Tool in Oral Anticoagulant Therapy Coeficiente internacional normalizado, útil herramienta en la terapia anticoagulante oral

    OpenAIRE

    Dinorah Herenia Mulet Batista; Carlos Ramírez Pérez; Gladis Abreu Sera; Juan Pérez Mir; Jesús Alberto Pérez González

    2012-01-01

    The international normalized ratio (INR) is the primary tool for assessing patients undergoing oral anticoagulant therapy. It was created from the need of standardizing the different types of thromboplastins, regardless of their origin, from which the figures of the true anticoagulation state desired by the physician depend, mainly in patients at risk of thromboembolic events. The objective of this work is to show the simple technique of determining this ratio so that it can be extended to an...

  6. Complicaciones del tratamiento con anticoagulantes orales en mayores de 65 años, a propósito de un caso

    Directory of Open Access Journals (Sweden)

    María de las Nieves Perejón Díaz

    2014-08-01

    Full Text Available Descripción del caso: Mujer de 79 años con antecedentes de hipertensión arterial, fibrilación auricular (FA permanente anticoagulada (acenocumarol e insuficiencia mitral. Barthel 90, Lowton-Brody: 2. Acude a urgencias por dolor costal (osteomuscular de dos semanas de evolución, sin otros síntomas, siendo dada de alta y acudiendo nuevamente por epistaxis y disnea. Exploración y pruebas complementarias: destacar en la auscultación cardio-pulmonar: tonos arrítmicos con soplo sistólico en reborde esternal izquierdo, crepitantes hasta campos medios, con murmullo vesicular disminuido. Radiografía de tórax: masa hiliar derecha con engrosamiento pleural derecho, e infiltrado bilateral. Hemograma: hemoglobina 7.9 g/dl (previa 11.6 g/dl, leucocitos 11.57x10l. Bioquímica: PCR 72.90mg/l, urea 85 mg/l. Coagulación: INR indeterminado, actividad protrombina 4 aumenta el riesgo de sangrado. Se trata de un paciente pluripatológico, dependiente moderada, con mal cumplimiento tratamiento y de control de anticoagulación. Ante estos datos (anemización, ausencia de signos de infección o insuficiencia cardiaca, y los resultados de las pruebas, nos decantamos por la hemorragia alveolar como primera posibilidad diagnostica.

  7. MÉTODO PARA EL GENOTIPADO DE POLIMORFISMO DE ÚNICO NUCLEÓTIDO RELACIONADOS CON LA ADMINISTRACIÓN DEL FÁRMACO ANTICOAGULANTE WARFARINA

    OpenAIRE

    LEÓN SALA, TERESA

    2015-01-01

    [EN] Oral anticoagulants are chronically taken by 1% and 2% of the population of the developed world. The most important is the warfarin (4-hydroxy-3-(3-oxo-1-phenylbutyl)-coumarin) because their effectiveness for thromboembolic prophylaxis in atrial fibrillation has been clinically demonstrated. However, warfarin is a drug with a wide interindividual variability and a narrow therapeutic index. Genetic markers have been proposed as stratification tools to predict therapeutic effects in patien...

  8. Avaliação do potencial anticoagulante e antitrombótico de polissacarídeos nativos e quimicamente sulfatados de basidiomicetos

    OpenAIRE

    Gracher, Ana Helena Pereira

    2011-01-01

    Resumo: A heparina e um importante agente terapeutico para tratamento e profilaxia da trombose. No entanto, sua fonte e limitada e alguns problemas sao associados ao seu uso, tais como hemorragias e trombocitopenia induzida por heparina. Modificacoes quimicas de polissacarideos, como a sulfatacao, tem atraido interesse, pois aumentam a semelhanca estrutural com a heparina. Na busca de alternativas a heparina, tres polissacarideos isolados de basidiomicetos e previamente caracterizados, foram ...

  9. Cardiopatía, embarazo y tratamiento anticoagulante Anticoagulant therapy in pregnant women with mechanical valve prosthesis and/or heart diseases

    OpenAIRE

    Sandra Braun J

    1999-01-01

    Pregnancy is a hypercoagulable state. Some women with cardiac disease and mechanical valve prosthesis are at increased risk of arterial thromboembolic phenomena. These women are maintained on oral anticoagulants and require effective permanent prophylaxis during pregnancy. The use of oral anticoagulants during pregnancy is controversial because of the risks of embriopathy (Chondrodysplasia punctata) in fetuses who are exposed to coumarin between the 6th and 9th week of gestation, the risk of ...

  10. Estudio de mezclas de disolventes orgánicos y triglicéridos de aceite de linaza o los ácidos grasos libres. I.- Volumen molar, refracción molar y viscosidad dinámica

    Directory of Open Access Journals (Sweden)

    Mantell Serrano, C.

    1995-06-01

    Full Text Available Measurements of molar volume, refraction index and dynamic viscosity in mixtures of fatty acids or triglycerides and trichloroethylene, tetrachloroethylene and hexane were realized. Temperature range studied was 278-313 K each 5 K. The relationship between molar volume and molar fraction show high correlation coefficient In fatty acids with trichloroethylene and tetrachloroethylene mixtures. On the other hand, hexane mixtures show little contractions of molar volume at low molar fractions. Triglyceride mixtures present important deviations with regard to the ideality of the molar volume. The adjusts obtained for the molar volume values versus temperature are acceptable, calculating the coefficients of thermal expansion of the studied mixtures. Equally, the adjust of the experimental results of viscosity for two prediction equations are studied: one of additive type and the other of parabolic type.

    Se han realizado medidas del volumen molar, índice de refracción y viscosidad dinámica en el intervalo de temperatura de 278 K a 313 K cada 5 K, a mezclas de ácidos grasos o triglicéridos con tricloroetileno, tetracloroetileno y hexano. Las mezclas de ácidos grasos con tricloroetileno y tetracloroetileno, presentan unos altos coeficientes de correlación para los valores del volumen molar frente a la fracción molar, mientras que las mezclas con hexano, a fracciones molares bajas, manifiestan una pequeña contracción del volumen molar. Las mezclas de triglicéridos presentan importantes desviaciones con respecto a la Idealidad del volumen molar. Los ajustes obtenidos para los valores del volumen molar frente a la temperatura son aceptables, determinándose los valores del coeficiente de dilatación volumétrica a presión constante de las mezclas estudiadas. Igualmente se ha estudiado el ajuste de los resultados experimentales de viscosidad a dos ecuaciones de predicción: una del tipo aditiva y otra del tipo parabólico.

  11. Biocatálisis en disolventes neotéricos : nuevos desarrollos de la química verde para la producción de biodiesel y aromas

    OpenAIRE

    Bernal Palazón, Juan María

    2014-01-01

    Objetivos El objetivo global de esta Tesis Doctoral fue el diseño de nuevos protocolos operacionales integrados de reacción/separación que permitieran la síntesis y purificación directa de productos de alto valor añadido, mediante el empleo de tecnologías limpias y sostenibles. Para ello, se ensayaron por primera vez ILs hidrofóbicos con sustituyentes alquílicos de larga longitud de cadena, sólidos a temperatura ambiente pero con temperaturas de fusión inferiores a 100ºC y que presentaron ...

  12. Propiedades catalíticas de la lipasa B de Candida antarctica inmovilizada en soportes magnéticos. Actividad sintética en disolventes orgánicos

    OpenAIRE

    Quesada Ganuza, Ane

    2014-01-01

    Este trabajo se centra en la inmovilización de la lipasa B de Candida antarctica en nanopartículas magnéticas y la posterior caracterización cinética de su actividad sintética en medios orgánicos para la pr oducción de biodiesel. La historia del biodiesel comienza en 1893, cuando Rudolph Diesel, el padre del motor diésel, puso en marcha el primer motor de este tipo. Más tarde, en 1900, Diesel ganó el Grand Prix en la Feria Mundial de París con su m otor impuls...

  13. Solvent. I. Extraction systems applied to uranium analysis. I. Extraction studies with Tributyl phosphate-Methyl-isobutyl-ketone; Metodos de extraccion don disolventes aplicados al analisis quimico del uranio. I. Estudio de la extraccion con fosfato de tributilo-metilisobutilcetano

    Energy Technology Data Exchange (ETDEWEB)

    Vera Palomino, J.; Palomares Delgado, F.; Petrement Eguiluz, J. C.

    1964-07-01

    A factorial study of the selective extraction of uranium with a mixture of TBP-MIC was carried out using 0,8 N nitric acid and different salting agents. We use the most suitable salting agent to develop new factorial experiments in order to get an equation involving the percent of extracted uranium, E, the concentration of the extraction agent in the organic phase, c, and the concentration of the slating agent in the aqueous phase, n. (Author) 3 refs.

  14. Reactividad química de 1,3-bis-(2'-hidroxi-5'-clorobencil) imidazolidina (BISBIA) frente a fenoles y naftoles en condiciones libre de disolvente (Solvent – Free)

    OpenAIRE

    Fals Guerra, Jayson

    2012-01-01

    En este trabajo se hizo reaccionar 1,3-bis-(2'-hidroxi-5'-clorobencil)imidazolidina con naftoles (1-naftol y 2-naftol) y fenoles (4-cloro-3,5-xilenol y fenol) bajo condiciones solvent-free para evaluar el efecto del sustituyente en el anillo aromático, el cual aumenta la fuerza de los puentes de hidrógeno intramoleculares y en consecuencia la electrofilia de los metilenos bencílicos y aminálico. A diferencia de otras estructuras similares estudiadas en el grupo de investigac...

  15. Suomenhevosten T-jalostussuunnan kantakirja-aines vuosina 1994-2014

    OpenAIRE

    Iso-Markku, Katri

    2016-01-01

    Toimeksiantajana työlle oli Suomen Hippos. Työhevosten jalostusohjesään-tö muuttui vuoden 2015 lopulla, joten työn toimeksiannon ajatuksena oli saada työstä jonkinlaisia uusia näkökulmia jalostusohjeäännön kannalta, sekä saada tietää millaista ainesta työhevoskantakirjaan on kirjattu kah-denkymmenen vuoden aikana. Työn tavoitteena oli tutkia vuosina 1994-2014 kantakirjattuja suomentyö-hevosia. Minkälaista materiaalia T-suunnalle on kantakirjattu, mistä suvuis-ta nämä kantakirjatut hevoset...

  16. Tõnu Virve: filmi aines puudutas mu enda mälestusi / Tõnu Virve ; intervjueerinud Andres Laasik

    Index Scriptorium Estoniae

    Virve, Tõnu, 1946-

    2009-01-01

    Intervjuu 22. septembril Kumu auditooriumis esilinastunud dokumentaalfilmi "Monument" (Freyja Film, 2009) režissööri Tõnu Virvega. Kesksel kohal on filmis Tallinna Tõnismäe monument (skulptor Enn Roos, arhitekt Arnold Alas)

  17. Paleostress reconstructions of Jabal Hafit structures, Southeast of Al Ain City, United Arab Emirates (UAE)

    Science.gov (United States)

    Zaineldeen, Usama F.

    2011-02-01

    This paper presents the first paleostress results obtained from displacement and fracture systems within the Lower Eocene sediments at Jabal Hafit, Abu Dhabi Emirate, UAE. Detailed investigation of Paleogene structures at Jabal Hafit reveal the existence of both extensional structures (normal faults) and compressional structures (strike-slip and reverse faults). Structural analysis and paleostress reconstructions show that the Paleogene kinematic history is characterized by the succession of four paleostress stages. Orientation of principal stresses was found from fault-slip data using an improved right-dihedra method, followed by rotational optimisation (TENSOR program). The paleostress results confirm four transtensional tectonic stages (T1-T4) which affected the study area. The first tectonic stage (T1) is characterized by SHmax NW-SE σ2-orientation. This stage produced NW-SE striking joints (tension veins) and E-W to ENE-WSW striking dextral strike-slip faults. The proposed age of this stage is Early Eocene. The second stage (T2) had SHmax N-S σ2-orientation. N-S striking joints and NNE-SSW striking sinistral strike-slip faults, E-W striking reverse faults and N-S striking normal faults were created during this stage. The T2 stage is interpreted to be post-Early Eocene in age. The third stage (T3) is characterized by SHmax E-W σ2-orientation. This stage reactivated the E-W reverse faults as sinistral strike-slip faults and created E-W striking joints and NE-SW reverse faults. The proposed age for T3 is post-Middle Eocene. During the T3 ( SHmax E-W σ2-orientation) stage the NNW-plunging Hafit anticline was formed. The last tectonic stage that affected the study area (T4) is characterized by SHmax NE-SW σ2-orientation. During this stage, the ENE-WSW faults were reactivated as sinistral strike-slip and reverse faults. NE-SW oriented joints were also created during the T4 ( SHmax NE-SW σ2-orientation) stage. The interpreted age of this stage is post-Middle Miocene time but younger than T3 ( SHmax E-W σ2-orientation) stage.

  18. ... ain pild erheben, als das zu perln gehoret... - Relief- und Perlstickerei des Spätmittelalters

    Czech Academy of Sciences Publication Activity Database

    Wetter, Evelin

    -, č. 70 (2014), s. 112-125. ISSN 0231-5793 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : textile works of art from the treasuries * liturgical robes * embroidery * serial production * made-to-order production Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. Super-piimatööstus lööks konkurente mahuga / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2014-01-01

    Kui viis eesti suuremat piimatööstust suudavad igaüks töödelda päevas maksimaalselt 300 tonni piima, kokku seega 1500 tonni, siis ökonoomsemalt aitaks majandada üks suur n-ö supertööstus, käideldes päevas tuhat ja rohkemgi tonni toorpiima

  20. Applying of whole-tree harvesting method; Kokopuujuontomenetelmaen soveltaminen aines- ja energiapuun hankintaan

    Energy Technology Data Exchange (ETDEWEB)

    Vesisenaho, T. [VTT Energy, Jyvaeskylae (Finland); Liukkonen, S. [VTT Manufacturing Technology, Espoo (Finland)

    1997-12-01

    The objective of this project is to apply whole-tree harvesting method to Finnish timber harvesting conditions in order to lower the harvesting costs of energy wood and timber in spruce-dominant final cuttings. In Finnish conditions timber harvesting is normally based on the log-length method. Because of small landings and the high level of thinning cuttings, whole-tree skidding methods cannot be utilised extensively. The share of stands which could be harvested with whole-tree skidding method showed up to be about 10 % of the total harvesting amount of 50 mill. m{sup 3}. The corresponding harvesting potential of energy wood is 0,25 Mtoe. The aim of the structural measurements made in this project was to get information about the effect of different hauling methods into the structural response of the tractor, and thus reveal the possible special requirements that the new whole-tree skidding places forest tractor design. Altogether 7 strain gauge based sensors were mounted into the rear frame structures and drive shafts of the forest tractor. Five strain gauges measured local strains in some critical details and two sensors measured the torque moments of the front and rear bogie drive shafts. Also the revolution speed of the rear drive shaft was recorded. Signal time histories, maximum peaks, Time at Level distributions and Rainflow distributions were gathered in different hauling modes. From these, maximum values, average stress levels and fatigue life estimates were calculated for each mode, and a comparison of the different methods from the structural point of view was performed

  1. Füüsikud maailma päästmas / Ain Ainsaar

    Index Scriptorium Estoniae

    Ainsaar, Ain

    2003-01-01

    9.-11. oktoobrini Tallinna Pedagoogikaülikoolis aset leidnud rahvusvahelisest seminarist "Tiheda plasma ja materjalide interaktsioon", kus käsitleti termotuumareaktorite mudelite ehitamisel ette tulnud tehnilisi raskusi

  2. Saaremaa rannaala võib suureneda 200 meetrilt riigiteeni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2003-01-01

    Aasta lõpuks valmiva Saare maakonna rannaalade tsoneeringu ülesandeks on koostada rannaalade andmebaas, hinnata mõju keskkonnale, töötada välja metoodika rannaalade planeerimiseks. Tsoneering hõlmab asustust, kuhu jääb neli alevikku ja 248 küla 10 235 elanikuga

  3. Ühispanga juht : eestlased ainult ärplevad Venemaaga / Ain Hanschmidt ; interv. Erkki Erilaid

    Index Scriptorium Estoniae

    Hanschmidt, Ain, 1961-

    2004-01-01

    Ilmunud ka: Sakala, 29. apr. 2004, lk. 7; Infopress, 7. mai, nr. 19, 2004, lk. 131. Ühispanga juht vastab küsimustele, mis puudutavad Eesti EL-iga liitumise mõju majandusele, Venemaa ekspordilt topelttollide kadumist, eestlaste ettevaatlikkust Venemaale investeerimisel, venelaste suhtumise muutumist eestlastesse, kasvava konkurentsi mõju Eesti teenusteturule

  4. HPV infection, anal intra-epithelial neoplasia (AIN) and anal cancer: current issues

    OpenAIRE

    Stanley Margaret A; Winder David M; Sterling Jane C; Goon Peter KC

    2012-01-01

    Abstract Background Human papillomavirus (HPV) is well known as the major etiological agent for ano-genital cancer. In contrast to cervical cancer, anal cancer is uncommon, but is increasing steadily in the community over the last few decades. However, it has undergone an exponential rise in the men who have sex with men (MSM) and HIV + groups. HIV + MSM in particular, have anal cancer incidences about three times that of the highest worldwide reported cervical cancer incidences. Discussion T...

  5. Eesti ei maksa Natura aladel toetust 7800 krooni hektari kohta / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    EL 2007-2013 eelarve eelnõu kohaselt võib Natura 2000 aladel tegutsevatele põllumajandustootjatele maksta põllumajanduskõlviku hektari kohta igal aastal kuni 7800 krooni. Põllumajandusministeeriumi spetsialistid ei pea nii suurte toetuste maksmist võimalikuks

  6. Rannakalanduse tulevik sõltub varust / Ain Soome ; interv. Agnes Jürgens

    Index Scriptorium Estoniae

    Soome, Ain

    2008-01-01

    Kalapüügiseaduse muudatustest. Lisatud: kalastajad. Ilmunud ka Hiiu Leht 2. mai 2008, lk. 4 ; Oma Saar 6. mai 2008, lk. 4 ; Vooremaa 13. mai 2008, lk. 2 ; Lääne Elu 20. mai 2008, lk. 4, lisatud: taustainfo ; Harju Elu 3. juuni 2008, lk. 2 ; Peipsi Rannik = Tshudskoje Poberezhje mai 2008, lk.4, lisatud: taustinfo

  7. High sensitivity biosensors based on shear mode AIN resonators for in liquid operation

    OpenAIRE

    Miguel Ramos, Mario de

    2015-01-01

    El diagnóstico y detección temprana de enfermedades son clave para reducir la tasa de mortalidad, las hospitalizaciones de larga duración y el desaprovechamiento de recursos. En los últimos años se ha impulsado, mediante un aumento de la financiación, el desarrollo de nuevos biosensores de bajo coste capaces de detectar y cuantificar cantidades muy pequeñas de especies biológicas de una forma barata y sencilla. El trabajo presentado en esta Tesis Doctoral describe la investigación llevada a c...

  8. prevalence of hepatitis B and C viruses among health care workers in Ain Shams university hospitals

    International Nuclear Information System (INIS)

    exposure to blood borne pathogens poses a serious risk to health care workers (HCW), since the transmission of viral hepatitis B and C to health care workers has became of worldwide concern. hepatitis B and C viruses are the most frequent occupational disease in health care service workers, HCW are defined as persons (doctors, nurses, employees, students, contractors, attending clinicians, public-safety workers, or volunteers) whose activities involve contact with patients or with blood or other body fluids from patients in a health - care, laboratory, or public-safety setting . the potential exists for blood and body fluid exposure to other workers, and the same principle of exposure management could be applied to other setting.in the united states, the prevalence of HBV and HCV among HCWs range between (6-30%) and (2.7-10%) respectively . in spain HBV prevalence is 11.6% and HCV is 28.8%. while in taiwan 16.7% of HCWs were seropositive to HBsAG and 12.7% were seropositive for HCV. In Egypt, screening of 1485 HCWs in the Ministry of health hospitals, 35% were exposed to needle sticks

  9. Saaremaa sadamate majanduslik-regionaalpoliitiline tähtsus ja arenguperspektiivid / Taavo Asuja, Ain Eidast

    Index Scriptorium Estoniae

    Asuja, Taavo

    2005-01-01

    Et puudub selgus püsiühenduse rajamise ning selle tegevuse suhtes, on raskendatud sadamate arengu pikaajaline prognoosimine ja suunamine. Autorite hinnangul oleks vaja koostada Saaremaa sadamate arengu kontseptsioon. Tabelid. Diagrammid

  10. Uus ulukite käitlemiskeskus edendab Eesti jahimajandust / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2005-01-01

    Pärnumaal avati Kilingi-Nõmme jahimajandi ulukite töötlemiskeskus. Kommenteerib Ülo Viilup. Vt. samas: RMK arendab jahimajandust ja turismi; RMK teenis poole aastaga riigile üle 670 miljoni krooni

  11. Summertime, and the Choosin' Ain't Easy: An Ice Cream Counting Problem.

    Science.gov (United States)

    Kreith, Kurt

    1992-01-01

    Utilizes the problem of determining the number of different ice cream cones and cups that can be made from a choice of 31 flavors to investigate the concepts of combinations and permutations. Provides a set of six related problems with their answers. (MDH)

  12. Ühiskondliku Leppe Sihtasutus tahab GMO üle otsustamise anda elanikele / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2005-01-01

    Ühiskondliku Leppe Sihtasutus peab mõttekaks ühineda üle-euroopalise algatusega muuta EL seadusandlust selliselt, et GMO-vabade piirkondade kehtestamiseks õigus jääb maaomanike ja ametnike asemel elanikele

  13. Ester Tuiksoo : Saksamaa on Eestile biomassi ja GMO vallas eeskujuks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Põllumajandusminister Ester Tuiksoo ja abiminister Rain Vändre kohtusid Kielis Schleswig-Holsteini liidumaa ministri dr. Christian von Boetticheriga, peateemadeks abi biomassi ja geneetiliselt muundatud kultuurtaimede kooseksisteerimise vallas

  14. Preliminary investigations of the southeastern section of the settlement site of Lehmja / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain, 1951-

    2007-01-01

    Seoses Tallinn-Tartu maantee rekonstrueerimisega toimusid 1985.-1986. aastal Lehmja asula lõunapoolsel alal mahukad päästekaevamised. Selgus, et tegemist on I aastatuhandest pärit asulakohaga, milliseid teatakse Eestis vähe. 2006. aasta kaevamismetoodikast ja uurimistulemustest

  15. Trial excavations of the northern part of the Lehmja settlement site / Ain Lavi

    Index Scriptorium Estoniae

    Lavi, Ain

    2004-01-01

    Hilisrauaajal on pinnaveetaseme tõus sundinud Lehmja asukaid ümber asuma Tuuleveskimäe lõuna- ja edelajalamile. 2003. aasta kaevamiste põhjal näib, et Tuuleveskimäe edelanõlvale tekkis asustus keskajal

  16. Effects of heat treatment on the properties of powder injection molded AIN ceramics

    Institute of Scientific and Technical Information of China (English)

    DU Xueli; QIN Mingli; Akhtar Farid; FENG Peizhong; QU Xuanhui

    2008-01-01

    The effects of two different heat-treatment atmospheres,nitrogen atmosphere and reducing nitrogen atmosphere with carbon,on the properties of Y2O3-doped aluminum nitride (AlN) ceramics were investigated.The AlN powder as a raw material was synthesized by self-propagating high-temperature synthesis (SHS) and compacts were fabricated by employing powder injection molding technique.The polymer-wax binder consisted of 60 wt.% paraffin wax (PW),35 wt.% polypropylene (PP),and 5 wt.% stearic acid (SA).After the removal of binder,specimens were sintered at 1850℃ in nitrogen atmosphere under atmospheric pressure.To improve the thermal conductivity,sintered samples were reheated.The result reveals that the heat-treatment atmosphere has significant effect on the properties and secondary phase of AlN ceramics.The thermal conductivity and density of AlN ceramics reheated in nitrogen gas are 180 W·m-1 K-1 and 3.28 g,cm-3 and the secondary phase is yttrium aluminate.For the sample reheated in reducing nitrogen atmosphere with carbon,the thermal conductivity and density are 173 W.m-1.K-1 and 3.23 g·cm-3,respectively,and the secondary phase is YN.

  17. Katrin Pudersell kaitses farmaatsiadoktori väitekirja / Ain Raal, Elmar Arak

    Index Scriptorium Estoniae

    Raal, Ain, 1961-

    2006-01-01

    3. mail 2006 kaitses farmaatsiamagister Tartu Ülikooli arstiteaduskonna nõukogu ees doktoriväitekirja "Tropaanalkaloidide ja riboflaviini produktsioon koera-pöörirohu (Hyoscyamus niger L.) põllu- ja koekultuurides

  18. Cancer Diagnostics: The Future Ain't What It Used to Be

    NARCIS (Netherlands)

    Groenendijk, F.H.

    2015-01-01

    Cancer is a genomic disease. Most cancers contain multiple genetics alterations that drive their unrestrained proliferation, progression and metastatic capacity. For most cancer types, it is known what these alterations are and what their frequency is. Genomics technologies have made it possible to

  19. Laevade erinevate soetamisviiside kommertstingimuste võrdlev analüüs / Ain Eidast, Allan Kivi

    Index Scriptorium Estoniae

    Eidast, Ain, 1939-2013

    2005-01-01

    Laevade erinevate soetamisviiside analüüs näitab, et ühtse, kõikidele osapooltele vastuvõetavate tingimuste väljatöötamine ja rakendamine ei ole tehniliselt võimalik ning majanduslikult õigustatud. Tabelid. Diagrammid

  20. Lindora 11.-12. sajandi kääbaskalmistuantropoloogiline aines / Leiu Heapost

    Index Scriptorium Estoniae

    Heapost, Leiu, 1936-

    2006-01-01

    Kagu-Eesti seni kõige varasem laibahaudadest saadud atropoloogiline materjal pärineb Lindora kääbaskalmetest. Lindora ümarkääbastesse maetud olid morfoloogiliselt võrdlemisi sarnased, kõrge ja kitsa koljuga, pikakasvulised ja graatsiliste jäsemeluudega

  1. Sõjageograafia aine ja Eestimaa sõjageograafia 1920. aastatel / Kersti Vennik

    Index Scriptorium Estoniae

    Vennik, Kersti, 1975-

    2003-01-01

    Autori arvates puudub praeguses ohvitseride väljaõppes kursus, kus selgitataks täpsemalt Eesti maastike omadusi, erinevate maastiku-komponentide omavahelist koosmõju ning maastiku mõju kaitsejõudude tegevusele. Polkovnik Nikolai Reegi (1890-1942) panusest Eesti geograafiateaduse ajalukku

  2. Living with the Sermon of the Mount : an uncomfortable presence of transcendence / Ain Riistan

    Index Scriptorium Estoniae

    Riistan, Ain, 1965-

    2003-01-01

    Ettekanne sümpoosionilt: Gemeinsames Symposium der Evangelisch-Theologischen Fakultät der Universität Tartu, der Estnischen Studiengesellschaft für Morgenlandkunde und der Deutschen Religionsgeschichtlichen Studiengesellschaft. Tartu, 2001

  3. Detoxification Of Ochratoxin AIN Green Coffee Beans By Physical Methods With Studying Genotoxicity Of Treated Samples

    International Nuclear Information System (INIS)

    Ochratoxin A (OTA) is potently nephrotoxic, teratogenic and carcinogenic, and the potency was varied markedly between species and sexes. Unfortunately, OTA are present due to mold contamination in different food stuffs such as coffee bean, therefore, the present study was carried out on collected imported coffee samples from super markets in Egypt. The isolation and identification proved presence of Penicilli sp. and Aspergillus sp. whereas the last one was dominant in two samples as A. niger and A. ochoruses. Determination of OTA by using HPLC analysis showed presence of high levels than the allowance levels in green coffee beans (more than 5 μg/kg; ppb). In addition, another group of collected samples as roasted coffee beans indicated the presence of high toxic concentrations of OTA. The study was then conducted on samples contain the highest OTA content by using some physical methods as gamma irradiation (5 and 10 kGy), charcoal (powder, granules), roasting (at 2000C for 7-10 min and 20 min). The results showed that proposed physical methods, mainly gamma irradiation and charcoal, could be efficient to decrease OTA in green beans coffee without produce toxic substance as well as non-significant changes in its properties. In addition, safety of resulted coffee beans after treatments were checked by ESR and genotoxicity test, which raise the preferability of gamma irradiation (10 kGy) treatment before using medium roasting to get coffee beans free from OTA

  4. Teaduspargist võrsub eriti agar gasell / Ain Alvela ; kommenteerinud Seren Eilmann

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2010-01-01

    Tallinna tehnoloogiapargi Tehnopol ja Tartu teaduspargi ettevõtlusinkubaatorid pakuvad ettevõtluskeskkonda kiiret arengut taotlevatele ettevõtetele. Tehnopolis on gaselli staatuse saanud 22 firmat, Tartu teaduspargis 13 firmat. AS-ist Proekspert, OÜ-st Interfire. Tabel

  5. DiSC aitab käitumist parandada / Ain Kivesti

    Index Scriptorium Estoniae

    Kivesti, Ain

    2008-01-01

    DiSC testi abil on võimalik saada ülevaade personaalsetest käitumishoiakutest ning vastavalt olukorrale on võimalik harjumuspärast reageerimisstiili radikaalselt muuta. Kommenteerivad Jorma Sarv ja Paavo Pilv

  6. "I Know There Ain't No Pigs with Wigs": Challenges of Tier 2 Intervention

    Science.gov (United States)

    Stephens, Diane; Cox, Robin; Downs, Anne; Goforth, Jennie; Jaeger, Lisa; Matheny, Ashley; Plyler, Kristi; Ray, Sandra; Riser, Lee; Sawyer, Beth; Thompson, Tara; Vickio, Kathy; Wilcox, Cindy

    2012-01-01

    As a part of Response to Intervention, for three years, ten reading interventionists provided supplemental support to readers. They formed a learning community, took an inquiry-based approach to assessment and developed a theory of what students needed to know and be able to do as readers. They addressed and learned from several other challenges:…

  7. A successful chronic care program in Al Ain-United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Al Husaini Alhusini I

    2010-02-01

    Full Text Available Abstract Background The cost effective provision of quality care for chronic diseases is a major challenge for health care systems. We describe a project to improve the care of patients with the highly prevalent disorders of diabetes and hypertension, conducted in one of the major cities of the United Arab Emirates. Settings and Methods The project, using the principles of quality assurance cycles, was conducted in 4 stages. The assessment stage consisted of a community survey and an audit of the health care system, with particular emphasis on chronic disease care. The information gleaned from this stage provided feedback to the staff of participating health centers. In the second stage, deficiencies in health care were identified and interventions were developed for improvements, including topics for continuing professional development. In the third stage, these strategies were piloted in a single health centre for one year and the outcomes evaluated. In the still ongoing fourth stage, the project was rolled out to all the health centers in the area, with continuing evaluation. The intervention consisted of changes to establish a structured care model based on the predicted needs of this group of patients utilizing dedicated chronic disease clinics inside the existing primary health care system. These clinics incorporated decision-making tools, including evidence-based guidelines, patient education and ongoing professional education. Results The intervention was successfully implemented in all the health centers. The health care quality indicators that showed the greatest improvement were the documentation of patient history (e.g. smoking status and physical activity; improvement in recording physical signs (e.g. body mass index (BMI; and an improvement in the requesting of appropriate investigations, such as HbA1c and microalbuminurea. There was also improvement in those parameters reflecting outcomes of care, which included HbA1c, blood pressure and lipid profiles. Indicators related to lifestyle changes, such as smoking cessation and BMI, failed to improve. Conclusion Chronic disease care is a joint commitment by health care providers and patients. This combined approach proved successful in most areas of the project, but the area of patient self management requires further improvement.

  8. Sulev Keedus : "Jonathan" on film esti indiaanlastest / Sulev Keedus ; interv. Ain Lember

    Index Scriptorium Estoniae

    Keedus, Sulev, 1957-

    2007-01-01

    Dokumentaalfilm "Jonathan Austraaliast" : režissöör ja operaator Sulev Keedus : F-Seitse 2007. Režissöör filmist, kaitstes end kohaliku rahva süüdistuste vastu filmis kujutatu ebaeetilisuse üle

  9. Pool viljast jääb põllule / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Vihmased ilmad on nurjanud põllumeeste saagikoristuse, seetõttu on talunikud ja agrofirmad prognoosinud raskete aegade tulekut põllumajandussektorisse. Vt. samas: Põllumehel pole loota, et riik või kindlustus ikaldunud saagi korvaks; Nigel saak ei vääri kombaini käivitamist; Vihm on tänavu talunikele nuhtluseks. Küsimusele vastab Tõnu Talinurm

  10. Life for Minority Professors of Special Education Ain't Been No Crystal Stair

    Science.gov (United States)

    Gentry, Ruben

    2010-01-01

    To expect an "easy life" as a professor of special education is to expect what never was nor never will be. But when the playing field is uneven for minorities, or even worse, when it is not even recognized that the playing field is uneven, there is cause for action. For example, Bonner (2004) stated that minority faculty face tremendous…

  11. MTZ trügib maailma mõjukate traktoritootjate sekka : [Minski traktoritehas] / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    2016. a oma asutamise 70. aastapäeva tähistav Minski traktoritehas (MTZ) panustab viimse kümnendi jooksul jõuliselt Euroopa tingimustele ja nõuetele vastavate traktorite välja töötamisele ning tootmisele

  12. FcγRIII in ITP: it ain't over 'til it's over.

    Science.gov (United States)

    McCrae, Keith R

    2016-01-01

    In this issue of Blood, Yu et al describe a novel anti–Fcγ receptor III (FcγRIII)-albumin fusion protein that inhibits the development of thrombocytopenia in a murine model of immune thrombocytopenia (ITP).1 The unique aspect of this protein is that it blocks FcγRIII-mediated uptake of antibody-coated platelets without activating FcγRIII and the associated inflammatory response. PMID:26744437

  13. Veiko Õunpuu pälvis Euroopa Talendi auhinna / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2008-01-01

    Cannes'i filmifestivali raames toimuval Euroopa päeval antakse filmirežissöör Veiko Õunpuule üle Euroopa Talendi auhind (European Talent Prize) mängufilmiprojekti "Püha Tõnu Kiusamine" eest (produtsent Katrin Kissa). MEDIA Desk Eesti juht Anu Ernits peab seda suureks võiduks kogu Eesti filmile

  14. Obrashtshonnoje mgnovenije : [luuletused] / Artur Alliksaar ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Alliksaar, Artur, 1923-1966

    1999-01-01

    Sisu: Obrashtshonnoje mgnovenije ; Beda prihhodit moltsha, zovjot li, uhhodja? ; Vspõshka / tlk. G. Kirillov ; Vremja ; Avtoportret ; Nebõtija moglo bõ i ne bõt ; Govorju slova tebe, smert, velikomu bezmolviju i sebe samomu ; Gde-to za rekoi vremeni / tlk. Svetlan Semenenko. Orig.: Õnnetus ei hüüa tulles, aga kas ta minnes hüüab? ; Välkvisioon ; Aeg ; Autoportree ; Olematus võiks ju ka olemata olla ; Sõnad sinule, surm, suurele vaikusele ja iseendale ; Kuskil ajajõe taga

  15. Promõshlennõje zonõ ohvatil "mjortvõi sezon" / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Arendajad on tehnoparkide rajamise ooterežiimile pannud - ostjaid jaguks, kuid võimalusi napib. Diagramm: Za pjat let stoimost zemli promõshlennogo naznatshenija võrosla v pjat raz; Tabel: Naiboleje dorogaja zemlja - v promparke Lasnamäe. Kommenteerivad Enn Tosso, Nikolai Pitshugov ja Urmas Ahven

  16. A Completely New Type of Actuator -or- This Ain't Your Grandfather's Internal Combustion Engine

    Science.gov (United States)

    Gore, Brian W.; Hawkins, Gary F.; Hess, Peter A.; Moore, Teresa A.; Fournier, Eric W.

    2010-01-01

    A completely new type of actuator - one that is proposed for use in a variety of environments from sea to land to air to space - has been designed, patented, built, and tested. The actuator is loosely based on the principle of the internal combustion engine, except that it is a completely closed system, only requiring electrical input, and the working fuel is water. This paper outlines the theory behind the electrolysis- and ignition-based cycle upon which the actuator operates and describes the performance capability test apparatus and results for the actuator. A mechanism application that harnessed the unit s power to twist a scaled rotor blade is also highlighted.

  17. Sõjanuiad, võimusümbolid ja margapuud / Ain Mäesalu, Jüri Peets

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Artiklis käsitletakse muinas- ja keskaegsete sõjanuiade problemaatikat arheoloogiliste leidude, kirjalike allikate ja omaaegsete kunstiteoste põhjal. Eestist leitud sõjanuiapeadest, mida kasutati 12.-13. sajandil relvadena, kuid need võisid sümboliseerida ka selle omaniku kõrget staatust. 19.-20. sajandil kasutati samasuguseid metalltahukaid margapuu otsaraskusena

  18. Associations of cardiovascular risk factors in Al Ain- United Arab Emirates

    OpenAIRE

    Nazirudeen Mohammad K; Ahmed Nader M; Omar Aziza O; Jaber Tariq M; Nagelkerke Nico JD; Revel Anthony D; Baynouna Latifa M; Al Sayed Mamdouh F; Nour Fuad A; Abdouni Sameh

    2009-01-01

    Abstract Background Over the last 30 years the citizens of the United Arab Emirates have experienced major changes in life-style secondary to increased affluence. Currently, 1 in 5 adults have diabetes mellitus, but the associations (clustering) among risk factors, as well as the relevance of the concept of the metabolic syndrome, in this population is unknown. Aim To investigate the prevalence and associations among cardiovascular risk factors in this population, and explore to what extent a...

  19. Ligi 800 km kruusateid utsitab edu püüdlema / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2003-01-01

    Põlvamaa ettevõtete TOP-i 1. koht. Põlvamaa edukaim ettevõte on maakonnas riigiteede hooldetöid teostav Põlva Teed AS. Diagramm: Põlva Teed AS käive ja kasum 2001-2003. Kommenteerib Riho Sõrmus.

  20. Study on magnetic behavior and structure of V-doped AIN films

    Energy Technology Data Exchange (ETDEWEB)

    Sato, T; Endo, Y; Kawamura, Y; Nakatani, R; Yamamoto, M [Department of Materials Science and Engineering, Graduate School of Engineering, Osaka University (Japan)], E-mail: takanobu.sato@mat.eng.osaka-u.ac.jp

    2008-03-15

    Magnetic behavior and structure of V-doped AlN (Al{sub 1-x}V{sub x}N) films with various V concentrations (x = 0.03-0.36) were studied. These films exhibit paramagnetic behavior in the temperature range of 10-300 K for all x. These films have only wuerzite-type AlN phase for the range of x below 0.20. For x of 0.36, coexistence of wuerzite-type AlN phase and secondary phase is observed.

  1. Otepää piiskoplinnuse hävimisdaatumist / Ain Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Ain, 1955-

    2010-01-01

    Ülevaade, miks autor hakkas 1980. aastate keskel toetama hüpoteesi Otepää keskaegse linnuse hävimisest 1396. aastal. Samas on kriitiliselt vaetud sama ajakirja numbris mõningaid Jaak Mälli seisukohti

  2. Keskkonnanõuete täitmine neelab tootjate kasumist miljoneid kroone / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2008-01-01

    Üha karmimaks muutuvad keskkonnanõuded sunnivad tootmisettevõtteid investeerima miljoneid kroone. Diagrammid: Saasteainete kogused vähenevad; Investeeringud hakkavad taas kasvama. Vt. samas: Ketlin Priilinn. Keskmine rahapaigutus jääb 50 miljoni krooni kanti. Kommenteerivad: Kalmer Sokman, Georg Luzhkov, Julia Aleksandrova, Heiki Hallik, Aivar Reivik, Gunnar Paalman, Riia Ratnik ja Kersti Salulaid

  3. Front-running by Mutual Fund Managers: It ain't that Bad

    OpenAIRE

    Jean-Pierre DANTHINE; Moresi, Serge X

    1996-01-01

    This paper evaluates the welfare implications of front-running by mutual fund managers. It extends the model of Kyle (1985) to a situation in which the insider with fundamentals-information competes against an insider with trade-information and in which noise trading is endogenized. Noise traders are small investors trading through mutual funds to hedge non-tradable or illiquid assets. The insider with trade-information is one of the fund managers. We find that front-running activity reduces ...

  4. Jaani seek väärib säilitamist / Ain Mäesalu

    Index Scriptorium Estoniae

    Mäesalu, Ain

    2001-01-01

    5. oktoobril kogunes Jaani seegi varemete vahele Eesti juhtivatest arheoloogidest koosnev arheoloogiamälestiste nõukogu, kes otsustas, et müüristik on väga väärtuslik muinsus. Samal seisukohal on ka muinsuskaitsjad. Agne Trummali ja Toomas Tamla kommentaarid

  5. Odnim blazhennõm dnjom : [luuletused] / Uku Masing ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Masing, Uku, 1909-1985

    1999-01-01

    Sisu: Odnim blazhennõm dnjom ; Veter tshelnok bõl ; Pesn soldat, otstupajushishih pod natiskom netshistoi silõ / tlk. Svetlan Semenenko ; "Tõ groznaja gora..." ; "Ne mozhet ditja bez ottsa naroditsja..." ; K predelam ; Vestnik iz "Magellanovõh oblakov" : katkend ; Postigaja i verja ; V kazhdom strannike - nadezhda / tlk. A. Zorin. Orig.: Ühel kaunil päeval ; Süstik on tuul ; Tontide eest taganejate sõdurite laul ; "Sa oled mägi, mida kardavad me karjad..." ; "Välja südamest visata..." ; Piiridele püüdes ; Saadik Magellani pilvest : katkend ; Mõistu saades ja uskudes ; Iga rändur on lootus

  6. Ordenid saavad oma sära Tavasti kullapajas / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    1999-01-01

    Roman Tavasti asutatud kullassepatöökojast (1923), sellest väljakasvanud Metallmärgist, Juveelitehasest (195?) ja OÜ-st Roman Tavast (1994). Eesti Vabariigi riiklike teenetemärkide valmistamisest. Firmat juhib Raul-Roman Tavast

  7. Uso racional de AINEs y antimicrobianos en odontopediatría

    OpenAIRE

    Mariel Colmenares Faraco; Ingrid Hoffmann; Efraín Guerrero; Henry Pérez

    2015-01-01

    The pediatric dentist in clinical practice needs to prescribe medications to their patients, this requirement should make it rationally, based on a diagnosis according to its clinical judgement and examinations for a comprehensive treatment plan. It is therefore important to know the peculiarities of the child in relation to drugs, which highlights the pharmacokinetics, pharmacodynamics, development and maturation, special care for the elimination of drugs. The pre...

  8. "If It Ain't Broke, Don't Fix It"

    DEFF Research Database (Denmark)

    Blasco, Maribel; Tackney, Charles

    2013-01-01

    Denmark is among the world's most competitive nations. It also has a strong tradition of citizenship–oriented higher education, promoted through the widespread Problem–Oriented Project Work (POPW) didactic approach. We argue that recent changes to this tradition have modified the incentives...... embedded in the hidden curriculum, which made Danish higher education effective at producing graduates with analytical and personal abilities and dispositions, such as reflexivity, curiosity, collaboration and trust that are particularly suitable for today's globalised, knowledge–based economies. We...... illustrate this by drawing on examples of changes to an education programme at a Danish business school....

  9. Water Ser - areng läbi torude ja üle kraavide / Ain Alvela

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2007-01-01

    1992. aastal asutatud vee- ja kanalisatsioonitorustike paigaldamisele spetsialiseerunud perefirma AS Water Ser on kasvanud rahvusvaheliselt mainekaks kontserniks. Vt. samas: Perefirma arengu kronoloogia; Amet sai alguse teismelise eas kraavikaevamisest. Kommenteerivad Andrus Piir ja Toomas Kapp

  10. Ain't No Neuroscience Mountain High Enough: Experiences of a Neurogardener.

    Science.gov (United States)

    Abdullah, Jafri Malin

    2015-01-01

    16 years have passed since the idea was mooted in 1999 by five neurosurgeons in the corridors of Hotel Perdana, Kota Bharu. They were Dato' Dr Johari Siregar Bin Adnan, Dato' Professor Dr Ahmad Zubaidi Abdul Latif , Dr Azmin Kass Bin Rosman, Dato' Dr Mohammed Saffari Bin Mohammed Haspani and Professor Dato' Dr Jafri Malin Abdullah. They initiated the beginning of the first programme in Neurosurgery in Malaysia. The rest is history. PMID:26715890

  11. Konkurentide ees annab eelise disainiga tegelemine / Peter L. Phillips ; intervjueerinud Ain Alvela

    Index Scriptorium Estoniae

    Phillips, Peter L.

    2010-01-01

    Intervjuu rahvusvaheliselt tunnustatud disainieksperdiga tootmisettevõtete ja disainerite koostöö tähtsusest, disaineri rollist. Eksperdi sõnul on äärmiselt oluline kasutada toodete eristumiseks ja nende turustamiseks disaini, kui Eesti tootjatel on soov müüa tooteid Eestist välja

  12. Road risk-perception and pedestrian injuries among students at Ain Shams University, Cairo, Egypt

    OpenAIRE

    Maged El-Setouhy; Jon Mark Hirshon; Hannah Day; Jehan M. Ibrahim

    2012-01-01

    Abstract: Background: Road traffic injuries (RTIs) constitute 45% of injury mortality in Egypt; 75% of these injuries are pedestrians related. Traditionally, research on road traffic safety has focused on the traffic environment and the vehicles. However, little attention has been given to road risky behaviors and perceptions of road safety by pedestrians as risk factors associated with high pedestrian injury rates. This study aimed to examine the relationship between road risk- perception, s...

  13. Küla arengukava on külaarengu toetuse saamiseks vajalik / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    Liikumine Kodukant kavatseb esitada põllumajandusministeeriumile protestikirja, kuna ei nõustu ministeeriumi infopäevadel levitatava tõlgendusega nagu võiks külade taastamise ja arendamise meetme toetust taotleda ka ilma küla arengukavata. Arvamust avaldavad: Maris Ode, Lemmi Maasik, Heli Raamets, Marek Raud ja Sille Rähn

  14. Vitamin D deficiency among healthy adolescents in Al Ain, United Arab Emirates

    OpenAIRE

    Shamma J Muhairi; Mehairi, Aaesha E.; Khouri, Aysha A; Naqbi, Muna M.; Maskari, Fatima A; Kaabi, Juma Al; Dhaheri, Ayesha S Al; Nagelkerke, Nico; Shah, Syed M

    2013-01-01

    Background Although vitamin D deficiency has been studied in various adult populations, there are few data on the prevalence of this nutritional deficiency among healthy adolescents in the United Arab Emirates (UAE). This study was conducted to determine the prevalence of vitamin D deficiency and to examine its correlates in adolescents aged 15 to 18 years. Methods This was a cross-sectional study in urban schools. Healthy adolescents (N=315) from a sample of 8 schools were randomly selected ...

  15. The Input To Language Learning: Two Out Of Three Ain't Good Enough Michael Swan%The Input To Language Learning:Two Out Of Three Ain't Good Enough

    Institute of Scientific and Technical Information of China (English)

    Michael Swan

    2007-01-01

    @@ Child language learning depends on: 1. extensive input: the flood of language in the environment. 2. concentrated input: repeated stories, nursery rhymes,the formulaie language of meals or bathtimes, etc. By unconsciously analysing memorised material, children build up their knowledgeof linguistic regularities.

  16. Method 445.0 In Vitro Determination of Chlorophyll a and Pheophytin ain Marine and Freshwater Algae by Fluorescence

    Science.gov (United States)

    This method provides a procedure for low level determination of chlorophyll a (chl a) and its magnesium free derivative, pheophytin a (pheo a), in marine and freshwater phytoplankton using fluorescence detection.(1,2) Phaeophorbides present in the sample are determined collective...

  17. Söötmisega disainitud piim tagab tervisliku toidukraami / Ene Tammsaar ; intervjueerinud Ain Alvela ; kommenteerinud Üllas Jaaska

    Index Scriptorium Estoniae

    Tammsaar, Ene, 1952-

    2014-01-01

    Et farmidest tööstusse minevast toorpiimast saaks toota maitsvaid ja tervislikke tooteid, peab toorpiim olema kõrgeima võimaliku kvaliteediga. Selle tagamiseks on piimatööstused koostöös teadlastega ette võtnud piima koostise disainimise

  18. It ain't over till it's over: A global perspective on the Great Moderation-Great Recession interconnection

    OpenAIRE

    Fabio Bagliano; Claudio Morana

    2015-01-01

    A large-scale model of the global economy is used to investigate the structural determinants of the Great Moderation and the transition to the Great Recession (1986-2010). Beside the global economy perspective, the model presents the novel feature of a broad range of included financial variables and risk factors measures. The results point to the relevance of various mechanisms related to the global monetary policy stance (Great Deviation), financial institutions' risk taking behavior (Great ...

  19. Nitric oxide as a mediator of gastrointestinal mucosal injury?—Say it ain't so

    Directory of Open Access Journals (Sweden)

    Paul Kubes

    1995-01-01

    Full Text Available Nitric oxide has been suggested as a contributor to tissue injury in various experimental models of gastrointestinal inflammation. However, there is overwhelming evidence that nitric oxide is one of the most important mediators of mucosal defence, influencing such factors as mucus secretion, mucosal blood flow, ulcer repair and the activity of a variety of mucosal immunocytes. Nitric oxide has the capacity to down-regulate inflammatory responses in the gastrointestinal tract, to scavenge various free radical species and to protect the mucosa from injury induced by topical irritants. Moreover, questions can be raised regarding the evidence purported to support a role for nitric oxide in producing tissue injury. In this review, we provide an overview of the evidence supporting a role for nitric oxide in protecting the gastrointestinal tract from injury.

  20. V dvuh strofah 1-7 : [luuletused] / August Sang ; lühibiograafia: A. K. [Ain Kaalep

    Index Scriptorium Estoniae

    Sang, August, 1914-1969

    1999-01-01

    Sisu: V dvuh strofah 1-7 ; Kolõbelnaja ; Doroga / tlk. Leon Toom ; Pesn ob oboze ; Poslednaja usluga ; Vospominanije / tlk. A. Golemba. Orig.. Kahe stroofiga ; Hällilaul ; Teekond ; Laul järelväest ; Mälestus

  1. Tootest olulisemaks saab ärimudel. Kandiline arbuus tavalisest 30 korda kallim / Ain Alvela ; kommenteerinud Janek Kalvi

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Eesti Arengufondi juhatuse esimehe Ott Pärna, ASi Kalev Chocolate Factory juhataja Kaido Kaare ja ASi Balsnack International Holding juhatuse esimehe Elmar Rusingu ettekannetest toiduainetööstuse aastakonverentsil "Uue tõusu ootuses". Graafik

  2. Why 2 times 2 ain't necessarily 4 - at least not in IT security risk assessment

    OpenAIRE

    Braband, Jens

    2016-01-01

    Recently, a novel approach towards semi-quantitative IT security risk assessment has been proposed in the draft IEC 62443-3-2. This approach is analyzed from several different angles, e.g. embedding into the overall standard series, semantic and methodological aspects. As a result, several systematic flaws in the approach are exposed. As a way forward, an alternative approach is proposed which blends together semi-quantitative risk assessment as well as threat and risk analysis.

  3. Keskkonnakaitsjad pakuvad välja abinõud GMO saaste vältimiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Eesti Keskkonnaühenduste Koda esitas ettepanekud tagamaks geneetiliselt muundatud põllumajanduskultuuride kasvatamise selliselt, et need ei tekitaks kahju tava- ja mahepõllumeestele. Vt. samas: Põllumajandusminister Ester Tuiksoo kommentaar EKO ettepanekutele. Vt. samas: Eesti ilmselt toetab geenmuundatud taimede lubamist Euroopa Liitu ja lühiinterv. põllumajandusministeeriumi taimetervise osakonna juhataja Tambet Sovaga. Vt. ka lk. 5: Nastja Pertsjonok. GMO keskkonnakaitsja pilgu läbi

  4. Küttimine võib septembris peatuda. Maaomanikud vs. jahimehed / Ain Alvela ; kommenteerinud Heiki Hepner, Val Rajasaar

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Maksumaksjad ja maaomanikud toetavad Eesti jahindust sisuliselt viie miljoni euroga aastas, kuigi keskkonnaspetsialistide hinnangul võiks asi olla vastupidi. Kehtiv jahiseadus ei aita kaasa metsa väärtuse parandamisele. Tabelid

  5. Catering for Pilgrims: Petrographic Analysis of Late Antique Kitchenware from the Monastery of St Lot at Deir 'Ain 'Abata, Jordan

    Directory of Open Access Journals (Sweden)

    Louise Joyner

    2000-10-01

    Full Text Available Petrography has been used to elucidate patterns of production and consumption of kitchenware at a typical Early Christian desert monastery on the Pilgrim route. While some vessels may have been produced locally, there is evidence for long distance trade of other vessels.

  6. Õpilaste teadlikkus E-ainetest ja karastusjookides olevad E-ained / Dorel Donner ; juhendanud Karin Tuul

    Index Scriptorium Estoniae

    Donner, Dorel

    2014-01-01

    Räpina ühisgümnaasiumi 11. kl. õpilase uurimistööst, milles antakse ülevaade E-ainetest, nende kasutusaladest, eeldatavatest kõrvalmõjudest ning gümnaasiumiastme õpilaste karastusjookide tarbimise harjumustest ja üldisest E-ainetega seotud teadlikkusest

  7. Ain't Necessarily So : Review and Critique of Recent Meta-Analyses of Behavioral Medicine Interventions in Health Psychology

    NARCIS (Netherlands)

    Coyne, James C.; Thombs, Brett D.; Hagedoorn, Mariet

    2010-01-01

    Objective: We examined four meta-analyses of behavioral interventions for adults (Dixon, Keefe, Scipio, Perri, & Abernethy, 2007; Hoffman, Papas, Chatkoff, & Kerns, 2007; Irwin, Cole, & Nicassio, 2006; and Jacobsen, Donovan, Vadaparampil, & Small, 2007) that have appeared in the Evidence Based Treat

  8. Dystocia Ystocia Due to Due to Mummifiedummified Foetaloetal Monsteronster in ain a Yankasaankasa Ewewe: A Casease Reporteport

    Directory of Open Access Journals (Sweden)

    A.I. Kisani

    2012-06-01

    Full Text Available A 1 year old Yyankasa ewe weighing 24 kg was presented to the Large Animal Clinic unit of the Veterinary Teaching Hospital, University of Agriculture Makurdi, Nigeria. The owner with the complained t that she has been in labour for 24 h without delivery. Vital parameters were taken and found to be within the normal ranges. the The patient underwent general and obstetrical animal was examinationed. A diagnosis of dystocia was made with Tthe foetus was found to be in anterior presentation of the fetus, bilateral with the carpalus and shoulder flexioned and the neck deviated laterally.lateral deviation of the neck. Manual traction to deliver the foetus was not successful. Caesarean section was performed with the patient under sedation and epidural anaesthesiatherefore recommended. This was carried out and the dead foetus removed. Recovery post surgery was complete and the ewe was discharged five days post surgery.

  9. "Sa, haavapuu, kesköösel valendad..." : [luuletused] / Paul Celan ; saksa k. tlk. [ja saatesõna]: Ain Kaalep

    Index Scriptorium Estoniae

    Celan, Paul, pseud., 1920-1970

    2001-01-01

    Autorist lk. 49-50. Sisu: "Sa, haavapuu, kesköösel valendad..." ; Mälestus Prantsusmaast ; Aastad sinust minuni ; Surmafuuga ; Aja silm ; Kõnevõre ; Silm, lahtine ; Zürich, "Toonekure" kohvik : Nelly Sachsile ; Psalm ; "Niitpäikesed..." ; "Maovankris, mööda..." ; "Maastik urnidega..." ; Prahas ; "Kõmin: see on..." ; "Üks hambajälg eikuskilpool..." ; "Kahinais, otsekui meie alguses..." ; Teine ; "Teie oma..." ; "See, mis meid..." ; "Lõika palvekäsi..." ; "Ma kuulen, et kirves lõi õitsema..." ; "Leht, mille puu küljest..."

  10. Päästetute koor : [luuletused] / Nelly Sachs ; saksa k. tlk. [ja järelsõna:] Ain Kaalep

    Index Scriptorium Estoniae

    Sachs, Nelly

    2003-01-01

    Sisu: Päästetute koor ; Kes aga tühjendas liivast teie kingad ; Et jälitatuist ei saaks jälitajad ; Sündmatute koor ; Liblikas ; Maailma rahvad ; Valmis on kõik maad ; Nii üksildane on inimene

  11. Piimandus: laenukarid, ikaldused ja hinnaralli tõid kriisi / Ain Alvela ; kommenteerinud Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2009-01-01

    Kuigi piimatootmisega tegelevad ettevõtted vajaksid tegevuse arendamiseks hädasti investeeringuid, jäävad enamiku rahastamisplaanid paremaid aegu ootama. Diagramm. Kommenteerivad Tiit Tuuleveski, Urmas Põlluaas ja Tõnu Post

  12. "I Ain't Changing Anything": A Case-Study of Successful Generation 1.5 Immigrant College Students' Writing

    Science.gov (United States)

    Riazantseva, Anastasia

    2012-01-01

    The purpose of this case-study was to understand the relationship between success in college and L2 academic writing of three Generation 1.5 Russian-speaking middle-class college students and to describe the factors that could have contributed to the levels of academic literacy that these students developed. The following research questions were…

  13. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope x-ray fluorescence method

    International Nuclear Information System (INIS)

    The radioisotope x-ray fluorescence method was applied to provenance studies of ceramics fragments originated from the Mar-Takla site in Syria. 35 samples were analyzed, where each sample was irradiated 1000 s by sup 1 sup 0 sup 9 Cd radioisotope source and the elements (As, Ca, fe, Ga, Nb, Mn, Pb, Rb, Sr, Ti, Y, Zn, and Zr) were determined. The data were subjected to two multivariate statistical methods, cluster and principal component analysis (PCA). The study show that 94% of the samples can be considered to be manufactured using two sources of raw materials. (Authors)

  14. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope X-ray fluorescence method

    International Nuclear Information System (INIS)

    The radioisotope X-ray fluorescence method was applied to studies of the provenance of the ceramics fragments originated from the Mar-Takla site in Syria. The samples were irradiated 1000s by a 109Cd radioisotope source and 13 elements (Ca, Ti, Mn, Fe, Zn, Ga, As, Rb, Sr, Y, Zr and Pb) were determined in 35 samples. The data were subjected to two multivariate statistical methods, cluster and principal components analysis (PCA). It was shown from the combination of the statistical techniques and the determination of elemental composition of the samples that 94% of the ceramic samples analyzed can be considered to be manufactured using two sources of raw materials

  15. Saaremaal anti täiskäik LEADER-programmi käivitamiseks / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Saaremaa Kodukandi korraldatud infopäeval sündis algatusrühm LEADER-tüüpi arendustegevuse ettevalmistamiseks maakonnas. Tabel: Saaremaa algatusrühma tegevuskava LEADER-tüüpi maapiirkondade arendustegevuse ettevalmistamiseks

  16. Läti elanikud NSVL SARK filterlaagrites 1944-1948 (allikate ülevaade) / Ainārs Bambals

    Index Scriptorium Estoniae

    Bambals, Ainārs, 1964-

    2010-01-01

    Läti filtreerimise kontroll-koondamispunktid olid Riias, Daugavpilsis, Jelgavas, Kuldīga, Liepājas, Skrundas, Tukumsis, Vāiņodes, Ventspilsis, Ugāles. Pärast Teist maailmasõda allutati filtreerimisele 91 000 Läti elanikku

  17. Residential satisifaction in the new urban housing projects in Algeria: a case study of Ain-Allah, Algiers

    OpenAIRE

    Oussadou, Aomar

    1988-01-01

    During the last few decades most developing countries have experienced a rapid growth in population which has resulted in rapid urbanisation in the form of new towns and an expansion of existing towns, coupled with an increasing dependance upon developed countries for the implementation of the new housing programmes. In Algeria, since Independance the problems of the high population growth and the rural-urban migration have led to a rapid growth of cities and towns. Since 1975 the Algerian...

  18. Lootus : [luuletused] / Friedrich Schiller ; tlk. Ain Kaalep, Rein Sepp, Paul Viiding, Eduard Roos, Jaan Kross, Jakob Tamm

    Index Scriptorium Estoniae

    Schiller, Friedrich, 1759-1805

    2006-01-01

    Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239

  19. Nahast küünarvarrekaitsmed keskaegsest Tartust / Ain Mäesalu, Jüri Peets, Elna Haiba

    Index Scriptorium Estoniae

    Mäesalu, Ain

    2008-01-01

    2000. aastal Tartust leitud 14. sajandi lõpukümnenditest või 15. sajandi algusest pärinevatest küünarvarrekaitsmetest. Keskaegsest kaitsevarustusest, Tartu küünarvarrekaitsmete valmistamistehnikast, nende kahjustustest ja konserveerimisest

  20. Development of Production PVD-AIN Buffer Layer System and Processes to Reduce Epitaxy Costs and Increase LED Efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cerio, Frank

    2013-09-14

    The DOE has set aggressive goals for solid state lighting (SSL) adoption, which require manufacturing and quality improvements for virtually all process steps leading to an LED luminaire product. The goals pertinent to this proposed project are to reduce the cost and improve the quality of the epitaxial growth processes used to build LED structures. The objectives outlined in this proposal focus on achieving cost reduction and performance improvements over state-of-the-art, using technologies that are low in cost and amenable to high efficiency manufacturing. The objectives of the outlined proposal focus on cost reductions in epitaxial growth by reducing epitaxy layer thickness and hetero-epitaxial strain, and by enabling the use of larger, less expensive silicon substrates and would be accomplished through the introduction of a high productivity reactive sputtering system and an effective sputtered aluminum-nitride (AlN) buffer/nucleation layer process. Success of the proposed project could enable efficient adoption of GaN on-silicon (GaN/Si) epitaxial technology on 150mm silicon substrates. The reduction in epitaxy cost per cm{sup 2} using 150mm GaN-on-Si technology derives from (1) a reduction in cost of ownership and increase in throughput for the buffer deposition process via the elimination of MOCVD buffer layers and other throughput and CoO enhancements, (2) improvement in brightness through reductions in defect density, (3) reduction in substrate cost through the replacement of sapphire with silicon, and (4) reduction in non-ESD yield loss through reductions in wafer bow and temperature variation. The adoption of 150mm GaN/Si processing will also facilitate significant cost reductions in subsequent wafer fabrication manufacturing costs. There were three phases to this project. These three phases overlap in order to aggressively facilitate a commercially available production GaN/Si capability. In Phase I of the project, the repeatability of the performance was analyzed and improvements implemented to the Veeco PVD-AlN prototype system to establish a specification and baseline PVD-AlN films on sapphire and in parallel the evaluation of PVD AlN on silicon substrates began. In Phase II of the project a Beta tool based on a scaled-up process module capable of depositing uniform films on batches of 4”or 6” diameter substrates in a production worthy operation was developed and qualified. In Phase III, the means to increase the throughput of the PVD-AlN system was evaluated and focused primarily on minimizing the impact of the substrate heating and cooling times that dominated the overall cycle time.

  1. Twin City - past 1823-2013 : EHTE ja Haaga-Helia ühisprojekt / Tiit Kask, Ain Hinsberg

    Index Scriptorium Estoniae

    Kask, Tiit

    2012-01-01

    Turismikoolide ühisprojektist "Twin City - Empowering & Designing Twin-Capital Destination - Past, Present and Future of Tourism in Greater-Helsinki and Greater-Tallinn Area", mille eesmärgiks on Tallinna ja Helsingi kui ühtse turismisihtkoha käsitluse loomine ja 26. aprillil Tallinnas toimunud seminarist "TwinCity Helsinki-Tallinn / Tallinn & Estonian tourism 1813-2013", mis kutsus üles tähistama Tallinna (Kadrioru) merekuurordi ja "Eesti Turismimajandus 200" juubelit 2013. aastal

  2. "If It Ain't True, Then It's Just a Book!" The Reading and Teaching of Faction Literature

    Science.gov (United States)

    Olin-Scheller, Christina; Tengberg, Michael

    2012-01-01

    This article examines issues related to the reading and teaching of faction literature in school. Faction is defined not only as a literary genre but also as a form of reading applied to the reader. The article discusses young people's encounters with novels "based on a true story" as well as the challenges this means for literature instruction.…

  3. Tööstust ootavad kosmos ja energeetika / Ain Alvela ; kommenteerinud Aleks Rulkov, Peep Rammo, Marek Pakkin ... [jt.

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2009-01-01

    Hannoveri tööstus- ja tehnoloogiamessi peamine sõnum Eesti tootjatele seisneb selles, et tuleb senisest pingsama tähelepanuga jälgida potentsiaalselt arenemisvõimeliste valdkondadae teket ning nendega kohe kaasa minna

  4. Depression as a Predictor of Length of Hospital Stay in Elderly Patients Admitted to Ain Shams University Hospitals

    OpenAIRE

    Sherine M. Elbanouby, Sarah A.Hamza,Samia A. Abdel Rahman and Ahmed Kamel Mortagy

    2013-01-01

    Background: Depression among the physically ill is common and frequently under-diagnosed. Elderly patients with depressive symptoms are at higher risk of hospital admission for non psychiatric conditions and are more likely to have longer hospital stays and worse hospital outcomes, compared with non depressed patients. Objectives: The aim of this study was to find out if depression can be considered a predictor of prolonged hospital stay in elderly patients. Design: A prospective cohor...

  5. Tallinna linna päeva seminar" Tallinn - merelinn Soome lahe ääres" / Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2014-01-01

    Tallinna Linna Päeva "Lahe Tallinn" raames 15. mail Tallinna Kultuuriväärtuste ameti, Keskkonnaministeeriumi, Tallinki ja Eesti Hotelli- ja Turismikõrgkooli EHTE koostöös korraldatud seminarist Tallink MS Victoria pardal laeva konverentsikeskuses, kus ettekannetega seinesid abilinnapea Arvo Sarapuu, Arvo Veskimets keskkonnaministeeriumist, Risto Paju, Rein Albri, Suvi Innilä, Pauli Santala, Mia Tarhanen, Mika Perttunen

  6. Provenance studies of archaeological ceramics from Mar-Takla (Ain-Minin, Syria) using radioisotope X-ray fluorescence method

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The radioisotope X-ray fluorescence method was applied to studies of the provenance of the ceramics fragments originated from the Mar-Takla site in Syria. The samples were irradiated 1000s by a 109Cd radioisotope source and 13 elements (Ca, Ti, Mn, Fe, Zn, Ga, As, Rb, Sr, Y, Zr, Nb, and Pb) were determined in 35 samples. The data were subjected to two multivariate statistical methods, cluster and principal components analysis (PCA). It was shown from the combination of the statistical techniques and the determination of elemental composition of the samples that 94% of the ceramic samples analyzed can be considered to be manufactured using two sources of raw materials.

  7. Complicações da terapia anticoagulante com warfarina em pacientes com doença vascular periférica: estudo coorte prospectivo Complications of anticoagulant therapy with warfarin in patients with peripheral vascular disease: a cohort prospective study

    Directory of Open Access Journals (Sweden)

    Fernada Cardoso Santos

    2006-09-01

    Full Text Available OBJETIVO: Estudar prospectivamente a freqüência de complicações em pacientes tratados com warfarina e acompanhados no Ambulatório de Anticoagulação da Faculdade de Medicina de Botucatu da Universidade Estadual Paulista. MÉTODOS: Pacientes sorteados entre os agendados para consulta de junho de 2002 a fevereiro de 2004. Na primeira consulta, foi preenchida ficha com dados de identificação e clínicos. A cada retorno, ou quando o paciente procurou o hospital por intercorrência, foi preenchida ficha com a razão normatizada internacional, existência e tipo de intercorrência e condições de uso dos antagonistas da vitamina K. RESULTADOS: Foram acompanhados 136 pacientes (61 homens e 75 mulheres, 99 com tromboembolismo venoso e 37 com doença arterial; 59 pacientes eram de Botucatu, e 77, de outros municípios. Foram registradas 30 intercorrências: nove não relacionadas ao uso da warfarina e 21 complicações hemorrágicas (38,8 por 100 pacientes/ano. Uma hematêmese foi considerada grave (1,9 por 100 pacientes/ano. As demais foram consideradas moderadas ou leves. Não houve óbitos, hemorragia intracraniana ou necrose cutânea. A única associação significante foi da freqüência de hemorragia com nível médio de razão normatizada internacional. CONCLUSÃO: Nossos resultados mostram a viabilidade desse tratamento em pacientes vasculares em nosso meio, mesmo em população de baixo nível socioeconômico, quando tratados em ambulatório especializado.OBJECTIVE: To prospectively study the frequency of complications in patients treated with warfarin followed at Botucatu Medical School. METHODS: Patients randomly selected among those with appointments scheduled from June 2002 to February 2004. At the first appointment, a protocol was filled with identification and clinical data. At every return or when the patient went to the hospital due to clinical events, another form was filled with the international normalized ratio, existence and type of clinical event and the conditions of use of vitamin K antagonists. RESULTS: A total of 136 patients (61 men and 75 women, were followed; 99 patients with venous thromboembolism and 37 with arterial disease; 59 were from Botucatu and 77 were from other municipalities. Thirty clinical events were registered: nine of them were not related to the use of warfarin and 21 were hemorrhagic complications (38.8 per 100 patients-year. One hematemesis was considered severe (1.9 per 100 patients-year. The others were considered moderate or mild. There were no deaths, intracranial hemorrhage or cutaneous necrosis. The only significant association was frequency of hemorrhage and average international normalized ratio level. CONCLUSION: Our results demonstrate the feasibility of this treatment in vascular patients in our country, even in socially and economically poor populations, when treated in specialized clinics.

  8. Anticoagulant properties of a crude sulfated polysaccharide from the red marine alga Halymenia floresia (Clemente) C. Agardh = Propriedades anticoagulantes de um polissacarídeo sulfatado bruto da alga marinha vermelha Halymenia floresia (Clemente) C. Agardh

    OpenAIRE

    Rodrigo César das Neves Amorim; José Ariévilo Gurgel Rodrigues; Márjory Lima Holanda; Paulo Antônio de Souza Mourão; Norma Maria Barros Benevides

    2011-01-01

    Alternative sources of anticoagulants have arisen as a result of the increasing demand for safer anticoagulant clinical therapy, and the sulfated polysaccharides of seaweeds have gained attention in biomedicine. In this study, crude sulfated polysaccharide fractions (denominated Hf1, Hf2 and Hf3) were obtained from the red marine algaHalymenia floresia and the anticoagulant properties of a soluble crude polysaccharide fraction (Hf2s) were assayed. The three differential extractions yielded 38...

  9. Estudio del comportamiento mecánico de gelés físicos termorreversibles obtenidos a partir de copolímeros tribloques de PS-b-poli(etileno/butileno-PS en un disolvente selectivo del bloque central

    Directory of Open Access Journals (Sweden)

    Hernáez, E.

    2001-04-01

    Full Text Available The thermoreversible gelation of three triblock copolymers polystyrene-bpoly( ethylene/butylene-b-polystyrene, with different molar mass and a similar chemical composition, in n-octane was studied. The solvent is selective for the middle poly(ethylene/butylene block of the copolymers. The influence of the molar mass of the three copolymers on the gelation and on the mechanical properties of the gels was analysed. The sol-gel transition temperatures, Tgel, have been determined and they increase with the copolymer concentration and the copolymer molar mass. On the other hand, the mechanical properties of the different gels were examined through oscillatory shear and compressive stress relaxation measurements. The concentration dependence of the elastic storage modulus, G’, for the three copolymer studied fit a sole straight line in a doublelogarithmic scale and its slope (2.22 is close to that expected for systems in good solvents (2.25. As the temperature is near to the sol-gel transition temperature, the elastic modulus are smaller and the relaxation rates are higher.

    Se ha estudiado la influencia del peso molecular del copolímero en la formación de geles físicos termoreversibles de copolímeros tribloque de la forma poliestireno-b-poli(etileno/butileno-b-poliestireno (SEBS en n-octano y en sus propiedades mecánicas. Se ha determinado la temperatura de formación de los geles, Tgel, concluyendo que éstas aumentan con la concentración y el peso molecular del copolímero. Por otra parte, se han medido las propiedades mecánicas de los geles empleando ensayos de torsión y relajación de tensión, en función de la concentración de copolímero. La dependencia doble logarítmica del módulo G' con la concentración de copolímero para los tres SEBS se ajusta a una línea recta de pendiente 2,22, próxima a la predicha para geles preparados químicamente (2,25. Cuanto más próxima está la temperatura de medida a la de formación del gel los módulos elásticos obtenidos para los tres copolímeros son menores y la relajación es más rápida.

  10. Estudio del comportamiento mecánico de gelés físicos termorreversibles obtenidos a partir de copolímeros tribloques de PS-b-poli(etileno/butileno)-PS en un disolvente selectivo del bloque central

    OpenAIRE

    Hernáez, E.; Inchausti, I; Quintana, J. R.; Katime, I.

    2001-01-01

    The thermoreversible gelation of three triblock copolymers polystyrene-bpoly( ethylene/butylene)-b-polystyrene, with different molar mass and a similar chemical composition, in n-octane was studied. The solvent is selective for the middle poly(ethylene/butylene) block of the copolymers. The influence of the molar mass of the three copolymers on the gelation and on the mechanical properties of the gels was analysed. The sol-gel transition temperatures, Tgel, have been de...

  11. Procedimiento para recuperar polietileno y aluminio de hojas de aluminio recubiertas de polietileno de residuos de envases tipo "pack"

    OpenAIRE

    Corma, Avelino; Primo Millo, Jaime

    1997-01-01

    El procedimiento utiliza disolventes orgánicos tales como hidrocarburos clorados o no y comprende las siguientes etapas: a) Troceado del material, b) extracción del polietileno con un disolvente orgánico, c) separación en caliente del aluminio de la solución obtenida en b), d) separación del polietileno disuelto bien por enfriamiento, de la solución hasta una temperatura inferior a 60ºC y separación del sólido que precipita, bien por evaporación del disolvente, en el que cualquiera de las ...

  12. It ain'?t over till it'?s over: A global perspective on the Great Moderation-Great Recession interconnection

    OpenAIRE

    Fabio C. Bagliano; Claudio Morana

    2015-01-01

    A large-scale model of the global economy is used to investigate the structural determinants of the Great Moderation and the transition to the Great Recession (1986-2010). Beside the global economy perspec- tive, the model presents the novel feature of a broad range of included ?nancial variables and risk factors measures. The results point to the relevance of various mechanisms related to the global monetary policy stance (Great Deviation), ?nancial institutions? risk taking behavior (Great ...

  13. Ehitusmaavarad ümber puhkes poliitiline kemplemine. Ettevõtjad loodavad kindlust tuleviku ees / Ain Alvela ; kommenteerinud Veljo Haube ja Enno Reinsalu

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Valitsus on kinnitanud ehitusmaavarade arengukava aastani 2020 ja sinna on sisse kirjutatud ka Nabala karstiala lubjakivivarud, kuigi enne 6. märtsil toimunud parlamendivalimisi oli lubatud, et need jäetakse arengukavast välja. Tõstetakse ka ressursitasusid

  14. It Don't Mean a Thing if It Ain't Got Musicality: A Music-First Method for Teaching Historically Rooted Jazz Dance

    Science.gov (United States)

    Liebhard, Erinn

    2015-01-01

    This article proposes a method for teaching jazz dance technique according to music concepts and prioritizing deep embodiment of music. This method addresses what can be seen as a disconnect between current practices and historical understanding in jazz dance today, a gap that can be bridged with education empowering students to make innovative…

  15. Õnnistus : [luuletused] / Charles Baudelaire ; tlk. Johannes Semper, Ants Oras, August Sang, Ilmar Laaban, Ain Kaalep, Indrek Hirv, Jaan Kross

    Index Scriptorium Estoniae

    Baudelaire, Charles, 1821-1867

    2006-01-01

    Sisu: Õnnistus ; Albatross ; Ülenemine ; Vastavusi ; Kutse teekonnale ; Muusika ; Elav tungal ; Vaenlane ; Ebaõnn ; Mees ja meri ; Ilu ; Hiigelnaine ; Hümn ilule ; Kalliskivid ; Eksootiline lõhn ; Raibe ; Vampiir ; Pihtimus ; Kass ; Mis ütled, vaene hing ; Lõhnapudel ; Sume laotus ; Kutse teele ; Sügissonett ; Öökullid ; Olematuse maitse ; Spliin : "Mu mälestuste last on nii painajalik..." ; Spliin : "Ma olen nii kui vürst, vürst sajulisel maal..." ; Mõrane kell ; "Nagu põhjatu taevas, öös tummuv ja mustav..." ; Kell ; Maastik ; Päike ; Punajuukselisele kerjustüdrukule ; Luik ; Hämarus ; Mäng ; Somp ja udud ; Pariisi unenägu ; Hommikuhämarik ; Üksildaste vein ; Üks märtritar ; Beatrice ; Aabel ja Kain ; Armastajate surm ; Vaeste surm ; Matk ; Lunahind ; Ühe pilgu lubadused. Eluloolisi andmeid autori kohta lk. 703

  16. Things ain't what they ought to be: social forces underlying racial disparities in rates of sexually transmitted diseases in a rural North Carolina county.

    Science.gov (United States)

    Thomas, J C; Thomas, K K

    1999-10-01

    Social forces shaping a region can also affect behaviors that facilitate the transmission of sexually transmitted diseases (STDs), including HIV. We sought to understand the social forces underlying high rates of infection, particularly among blacks, in a rural county of North Carolina in which 40% of the county is black. In the context of ongoing research on STDs we collected information from archival data on the county since the 1940s and interviewed local residents knowledgeable about the county's history. We present local data in the context of national economic and demographic trends. Successive changes in the national economy and farming policies disproportionately affected black farmers. A rural ghetto formed when poor blacks left their farms to seek work in the central town of the county. Segregationist housing policies and race-based differentials in employment opportunities exacerbated the concentration of poverty. Migration to northern industrial cities, predominantly by skilled black men, decreased the social capital of the community and lowered the ratio of men to women. Poverty, income disparity, social capital and the ratio of men to women can all affect the behaviors that facilitate transmission of STDs. Knowledge of social forces and their effects is critical for designing and evaluating interventions to prevent STDs and to decrease extreme racial disparities in rates of disease. PMID:10475671

  17. Justiitsminister Langi umbusaldamine kogub hoogu / Tuuli Koch; kommenteerinud Andrus Ansip, AIn Seppik, Valdur Lahtvee, Karel Rüütli, Andres Herkel, Sven Mikser

    Index Scriptorium Estoniae

    Koch, Tuuli

    2009-01-01

    Reformierakonna valitsuspartner IRL ja opositsioon ei mõista justiitsminister Rein Langi otsust ajutise siseministrina kustutada küberrünnakuga seotud Sergei Markovi nimi Schengeni mustast nimekirjast

  18. Paneeldiskussioon (fonogrammilt lühendatult) / Ain Heinaru, Rein Vaikmäe, Rein Raud, Hardi Tullus, Urve Lippus, Andres Tali, Martin Zobel

    Index Scriptorium Estoniae

    2006-01-01

    Projekti "Eesti doktoriõppe kvaliteedi, tulemuslikkuse ja jätkusuutlikkuse tagamise süsteem" (2005-2008) II konverentsi "Doktorid Eesti tuleviku arengumootoriks" paneeldiskussioonist, millel arutleti doktoriõppe rahastamise ning doktoriõppe korralduse ja doktorandi juhendamise teemadel

  19. A nickel ain't worth a dime anymore: the illusion of money and the rapid encoding of its true value.

    Directory of Open Access Journals (Sweden)

    Rongjun Yu

    Full Text Available People often evaluate money based on its face value and overlook its real purchasing power, known as the money illusion. For example, the same 100 Chinese Yuan can buy many more goods in Tibet than in Beijing, but such difference in buying power is usually underestimated. Using event related potential combined with a gambling task, we sought to investigate the encoding of both the real value and the face value of money in the human brain. We found that the self-reported pleasantness of outcomes was modulated by both values. The feedback related negativity (FRN, which peaks around 250ms after feedback and is believed to be generated in the anterior cingulate cortex (ACC, was only modulated by the true value but not the face value of money. We conclude that the real value of money is rapidly encoded in the human brain even when participants exhibit the money illusion at the behavioral level.

  20. Education and Modernization in Egypt. Selections from Seminars Organized by Ain Shams University, Cairo for the American Association of Colleges for Teacher Education (1972 and 1973).

    Science.gov (United States)

    Salah El-Din Kotb, Yusef, Ed.

    This book presents selections from seminars whose purpose was to provide American teacher educators and faculty from related disciplines with a first-hand exposure to the modernization process in the Arab Republic of Egypt. The analysis of this topic focuses on three major areas affected in the modernization process: education, culture, and…

  1. Maastikusõiduk UTV aitab tööd teha ja lõõgastuda / Ain Alvela ; kommenteerinud Tanel Rütman

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2015-01-01

    Analoogselt ATVga (ingl k All Terrain Vehicle - iga maastiku sõiduk) võib ka UTVd (ingl k Utility Terrain Vehicle - vahend maastikul liikumiseks) käsitleda nii tarbesõidukina väiksemate maatööde tegemiseks või raskestiläbitaval maastikul liikumiseks kui ka lihtsalt adrenaliinilaksu pakkuva meelelahutajana

  2. It ain't over when it's over: The adoption and sustainability of minority protection rules in new EU member states

    Directory of Open Access Journals (Sweden)

    Liudmila Mikalayeva

    2009-12-01

    Full Text Available This paper conducts a multi-value Qualitative Comparative Analysis (QCA of the formal adoption and sustainability of minority protection rules in four new EU member states (Poland, Romania, Estonia, Latvia over a twelve-year period including pre- and post-accession phases (1997-2008 and five minority protection related issue areas (non-discrimination, language use, education, citizenship, integration of Roma based on four conditions (external incentives, government position, veto players, size of minorities, in order to investigate under which external and domestic conditions minority protection and non-discrimination measures are adopted, maintained or revoked in new member states before and after accession to the EU.

  3. "That Ain't No Ninja Turtles": The Prevalence and Influence of Popular Culture in the Talk and Writing of Prekindergarten Children

    Science.gov (United States)

    Kissel, Brian T.

    2011-01-01

    This article describes how 2 classrooms of 4-year-old children incorporated popular media (cartoons, television shows, video games, movies, and music) into their conversations with peers during writing. The findings assert that (a) children naturally incorporate popular culture into their writing, (b) children include popular culture in their…

  4. Revised astrochronology for the Ain el Beida section (Atlantic Morocco): No glacio-eustatic control for the onset of the Messinian Salinity Crisis

    NARCIS (Netherlands)

    Krijgsman, W.; Gaboardi, S.; Hilgen, F.J.; Iaccarino, S.; Kaenel, E. de; Laan, Erwin van der

    2004-01-01

    Glacio-eustatic sea level lowering has often been proposed as a key mechanism for explaining the onset of the Mediterranean evaporites during the Messinian Salinity Crisis (MSC). To examine the role of glacio-eustacy during the progressive isolation of the Mediterranean in more detail, we reinvestig

  5. SEMEN CHARACTERISTICS OF CROSSBRED (FRIESIAN X SAHIW AL AND SAHIWAL YOUNG BULLS MAINT AINED UNDER SUB-TROPICAL CONDITIONS OF PUNJAB

    Directory of Open Access Journals (Sweden)

    Ahsan-ul-Haq, R.H. Mirza and I.A. Zahid

    2003-04-01

    Full Text Available Comparative studies of semen characteristics were carried out in 50% crossbred (Friesian X Sahiwal and purebred Sahiwal young bulls maintained under sub-tropical conditions at Research Institute of Physiology of Animal Reproduction, Bhunikey and Semen Production Unit. Qadirabad, respectively. Semen was collected on weekly intervals for a period of one year. The semen characteristics (mean+SE, i.e., volume per ejaculate (ml, mass motility (0-5 score, individual motility of spermatozoa (%, dead and abnormal spermatozoa (% were 5.62+0.14, 1.25+0.04, 50.50+0.93, 25.78+0.91 and 27.15+0.97, respectively in crossbred bulls. The corresponding values for these semen characteristics in Sahiwal bulls were 3.64+0.09, 1.36+0.04, 60.55+ 0.33, 27.73+0.87 and 15.41+0.86, respectively. These semen parameters differed significantly (P<0.05 between crossbred and Sahiwal bulls. It may be concluded from this study that the semen characteristics in crossbred (Friesian x Sahiwal bulls ~'ere poorer than purebred Sahiwal bulls.

  6. Investigating the performance of TiN and TiAIN coatings on milling cutter used for machining bimetal steel strip

    OpenAIRE

    Sarwar, Mohammed; Haider, Julfikar

    2009-01-01

    Surface engineering of cutting tools (single point or multipoint) through advanced coatings (e.g., TiN) has contributed towards considerable improvement of tool life, productivity and machining quality [1] by modifying the tool substrate. New coating species (e.g., TiAlN) are also being developed to further improve the performance of cutting tools. In this study, milling tests were carried out with a TiN and TiAlN coated milling cutter to compare their performance. Physical Vapour Deposition ...

  7. Ain't No Crab, PWN Got A Brand New Bag: Correlated radio and X-ray Structures in Pulsar Wind Nebulae

    CERN Document Server

    Roberts, M S E; Gaensler, B M; Brogan, C L; Tam, C R; Romani, R W; Roberts, Mallory S.E.; Lyutikov, Maxim; Gaensler, Bryan M.; Brogan, Crystal; Tam, Cindy R.; Romani, Roger W.

    2004-01-01

    The traditional view of radio pulsar wind nebulae (PWN), encouraged by the Crab nebula's X-ray and radio morphologies, is that they are a result of the integrated history of their pulsars' wind. The radio emission should therefore be largely unaffected by recent pulsar activity, and hence minimally correlated with structures in the X-ray nebulae. Observations of several PWN, both stationary (sPWN) and rapidly moving (rPWN), now show clear morphological relationships between structures in the radio and X-ray with radio intensity variations on the order of unity. We present high-resolution X-ray and radio images of several PWN of both types and discuss the morphological relationships between the two wavebands.

  8. Ain't No Crab, PWN Got A Brand New Bag: Correlated radio and X-ray Structures in Pulsar Wind Nebulae

    OpenAIRE

    Roberts, Mallory S. E.; Lyutikov, Maxim; Gaensler, Bryan M.; Brogan, Crystal; Tam, Cindy R.; Romani, Roger W.

    2004-01-01

    The traditional view of radio pulsar wind nebulae (PWN), encouraged by the Crab nebula's X-ray and radio morphologies, is that they are a result of the integrated history of their pulsars' wind. The radio emission should therefore be largely unaffected by recent pulsar activity, and hence minimally correlated with structures in the X-ray nebulae. Observations of several PWN, both stationary (sPWN) and rapidly moving (rPWN), now show clear morphological relationships between structures in the ...

  9. Ain't I a Leader: Exploring the Leadership Narratives of Black Female Undergraduate Student Leaders at a Predominantly White Institution

    Science.gov (United States)

    Warren, Lamara D.

    2009-01-01

    Traditionally, research on student leadership development has been exclusive and focused primarily on the experiences of White, male undergraduate student leaders. Therefore, there is little knowledge about the leadership development of Black female undergraduate students. This exploratory study attempts to fills a gap in the student leadership…

  10. Ain't Nothin' Like the Real Thing. Motivation and Study Processes on a Work-Based Project Course in Information Systems Design

    Science.gov (United States)

    Helle, Laura; Tynjala, Paivi; Olkinuora, Erkki; Lonka, Kirsti

    2007-01-01

    Background: Advocates of the project method claim that project-based learning inspires student learning. However, it has been claimed that project-based learning environments demand quite a bit of self-regulation on the part of the learner. Aims: Consequently, it was tested whether students scoring low in self-regulation of learning experienced…

  11. Tallinnas sündinud tehing : briti ärimees küsis ameeriklastelt radioaktiivse aine eest 9 miljardit krooni / Priit Hõbemägi

    Index Scriptorium Estoniae

    Hõbemägi, Priit, 1957-

    2007-01-01

    Tallinnas elanud Briti kodanik Christopher Benbow pakkus 2003. aastal USA-s müüa radioaktiivset ainet strontsium-90. C. Benbow viitas kohtus Tarmo Urbile, T. Urb eitab sidet kogu looga. Lisa: Kuidas petisest sai petetav

  12. Evaluation de la Contamination des Dispositifs Médicaux (Cathéters et Sondes)à l'hôpital de Ain_Témouchentj

    OpenAIRE

    Boudelal, KHEIRA

    2015-01-01

    Dans le présent travail, 53 prélèvements ont été réalisé (43 cathéters et 10 sondes urinaires) 29/53ont presenté des cultures positives: 17 cultures sont des Gram positives et 14 cultures sont des Gram négatifs. L'antibiogramrne de certaines souches identifiées vis-à-vis d' une gamme d'antibiotiques a confirmé la multirésistance des souches de Staphylococcus aureus. La capacité de certaines baeteries à former un biofiim a été étudiée par deux méthodes: la Méthode de Plaque de C...

  13. T'ain't the way you say it, it's what you say : Perceptual continuity of voice and top-down restoration of speech

    NARCIS (Netherlands)

    Clarke, Jeanne; Gaudrain, Etienne; Chatterjee, Monita; Başkent, Deniz

    2014-01-01

    Phonemic restoration, or top down repair of speech, is the ability of the brain to perceptually reconstruct missing speech sounds, using remaining speech features, linguistic knowledge and context. This usually occurs in conditions where the interrupted speech is perceived as continuous. The main go

  14. "She Don't Know I Got It. You Ain't Gonna Tell Her, Are You?" Popular Culture as Resistance in American Preschools

    Science.gov (United States)

    Henward, Allison S.

    2015-01-01

    Popular culture is often a site of contestation in preschool classrooms. A multisited ethnographic design revealed preschools employed varied strategies to limit popular culture. Teacher and children's actions were considered through Michel de Certeau's (1984) concepts of tactics and strategies. Interviews and observations revealed children were…

  15. I Ain't Gonna Make It. Comparing Job Demands-Resources and Attrition Intention Between Senior Teachers and Senior Employees of Six Other Occupational Categories in Flanders.

    Science.gov (United States)

    Van Droogenbroeck, Filip; Spruyt, Bram

    2016-07-01

    Teachers are often thought to retire early and have more stress and burnout than other human service professionals. In this article, we investigate attrition intention amongst senior teachers and senior employees of six other blue- and white-collar occupational categories using the Job Demands-Resources (JD-R) model. We followed a two-step approach. First, analysis of variance and logistic regression analysis was used to assess differences in the level of job demands, resources, and attrition intention between occupations for male and female employees separately. Subsequently, multiple group path analysis was used to assess the invariance of the JD-R model across occupational groups and genders. We used representative data gathered in Flanders among 6,810 senior employees (45 years or older). Results indicate that there are differences in the determinants of attrition intention between men and women. The differences in attrition intention are minimal between occupations once controlled for job demands and resources. In addition, the JD-R model is largely invariant across white-collar occupations and gender. We provide support for both the energetic and motivational process of the JD-R model. PMID:27166367

  16. Impact of Dust from Ore Processing Facilities on Rain Water Collection Tanks in a Tropical Environment--The Obvious Source "Ain't Necessarily So".

    Science.gov (United States)

    Gulson, Brian; Korsch, Michael; Bradshaw, Anthony

    2016-02-01

    Concerns have been expressed that dust from the minerals processing facilities at Karumba Queensland Australia have resulted in elevated lead (Pb) concentrations in rain water tanks. The ores derived from the Century mine some 304 km from the port. High precision Pb isotopic measurements on environmental samples have been undertaken to evaluate the source of Pb in rainwaters and acid digests from roof wipes and gutter wipes. There does not appear to be any relationship between sample location and the processing facility but samples from the area subject to the prevailing winds show the highest contribution of Century Pb. All gutter wipes (82 to 1270 µg Pb/wipe) have contributions of Century ore ranging from 87% to 96%. The contribution of Century ore to five roof wipes (22 to 88 µg Pb/wipe) ranges from 89% to 97% and in the other two samples there is a mix of Century and Broken Hill Pb. Three of the seven rainwater have contributions of Century ore Pb ranging from 33% to 75%. Two of the other four rainwater samples have the highest water Pb concentrations of 88 and 100 µg/L and their isotopic data show Broken Hill Pb contributions ranging from 77% to 80%. The source of the Broken Hill Pb is probably from the galvanized roofing material and/or brass fittings in the rainwater tanks. The discrimination between various sources is only detectable using high precision (204)Pb-based isotopic ratios and not the now common inductively coupled plasma mass spectrometry (ICP-MS ) data presentations of the higher abundance isotopes (208)Pb, (207)Pb and (206)Pb. Isotopic results for the waters demonstrate that apportioning blame where there is an obvious point source may not always be the correct conclusion. Nevertheless the isotopic data for the gutter wipes indicates that there was widespread contamination from the processing facilities throughout the town. PMID:26907319

  17. Cloning,characterization,and expression analysis of the DEAD-box family genes,Fc-vasa and Fc-PL10a,in Chinese shrimp (Fenneropenaeus chinensis)

    Institute of Scientific and Technical Information of China (English)

    周倩如; 邵明瑜; 秦贞奎; 康庆浩; 张志峰

    2010-01-01

    RNA helicases of the DEAD-box and related families are involved in various cellular processes including DNA replication,DNA repair,and RNA processing.However,the function of DEAD-box proteins in aquaculture species is poorly understood at molecular level.We obtained the full-length cDNA sequences of two genes encoding helicase-related proteins,Fc-vasa and Fc-PL10a,from the testes of Chinese shrimp,Fenneropenaeus chinensis.The two predicted amino acid sequences contain all the conserved motifs characterized ...

  18. Mööbel vajab nišše ja ekspordiauke. Vallutamist ootab vana Euroopa / Ain Alvela ; kommenteerinud Ari Lustila, Heido Vitsur, Priit Tamm

    Index Scriptorium Estoniae

    Alvela, Ain, 1967-

    2011-01-01

    Olukorrast mööbliturul: edukamad on olnud korpusmööbliga tegelevad ettevõtted. Arvamust avaldavad ASi Suwem turundusjuht Mart Nilson ja OÜ Bellus Furnitur tootmisjuht Rolf Kristian Relander. Diagrammid

  19. This ain't the road of peace : the shepherdstown document (the israeli draft) and Barak's public messages do not signal peace

    NARCIS (Netherlands)

    Reinhart, T.

    2006-01-01

    [Background: Following the Shepherdstown's Syria-Israel talks, the US issued a concealed document summarizing the positions of the two sides. The Arab (London) paper 'Al Hayat' printed a summary draft of this document, based on Syrian sources. Israeli sources denied the authenticity of this ver

  20. I've got 99 problems but a phone ain't one: electronic and mobile health in low and middle income countries

    OpenAIRE

    Kumar, P.; Paton, C; Kirigia, D

    2016-01-01

    Mobile technology is very prevalent in Kenya-mobile phone penetration is at 88% and mobile data subscriptions form 99% of all internet subscriptions. While there is great potential for such ubiquitous technology to revolutionise access and quality of healthcare in low-resource settings, there have been few successes at scale. Implementations of electronic health (e-Health) and mobile health (m-Health) technologies in countries like Kenya are yet to tackle human resource constraints or the pol...

  1. Kuidas on läinud vene koolide eestikeelsele aineõppele üleminek? / Natalja Lapikova, Vjatšeslav Gussarov, Irene Käosaar

    Index Scriptorium Estoniae

    Lapikova, Natalja

    2008-01-01

    Küsimusele vastavad Tallinna Haridusameti hariduskorralduse teenistuse üldhariduse osakonna vanemspetsialist Natalja Lapikova, Tallinna Kesklinna Vene Gümnaasiumi direktor Vjatšeslav Gussarov ja HTM-i rahvusvähemuste hariduse osakonna juhataja Irene Käosaar

  2. Influence des pratiques agropiscicoles sur la biodiversité des étangs de la Dombes (Ain, France) en vue d'une valorisation de produits du terroir

    OpenAIRE

    Vallod, Dominique; Wezel, Alexander

    2010-01-01

    Dans le cadre d’un programme de recherche conduit en France pour produire des références alimentant le débat agriculture et biodiversité, une équipe de chercheurs de l’ISARA-Lyon mène un travail sur les relations entre pratiques agricoles et biodiversité dans une région d’étangs à vocation piscicole. Il s’agit de la Dombes, vaste région présentant une surface de près de 11 000 ha en eau. Ces étangs sont inscrits dans un paysage agricole constitué de cultures intensives, de prairies et de forê...

  3. Contribution à l'étude des techniques de multiplication arboricole dans la ferme de démonstration ITAFV. Ain Temouchent

    OpenAIRE

    BOURICHA, Rym

    2015-01-01

    L'utilisation des porte-greffes en viticulture est devenue indispensable depuis l'invasion phylloxérique de 1885 en Algérie. Les vignes de Vitis Vin jfera cultivées à l'époque « franc de pied » ont été décimées une à une par les dégâts importants occasionnés par l'insecte sur les racines, entrainant à plus ou moins brève échéance la mort des ceps. Le greffage sur des porte-greffes résistants d'origine américaine (Riparie, Rupestris, Bericindieri) est devenu ainsi indispensable et ...

  4. It Ain't the Heat, It's the Humanity: Evidence and Implications of a Knowledge-Based Consensus on Man-Made Global Warming

    Science.gov (United States)

    Jacobs, P.; Cook, J.; Nuccitelli, D. A.

    2013-12-01

    One of the most worrisome misconceptions among the general public about climate change is a belief that scientists disagree not only about the cause of the present climate change, but also whether or not the planet is currently warming. Recent surveys have demonstrated that an overwhelming consensus exists, both within the scientific literature and among scientists with climate expertise, that the planet is warming and humans are driving this climatic change. This disconnect, or 'consensus gap', between scientific agreement and public belief has significant consequences for public understanding of the reality and cause of climate change, as well as support for potential solutions. Ensuring that the consensus message is not simply broadcast but is also accepted as legitimate by the public appears to be a primary education and communications opportunity. While the existence of a consensus is not itself evidence of a position's truth, according to Miller (2013) scientific consensus can be taken as evidence that a position is true if it is 'knowledge-based', satisfying the conditions of social calibration, apparent consilience of evidence, and social diversity. We demonstrate that the scientific consensus on anthropogenic climate change is knowledge-based, satisfying Miller's criteria. In so doing, we hope to increase confidence in its use as an education and communications tool, and assure the public of its validity. We show the consensus is socially calibrated, based on common evidential standards, ontological schemes, and shared formalism. We establish that consilience of evidence points overwhelmingly to the reality of anthropogenic climate change by examining the evidence from several perspectives. We identify unique fingerprints expected as a result of increased greenhouse forcing, eliminate potential natural drivers of climate change as the cause of the present change, and demonstrate the consistency of the observed climate response with known changes in natural and manmade forcings across a wide variety of indices. Finally, we determine that the consensus is socially diverse, being geographically and disciplinarily varied, supported within public and private institutions, and endorsed by research organizations as well as groups with obvious financial incentives to deny it, such as fossil fuel companies. Additionally, we briefly discuss examples of purported incorrect consensus in climate research, and detail how they fail to satisfy one or more aspects of Miller's criteria. We conclude by discussing the key role that knowledge-based consensus can potentially play in education, influencing public beliefs about climate change, and increasing support for solutions.

  5. Cambios en la etiología, resultados y características de los pacientes con hemorragia digestiva aguda grave a lo largo del periodo 1999-2005 Changes in the etiology, outcome, and characteristics of patients with acute gastrointestinal bleeding between 1999 and 2005

    Directory of Open Access Journals (Sweden)

    A. Garrido

    2007-05-01

    Full Text Available Objetivos: analizar la evolución, a lo largo del periodo 1999-2005, de las siguientes variables de los pacientes ingresados por hemorragia digestiva (HD en una Unidad de Sangrantes: etiología, patología de base, consumo de AINE/anticoagulación y mortalidad. Material y métodos: durante el periodo 1999-2005 se ha estudiado la evolución de las siguientes causas de HD que requirieron ingreso en la Unidad de Sangrantes: ulcus duodenal (UD, ulcus gástrico (UG, hipertensión portal (HPT y otros. De igual forma se ha analizado la evolución en el porcentaje de enfermos ingresados con patología de base, consumo de fármacos AINE/anticoagulantes y mortalidad. Resultados: se han incluido 1.611 pacientes en el estudio con una edad media de 60,45 años (59,7-61,2, 76,41% hombres (74,3-78,5. La UD fue responsable del 22,20% de episodios (20,2-24,3, la UG del 18,40% (16,6-20,4 y la HPT del 33,60% (31,3-36,0. De forma global realizaban tratamiento con AINE el 34,5% (32,6-37,3, anticoagulación el 7,1% (6,0-8,6, presentaban patología de base el 72,6% (70,4-74,8 y la mortalidad global fue del 6,27% (5,16-7,59. A lo largo del periodo estudiado se constató un aumento de los pacientes con patología de base (p Objectives: to analyze the evolution of the following variables in patients admitted to a Blood Unit for gastrointestinal bleeding throughout 1999-2005: etiology, comorbid diseases, use of NSAIDs/anticoagulants, and mortality. Material and methods: we analyzed the evolution of the following causes of GIB that required admission to the Blood Unit from 1999 to 2005: duodenal ulcer (DU, gastric ulcer (GU, portal hypertension (PHT, and others. We also analyzed changes in the percentage of patients admitted with comorbid disease, use of NSAIDs/anticoagulants, and mortality. Results: 1,611 patients with a mean age of 60.45 years (59.7-61.2 were included in this study; 76.41% were males (74.3-78.5. DU was the cause of bleeding in 22.20% of cases (20

  6. Protein (Cyanobacteria): 83958 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available EEESYYPPTVKAENQLPTGVPVGPPIATPIETRTPVMEETWDEDEWQEARVVPPVQKAQAVPYVEYEEDLEEDNWGGIEPEPERVYDTPVYEARTVEEYEYQEQPEDMWDDDENPKPYNPPPLNIPERQKEKAPEYEEEAG ... ...AYTKLISCEVITEAGEPLGKVRDFQFNIEDGKIYSIIIASLGIPQIPEQIISTYELSIEEVVSSGPNRLIVFEGAEEKITQITVGLLERLGIGRPPWER...ain protein Stanieria cyanosphaera PCC 7437 MTTENIRLRSEFLNTQVIARNSGKRLGVVKEILVDIDRREIVALGLRDNFLSVSGIPKYMYLESIRQTGDVILVEDENVIEDIEIE

  7. Protein (Cyanobacteria): 70598 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available aining protein Cyanothece sp. PCC 7425 MAHLAQRRSENVSGDFYVDSTCIDCDTCRWMAGEVFYAAGDQSAVYHQPVNEQERLRAMQALLSCPTAS...SIEKPLAGTDPIQLEPDLLIIPVPGHTRGHTVLLYRNQFLFTGDHLAWSDQQHQLIAFRYACWYSWSELTKSMQKLLDYSFEWVLPGHGRRFHSDRQTMAQQLEKCIAWMENQ ... ...IGTVEKPTDIKAVQQSFPIPIAENVYHCGYHAESSFGAASYLIQRPEGNVLVDSPRFAPSLVRQLEAMGGIRYLYLTHRDDVADHQKFRAHFGCDRLLHQEEITASTR

  8. Influence of anticoagulants and blood storage on hematological values in tambaqui, Colossoma macropomum - DOI: 10.4025/actascibiolsci.v20i0.4465 Influência de anticoagulantes e estocagem de sangue em valores hematológicos de tambaquis, Colossoma macropomum - DOI: 10.4025/actascibiolsci.v20i0.4465

    OpenAIRE

    Marcos Tavares-Dias; Elziane F. Silva Sandrim

    1998-01-01

    Foram empregados, neste estudo, tambaqui Colossoma macropomum Cuvier, 1818 (Osteichthyes: Characidae). O sangue de cada animal foi coletado através de punção da veia caudal utilizando-se seringas heparinizadas (5000 IU) ou contendo EDTA 10%. Após a coleta do sangue procedeu-se imediatamente à medida do hematócrito e da taxa de concentração da hemoglobina. Posteriormente, o sangue foi deixado em temperatura ambiente, onde permaneceu durante 10 horas, quando se realizou novamente a medida do pe...

  9. Kirjutaski endale elu pileti / Maarja Kangro

    Index Scriptorium Estoniae

    Kangro, Maarja, 1973-

    2010-01-01

    Arvustus: Pessoa, Fernando. Sõnum / tõlkinud Ain Kaalep, Maarja Kaplinski, Jüri Talvet ja Anneli Tuulik ; koost. Ain Kaalep ja Jüri Talvet. Tartu : Tartu Ülikooli Kirjastus, 2010. (Maailmakirjanduse tõlkevaramu)

  10. Precipitación de asfaltenos del crudo Maya en un sistema a presión

    OpenAIRE

    Guillermo Centeno; Fernando Trejo; Jorge Ancheyta; Antonio Carlos

    2004-01-01

    En este trabajo se presentan los resultados experimentales del efecto de la presión y la temperatura en la precipitación de asfaltenos del crudo Maya. Los experimentos se realizaron en un reactor Parr en una atmósfera de nitrógeno empleando n-heptano como disolvente. La presión se estudió en el intervalo de 15 a 25 kg/cm2 y la temperatura en el intervalo 40 a 100°C, manteniendo una relación volumétrica disolvente/crudo de 5 a 1. También se efectuaron pruebas ...

  11. Modelación del proceso de biofiltro percolador para el tratamiento de emisiones en aire de Compuestos Orgánicos Volátiles de elevada solubilidad en agua

    OpenAIRE

    San Valero Tornero, Pau

    2016-01-01

    La contaminación del aire producida por las emisiones a la atmosfera de compuestos orgánicos volátiles (COV) es una de las causas más importantes asociadas al deterioro de la calidad ambiental. Una de las fuentes principales de emisión de COV son las industrias que utilizan disolventes. En este sentido, las industrias deben hacer un esfuerzo por adaptar sus procesos productivos para minimizar el impacto ambiental. Sin embargo, las propiedades de los disolventes los convierten en indispensable...

  12. Procedimiento de obtención de materiales cerámicos transparentes de -alúmina policristalina dopada con ceria y producto obtenido por medio de dicho procedimiento

    OpenAIRE

    Torrecillas, Ramón; J. S. Moya; Álvarez-Clemares, I.

    2009-01-01

    Procedimiento de obtención de materiales cerámicos transparentes de -alúmina policristalina con ceria y producto obtenido por medio de dicho procedimiento. Comprende los pasos de: preparar suspensión de polvo de -alúmina en un disolvente mediante agitación; añadirle una disolución de sal de cerio como dopante mediante agitación; secar el producto del paso anterior eliminándose el disolvente; calcinar el producto del paso anterior; moler el producto del paso anterior;...

  13. Estudio del proceso de extracción de esterasa a partir de Plexaura homomalla y evaluación de su actividad enzimática

    OpenAIRE

    Rivas de la Vega, Yaelis; González Lavaut, José Antonio; Ávila González, Rizette; Ruiz Caballero, Ritsie; Sordo Martínez, Lissette; Castro Nodal, Mayra

    1999-01-01

    La aplicación de procesos enzimáticos en la química fina con empleo de disolventes orgánicos y acuosos constituye un campo de atractivo potencial para la obtención de compuestos biológicamente activos, entre ellos las prostaglandinas. En este trabajo se reportan los resultados del proceso de extracción del complejo prostaglandina-esterasa, enzima que resulta importante en la síntesis de diferentes prostaglandinas. Se realizaron diferentes procesos variando el volumen de disolvente utilizado y...

  14. Gene : CBRC-GGOR-01-1448 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available PGTSAPSTLGTSAPSTPGTTAPSTAGTSAPSTSGTSAPSTSGTSAPSKPTTSAPYTPGTSAPSIPGTSAPSTTGTSAPSTPGTSAPSTPGTSAPSKPGTSAPST...ain Friedlin] 1e-79 49% MCLALGSAGTADDVKLHPVACADTARSTPGTSAPSTPGTSAPSTPGTSAPSTSGISAPSTSGTSAPSTLGTSAPSKPGTSAPSKPGISAPSTSGISAPSTSGTSAPST...SGTSAPSTPGTSAPSKPGTSAPSKPGISAPYTPGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSKPGTSAPST...PGTSAPSTLGTSAPSTPGTSAPSTPGTSAPSKPGTSAPSMSGTSAPSTPGTSVPSKAGTSAPVDPGVLWGLERPLTDTEGRWLPPYVLL...RFDSSWRRWPATFPGLSITVELEPCEHPGRMGLRPKPQQATADPGSTLKRSCCSQEESKALASKKKEKVLPPEMFSNRLLKYSFFVFFRWSXXXXXX ...

  15. Gene : CBRC-MEUG-01-2558 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ain Friedlin] 3e-42 27% MSGRPLSPLWLRAMLSLALAAWSPVSALGLSGAERVTPAIHRRSGHGTQPGVVAQALAVLPDPAAVRAQVLGPGEVFTTAPAPS...RALAVLPKVSGVLEATKRTPTPDPESPPIYPAKRASQTLPPPVVTTRAPTLPSELPQTRAPGFLMPLAALMVTHTPVMVPASMPLARTSATSLVPASSSTA...HRTSTASCVPAQDSTTAPQTSAVSSGPSLSSILSPILVPSEMPAASCVPAQDSTTAPQTSAVSSGPSLSSILSPILVPSEMPAASCVPAQDSTTAPQTSAVSSGPS...LSSILSPILVPSEMPAASCVPAQDSTTAPQTSAVSSEPSLSSILSPILVPSEMPAASCVPAQDSTTAPQTSAVSSGPSLSSILSPILVPSEMPAASCVPAQDSTTAP...QTSAVSSEPSLSSILSPILVPSEMPAASCVPAQDSTTAPQTSAVSSGPSLSSILSEILVPSEMPAASCVPAQDSTTAPQTPAVSSGPS

  16. Anterior interosseous nerve syndrome diagnosis and intraoperative findings: A case report

    Directory of Open Access Journals (Sweden)

    Abdulla Aljawder

    2016-01-01

    Conclusion: Clinical suspicion should arise in the presence of isolated paralysis of the AIN-supplied muscles. MRI and electrodiagnostic studies will confirm the diagnosis and identify the etiology. The optimal treatment of AIN syndrome has not been established. We recommend surgical intervention in confirmed AIN syndrome from compression neuropathy, refractive to conservative therapy.

  17. Primeiro relato da podridão da estipe da pupunheira, causada por Phytophthora palmivora, no estado do Paraná First report of stem rot on peach palm caused by Phytophthora palmivora ain the State of Paraná

    Directory of Open Access Journals (Sweden)

    Álvaro F. dos Santos

    2004-12-01

    Full Text Available Phytophthora palmivora foi isolado de plantas de pupunheira (Bactris gasipaes com sintomas de podridão da estipe, no Paraná, em 2002. Testes de patogenicidade e o subseqüente reisolamento do fungo confirmaram a hipótese de que P. palmivora é o agente causal da podridão do estipe. Este é o primeiro relato de P. palmivora causando podridão do estipe na pupunheira no estado do Paraná.Phytophthora palmivora was isolated from infected peach palm (Bactris gasipaes plants with stem rot symptoms in Paraná State, in 2002. Pathogenicity tests and subsequent reisolations of P. palmivora confirmed the hypothesis that this fungus was the causal agent of the disease. This is the first report of P. palmivora causing stem rot on peach palm (Bactris gasipaes in the southern State of Paraná.

  18. Mise en place d`un protocole expérimental de mesure de taux de MES par ADCP. Modélisation de la confluence lône de Ricotti - rivière d`Ain

    OpenAIRE

    Drevet, C.

    2004-01-01

    Suspended matters concentrations in natural streams can be measured by various means: direct measurements are implemented according to standard procedures, indirect measurements are based on the attenuation of an optic or acoustic signal. Among these, ADCP measurements - Acoustic Doppler Current Profiler, a device dedicated to gauging by exploration of the velocities - requires a calibration from direct probes in order to get suspended matters concentration and flux contours through a given r...

  19. Stiiliharjutused / Raymond Queneau ; prantsuse k. tlk. Jana Porila, värsstekstid tlk. Ain Kaalep, Toim. Hasso Krull, Järelsõna: M. V. [Märt Väljataga

    Index Scriptorium Estoniae

    Queneau, Raymond

    1995-01-01

    Sisu: Märkmed; Kahekordselt; Litootes; Metafoorselt; Tagasivaateline; Üllatused; Unenägu; Prognoosid; Vikerkaar; Kõhklused; Täpsustused; Subjektiivne pool; Teistpidi isiklik; Jutustus; Liitsõnad; Eitus; Animism; Anagrammid; Ametlik kiri; Annotatsioon; Teadmatus; Aleksandriinid; Mina igatahes; Hüüatused; Ja siis; Ülev; Ülekuulamine; Komöödia; Vahelaused; Kummituslik; Kõnetlus; Sonett; Gustatiivne; Taktiilne; Telegraafiline; Tanka; Kirjeldus; Hüüdsõnad; Ootamatu

  20. Order-disorder in In3+ perovskites: The example of A(In2/3B''1/3)O3 (A=Ba, Sr; B''=W, U)

    International Nuclear Information System (INIS)

    We describe the preparation and structural characterization of four In-containing perovskites from neutron powder diffraction (NPD) and X-ray powder diffraction (XRPD) data. Sr3In2B''O9 and Ba(In2/3B''1/3)O3 (B''=W, U) were synthesized by standard ceramic procedures. The crystal structure of the W-containing perovskites and Ba(In2/3U1/3)O3 have been revisited based on our high-resolution NPD and XRPD data, while for the new U-containing perovskite Sr3In2UO9 the structural refinement was carried out from high-resolution XRPD data. At room temperature, the crystal structure for the two Sr phases is monoclinic, space group P21/n, where the In atoms occupy two different sites Sr2[In]2d[In1/3B''2/3]2cO6, with a=5.7548(2) A, b=5.7706(2) A, c=8.1432(3) A, β=90.01(1)o for B''=W and a=5.861(1) A, b=5.908(1) A, c=8.315(2) A, β=89.98(1)o for B''=U. The two phases with A=Ba should be described in a simple cubic perovskite unit cell (S.G. Pm3-bar m) with In and B'' distributed at random at the octahedral sites, with a=4.16111(1) A and 4.24941(1) A for W and U compounds, respectively. - Graphical abstract: The structure of the new uranium-based double perovskite Sr3In2UO9 is described and the true symmetry of the other title compounds are revisited. The presence of long-range ordering in the Sr samples, by contrast with the Ba perovskites, is related with the smaller unit cell and B-B distances in the Sr oxides, promoting the electrostatic repulsions between highly charged W6+ and U6+ cations as driving force for the long-range B-site ordering

  1. Cultural tourism 2011 - Projekt Central Baltic INTERREGIV A Project Cultural Tourism 2011 - Developing cultural tourism as a joint network in Capitals of Culture 2011 võtab kokku ja plaanib jätku / Maritta Hiltunen, Ain Hinsberg

    Index Scriptorium Estoniae

    Hinsberg, Ain

    2012-01-01

    Soome organisatsiooni Matkailun ja elämystuotannon osaamisklusteri (OSKE) algatatud koostööprojektist Tallinna ja Turu kultuuripealinna vahel, mille laiem eesmärk on edendada Läänemere regiooni kultuuriturismi alast koostööd ning luua Läänemere regiooni hõlmav kultuuriturismi bränd

  2. Maison forte et motte castrale.Distinction fonctionnelle et analyse du mobilier archéologique : comparaison de la maison forte du Pré-Putet (Yzeure,Allier) et la motte de Villars-les-Dombes (Ain).

    OpenAIRE

    Berthon, Amélie

    2006-01-01

    Le début des années 1980 a marqué les prémices d'une distinction entre les mottes castrales et les plates formes quadrangulaires. Si l'on a d'abord observé des différences typologiques dans le but d'établir une éventuelle chronologie, la question de la fonction et du statut de ces fortifications de terre s'est vite posée. Réelle fortification ou lieu de pouvoir symbolique ? Force est d'admettre que chaque cas semble particulier, que des types apparaissent à l'échelle d'une région et que, suiv...

  3. EFFE C T OF MAITLAND V S MULLIGAN MOBILIS A TION TE CHNIQUE ON UPPER THORA CIC SPINE IN P A TIENT S WITH NON-SPE CIFIC NE CK P AIN - A C OMP ARA TIVE S TUD Y

    Directory of Open Access Journals (Sweden)

    Kaur Inderpreet

    2013-12-01

    Full Text Available Background and introduction:Neck pain is a frequent and disabling complaint in general population. One ofthe most common causes of neck pain is mechanical dysfunction of cervical spine.Although diverse methodshave been proposed for increasing cervical range of motion, joint mobilisation has been confirmed aseffectivein several studies.The current study will compare the effect of three different treatment protocols i.e. Maitlandmobilisation, Mulligan mobilisation and conventional treatment on upper thoracic spine on female patientswith neck pain. This study tries to find out new effective method for reducing the problem of pain.Method:30 subjects were selected according to the inclusion and exclusion criteria were randomly dividedinto three groups: Maitland, Mulligan mobilization along with conventional treatment. Pre and post reading at0 day, 14thday and 21thdaywere recorded for NDI and NPRS scale.Results:After three week protocol it was found that all the three groups showed significant improvement inNDI and NPRS score within the group. The present finding shows that Group B (Maitland shows significantimprovements in the NDI score and Group C (Mulligan would shows significant improvements in the NPRSscores in the patients with nonspecific neck pain.Conclusion:The present study shows that Maitland mobilisation along with the conventional treatment proveto be more effective in improving NDI and NPRS scores in patients with nonspecific neck pain than Mulliganmobilisation along with the conventional treatment.

  4. In-situ preparation of TiC/Al2O3, TiN/Al2O3 and TiN/AIN composites from alkoxide-derived precursors

    International Nuclear Information System (INIS)

    This paper discusses the reaction between furfuryl alcohol (FuOH) and the hydrolysis product of a mixture of Ti(O-n-Bu)4 and Al(O-sec-Bu)3 (Al:Ti = 1:1) that resulted in the formation of soluble polymeric solids. Pyrolysis of these polymers in argon yielded TiC/Al2O3 composite at 1250 degrees C. When these polymers were pyrolyzed in ammonia, TiN/Al2O3 or TiN/AlN composite was formed. All these composites showed fine microstructure and excellent homogeneity. Furthermore, the structure and pyrolysis chemistry of these polymeric precursors as well as the microstructure of the pyrolysis products were studied by means of FTIR, TGA, XRD, SEM, TEM, STEM, Auger, elemental analyses etc

  5. Влияние структуры напыляемых слоев TiN и AIN на свойства нанокомпозитного TiAIN покрытия

    OpenAIRE

    Броздниченко, Анатолий; Горчаков, Сергей; Рязанцев, Сергей; Сенкевич, Станислав; Тильте, Константин; Хинич, Иосиф

    2006-01-01

    Исследованы наноструктурные покрытия TiAlN, полученные при последовательном нанесении TiN и AlN на упрочняемый материал. Эти покрытия являются более износостойкими, чем обычные гомогенные покрытия, их большая твердость объясняется кубической структурой слоев AlN, навязываемой промежуточными слоями TiN. Морфология исследованных пленок контролировалась методами атомно-силовой микроскопии....

  6. MR imaging findings of anterior interosseous nerve lesions

    Energy Technology Data Exchange (ETDEWEB)

    Dunn, Andrew J. [Royal Liverpool University Hospital, Department of Medical Imaging, Liverpool (United Kingdom); Salonen, David C. [University of Toronto, Toronto Western Hospital, Department of Medical Imaging, Toronto, Ontario (Canada); Anastakis, Dimitri J. [University of Toronto, Toronto Western Hospital, Division of Plastic Surgery, Toronto, Ontario (Canada)

    2007-12-15

    To study and characterise the MR imaging findings of lesions of the anterior interosseous nerve (AIN). Magnetic resonance imaging (MRI) findings of the forearm of ten patients referred to our institution with suspected AIN lesions were retrospectively studied. Five healthy volunteers with normal forearm MRI findings formed a control group. Two musculoskeletal radiologists assessed the forearm musculature for oedema in the distribution of the AIN, median, posterior interosseous and radial nerves on T2-weighted (T2W) fat-saturated sequences. T1-weighted (T1W) images were assessed and graded for the presence of muscle atrophy and fatty involution. Six patients had undergone surgical exploration; five of these had surgically confirmed AIN compression. Four patients had diagnoses other than AIN compression made on imaging features. Of the cases of proven AIN compression, oedema within the pronator quadratus (PQ) muscle was identified in all cases. PQ atrophy and fatty involution were seen in three (43%) surgically confirmed cases. Cases 2 and 3 also demonstrated oedema in the flexor digitorum profundus (FDP)1 and FDP2 muscles. These cases also showed oedema in the flexor-carpi radialis (FCR) and FDP3/FDP4 muscles, respectively. The four cases of non-AIN compression demonstrated muscle oedema patterns that were atypical for the AIN distribution. They included a rupture of the flexor pollicis longus (FPL) tendon, brachial neuritis, amyotrophic lateral sclerosis and compression of the proximal median nerve. MRI is a useful investigation in the diagnostic workup of AIN syndrome. AIN syndrome is likely when there is diffuse oedema of AIN innervated muscles on T2W fat-saturated images. The most reliable sign of an AIN lesion is oedema within the PQ. Oedema in the flexor carpi radialis, FDP3 and FDP4, although not in the classical distribution of the AIN, does not preclude the diagnosis of AIN syndrome. (orig.)

  7. "Kurja lillede" kuus ärakeelatud luuletust / Charles Baudelaire ; saatesõna: Marek Tamm

    Index Scriptorium Estoniae

    Baudelaire, Charles

    2000-01-01

    Sisu: Kalliskivid / tlk. Ain Kaalep ; Lethe / tlk. Märt Väljataga ; Temale, kes on liiga rõõmus / tlk. Ain Kaalep ; Lesbos / tlk. Ilmar Laaban ; Äraneetud naised (Delphine ja Hyppolyte) / tlk. Ain Kaalep ; Vampiiri metamorfoosid / tlk. August Sang. Orig.: Les Bijoux ; Le Léthé ; A celle qui est trop gaie ; Lesbos ; Femmes damnées. Delphine et Hippolyte ; Les Métamorphoses du vampire

  8. A comparison between cytology and histology to detect anal intraepithelial neoplasia.

    OpenAIRE

    Ruiter, A.; Carter, P.; Katz, D. R.; Kocjan, G.; Whatrup, C; Northover, J; Mindel, A

    1994-01-01

    INTRODUCTION--Anal intraepithelial neoplasia (AIN), which may be a precursor of anal carcinoma, has been identified on histology following minor anal surgical procedures, in particular the removal of perianal condylomata, in increasing numbers of homosexual and bisexual men. Anal cytology has recently been proposed as a useful method of identifying AIN lesions. OBJECTIVE--To compare anal cytology with histology as a method of detecting AIN. METHODS--215 homosexual and bisexual men attending a...

  9. Aluminium nitrate ceramics: A potential UV dosemeter material

    DEFF Research Database (Denmark)

    Trinkler, L.; Bøtter-Jensen, L.; Berzina, B.

    The ceramic material AIN-Y2O3 is proposed as a potential ultraviolet radiation (UVR) dosemeter using optically stimulated luminescence (OSL) and thermally stimulated luminescence (TL). Experimental studies have shown that AIN ceramics exhibit attractive characteristics suitable for practical UV...... Al2O3:C; and (4) a large dynamic range TL signal (5 orders of magnitude). Although there is relatively high fading, it is demonstrated that AIN is a feasible material for UVR dosimetry using short integration times....

  10. Risk Factors for the Presence of Anal Intraepithelial Neoplasia in HIV+ Men Who Have Sex with Men

    OpenAIRE

    Richel, Olivier; Henry J C de Vries; Dijkgraaf, Marcel G. W.; van Noesel, Carel J. M.; Prins, Jan M.

    2013-01-01

    Objective Anal Intraepithelial Neoplasia (AIN) is present in the majority of HIV+ men who have sex with men (MSM) and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. Methods We screened 311 HIV+ MSM by high resolution anoscopy, with biopsies of suspect lesions. HIV-parameters, previous sexual transmitted infections (STI’s), anal pathology, sexual practices and substance use were ana...

  11. Acute interstitial nephritis with acetaminophen and alcohol intoxication

    OpenAIRE

    Alexopoulou Iakovina; Fruchter Lauren L; Lau Keith K

    2011-01-01

    Abstract Drug-induced acute interstitial nephritis (AIN) represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well...

  12. Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis Cost-effectiveness analysis of the use of celecoxib for the treatment of osteoarthritis

    OpenAIRE

    Moreno, A.; Vargas, E.; Soto, J.; J. Rejas

    2003-01-01

    Antecedentes: Los antiinflamatorios no esteroideos (AINE), utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI) graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2), ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en e...

  13. Análisis coste-efectividad del empleo de celecoxib en el tratamiento de la artrosis

    OpenAIRE

    Moreno A; Vargas E.; Soto J.; Rejas J

    2003-01-01

    Antecedentes: Los antiinflamatorios no esteroideos (AINE), utilizados en el tratamiento de la artrosis, pueden producir reacciones adversas gastrointestinales (GI) graves. Celecoxib, un inhibidor específico de la ciclooxigenasa 2 (COX-2), ha demostrado una eficacia equivalente a los AINE convencionales con un mejor perfil de tolerabilidad y seguridad. Objetivo: La finalidad de este estudio ha sido realizar un análisis coste-efectividad sobre el uso de celecoxib frente a los AINE clásicos en e...

  14. Kaks debüüti / Lilian Vellerand

    Index Scriptorium Estoniae

    Vellerand, Lilian, 1932-

    1997-01-01

    "Shakespeare'i kogutud teosed" ("The Complete Works of William Shakespeare") Rakvere Teatris, lavastaja Ain Prosa ja Friedebert Tuglase - Ingomar Vihmari "Hei, Luciani!" Ugalas, lavastaja Ingomar Vihmar

  15. Trimethoprim-sulfamethoxazole induced acute interstitial nephritis in renal allografts; clinical course and outcome.

    LENUS (Irish Health Repository)

    Garvey, J P

    2009-11-01

    Acute interstitial nephritis (AIN) secondary to trimethoprim-sulfamethoxazole (TMP-SMX) is well documented as a cause of acute renal failure in native kidneys. TMP-SMX is the standard prophylactic agent against pneumocystis carinii (PCP) used in the early post-transplant period, however, it has to date only been indirectly associated with AIN in renal allografts. DESIGN, SETTING, PARTICIPANTS AND MEASUREMENTS: We describe eleven renal transplant patients with acute allograft dysfunction in whom a transplant biopsy demonstrated primary histopathologic features of allergic AIN, all of whom were receiving TMP-SMX in addition to other medications known to cause AIN.

  16. Kihutav politseijuht Antropov testis Saaremaal Hummerit / Risto Berendson, Tuuli Koch

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2003-01-01

    Politsei pressishefi sõnul testis politseijuht Robert Antropov Saaremaal julgestuspolitsei tarbeks maastikuautot Hummer. Endise politseijuhi Ain Seppiku kommentaare. Tabel: Tavaline politseimaastur võrreldes Hummeriga

  17. Arc-Discharge Synthesis and Microstructure Characterization of AlN Nanowires

    Institute of Scientific and Technical Information of China (English)

    Zhijie LI; Zhiqi SHEN; Fu WANG; Lianlong HE

    2006-01-01

    AIN nanowires with a hexagonal structure were synthesized using an improved arc-discharge method and their microstructures were characterized using a high-resolution transmission electron microscope. The synthesized AIN nanowires were of various shapes. Their diameters ranged from 20 to 110 nm and the lengths were up to 20μm. Most of the AIN nanowires were coated by an amorphous layer of aluminum oxide. Fabrication yield was about several grams. The growth mechanism was considered to be a vapor-liquid-solid process and an Al droplet formed on the top of as-grown AIN nanowire played a role of catalyst.

  18. Métodos de síntesis para la obtención de poliuretanos de celulosa

    Directory of Open Access Journals (Sweden)

    Liván Alba Gutiérrez

    2009-01-01

    materiales políméricos obtenidos, la celulosa microcristalina (MCC mostró los mejores resultados desde el punto de vista morfológico y en cuanto a la solubilidad de los productos sintetizados en disolventes tradicionales. El método sonoquímico demostró sus ventajas en cuanto a rapidez y completamiento de las reacciones, lo que se traduce en mejores propiedades para los materiales sintetizados.

  19. Tratamiento de aguas contaminadas con compuestos organoclorados mediante hidrodecloración catalítica

    OpenAIRE

    Padilla Vivas, Beatriz

    2008-01-01

    Los efluentes acuosos contaminados por compuestos clorados son un importante problema medioambiental, tanto por su toxicidad intrínseca (bioacumulables, efectos crónicos y agudos, efectos cancerígenos, mutagénicos y teratogénicos), como por su alta capacidad para contaminar medios ecológicamente sensibles (aguas superficiales y subterráneas). Los compuestos organoclorados constituyen una familia de compuestos muy amplia y con numerosas aplicaciones como disolventes, reactivos e intermedios en...

  20. Granada modificado con restricción geométrica

    Directory of Open Access Journals (Sweden)

    Susana González Santana

    2013-03-01

    Full Text Available El desarrollo de la química computacional la ha convertido en una sólida e importante disciplina de la química moderna. Numerosos métodos han sido implementados con objetivos muy diversos. La metodología de Hipersuperficie de Múltiples Mínimos (MMH permite el estudio de la influencia de disolventes sobre un soluto, y en general de interacciones débiles, haciendo uso de las herramientas de la química cuántica y la termodinámica estadística. Con el objetivo de explorar el espacio de configuraciones se crea un ensemble N, V, T empleando el programa GRANADA para generar  celdas o supermoléculas de configuraciones diferentes del (o los disolvente(s que rodean al soluto. El programa GRANADA no permite restringir la generación de configuraciones del disolvente a una zona del espacio específica respecto al soluto. Esta restricción es útil para evitar la exploración innecesaria (y el consiguiente costo computacional de las zonas del espacio que no son de interés o no representan la realidad física del problema. Por este motivo, en este trabajo se modificó el código fuente del GRANADA para implementar la restricción espacial en la generación de las celdas. Además presentamos un ejemplo de las ventajas de aplicar la restricción para la modelación de la influencia de grupos superficiales en la adsorción de Hexaclorociclohexano en Carbón Activado utilizando un modelo simple.

  1. Pärast kõike / intervjueerinud Veiko Märka

    Index Scriptorium Estoniae

    1998-01-01

    Vestlusring: Ain Mäeots, Merle Jääger, Helena Merzin, Margus Jaanovits, Riho Kütsar. Madis Kõivu võrukeelse näidendi 'Omavahelisi jutuajamisi tädi Elliga' lavastamisest Vanemuise teatris, lavastaja Ain Mäeots. Ka Kauksi Ülle kommentaar

  2. Kurvad laulud, mõne rõõmsa imekspanekuga : Tagasivaade ETV teleteatrile hooajal 1995/96 / Sven Karja

    Index Scriptorium Estoniae

    Karja, Sven, 1968-

    1996-01-01

    Telelavastused: Betti Alveri ja Talvo Pabuti 'Trimalhio pidu' (lav. Talvo Pabut); 'Viimane lend' (stsen. ja lav. Valentin Kuik); August Mälgu ja Ain Prosa 'Tuli sinu käes' (lav. Ain Prosa); Viktor Slavkini ja Andres Noormetsa 'Tagasi kadunud maailma' (lav. Andres Noormets); 'Amatsoonid' (stsen. ja lav. Andres Puustusmaa ja Kalev Lepik)

  3. Solution for engineering and archaeological problems with subsurface voids - the microgravity survey

    Czech Academy of Sciences Publication Activity Database

    Mrlina, Jan

    Al Ain : United Arab Emirates University, 2011, s. 112-115. [International conference on engineering geophysics /1./. Al Ain (AE), 11.12.2011-14.12.2011] Institutional research plan: CEZ:AV0Z30120515 Keywords : microgravity survey * subsurface voids * gravity field Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  4. Structure and stability of (AlN)_n clusters

    Institute of Scientific and Technical Information of China (English)

    武海顺; 张聪杰; 许小红; 郑兰荪; 张乾二

    2000-01-01

    AIN and Al2N2 have been observed in the record of time-of-flight mass-spectra as positive ions. Associating with density functional theory(DFT) B3LYP method with 6-31G* basis set, we have carried out the optimizing calculations of the geometry, electronic state and vibrational frequency for (AIN)n (n = 1-15) clusters, moreover, discussed the character of the chemical bond and thermodynamical stability and explained the experimental mass spectra. The results show that there do not exist AI-AI and N-N bonds and only exists AI-N bond in the ground state structures of (AIN)n clusters; and the "magical number" regularity of (AIN)n is those whose atom number Is 4, 8, 12,16, 20, etc, all of which are times of four.

  5. Effects of rare earth oxide additives on the thermal behaviors of aluminum nitride ceramics

    Institute of Scientific and Technical Information of China (English)

    YAO Yijun; WANG Ling; LI Chuncheng; JIANG Xiaolong; QIU Tai

    2009-01-01

    The effects of Y_2O_3 and Er_2O_3 on the sintering behaviors, thermal properties and microstructure of AIN ceramics were investigated. The ex-perimental results show that the sintering temperature can be decreased; the relative density and thermal behavior can be improved by adding rare earth oxide in AIN ceramics. For AIN ceramics with 3 wt.% Er_2O_3 additive, the relative density is 98.8%, and the thermal conductivity reaches 106 W·m~(-1)·K~(-1). The microstructure research found that no obvious aluminum erbium oxide was found in AIN ceramics doped with 3 wt.% Er_2O_3, which favored the improvement of the thermal conductivity of AIN ceramics.

  6. Risk Factors for the presence of anal intraepithelial neoplasia in HIV+ men who have sex with men.

    Directory of Open Access Journals (Sweden)

    Olivier Richel

    Full Text Available OBJECTIVE: Anal Intraepithelial Neoplasia (AIN is present in the majority of HIV+ men who have sex with men (MSM and routine AIN-screening is subject of discussion. In this study we analysed a wide range of potential risk factors for AIN in order to target screening programs. METHODS: We screened 311 HIV+ MSM by high resolution anoscopy, with biopsies of suspect lesions. HIV-parameters, previous sexual transmitted infections (STI's, anal pathology, sexual practices and substance use were analysed in relation to AIN by uni- and multivariable logistic regression. RESULTS: AIN (any grade was found in 175/311 MSM (56%, high grade (HGAIN in 30%. In the univariable analysis, years since HIV diagnosis, years of antiretroviral therapy (cART and anal XTC use decreased AIN risk, while a history of anogenital warts and use of GHB (γ-hydroxybutyric acid increased this risk. In the multivariable analysis three parameters remained significant: years of cART (OR=0.92 per year, p=0.003, anal XTC use (OR=0.10, p=0.002 and GHB use (OR=2.60, p=0.003. No parameters were significantly associated with HGAIN, but there was a trend towards increased risk with anal enema use prior to sex (>50 times ever; p=0.07 and with a history of AIN (p=0.06. CD4 count, STI's, anal pathology, smoking, number of sex partners and anal fisting were not associated with (HGAIN. CONCLUSION: GHB use increases the risk for AIN, while duration of cART and anal XTC use are negatively correlated with AIN. Given the high prevalence of AIN in HIV+ MSM, these associations are not helpful to guide a screening program.

  7. SerumLevelofMicroRNA-181ainPatientswithLungSquamousCancerandItsEffectonCell Function%肺鳞癌患者血清miRNA-181a的表达及其对肺癌细胞功能的影响

    Institute of Scientific and Technical Information of China (English)

    李晓丽; 曹国良; 施惠华; 凌丹芸; 王传慧

    2012-01-01

      [目的]探讨肺鳞癌患者血清中microRNA-181a(miR-181a)水平的变化及其对人肺鳞癌细胞生物学功能的影响.[方法]选择56例肺鳞癌患者和50名健康成人,采用stem-loop定量PCR的方法检测其血清中miR-181a的表达变化;体外实验采用CCK8和Transwell小室实验检测miR-181a对人肺鳞癌细胞株NCI-H226增殖、侵袭和迁移能力的影响.[结果]miR-181a在肺鳞癌患者血清中表达较健康成人显著降低(P<0.05);miR-181a可明显抑制肺鳞癌细胞NCI-H226的增殖、侵袭和迁移.[结论]在肺鳞癌患者miR-181a是一种保护性的微小RNA,具有较好的诊断和治疗前景.

  8. Macroscopic small bowel mucosal injury caused by chronic nonsteroidal anti-inflammatory drugs (NSAIS use as assessed by capsule endoscopy Valoración mediante cápsulas endoscópicas de las lesiones intestinales mucosas causadas por antiinflamatorios no esteroideos (AINE

    Directory of Open Access Journals (Sweden)

    A. Caunedo-Álvarez

    2010-02-01

    Full Text Available Objective: to evaluate the type, frequency, and severity of macroscopic small bowel mucosal injury after chronic NSAID intake as assessed by capsule endoscopy (CE, as well as to correlate the severity of gastroduodenal and intestinal damage in these patients. Material and methods:a prospective, endoscopist-blind, controlled trial. Sixteen patients (14F/2M; age: 57.06 ± 10.16 yrs with osteoarthritis (OA on chronic therapy with NSAIDs underwent CE and upper gastrointestinal endoscopy (UGE. Seventeen patients with OA (9F/2M; age: 57.47 ± 9.82 yrs who did not take NSAIDs were included as a control group. A scale ranging from 0 to 2 (0 = no lesions, 1-minor = red spots or petechiae, denuded areas and/or 1-5 mucosal breaks; 2-major = > 5 mucosal breaks and/or strictures, or hemorrhage was designed to assess the severity of small bowel mucosal injuries. Results: CE found intestinal lesions in 75% (12/16 of patients in the study group and in 11.76% (2/17 of controls (p < 0.01. Seven out of 16 NSAID consumers (43.75% and none in the control group (0% had a major small bowel mucosal injury (p < 0.01. The percentages of patients with grade 1 and 2 gastroduodenopathy in the study group, as assessed by UGE, were 37.14 and 23.81%, respectively. There was no significant difference in the rate of major enteropathy between patients with none or minor gastroduodenal injury, and those with major gastroduodenopathy (43.75 vs. 40%; p = N.S.. Conclusions: chronic NSAID intake is associated with a high rate of small bowel mucosal injuries. Our data have failed to demonstrate a relationship between the severity of gastroduodenal and intestinal injury.

  9. Decree no. 2010-402 from April 23, 2010, giving permission to Electricite de France to create, on the territory of the town of Saint-Vulbas (Ain, France), a basic nuclear facility named activated waste conditioning and storage facility (ICEDA)

    International Nuclear Information System (INIS)

    The purpose of the nuclear facility named 'activated waste conditioning and storage facility' (ICEDA) is to process and store the wastes generated by the dismantlement of the Creys-Malville nuclear power plant (Superphenix reactor), and those generated by the exploitation, maintenance and modification of the PWR power plants of Electricite de France (EdF). The facility comprises a reception/evacuation hall, a processing unit, a waste storage building, an effluent treatment plant and some annexe buildings with offices and technical workshops. Wastes are of 3 type: medium activity/long living, low to medium activity/short living, and low activity/long living. The facility ensures the storage of the Chooz A power plant source rods as well. This decree defines the specifications of the facility in the following domains: confinement of radioactive or toxic compounds, protection against internal and external risks (fire hazards, explosions, earthquakes, other environmental risks), exploitation of the facility, management of liquid and gaseous effluents and other wastes generated by the facility. (J.S.)

  10. TiC含量和烧结工艺对AlN-TiC复相陶瓷烧结性能的影响%Effect of TiC Content and Sintering Process on Sintering Properties of AIN-SiC Composite Ceramics

    Institute of Scientific and Technical Information of China (English)

    程卫华

    2012-01-01

    Taking A1N and TiC as raw materials, the A1N-TiC composite ceramics were prepared by hot pressing sintering process, and the effects of TiC content and sintering process on sintering properties of A1N-SiC composite ceramics were studied. The results show that the composite ceramics didnlt generate new phase and consisted of A1N and TiC phases during sintering. The compact composite ceramics could be prepared after sintering at 1 900 ℃ for 1 h, the relative density reached more than 99%and the TiC content had no effect on sintering properties of the composite ceramics.%以A1N和TiC粉为原料,采用热压烧结工艺制备AlN-TiC复相陶瓷,研究了TiC含量、烧结工艺对复相陶瓷烧结性能的影响。结果表明:在烧结过程中复相陶瓷没有新相生成,由AlN和TiC两相组成;在1900℃下烧结1h后,可以制备出致密的A1N-TiC复相陶瓷,其相对密度达到了99%以上,TiC的加入量对复相陶瓷的烧结性能无影响。

  11. Cirugía maxilofacial ambulatoria en pacientes con riesgo hemostático

    OpenAIRE

    José M. Díaz Fernández; . Ricardo Pérez Arredondo

    1999-01-01

    Se presenta un método de acción para exodoncia y cirugía bucal mediana en personas con riesgo hemostático, para lo cual se analizaron 68 intervenciones en 57 pacientes: 49 con trastornos anticoagulantes crónicos y 8 con algún tipo de hemopatía, que fueron realizadas en todos los casos con aplicación de trombina en el alvéolo o superficie alveolar. En más de la mitad de los pacientes medicados con anticoagulantes, éstos se suspendieron antes y después del acto quirúrgico, con hemostasia posope...

  12. Old and New Oral Anticoagulants. Pharmacological Perspective

    OpenAIRE

    Marques da Silva, P

    2012-01-01

    A terapêutica anticoagulante oral está em mudança. A varfarina e o acenocumarol constituem ainda o padrão anticoagulante oral em muitos contextos clínicos. Mas, face às limitações dos antivitamínicos K, resultantes do lento início de ação farmacológica, da janela terapêutica estreita, do metabolismo variável dependente do citocromo P450, das múltiplas interações com fármacos e com alimentos e do risco potencial de complicações hemorrágicas, nos últimos anos tem-se procurado afirmar, na ...

  13. Nanotechnological applications and pharmacogenetic research

    OpenAIRE

    Era, Daniel

    2012-01-01

    Abstract (Italian version) Questo progetto di dottorato di ricerca è finalizzato allo studio dell'applicazione nella pratica clinica attuale della medicina di comunità, di tests farmacogenetici utili sia per la determinazione di polimorfismi noti per influenzare la dose iniziale di warfarin nella terapia anticoagulante orale, sia per l’analisi dei polimorfismi associati alla risposta di farmaci antidepressivi. Gli studi si sono perciò svolti in collaborazione con la medicina...

  14. ¿Sabía usted? Anticuerpos antifosfolípidos

    OpenAIRE

    Javier Molina

    1992-01-01

    Los anticuerpos antifosfolípidos comprenden varias poblaciones de inmunoglobulinas, que pueden ocasionar falsos positivos biológicos con el VDRL, interferir con el complejo activador de la protrombina (anticoagulante lúpico) o reaccionar con elfosfolípido cardiolipina en una prueba de enzimoinmunoanálisis (EIA).

  15. Análise da freqüência de trombofilia em pacientes com atrofia branca de Milian Frequency analysis of thrombophilia in patients with atrophie blanche

    OpenAIRE

    Aline Donati Jorge; Bruno de Carvalho Fantini; Evandro A. Rivitti; Benabou, Joseph E; Cidia Vasconcellos; Paulo Ricardo Criado

    2007-01-01

    FUNDAMENTOS - Atrofia branca de Milian ou vasculopatia livedóide é entidade clinicopatológica rara, cuja patogênese não é completamente compreendida. OBJETIVOS - Avaliar casos de atrofia branca de Milian para verificar a prevalência de diversas trombofilias. MATERIAL E MÉTODOS - Quatorze pacientes foram submetidos a exames laboratoriais incluindo pesquisa de fator V (Leiden), protrombina mutante, dosagem de antitrombina, proteína S e C, pesquisa de anticorpos anticardiolipina e anticoagulante...

  16. Studio su alcuni marker emocoagulativi (Trombomodulina, Proteina C e Antitrombina III) in gatti affetti da cardiomiopatia primitive a diverso stadio clinico

    OpenAIRE

    Di Loria, Antonio

    2006-01-01

    Trombomodulina (TM) è un proteoglicano di membrana dell’endotelio vasale, presente sulla superficie endoteliale che presenta una elevata affinità nei confronti della trombina. Il complesso trombomodulina/trombina possiede un alto potere anticoagulante attraverso l’attivazione della proteina C, che a sua volta inattiva i fattori plasmatici Va e VIIIa della via intrinseca, impedendo, come fine ultimo, la formazione di ulteriori molecole di trombina. L’antitrombina III è una glicoproteina sint...

  17. Optimum sintering conditions for optical properties of translucent aluminum nitride ceramics

    Institute of Scientific and Technical Information of China (English)

    KANECHIKA Yukihiro; AZUMA Masanobu; FUKUSHIMA Hiroshi

    2009-01-01

    High translucency is one of the excellent properties of AIN ceramics because of its wide optical band gap energy of 6.2 eV. We have achieved success in producing AIN ceramic tube of 98% total visible light transmittance at 0.6 mm thick tube wall by applying an improved sintering technique. This AIN ceramic was produced by sintering at 1880℃ using Ca3Al2O6 as a sintering additive and in reduction atmosphere to remove the sintering additive from the final sintered material. After the sintering, the annealing with Al2o3 was carried out to improve the transmittance of AIN ceramics. The amount of metal impurities and carbon were 27ppm and 100ppm, respectively. It is noteworthy that the amount of oxygen in AIN ceramics after the annealing was 0.36wt% which was higher than the 0.07wt% of the as-sintered AIN ceramics. Therefore, total transmittance was improved by the oxygen doping. On the other hand, thermal conductivity of AIN after the annealing was lowered by 35% compared with that of as-sintered AIN. Positron Annihilation Lifetime (PAL) measurement was applied to investigation of a relationship between the total transmittance and lattice defects. The present PAL results confirms the presence of negatively charged atomic-size vacancies that is aluminum site vacancies and also sug-gests the increase in the concentration of the vacancies after the annealing compared with that of the as-sintered material. However, it can be concluded that there is no relation between aluminum site va-cancies and the light transmittance of AIN ceramics.

  18. Hydrogeological and isotopic studies for selected springs in Sinai Peninsula

    International Nuclear Information System (INIS)

    This paper deals with the hydrogeology and isotopic composition of water samples collected from selected spring in sinai (e.g. Algudierate, Alqusiema, qidis and Isram) in order to identify their genesis, their interaction with the host rocks and mixing trend. Results of isotopic composition have indicated the similarity in the hydrogeologic situation of Ain qidis and Ain-al-gudierate, while Ain Isram has shown a marked difference in its stable isotope and this could be due to evaporation effect. The isotopic and hydrochemical constituents of the studied springs reflect eater of a meteoric origin with a possible contamination from surficial materials (evaporates) and deeper aquifers. 6 figs., 2 tabs

  19. The earliest human occupation of North Africa: a reply to
    Sahnouni et al. (2002)

    OpenAIRE

    Geraads, Denis; Raynal, Jean-Paul; Eisenmann, Vera

    2004-01-01

    In a series of papers, Sahnouni et al. (1996, 2002) and Sahnouni and de Heinzelin (1998) have reported the results of their renewed excavations atthe important Algerian localities of Ain Hanech and Ain Boucherit, first studied by Arambourg (e.g., Arambourg, 1970, 1979). According to the latest paper by Sahnouni and co-workers (Sahnouni et al., 2002), Ain Hanech would belong to the Olduvai subchron, dated to 1.77–1.95 Ma. This would make it by far the earliest North African site with evidence ...

  20. Processing of spent nickel catalyst for fat recovery

    Directory of Open Access Journals (Sweden)

    Ibrahim Nasir, Mohammad

    2002-06-01

    Full Text Available Spent nickel catalyst (SNC have the potential of insulting the quality of the environment in a number of ways. The disposal of SNC will have a pollution effect. Optimum recovery of fat from SNC , could save the environment and reduce the oil loss. Hexane has been the solvent of choice for oil extraction. Alternative solvents that are considered safer have been evaluated. Hexane, isopropanol, ethanol, and heptane were examined using soxhlet extraction. While hexane was more efficient in oil recovery from SNC, isopropanol proved to be very good, to clarifying separation of oil from waste material and also provide high solvent recovery compared to other solvents. Isopropanol extraction with chill provided separation of miscella into two phases: lower oil–rich and an upper solvent – rich. It saved much energy of vaporization for distilling. An aqueous extraction process with immiscible solvent assisted was tested. Solvent like hexane added to SNC, and water added later with continuous stirring. The mixture was stirred for about 30 minutes, prior to centrifugation. Aqueous process extracted less amount of oil compared to solvent extraction.El catalizador agotado de níquel (SNC tiene el potencial de dañar la calidad del medio ambiente de diversas formas. El depósito de SNC tendrá un efecto de polución. La recuperación óptima de la grasa a partir del SCN, podría conservar el medio ambiente y reducir la pérdida de aceite. El hexano ha sido el disolvente elegido para la extracción del aceite. También se han evaluado disolventes alternativos que son considerados seguros. Se han examinado hexano, isopropanol, etanol y heptano usando extracción con soxhlet. Mientras que el hexano fue el mas eficaz en la recuperación del aceite, el isopropanol demostró ser muy bueno para aclarar la separación del aceite a partir de la materia residual y también proporcionó una alta recuperación del disolvente en comparación con los otros

  1. Extraction of oil from pequi fruit (Caryocar Brasiliense, Camb. using several solvents and their mixtures

    Directory of Open Access Journals (Sweden)

    Antoniassi, R.

    2011-09-01

    Full Text Available In this study, the oil extraction process from pequi pulp using different solvents (hexane, acetone and ethyl alcohol and their mixtures was investigated, using a simplex-centroid design. The extraction occurred at 50°C, under stirring (22 Hz, for 16 hours. The solid-liquid ratio used was 1:10 (w/w. Higher yield values were obtained for extractions with acetone and hexane, especially their mixtures with ethanol. Iodine value, saponification value and refractive index did not differ significantly among the treatments. A higher acid value was obtained for the extraction with ethyl alcohol. Higher carotenoid contents were obtained for the extraction with acetone and ethyl alcohol as pure solvents. The fatty acid profile in the oil fraction of the extracts did not vary among the different types of solvents and their mixtures.En este trabajo fue estudiado el proceso de extracción de aceite de la pulpa de pequi utilizando diferentes disolventes (n-hexano, acetona y etanol y sus mezclas, empleando diseño central simplex. Las extracciones fueron realizadas a 50°C, durante 16 horas de agitación (22 Hz. La proporción sólido:líquido empleada fue 1:10 (p/p. Los mayores rendimientos fueron obtenidos para las extracciones con acetona y con hexano, especialmente cuando fueron mezclados con etanol. El índice de yodo, el índice de saponificación y el índice de refracción no difirieron significativamente entre los tratamientos. Los mayores valores de acidez se obtuvieron en la extracción con etanol. Los mayores contenidos en carotenoides se obtuvieron en las extracciones con acetona y etanol como disolventes puros. El perfil de los ácidos grasos en las fracciones de aceite de los extractos no presentó variación entre los diferentes tipos de disolventes y sus mezclas.

  2. Kes kaitseks Eesti ohvitsere NKVD-KGB laimu eest? / Peep Varju

    Index Scriptorium Estoniae

    Varju, Peep

    2008-01-01

    Autor polemiseerib Eesti Ekspressis ilmunud artiklitega Eesti endiste ohvitseride kohta, kus käsitletakse nende väidetavat koostööd KGBga. Vaatluse all on ohvitserid Ain Mere, Harald Nugiseks, Alfons Rebane ja Harald Riipalu

  3. Teatrikuul astuvad lavale Leo Saalep ja Jaan Poska / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2011-01-01

    19. veebruaril Vanemuise väikses majas esietenduvast Roman Baskini lavastusest "Tabamata ime" ja Rakvere Teatris esietenduvast Peeter Tammearu lavastusest "Eksperiment õhupumbaga". Tallinnas Jaan Poska majas 28. veebruaril esietenduvast Ain Mäeotsa lavastusest "Jaan Poska saaga"

  4. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2005-01-01

    Uutest heliplaatidest The All-American Rejects "Move Along", Devendra Banhart "Criple Crow", Rod Stewart "Thank For The Memory", Him "Dark Light", Status Quo "the Party Ain't Over Yet", Ricky Martin "Life", Barbara Streisand "Guilty Pleasures"

  5. President Meri annetas aumärke

    Index Scriptorium Estoniae

    1996-01-01

    Riigivapi I klassi orden Jaan Krossile ja Kalju Lepikule; Riigivapi III klassi orden Ain Kaalepile, Hilja Rüütlile (Aili Helm); Riigivapi IV klassi orden Voldemar Millerile, Juhan Peeglile ja Ants Viiresele

  6. Klassitsheski ideal krasotõ v biznes-tsentre

    Index Scriptorium Estoniae

    2003-01-01

    Viru kaubanduskeskuse ette planeeritakse August Weizenbergi skulptuuri "Hämarik" pronkskoopiat. Idee on pärit projekteerijatelt Vilen Künnapult ja Ain Padrikult. Krista Kodres ei pea kohta klassikalisele skulptuurile sobivaks

  7. The Comparison between the Statistical Heuristic Search and A

    Institute of Scientific and Technical Information of China (English)

    张Po; 张铃

    1989-01-01

    In order to further unravel the principle and performance of the statistical heuristic seach algorithm S A,in this paper,in comparison with A * search,the hypothesis,performance and computational complexity of SA are discussed.

  8. Plaat

    Index Scriptorium Estoniae

    2008-01-01

    Laseringi kauplustes müügilolevatest heliplaatidest: Compromise Blue "Loomad on lahti", Mari Boine "Remixed vol. 2 - It Ain't Necessarily Evil", Me, Myself and I "Aastaajad", Whitesnake "Good To Be Bad", Estelle "Shine"

  9. Moroz i rozõ / Lev Livshits

    Index Scriptorium Estoniae

    Лившиц, Лев, 1924-2013

    2006-01-01

    Ain Järvega Kadrioru pargist. Kadrioru Lastepargi tekkimise ajaloost ja uue Lastepargi rajamisest. Ehitatakse uus Lastemuuseumi hoone kuhu kolib Kotzebue tänavalt Tallinna Nukumuuseum. Nukumuuseumist ja muuseumidest Kadriorus, ka KUMU hoonest

  10. Professional preparation of teachers - problems and possibilities. The Estonian case / Katrin Poom-Valickis, Ülle Saarits, Helle Sikka... [jt.

    Index Scriptorium Estoniae

    2008-01-01

    Artikkel kirjeldab õpetajakoolituse olukorda Eestis aastal 2003. Aineõpetajate, klassiõpetajate ja koolieelsete lasteasutuste õpetajate ettevalmistusest Tallinna Ülikoolis ning nende karjääriperspektiive tööturul

  11. Materjalide jagamisest võidavad kõik / Maarja Soone

    Index Scriptorium Estoniae

    Soone, Maarja

    2011-01-01

    Koolitusest Colchesteris - Content and Language Integrated Learning, mis tähendab võõrkeelset aineõpet, kus vajadusel võetakse kasutusele ka emakeel, mistõttu viidatakse sellele tihti kui kakskeelsele õppele

  12. Há uma associação entre anti-inflamatórios não-esteroides e nefropatia induzida por contraste? ¿Hay una asociación entre antiinflamatorios no esteroides y nefropatía inducida por contraste? Is there an association between non-steroidal anti-inflammatory drugs and contrast nephropathy?

    OpenAIRE

    Luciano Passamani Diogo; David Saitovitch; Michelle Biehl; Laura Fuchs Bahlis; Maria Claudia Guterres; Cinthia Fonseca O'Keeffe; Gustavo Franco Carvalhal; Paulo Ricardo Avancini Caramori

    2010-01-01

    FUNDAMENTO: A associação entre o uso de anti-inflamatórios não-esteroides (AINEs) e insuficiência renal aguda ou crônica é bem documentada, mas evidências sobre a associação entre AINEs e nefropatia induzida por contraste (NIC) não são encontradas na literatura. OBJETIVO: Avaliar uma possível associação entre AINEs e NIC. MÉTODOS: Em um estudo de coorte, através da entrevista clínica de pacientes que foram submetidos à cateterização cardíaca, analisamos o uso de AINEs e sua associação com des...

  13. Spielpläne

    Index Scriptorium Estoniae

    2007-01-01

    Laulja Annely Peebo ooperis "Jenufa" 2., 4., 6., 9., 11., 13. ja 15. mail Mailandis. Eesti Filharmoonia Kammerkoor esinemas 27. ja 28. mail Bergenis. Laulja Ain Anger 19. mail Placido-Domingo Galal ja 31. mail ooperis "Othello" Viini Riigiooperis

  14. The value of anal cytology and human papillomavirus typing in the detection of anal intraepithelial neoplasia: a review of cases from an anoscopy clinic

    OpenAIRE

    Fox, P; Seet, J; Stebbing, J; Francis, N.; Barton, S.; Strauss, S; Allen-Mersh, T; Gazzard, B.; Bower, M

    2005-01-01

    Background: Previous studies have reached differing conclusions about the utility of anal cytology as a screening tool for anal intraepithelial neoplasia (AIN). There is a need also to establish whether HPV typing offers a useful adjunct to screening.

  15. Strasti po 22 sentjabrja / Eldar Efendijev

    Index Scriptorium Estoniae

    Efendijev, Eldar, 1954-

    2005-01-01

    Isamaaliidu algatatud pühade ja tähtpäevade seaduse muutmise eelnõust 1944. a. 22. septembril tegutsenud Otto Tiefi valitsuse mälestuse jäädvustamiseks. Keskerakonna seisukohta tutvustab Ain Seppik

  16. Jälle põlved ja küünarnukid / Mihkel Mutt

    Index Scriptorium Estoniae

    Mutt, Mihkel

    1996-01-01

    Jess Borgesoni, Adam Longi ja Daniel Singeri 'Shakespeare'i kogutud teosed' Rakvere teatris (lav. Ain Prosa); Hermann Bahri 'Mees, naine ja kontsert' (lav. Eino Baskin) ning Tankred Dorsti 'Härra Paul' Eesti Draamateatris (lav. Mati Unt)

  17. 9. II avati taas von Krahli Akna galerii

    Index Scriptorium Estoniae

    2004-01-01

    Näitusel "Mute - a Register of Dreams" on vaadata Aine Phillipsi (Iirimaa), Avangardi, Diane Dwyer & Tillamook Cheddari (USA), Evelin Urmi, Kiwa, Lee Adamsi (Inglismaa), Marcello Mercado (Saksamaa), Miguel Rodriguez Sepulveda (Mehhiko) ja Renato Meneghetti (Itaalia) töid

  18. Asjatundlikkus, nõustamine ja laenamine : SEB : kiire areng nõuab Euroopa- ja e-kesksust / Margit Aedla

    Index Scriptorium Estoniae

    Aedla, Margit, 1970-

    2001-01-01

    SEB-i juhatuse esimees Lars H. Thunell ja Ühispanga juhatuse esimees Ain Hanschmidt koostööst ja tulevikuplaanidest. Diagrammid: SEB-i turuosa laenudes; SEB-i turuosa deposiitides; SEB, september 1998; SEB, aprill 2000

  19. Tänavu jagub presidendi tunnustust neljale ettevõtjale / Väinu Rozental

    Index Scriptorium Estoniae

    Rozental, Väinu, 1957-

    2009-01-01

    Ärimees Margus Reinsalu, Nopri talu peremees Tiit Niilo, ehitusfirma Aspi üks omanikke Ain Tromp ja Harju Elektri nõukogu esimees Endel Palla pälvisid president Toomas Hendrik Ilveselt riiklikud teenetemärgid

  20. Turvalisuse tagamiseks ei aita loosungitest / Evelyn Sepp

    Index Scriptorium Estoniae

    Sepp, Evelyn, 1972-

    1999-01-01

    Autor: Keskerakond. Konverentsist: Kuritegevus muutuvas ajas 4. nov. Kommenteerivad Ain Seppik, Ando Leps, Arved Liivrand, Evelyn Sepp, Priit Männik, Olavi Iisrael, Jüri Kaljuvee, Mart Remmel, Siiri Oviir

  1. ETV sari valmib huumori ja tagasihoidliku eelarvega / Karin Volmer

    Index Scriptorium Estoniae

    Volmer, Karin

    2008-01-01

    9. oktoobril jõuab ETV ekraanile Eesti ajaloost jutustava 12-osalise draamaseriaali "Tuulepealne maa" esimene osa. Hetki võtteplatsilt (näitlejad Rasmus Kaljujärv, Mirtel Pohla, tegevprodutsent Kädi Rammula, lavastaja Ain Prosa)

  2. Märkmeid uusima Preisi tsensuuriinstruktsiooni kohta / Karl Marx

    Index Scriptorium Estoniae

    Marx, Karl

    2000-01-01

    Preisi uue (1841. aasta) tsensuuriinstruktsiooni tõusikliku vaimu vastuolust vana (1818. aasta) tsensuurimääruse ratsionalismiga. Moraali ja religiooni vastuolust. Vt. ka Ain Kaalepi artiklit "Veel Karl Marxist ja tsensuurist

  3. Hoia ja keela! / Taavi Paide, Indrek Hellermaa

    Index Scriptorium Estoniae

    Paide, Taavi

    2004-01-01

    Tallinnasse Vabaõhumuuseumi tee 2a kerkivast, 2005. a. valmivast neljakorruselisest majast Nautilus, mis varjab merevaadet. Maja I korrusel on parkla ja äripinnad, II-IV korrusel korterid. Arhitekt Ain Padrik

  4. Itaalia seadustab ainuõige pitsa / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2004-01-01

    Pizza Napolitana ained, valmistusviis ja tulemus peavad vastama nõuetele. Itaalia põllumajandusministeeriumis välja töötatud pitsareeglid on osa Itaalia pingutustest kaitsta oma kuulsat kööki. Lisaks: Pitsavalmistamise reeglid

  5. Partii Reform ne bezrazlitshna sudba russkogo obrazovanija / Sergei Ivanov

    Index Scriptorium Estoniae

    Ivanov, Sergei, 1958-

    2005-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad Tallinna Pedagoogikaülikoolis algavat vene koolide jaoks aineõpetajate ettevalmistamist ja selleks ettenähtud rahasummat, vene akadeemilise keskuse loomiseks eraldatud raha kulutamist

  6. Kolhoosikeskus - oma ja võõras = Collective farm centre - familiar and alien / Liina Jänes ; tõlk. Liisi Ojamaa

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2000-01-01

    Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart

  7. Pop / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2004-01-01

    Heliplaatidest: Current 909 "The price for existence is eternal warfare", Aapo Ilves "Pilpaküla kontsert", Yello "The Eye", Maian Kärmas, Ain Agan, Riho Sibul, Arvo Haasma "Tuigutuled", Manatark "Chaos Engine"

  8. Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak

    Index Scriptorium Estoniae

    Juurak, Raivo, 1949-

    2001-01-01

    Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades

  9. Disease: H00595 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00595 Myofibrillar myopathies (MFM), including: Desminopathy (MFM1); alpha-B Crystallinopathy ( ... aining the structural integrity of the Z-disk. The pathology ... includes accumulations of these proteins irrespect ...

  10. Mechanism of the Association between Na+ Binding and Conformations at the Intracellular Gate in Neurotransmitter:Sodium Symporters

    DEFF Research Database (Denmark)

    Stolzenberg, Sebastian; Quick, Matthias; Zhao, Chunfeng;

    2015-01-01

    Neurotransmitter:sodium symporters (NSSs) terminate neurotransmission by Na+-dependent reuptake of released neurotransmitters. Previous studies suggested that Na+-binding reconfigures dynamically coupled structural elements in an allosteric interaction network (AIN) responsible for function...

  11. Krundi müük võiks EKA ehitusest viiendiku säästa / Ann-Marii Nergi ; kommenteerinud Jaak Aaviksoo

    Index Scriptorium Estoniae

    Nergi, Ann-Marii

    2011-01-01

    Eesti Kunstiakadeemia peab õigeks ehitada uus õppehoone ajaloolisele asukohale. Hoone ehituse ettevalmistamiseks on kulunud ligi viis miljonit eurot. EKA uue hoone mujale ehitamise osas avaldavad arvamust Metro Capital Management Eesti juht Ain Kivisaar ja riigihangete keskuse juhatuse liige Margus Lantin

  12. AHHAA keskus Tartus = The Ahhaa Science Centre in Tartu / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2011-01-01

    2011. a. valminud AHHAA teaduskeskuse arhitektid on Ain Padrik ja Vilen Künnapu (AB Künnapu & Padrik), sisearhitektid Tea Tammelaan, Krista Lepland ja Malle Jürgenson (Laika, Belka & Strelka). Projekt: 2008

  13. 3000 miljonikorterit aastas : kes neid ostab? / Mari Sarv

    Index Scriptorium Estoniae

    Sarv, Mari, 1978-

    2005-01-01

    Kinnisvarabüroo Uus Maa investeeringute konsultant Ain Kivisaar ja Ober-Haus Kinnisvara Eesti tegevdirektor Hindrek Leppsalu uute korterite ostjatest, ostmisest, uue kodu valiku kriteeriumidest. Kaart: Valmivad korterelamud

  14. Rector's office as of 31 December 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  15. Rektoraat seisuga 31.12. 2005

    Index Scriptorium Estoniae

    2006-01-01

    TÜ rektoraadi koosseis: rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Tõnu Lehtsaar, prorektor prof. Jaak Kangilaski; administratsioonidirektor Mihkel Pärnoja, finantsdirektor Taimo Saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  16. Rektoraat seisuga 31.12.2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  17. [Kirjandusetendusest "Meri kümnele häälele"] / Kätlin Kaldmaa ; küsinud D. K. [Doris Kareva

    Index Scriptorium Estoniae

    Kaldmaa, Kätlin, 1970-

    2011-01-01

    Luulelavastus sisaldab Álvaro de Campose (Fernando Pessoa) "Mereoodi" ning Ain Kaalepi, Kalju Kruusa, fs-i jt. eesti luuletajate tekste. Lavastaja Anne Türnpu, etendused toimuvad kinos Sõprus. Vt. ka kuulutust lk. 30

  18. Plaadid / Aivo Vahemets

    Index Scriptorium Estoniae

    Vahemets, Aivo

    2006-01-01

    Uutest heliplaatidest Waltari "Blood Sample", Anthony Hamilton "Ain't Nobody Worrying", Kismabande "Polüpale", Siiri Sisask "Kuu lõhn", Les Diamants "Fortune Fools", "The Voice Clubbin", Nits "Les Nuits"

  19. Алексий II 1929-2008

    Index Scriptorium Estoniae

    2008-01-01

    Aleksius II meenutavad: Kornelius, Tallinna ja kogu Eesti metropoliit ; Karin Jaani ; Marina Kaljurand ; Dmitri Medvedev, Venemaa president ; Helene Kamzol, Aleksius II sugulane ; Ain Seppik ; Vladimir Illjashevitsh ; Edgar Savisaar ; Jevgeni Tomberg ; Ene Ergma ; Toomas Hendrik Ilves, Eesti Vabariigi president

  20. Pap smears for men: a vision of the future?

    LENUS (Irish Health Repository)

    Oon, S F

    2012-02-01

    BACKGROUND: Anal intraepithelial neoplasia (AIN) rarely receives as much publicity as its neighbouring orifice, the cervix. As in the cervix, intraepithelial neoplasias are precursors to cancer in the anal canal. AIN and cervical interstitial neoplasia (CIN) undergo dysplasia as a consequence of human papillomavirus (HPV) infection. Since the advent of screening with the Pap smear in CIN, cervical cancer has plummeted to a fifth of its initial incidence. Anal cancer, however, has been rising, with a predilection for human immunodeficiency virus-infected men. HPV causes a squamous epithelial dysplasia and converts healthy tissue into AINs of increasing severity until anal cancer manifests. CLINICAL CASE: This article describes a clinical case of anogenital HPV infection refractory to medical and surgical therapy. It also describes an effective surgical excision technique associated with a good cosmetic outcome. CONCLUSIONS: The paper concludes by briefly discussing the implications of a national screening programme against AIN in the future.

  1. Rector's office as of 31 December 2006

    Index Scriptorium Estoniae

    2007-01-01

    Rektor prof. Jaak Aaviksoo, teadusprorektor prof. Ain Heinaru, õppeprorektor prof. Birute Klaas, administratsioonidirektor prof. Mihkel Pärnoja, finantsdirektor Taimo saan, haldusdirektor Riho Illak, akadeemiline sekretär Ivar-Igor Saarniit

  2. Lapi torn, Ameerika kotkas ja gooti kell / Vilen Künnapu ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    Künnapu, Vilen, 1948-

    2010-01-01

    Arhitekt Vilen Künnapu oma installatsioonist "Gooti kell", mis avati 2. novembril Lilleoru pargis, arhitekti rollist, osalemisest koos Ain Padriku, Lennart Meri ja Andres Siimuga rahvusvahelistel arhitektuurivõistlustel, valminud hoonetest, installatsioonidest, praegusest tegevusest jm.

  3. Kummitusmaja ja fusion-köök = Haunted House and Fusion Cuisine / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2003-01-01

    Tallinnas Rataskaevu 16 asuva jaapani toitu pakkuva restorani "Sushihouse" kujundus, ruumide restaureermine. Sisekujundajad Ain Nurmela ja Liina Link. Projekt 2001-2003, valmis 2003. Kõige muinsusteadlikumalt restaureeritud maja 2002. a. 3 ill

  4. Biopsy-proven drug-induced tubulointerstitial nephritis in a patient with acute kidney injury and alcoholic severe acute pancreatitis.

    Science.gov (United States)

    Yoshioka, Wakako; Mori, Takayasu; Nagahama, Kiyotaka; Tamura, Teiichi

    2013-01-01

    We report a 49-year-old man with alcoholic severe acute pancreatitis (SAP) complicated by drug-induced acute tubulointerstitial nephritis (DI-AIN). Oliguria persisted and became anuric again on day 17 despite improvement of pancreatitis. He presented rash, fever and eosinophilia from day 20. Renal biopsy was performed for dialysis-dependent acute kidney injury (AKI), DI-AIN was revealed, and prompt use of corticosteroids fully restored his renal function. This diagnosis might be missed because it is difficult to perform renal biopsy in such a clinical situation. If the patient's general condition allows, renal biopsy should be performed and reversible AKI must be distinguished from many cases of irreversible AKI complicated by SAP. This is the first report of biopsy-proven DI-AIN associated with SAP, suggesting the importance of biopsy for distinguishing DI-AIN in persisting AKI of SAP. PMID:23645698

  5. Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja

    Index Scriptorium Estoniae

    Iir Hermeliin, pseud., 1973-

    2000-01-01

    Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"

  6. Meie igapäevane paanika / Ott Karulin

    Index Scriptorium Estoniae

    Karulin, Ott, 1980-

    2007-01-01

    Kahest Vanemuise teatri lavastusest Tartus - Saksa Kultuuri Instituudis etendunud Ingvar Ambjornseni-Axel Hellsteniuse "Elling" Ain Mäeotsa lavastuses ja Laura Cunninghami "Beautiful Bodies" Vanemuises, lavastaja Jüri Lumiste

  7. На сцене прозвучит музыка из фильмов / Лилия Крысина

    Index Scriptorium Estoniae

    Крысина, Лилия

    2010-01-01

    15. nov. esietendub Vene Teatris kontsertetendus "17 kevadist hetke", milles Eduard Toman, Aleksandr Ivaškevitš, Gerli Padar ja Ülle Lichtfeldt esitavad laule tuntud nõukogude filmidest-seriaalidest. Lavastaja Ain Mäeots

  8. Mis saab maaärist? / Ester Šank

    Index Scriptorium Estoniae

    Šank, Ester, 1956-

    2000-01-01

    Maaostu piirava seaduseelnõu Riigikogu menetlusest välja arvamist kommenteerib Vootele Hansen. Lisatud ka eelnõu autorite Jaanus Marrandi, Harri Õunapuu ja töörühma liikme Ain Kendra seisukohad

  9. Avalikul loengul räägitakse muusikast kui eluks vajalikust ainest

    Index Scriptorium Estoniae

    2006-01-01

    Tallinna Ülikooli kunstide teaduskonna saalis esineb 27. novembril avaliku loenguga " Muusika kui eluks vajalik aine" Hamburgi muusika- ja teatriülikooli muusikateraapia instituudi direktor professor Hans-Helmut Decker-Voigt

  10. Rainer Maria Rilke poeetiline psühhoteraapia / Aivar Kull

    Index Scriptorium Estoniae

    Kull, Aivar, 1955-

    1995-01-01

    Arvustus: Rilke, Rainer Maria. Kirjad noorele luuletajale : luuletusi / Saksa keelest tlk. Tiiu Relve ja Ain Prosa. Tln.: Perioodika, 1995. (Loomingu rmtk.; 13). Vaata ka: Kull, Aivar. Kulli pilk. - Tartu : Ilmamaa, 2005, lk. 57-59

  11. Technical Progress Report for "Optical and Electrical Properties of III-Nitrides and Related Materials"

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Hongxing

    2008-10-31

    Investigations have been conducted focused on the fundamental material properties of AIN and high AI-content AIGaN alloys and further developed MOCVD growth technologies for obtaining these materials with improved crystalline quality and conductivities.

  12. Popmuusika / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2006-01-01

    Uutest heliplaatidest Graham Coxon "Love Travels At Illegal Speeds", Gabriel Rios "Ghostboy", "Sounds Of India", John Hughes "Wild Ocean", Ain Agan & Tallinn Chamber Orchestra/Toomas Vavilov, Ashanti "Collectables By Ashanti", Liv Kristine "Enter My Religion"

  13. Ravimtaimed moodustavad osa meie rahvakultuurist / Aita Nurga

    Index Scriptorium Estoniae

    Nurga, Aita

    2006-01-01

    Tartu Ülikooli farmaatsia instituudi farmakognoosiadotsent Ain Raal on uurinud Eestis laialt levinud taimravi ning aidanud koostada projekti Herba raames koostada andmebaasi, kus on kirjas enamlevinud ravimtaimede toime ning taimede ja haiguste rahvapärased nimetused

  14. Lugedes Pilve ja Pazi / Mathura

    Index Scriptorium Estoniae

    Mathura, pseud., 1973-

    2007-01-01

    Võrdlevalt Aare Pilve luulekogust "Näoline" (kirj. Tuum, 2007) ja Octavio Pazi luulekogust "Alati on olevik" (hispaania k. tlk. Ain Kaalep, Jaan Kaplinski, Asta Põldmäe ja Jüri Talvet, kirj. Perioodika, 1984)

  15. Politicians spin attacks against methadone, syringe replacement / Milda Seputyte

    Index Scriptorium Estoniae

    Seputyte, Milda

    2005-01-01

    Leedu parlamendiliikmed osalevad kampaanias, millega võideldakse narkomaanidele tasuta süstalde jagamise ja sõltuvuse vastase aine metadooni vastu, kuna nende arvates need meetmed pigem süvendavad narkomaaniat

  16. Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm

    Index Scriptorium Estoniae

    Vaus-Tamm, Heili, 1961-

    2007-01-01

    Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko

  17. Õpetaja professionaalse rolli internaliseerimise hindamine õpetajakoolituse esmaõppe üliõpilaste hulgas / Äli Leijen, Katrin Kullasepp, Aivar Ots

    Index Scriptorium Estoniae

    Leijen, Äli

    2013-01-01

    Aineõpetaja magistriõppe üliõpilaste seas läbi viidud uurimusest, milles vaadeldakse, kuidas üliõpilased koordineerivad personaalset ja professionaalset mina-positsiooni erialaste ambivalentsete olukordade kontekstis

  18. USA-s jagati kirjandusauhindu / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2007-01-01

    Ameerika Ühendriikide kirjandusauhinna National Book Award laureaadid 2007. a.: parim prosaist - Denis Johnson (romaan "Suitsupuu"), parim noorsookirjanik - Sherman Alexie ("Poole kohaga indiaanlase absoluutselt tõene päevik"), parim luuletaja - Robert Hass (luulekogu "Aeg ja ained")

  19. Sotsiaalne õiglus, maailm ja Eesti / Heiki Haljasorg

    Index Scriptorium Estoniae

    Haljasorg, Heiki

    2012-01-01

    2009. aastal alustas MTÜ Mondo koos Bulgaaria, Suurbritannia, Läti, Sloveenia ja Portugaliga projekti, mille eesmärk on tutvustada sotsiaalse õiglusega seotud teemasid ja lõimida neid aineõpetusse

  20. BINAM-prolinamidas: nuevos organocatalizadores quirales en reacciones aldólicas

    OpenAIRE

    Hita López, María del Carmen

    2007-01-01

    En la presente memoria se describe la síntesis y aplicaciones de nuevos organocatalizadores derivados de B1NAM y prolina en reacciones aldólicas. Se ha puesto a punto la síntesis de las diferentes prolinamidas derivadas de BINAM y prolina, discutiendo su estructura, relación entre ellas, así como su recuperación. Se ha estudiado la actividad catalítica de los nuevos catalizadores BINAM-prolinamidas en condensación aldólica directa entre aldehidos y cetonas alifáticas, en diferentes disolvente...

  1. Evaluación de los polvos de acetona de hígado animal en la hidrólisis enantioselectiva del éster metílico del ácido 2,3-dihidro-6- metoxibenzofuran-2-carboxílico

    OpenAIRE

    Mauro A. Villanueva Lendechy; Raúl Cortés García; Ricardo Tovar Miranda; Héctor Luna

    2000-01-01

    Se describe el estudio de la resolución del ácido 2,3- dihidro-6-metoxibenzofuran-2-carboxílico (1) mediante la hidrólisis enzimática de su éster metílico 2, utilizando en la biotransformación las hidrolasas presentes en el hígado de bovino, cerdo, pollo, rata y conejo. Se variaron en la biocatálisis los parámetros de temperatura, pH, co-disolventes, tiempo de reacción y el concentrado enzimático en su soporte natural.

  2. Constituyentes aromáticos del zumo de naranja. Efecto del procesado industrial.

    OpenAIRE

    Jordán Bueso, María José

    1999-01-01

    Teniendo en cuenta la importancia del aroma en la aceptación de los alimentos por parte del consumidor, en esta Memoria abordamos el estudio de la fracción aromática del zumo de naranja, así como las posibles alteraciones que pueda sufrir durante el procesado industrial. El análisis de componentes volátiles totales se realiza mediante la aplicación de la destilación- extracción simultánea (SDE). Esta técnica es favorable en la recuperación de componentes de menor volatilidad que el disolvente...

  3. Estudio espectroscópico y efecto láser en SO(2)-análogos de Pteridinas y Piridopirimidinas

    OpenAIRE

    Weigand Talavera, Rosa

    1993-01-01

    El objeto de estudio de esta tesis ha sido, por un lado, la caracterización espectroscópica de algunos derivados de dos familias de compuestos: 2,2-dioxidos de aminopirido (2,3-c) -1,2,6-tiadiazinas y 2,2-dioxidos de pirazino(2,3-c)-1,2,6-tiadiazinas en dimetilsulfoxido y acetonitrilo, con objeto de ver su aplicación como láseres de colorante. Estos compuestos presentan comportamiento acido-base en estos disolventes y las diferentes especies han sido caracterizadas a través de espectros de ab...

  4. Reología de espesantes celulósicos para pinturas al agua: Modelización y mecanismo de espesamiento

    OpenAIRE

    Maestro Garriga, Alicia

    2003-01-01

    Las pinturas al disolvente están siendo sustituidas por pinturas en base acuosa por razones medioambientales y de seguridad e higiene. Las propiedades de una pintura están influidas por su comportamiento reológico. En concreto, el conocimiento y control de la variación de la viscosidad de equilibrio con el gradiente de velocidad y la cinética de esta variación (tixotropía) de una pintura son relevantes para prevenir la sedimentación dentro del envase, facilitar su aplicación y asegurar una bu...

  5. Repercusiones multiorgánicas de la inhalación de alcohol isopropílico y cloruro de metileno como substancias de abuso

    OpenAIRE

    JC Trullás; S. Nogué; O. Miró; S Mondón; Navarro, V.; Jou, J

    2005-01-01

    En España el consumo de substancias de abuso está muy extendido. Entre las drogas ilegales destaca, en el momento actual, la prevalencia de consumidores de cannabis, derivados anfetamínicos y cocaína. Los inhalables volátiles, como las colas, pegamentos, gasolina y disolventes, representan otra forma de consumo de drogas, pero que está poco arraigada en nuestro medio. Se presenta el caso de una mujer snifadora crónica de una laca para el pelo, que contenía alcohol isoprop...

  6. Líquidos iónicos para la transformación de biomasa lignocelulósica

    Directory of Open Access Journals (Sweden)

    Daisy Dopico-Ramírez

    2013-01-01

    Full Text Available Se ofrece una introducción a los compuestos denominados líquidos iónicos: evolución histórica, peculiaridades físico-químicas, relación estructura/propiedades con el poder disolvente y su aplicación en el fraccionamiento de los componentes del material lignocelulósico. Se reporta la obtención de celulosa, lignina, azúcares fermentables, hidroximetilfurfural y otros derivados, mediante procesos compatibles con el medio ambiente basados en el uso de los líquidos iónicos.

  7. Obtención a escala piloto de un extracto de café

    OpenAIRE

    Borges, P.; Ortega, A.; Roncal, E.; Rogert, E.

    2008-01-01

    Se obtuvo un extracto de café, mediante una tecnología de extracción sólido-líquido con etanol a 36 %, agitación y a ebullición del disolvente. El rendimiento promedio del extracto, expresado en porcentaje de sólidos totales, fue 90,4 % y por su caracterización sensorial resultó de buena calidad. Además se desarrolló un aroma de café que presentó una excelente calidad y fue aplicado en helado con una dosis de 8 mL/kg de crema base.

  8. Síntesis por microondas de 3,4-dihidro-2(1h)-piridonas con potencial actividad biológica empleando dimetilsulfóxido

    OpenAIRE

    Yeily Seruto; Liván Alba; Adolfo Brown; Milaydis Reyna; Jorge García; Estael Ochoa; Yamila Verdecia; Roxana Fernández

    2010-01-01

    Se sintetizaron cuatro derivados del tipo 3,4-dihidro-2(1H)-piridonas a partir del 2,2- dimetil-1,3-dioxano-4,6-diona (ácido de Meldrum) y diferentes benzaldehídos, bajo irradiación por microondas y se utilizó dimetilsulfóxido como disolvente. Este nuevo método permitió obtener los productos finales en tiempos de reacción de 5-10 min con rendimientos aceptables de 65-70%. Los compuestos se caracterizaron mediante espectrometría FTIR, RMN-1H y RMN-13C.

  9. Molybdenum Oxide Supported on Silica (MoO3/SiO2): An Efficient and Reusable Catalyst for the Synthesis of 1,8-dioxodecahydroacridines Under Solvent-free Conditions

    OpenAIRE

    Amir Khojastehnezhad; Farid Moeinpour; Majid Vafaei

    2015-01-01

    Se encontró que el óxido de molibdeno soportado en sílica (MoO3/SiO2) es un catalizador eficiente y amigable con el ambiente para la reacción multicomponente de aldehídos aromáticos, dimedona y acetato de amonio o aminas aromáticas bajo condiciones libres de disolvente para producir las correspondientes 1,8-dioxodecahydroacri-dinas con rendimientos elevados. El catalizador puede ser recupe-rado fácilmente y usado por varias veces sin pérdidas de actividad considera...

  10. Los pinceles de la química

    OpenAIRE

    Torras Galán, A.; Díez Díez, G.

    2009-01-01

    La química desarrolla un papel muy importante en diferentes campos de investigación. Normalmente cuando se habla de química la gente piensa en reacciones y síntesis de nuevos proyectos. Sin embargo, un campo poco conocido para la química es el mundo de la restauración de pinturas. Nombres tan conocidos como Lewis, Hückel, Diels-Alder se imparten en nuestras aulas, pero por qué se menosprecia los disolventes. Los solventes son muy importantes en las reacciones químicas aunque muchas veces los ...

  11. Environmental impacts of an imidacloprid-containing formulation: from soils to waters

    OpenAIRE

    Bori Dols, Jaume; Ribalta Carrasco, Carla; Domènech Antúnez, Xavier; Riva Juan, Mª del Carmen; Ribó Arboledas, Juan Manuel

    2015-01-01

    El pesticida neonicotinoide imidacloprid se encuentra entre los agroquímicos más vendidos en todo el mundo. Debido a su amplio uso en mezclas con diferentes disolventes y co-adyuvantes, estudiar el impacto ambiental de las formulaciones comerciales derivadas se ha convertido en obligatorio. En este estudio se utilizaron ensayos ecotoxicológicos de laboratorio para cuantificar el impacto del ConfidorR 20SL (formulación que contiene imidacloprid) en los compartimentos terrestre y acuático. Los ...

  12. Estudio químico de los compuestos bioactivos de hojas senescentes de Croton funckianus (Euphorbiaceae) / Chemical analysis of bioactive compounds from senescent leaves of Croton funckianus (Euphorbiaceae)

    OpenAIRE

    Vegas Mendoza, Sonia Milena

    2010-01-01

    El extracto etanólico de hojas senescentes frescas de Croton funckianus se sometió a partición líquido-líquido con disolventes de diferente polaridad. Los ensayos de actividad larvicida frente a larvas de tercer estadío de Culex quinquefasciatus, mostraron que las fracciones separadas en éter de petróleo (F2), acetato de isopropilo (F5) y butanol (F7) presentan actividad promisoria. El fraccionamiento, guiado por el bioensayo de actividad larvicida de la fracción en butanol, condujo a la obte...

  13. Síntesis y optimización de las condiciones de aplicación de un jabón para eliminar los barnices Damar y Mastique

    OpenAIRE

    Porcel Arauzo, Eva

    2009-01-01

    En los trabajos de restauración de obras de arte y concretamente de pinturas, frecuentemente es necesario retirar el barniz que las recubre. Se han utilizado con esta finalidad numerosas sustancias, tales como detergentes y disolventes. Muchas veces las resultados no son los esperados y el peligro para la integridad de las obras es evidente. Es por ello que se intenta encontrar un producto que tenga la màxima eficàcia con el menor riesgo. Para ello se obtienen un jabón de oleico-oleato.

  14. Teoría y simulación de la dinámica de procesos unimoleculares en disolución

    OpenAIRE

    Muñoz Sanz, Raúl

    1997-01-01

    Las reacciones unimoleculares de isomerización y descomposición han sido objeto de estudio mediante técnicas de simulación por ordenador con las que se pretendía comprender la influencia dinámica del disolvente sobre importantes fenómenos como la transferencia intermolecular de energía o la reactividad. Para ello se eligieron los siguientes sistemas químicos. Las moléculas de metil-isonitrilo y metil-ciclohexano, cuya isomerización fue estudiada por mecánica clásica con un esquema de dinámica...

  15. Antioxidant properties of extracts obtained from Grifola gargal mushrooms

    OpenAIRE

    Bruijn, J; C. Loyola; P. Aqueveque; J. Cañumir; M. Cortéz; France, A

    2009-01-01

    Se investigó el efecto de diferentes solventes en el rendimiento de extracción, actividad antioxidante y contenido de polifenoles y flavonoides en extractos de los cuerpos fructíferos de Grifola gargal. Se utilizaron los siguientes disolventes en la extracción: acetona, etanol, acetato de etilo, n-hexano, agua, y mezclas de agua y etanol. La capacidad antioxidante se midió mediante la captación de radicales libres de ácido 2,2-azino-bis-(3-etilbenzotiazol-6-sulfónico) y 2,2-difenil-1-picrilhi...

  16. Normativa sobre el impuesto sobre los gases efecto hivernadero (Green house gases tax)

    OpenAIRE

    Rodrigo de Larrucea, Jaime

    2013-01-01

    Como dice el apartado V de la Exposición de motivos de la Ley 16/2013, se crea un nuevo impuesto sobre los gases de efecto invernadero, relativo a los gases fluorados que se utilizan habitualmente en numerosos sectores como refrigerantes, disolventes, agentes espumantes o agentes extintores de incendios, para paliar de alguna manera su negativa contribución al calentamiento de la atmósfera, con un potencial de calentamiento global mucho más elevado que el CO2.

  17. Proyecto de caracterización de la Mejor Técnica Disponible para el cumplimiento del RD 117/2003 sobre emisiones atmosféricas de COVs en una empresa de impresión flexográfica

    OpenAIRE

    Fernández Fernández, Encarna

    2008-01-01

    El presente proyecto tiene por objetivo caracterizar la mejor técnica disponible (MTD) para que una empresa situada en la provincia de Barcelona y que se dedica a la impresión flexográfica con tintas en base disolvente orgánico, se adecue a lo establecido en el RD 117/2003 en lo concerniente a emisiones de compuestos orgánicos volátiles a la atmósfera. En una primera fase se realizaron visitas y se mantuvieron reuniones en la empresa objeto de estudio. Fruto de ello es la recop...

  18. Comportamiento reológico de geles biodegradables para aplicacions en medicina regenerativa

    OpenAIRE

    Reyes Ortega, F.; Rodríguez, G.; Rosa Aguilar, M.; García-Sanmartín, J.; Martínez, A.; J. San Román

    2012-01-01

    Resumen Los hidrogeles (HG) poliméricos son redes macromoleculares tridimensionales constituidas por elementos básicos conectados entre sí física o químicamente e hinchados por un disolvente. Los HG poliméricos tienen múltiples aplicaciones, entre ellas su utilización en el desarrollo de materiales para regeneración de tejidos gracias a su alta biocompatibilidad y su uso frecuentemente como sistemas de liberación de fármacos debido a su capacidad para retener líquidos y comp...

  19. Synthesis, characterization and study of supramolecular gel materials based on glycoamphiphiles

    OpenAIRE

    Clemente Oteo, María José; Fitremann, Juliette; Oriol Langa, Luis Teodoro

    2013-01-01

    El trabajo desarrollado en esta tesis, se centra en el campo de la ciencia de los materiales blandos, y en concreto dentro de este campo, en los geles. Los geles, son ampliamente conocidos por sus diversas aplicaciones como por ejemplo, en la alimentación, la cosmética o la biomedicina y se definen como estructuras viscoelásticas formadas por una red entrecruzada tridimensional hecha a partir de moléculas gelificantes que se autoensamblan atrapando el disolvente, el cual es el componente may...

  20. Procedimiento de preparación de nanopartículas de aleaciones Ni-Sn y su uso en reacciones de reformado

    OpenAIRE

    Romero Sarria, Francisca; Bobadilla Baladrón, Luis; Romero Sarriá, Luis; Centeno, Miguel Ángel; Odriozola, José Antonio

    2009-01-01

    Procedimiento de preparación de nanopartículas de aleaciones Ni-Sn y su uso en reacciones de reformado. La presente invención se refiere a un procedimiento para la preparación de nanopartículas de Ni-Sn que comprende - preparar una disolución de un carboxilato de níquel en el que dicho carboxilato tiene entre 1 y 6 átomos de carbono, y un halogenuro de estaño en un disolvente orgánico - añadir PVP (polivinilpirrolidona) - mantener en agitación hasta obtener una disoluc...

  1. Resultados preliminares sobre un proceso Sol-Gel para la síntesis de disoluciones precursoras de láminas delgadas ferroeléctricas con estructura de Perovskita laminar

    OpenAIRE

    Calzada, M.L. (María Lourdes); González, A.; Jiménez, Ricardo; Mendiola, J.

    1999-01-01

    [ES] Se han preparado por sol-gel soluciones precursoras de SrBi2Ta2O9, utilizando como reactivos el etóxido de tántalo y los 2-etilhexanoatos de estroncio y de bismuto. Como disolvente mayoritario se empleó el 1,3-propanodiol. Las soluciones resultantes presentaron una baja velocidad de hidrólisis y condensación, haciendo posible su almacenaje y manipulación en atmósferas no exentas de humedad. Las láminas derivadas de estas soluciones y cristalizadas a 750ºC presentaron como fase m...

  2. Estudio termodinámico de un proceso SEDS para la precipitación de fármacos

    OpenAIRE

    Tabernero de Paz, Antonio

    2014-01-01

    [ES]El presente trabajo de investigación está encuadrado dentro del proyecto que lleva a cabo nuestro grupo de investigación sobre la precipitación de fármacos con fluidos supercríticos como antisolventes (proceso SEDS). En este caso concreto se pretende generar de forma semicontinua partículas de acetaminofén y tretinoína, utilizando etanol como disolvente y CO2sc como antisolvente. A fin de conocer la viabilidad de este proceso, es fundamental realizar un estudio termodinámico previo de los...

  3. Equipo portátil para análisis químicos del suelo

    OpenAIRE

    Jaramillo Madarriaga G.

    2013-01-01

    En estos últimos años, principalmente en los Estados Unidos, ha surgido una gran variedad de equipos portátiles para el examen rápido de suelos, basados la mayor parte en reacciones calorimétricas para fósforo, potasio, nitratos y algunos otros elementos considerados de importancia para la vida de la planta. El factor que determina la gran variedad de resultados obtenidos con tales equipos es la naturaleza del disolvente empleado para extraer los elementos de la muestra de suelo, disolve...

  4. Nuevos transportadores de fármacos: nanocápsulas de poliasparagina y caseína

    OpenAIRE

    Rivera Rodríguez, Gustavo Rodolfo

    2012-01-01

    Se han diseñado dos nuevas plataformas nanotecnológicas para la vehiculización selectiva de fármacos antitumorales. Estas nanoestructuras, constituidas por un núcleo oleoso y una cubierta polimérica, a base de secuencias de aminoácidos (poliasparagina o caseína), se prepararon mediante una modificación de la técnica de desplazamiento de disolvente. Las nanocápsulas de poliasparagina demostraron ser capaces de incrementar la actividad del docetaxel in vitro, sobre células de cáncer no microcít...

  5. Piperazine side-effects in a patient with pre-existing renal insufficiency

    OpenAIRE

    Majid Malaki

    2014-01-01

    Piperazine as an antihelminth has many adverse effects, especially on patients with renal insufficiency. We report the use of piperazine in a girl with a moderately severe kidney disease due to Biedl Bardet syndrome. She developed coma and acute kidney injury due to acute interstitial nephritis (AIN), anemia and thrombocytopenia. The presence of fever, proteinuria, acidosis, anemia, sterile pyuria and non-oliguric renal failure strongly suggested AIN. Her problems abated mostly by discontinui...

  6. Assessment of Dietary Practice Among Diabetic Patients in the United Arab Emirates

    OpenAIRE

    Al-Kaabi, Juma; Al-Maskari, Fatma; Saadi, Hussein; Afandi, Bachar; Parkar, Hasratali; Nagelkerke, Nicolaas

    2008-01-01

    OBJECTIVES: The aim of this study was to assess dietary practices and risk profile (hypertension, obesity, lipid profile and glycemic control) among people with diabetes in Al-Ain District, United Arab Emirates (UAE). METHODS: During 2006, we performed a cross-sectional study of diabetic patients attending diabetic outpatient clinics at Tawam Hospital and primary health care centers in Al-Ain District. Subjects completed an interviewer-administered questionnaire, blood pressure, body mass ind...

  7. Corporate Social Responsibility and the Influence of Non-Governmental Organizations : Tactics, mechanisms and legitimacy

    OpenAIRE

    2006-01-01

    The thesis explores the influence of Non-Governmental Organizations (NGOs) on the Corporate Social Responsibility (CSR) measures of Transnational Corporations (TNCs) operating in Less Developed Countries (LDCs). NGO influence is explored by studying two case NGOs; NorWatch and Amnesty International Norway (AIN), and their influence on three Norwegian corporations; Statoil, Hydro and the Varner Group. The thesis shows that NorWatch and AIN promote different tactics towards business, and rely o...

  8. Indrek Saar kehastub Pilistveres Rasputiniks / Aarne Mäe

    Index Scriptorium Estoniae

    Mäe, Aarne, 1967-

    2008-01-01

    7. aug. esietendub Pilistvere vanas rehehoones Ain Saviaugu kirjutatud ja lavastatud suvetükk "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar. Lisaks lühike intervjuu lavastajaga "Lavastaja Ain Saviauk : "Ajalugu on karm" ja fakte Rasputinist - "Grigori Jefimovitsh Rasputin-Novõhh"

  9. The Paleolithic Background of Early Food Producing Societies in the Fertile Crescent - Faunal Analysis

    OpenAIRE

    Napierala, Hannes

    2011-01-01

    The goals of this study were to identify and explain subsistence patterns in the faunal assemblages of Baaz, Kaus Kozah, Ain Dabbour and Wadi Mushkuna. These four sites are located in the mountains north of Damascus, Syria, and were excavated starting in 1999. They span a chronological sequence from the Middle Paleolithic (Wadi Mushkuna, Kaus Kozah AH IV) to the PPNA (Kaus Kozah AH I & II), with the Upper Paleolithic and Natufian layers of Baaz and the Geometric Kebaran of Ain Dabbour occurri...

  10. Reduced energy intake and moderate exercise reduce mammary tumor incidence in virgin female BALB/c mice treated with 7,12-dimethylbenz(a)anthracene

    Science.gov (United States)

    Lane, Helen W.; Teer, Patricia; Keith, Robert E.; White, Marguerite T.; Strahan, Susan

    1991-01-01

    The concurrent effects of diet (standard AIN-76A, restricted AIN-76A and high-fat diet) and moderate rotating-drum treadmill exercise on the incidence of 7,12-dimethylbenz(a)anthracene-induced mammary carcinomas in virgin female BALB/cMed mice free of murine mammary tumor virus are evaluated. Analyses show that, although energy intake was related to mammary tumor incidence, neither body weight nor dietary fat predicted tumor incidence.

  11. Relevancia clínica de las interacciones medicamentosas entre antiinflamatorios no esteroideos y antihipertensivos

    Directory of Open Access Journals (Sweden)

    Juan Villa

    2014-11-01

    Conclusiones: Algunos AINE pueden disminuir la efectividad del tratamiento antihipertensivo cuando se utilizan simultáneamente con antihipertensivos, en especial con inhibidores de la enzima conversora de angiotensina, diuréticos, bloqueadores beta y antagonistas de los receptores de angiotensina. No se encontró evidencia de la modificación del efecto de los antagonistas de los canales de calcio, especialmente dihidropiridínicos, por el uso simultáneo con AINE.

  12. Effect of Crucibles on Qualities of Self-Seeded Aluminium Nitride Crystals Grown by Sublimation

    Institute of Scientific and Technical Information of China (English)

    HAN Qi-Feng; WANG Yu-Qi; DUAN Cheng-Hong; QIU Kai; JI Chang-Jian; LI Xin-Hua; ZHONG Fei; YIN Zhi-Jun; CAO Xian-Cun; ZHOU Xiu-Ju

    2007-01-01

    Self-seeded aluminium nitride (AIN)crystals are grown in tungsten and hot pressed boron nitride(HPBN)crucibles With different shapes by a sublimation method.The qualities of the AIN crystals are characterized by high-resolution transmission electronic microscopy(HRTEM),scanning electron microscopy(SEM)and MicroRaman spectroscopy.The results indicate that the better quality crystals can be collected in.conical tungsten crucible.

  13. Immune profile and Epstein-Barr virus infection in acute interstitial nephritis: an immunohistochemical study in 78 patients.

    LENUS (Irish Health Repository)

    Mansur, Abdurrezagh

    2011-01-01

    Acute interstitial nephritis (AIN) is a common cause of acute kidney injury and is characterised by a dense interstitial cellular infiltrate, which has not been well defined. Previous studies have demonstrated a correlation between Epstein-Barr virus (EBV) infection and AIN. The purpose of our study was to define the nature of the interstitial immune infiltrate and to investigate the possibility of renal infection with EBV.

  14. Synthesis of TiCuAg thick film inks for glass frit free metallization of aluminium nitride

    International Nuclear Information System (INIS)

    A glas frit free screen printing ink for metallization of AIN was developed. Bonding to the substrate is achieved by active metal additives. The metallic component consists of Cu and Ag powder synthesized from inorganic salts by the polyol process, and Cu-Ti powder synthesized by arc melting, milling and ultracentrifugation. This ternary powder mixture was introduced to a specifically developed organic vehicle and screen printed onto AIN. The detailed development process and the results will be presented. (author)

  15. Microstructure of Nitrided Aluminum Alloys Using an Electron-Beam-Excited-Plasma (EBEP)

    Institute of Scientific and Technical Information of China (English)

    L. Liu; A. Yamamoto; T. Hishida; H. Shoyama; T. Hara; T. Hara

    2004-01-01

    Nitriding of surface of aluminum alloys was carried out with using an electron-beam-excited-plasma (EBEP)technique. The EBEP is sustained by electron impact ionization with energetic electron beam. Two kinds of substrates,aluminum alloys AA5052 and AA5083, were exposed to the down flow of EBEP source at 843 K for 45min. The specimens were characterized with respect to following properties: crystallographic structure (XRD), morphology (SEM) and the cross sectional microstructures of the nitrided layer was observed using a scanning electron microscopy (SEM). There are some Al2O3 particles on the surface of the nitrided AA5052 and AA5083. The AIN layers were formed on the substrates with the thickness of 4.5 μ m for AA5052 and 0.5 μ m for AA5083. A relatively uniform nitrided surface layer composed of AIN can be observed on the AA5052 substrate. The grains size near the interfaces between the substrate and AIN layer were smaller than that near the surface. On the surface of AIN layer, the concentration of nitrogen was high and in the middle of AIN layer it had a constant concentration like the aluminum and the concentration was decreased with approaching to the interface. On the surface of nitrided AA5083, a uniform AIN layer was not formed as the reason for the high nitriding temperature.

  16. Comparison of endpoints relevant to toxicity assessments in 3 generations of CD-1 mice fed irradiated natural and purified ingredient diets with varying soy protein and isoflavone contents.

    Science.gov (United States)

    Camacho, Luísa; Lewis, Sherry M; Vanlandingham, Michelle M; Juliar, Beth E; Olson, Greg R; Patton, Ralph E; Gamboa da Costa, Gonçalo; Woodling, Kellie; Sepehr, Estatira; Bryant, Matthew S; Doerge, Daniel R; Basavarajappa, Mallikarjuna S; Felton, Robert P; Delclos, K Barry

    2016-08-01

    Diet is an important variable in toxicology. There are mixed reports on the impact of soy components on energy utilization, fat deposition, and reproductive parameters. Three generations of CD-1 mice were fed irradiated natural ingredient diets with varying levels of soy (NIH-41, 5K96, or 5008/5001), purified irradiated AIN-93 diet, or the AIN-93 formulation modified with ethanol-washed soy protein concentrate (SPC) or SPC with isoflavones (SPC-IF). NIH-41 was the control for pairwise comparisons. Minimal differences were observed among natural ingredient diet groups. F0 males fed AIN-93, SPC, and SPC-IF diets had elevated glucose levels and lower insulin levels compared with the NIH-41 group. In both sexes of the F1 and F2 generations, the SPC and SPC-IF groups had lower body weight gains than the NIH-41 controls and the AIN-93 group had an increased percent body fat at postnatal day 21. AIN-93 F1 pups had higher baseline glucose than NIH-41 controls, but diet did not significantly affect breeding performance or responses to glucose or uterotrophic challenges. Reduced testes weight and sperm in the AIN-93 group may be related to low thiamine levels. Our observations underline the importance of careful selection, manufacturing procedures, and nutritional characterization of diets used in toxicological studies. PMID:27234134

  17. Acute interstitial nephritis with acetaminophen and alcohol intoxication

    Directory of Open Access Journals (Sweden)

    Alexopoulou Iakovina

    2011-04-01

    Full Text Available Abstract Drug-induced acute interstitial nephritis (AIN represents a growing cause of renal failure in current medical practice. While antimicrobials and non-steroidal anti-inflammatory drugs are typically associated with drug-induced AIN, few reports have been made on the involvement of other analgesics. We report our experience in managing a 17-year-old female with AIN and subsequent renal injury following an acetaminophen overdose in conjunction with acute alcohol intoxication. It is well established that acetaminophen metabolism, particularly at high doses, produces reactive metabolites that may induce renal and hepatic toxicity. It is also plausible however, that such reactive species could instead alter renal peptide immunogenicity, thereby inducing AIN. In the following report, we review a possible mechanism for the acetaminophen-induced AIN observed in our patient and also discuss the potential involvement of acute alcohol ingestion in disease onset. The objective of our report is to increase awareness of healthcare professionals to the potential involvement of these commonly used agents in AIN pathogenesis.

  18. Assistants' in nursing perceptions of their social place within mental health-care settings.

    Science.gov (United States)

    Cowan, Darrin; Frame, Nicholas; Brunero, Scott; Lamont, Scott; Joyce, Mark

    2015-10-01

    An international nurse shortage, tightening fiscal constraints, and increased service demands have seen health systems increasingly turn to employing assistants in nursing (AIN) as a cost-effective means to meet demand. This paper describes social positioning from the perspective of 11 AIN who were employed to work in specialist mental health settings in a metropolitan health service in Sydney. Data was collected by means of semistructured interviews. Interview questions encouraged AIN to explore their experience with reference to positioning within the service, role perception, role development, staff relationship, and role satisfaction. Thematic analysis was utilized to generate themes and explore meaning within the data. The following themes emerged: role definition and clarity; socialization and adaptation; and enhancing education. Analysis suggests that whilst AIN were integrated into mainstream service, the scope of activities or role remains geographically variable and inconsistent. Encouragingly, as AIN became familiar with their work environments and teams, they considered themselves to be of value and were able to play a meaningful role. A desire for learning and a need for continuing education also emerged as a primary theme. Findings from the data suggest that AIN in the mental health setting remain a novel and, to some extent, poorly utilized resource. PMID:26032120

  19. Fractal dimension and image statistics of anal intraepithelial neoplasia

    International Nuclear Information System (INIS)

    Research Highlights: → Human papillomaviruses cause anal intraepithelial neoplasia (AIN). → Digital image processing was carried out to classify the grades of AIN quantitatively. → The fractal dimension as well as grey value statistics was calculated. → Higher grades of AIN yielded higher values of the fractal dimension. → An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.

  20. Fractal dimension and image statistics of anal intraepithelial neoplasia

    Energy Technology Data Exchange (ETDEWEB)

    Ahammer, H., E-mail: helmut.ahammer@medunigraz.a [Institute of Biophysics, Center of Physiological Medicine, Medical University of Graz, Harrachgasse 21, A-8010 Graz (Austria); Kroepfl, J.M. [Human Performance Research Graz (HPR Graz), Karl-Franzens and Medical University of Graz, Max-Mell Allee 11, A-8010 Graz (Austria); Hackl, Ch. [Research Group of Applied Theoretical Pathology, Department of Pathology, Country Medical Centre St.Poelten, Propst Fuehrer Strasse 4, A-3100 St.Poelten (Austria); Sedivy, R. [Research Group of Applied Theoretical Pathology, Department of Pathology, Country Medical Centre St.Poelten, Propst Fuehrer Strasse 4, A-3100 St.Poelten (Austria); Department of Pathology, Country Medical Centre St.Poelten, Propst Fuehrer Strasse 4, A-3100 St.Poelten (Austria)

    2011-01-15

    Research Highlights: Human papillomaviruses cause anal intraepithelial neoplasia (AIN). Digital image processing was carried out to classify the grades of AIN quantitatively. The fractal dimension as well as grey value statistics was calculated. Higher grades of AIN yielded higher values of the fractal dimension. An automatic detection system is feasible. - Abstract: It is well known that human papillomaviruses (HPV) induce a variety of tumorous lesions of the skin. HPV-subtypes also cause premalignant lesions which are termed anal intraepithelial neoplasia (AIN). The clinical classification of AIN is of growing interest in clinical practice, due to increasing HPV infection rates throughout human population. The common classification approach is based on subjective inspections of histological slices of anal tissues with all the drawbacks of depending on the status and individual variances of the trained pathologists. Therefore, a nonlinear quantitative classification method including the calculation of the fractal dimension and first order as well as second order image statistical parameters was developed. The absolute values of these quantitative parameters reflected the distinct grades of AIN very well. The quantitative approach has the potential to decrease classification errors significantly and it could be used as a widely applied screening technique.