WorldWideScience

Sample records for antichloris viridis druce

  1. Hypolipidemic Activity of Prosopis cineraria L (Druce) Fruit Extract ...

    African Journals Online (AJOL)

    Original Research Article. Hypolipidemic Activity of Prosopis cineraria L (Druce) Fruit. Extract and Molecular Modeling Study with Farnesoid X. Receptor (FXR). Pankaj G Jain* and ... Molecular docking score of β-sitosterol for Farnesoid X receptor was -8.32 kcal/mol, suggesting .... °C. After incubation 2 ml of ice-cold 0.25 N.

  2. Flavonoid constituents and cytotoxic activity of Erucaria hispanica (L. Druce growing wild in Egypt

    Directory of Open Access Journals (Sweden)

    M.M. Marzouk

    2016-09-01

    Full Text Available Thirteen flavonoid compounds were isolated for the first time from the aerial parts of Erucaria hispanica (L. Druce growing in Egypt. Their structures were established on the basis of detailed chromatographic and spectroscopic techniques (UV, 1D and 2D NMR and ESIMS. The cytotoxic activity of the methanol extract as well as some isolated compounds against four human carcinoma cell lines; breast (MCF7, liver (HEPG2, cervix (HELA and colon (HCT116 were evaluated.

  3. Primeiro registro de Accinctapubes albifasciata (Druce, 1902 (Pyralidae, Epipaschiinae em frutos de Ocotea catharinensis Mez-Lauraceae. First record of Accinctapubes albifasciata (Druce 1902 (Pyralidae, Epipaschiinae feed on fruits of Ocotea catharinensis Mez-Lauraceae.

    Directory of Open Access Journals (Sweden)

    Édson Possidônio TEIXEIRA

    2011-06-01

    Full Text Available É registrada pela primeira vez a ocorrência de Accinctapubes albifasciata (Druce, 1902 (Lepidoptera, Pyralidae, atacando frutos de Ocotea catharinensis Mez (Lauraceae, canela-preta, desde o início do desenvolvimento até a sua dispersão, no Parque Estadual da Cantareira (23º22’S e 46º36’W, localizado nos municípios de Caieiras, Guarulhos, Mairiporã e São Paulo, Estado de São Paulo, Brasil.It is registered for the first time the occurrence of Accinctapubes albifasciata (Druce, 1902 (Lepidoptera, Pyralidae attacking fruits of Ocotea catharinensis Mez (Lauraceae, canela-preta, since the beginning of development until its dispersion, at Parque Estadual da Cantareira (23º22’S and 46º36’W, located in the Caieiras, Guarulhos, Mairiporã and São Paulo counties, State of São Paulo, Brazil.

  4. Ontogenetic shift in response to prey-derived chemical cues in prairie rattlesnakes Crotalus viridis viridis

    Directory of Open Access Journals (Sweden)

    Anthony J. SAVIOLA, David CHISZAR, Stephen P. MACKESSY

    2012-08-01

    Full Text Available Snakes often have specialized diets that undergo a shift from one prey type to another depending on the life stage of the snake. Crotalus viridis viridis (prairie rattlesnake takes different prey at different life stages, and neonates typically prey on ectotherms, while adults feed almost entirely on small endotherms. We hypothesized that elevated rates of tongue flicking to chemical stimuli should correlate with particular prey consumed, and that this response shifts from one prey type to another as individuals age. To examine if an ontogenetic shift in response to chemical cues occurred, we recorded the rate of tongue flicking for 25 neonate, 20 subadult, and 20 adult (average SVL = 280.9, 552, 789.5 mm, respectively wild-caught C. v. viridis to chemical stimuli presented on a cotton-tipped applicator; water-soluble cues from two ectotherms (prairie lizard, Sceloporus undulatus, and house gecko, Hemidactylus frenatus, two endotherms (deer mouse, Peromyscus maniculatus and lab mouse, Mus musculus, and water controls were used. Neonates tongue flicked significantly more to chemical cues of their common prey, S. undulatus, than to all other chemical cues; however, the response to this lizard’s chemical cues decreased in adult rattlesnakes. Subadults tongue flicked with a higher rate of tongue flicking to both S. undulatus and P. maniculatus than to all other treatments, and adults tongue flicked significantly more to P. maniculatus than to all other chemical cues. In addition, all three sub-classes demonstrated a greater response for natural prey chemical cues over chemical stimuli of prey not encountered in the wild (M. musculus and H. frenatus. This shift in chemosensory response correlated with the previously described ontogenetic shifts in C. v. viridis diet. Because many vipers show a similar ontogenetic shift in diet and venom composition, we suggest that this shift in prey cue discrimination is likely a general phenomenon among viperid

  5. Cytotoxic activity of the aqueous extract of Micromeria fruticosa (L. Druce subsp. serpyllifolia on human U-87 MG cell lines

    Directory of Open Access Journals (Sweden)

    Koc Kubra

    2017-01-01

    Full Text Available Micromeria fruticosa (L. Druce subsp. serpyllifolia, which is widely used in folk medicine as a medicinal herbal tea, is grown in different areas of Turkey and the Mediterranean region. The present study was conducted to evaluate the aqueous extract of Micromeria fruticosa subsp. serpyllifolia for its antioxidant and antiproliferative activity on a human glioblastoma multiforme cell line (U-87 MG, which has not been reported before. Here, the extract was added to cultures at 8 different concentrations (0-200 μg/mL. Cell viability and cell membrane damage was determined using the MTT and LDH assays for 48 h, respectively. To examine the oxidative effects, total antioxidant capacity (TAC and total oxidant status (TOS levels were measured. The extract displayed considerable antiproliferative activities at the high concentrations of 175 and 200 μg/mL. Furthermore, the extract caused a significant increase in the release of the lactate dehydrogenase (LDH enzyme in a concentration-dependent manner; 200 μg/mL of extract enhanced the release of LDH. Treatments with extract at higher doses increased TOS levels and decreased TAC levels in human U-87 MG cells. Our study suggests that the aqueous extract of Micromeria fruticosa ssp. serpyllifolia was capable of inducing growth inhibition of cancer cells. These results encourage further research to assess the value of the extract in modern phytotherapy.

  6. Biological factors controlling developmental duration, growth and metamorphosis of the larval green toad, Bufo viridis viridis

    Directory of Open Access Journals (Sweden)

    Gamal A. Bekhet

    2014-05-01

    Full Text Available The present study in a controlled laboratory setting provided important insights into both the degree of plasticity and the proximal environmental cues operating in the response of green toad tadpoles to pond drying, food level. It was concluded that timing of metamorphosis and size at metamorphosis were highly affected by pond duration. The effects of pond desiccation are reflected by shorter developmental duration and smaller size at metamorphosis as a result of increased crowding in the shallow tanks than tadpoles in the deep tanks. Bufo viridis raised on high food supplements grew faster than those raised on low food in low or high population density. In the tanks with decreased water and food levels, the tadpoles accelerate development and metamorphose earlier than tadpoles in higher food and water levels. The obtained data revealed that tadpoles grew faster under conditions of high population density than low one in either high or low food levels. Actual density had limited but significant effects on tadpole size and development. It also suggested that density regulation, acting on the tadpole stage, may be present in the population but was of less short-term importance than abiotic factors. Environmentally induced variation in developmental rates translated to changes in relative hind leg length. Hind leg length plasticity was positively correlated with growth rate plasticity. Finally, documenting the recent results of this study, B. viridis breed in temporary ponds and exhibited plasticity in developmental duration and growth rate in response to a change in water level.

  7. Genetic characterization of Perna viridis L. in peninsular Malaysia ...

    Indian Academy of Sciences (India)

    Mendelian inheritance and selective neutrality. Therefore, the objective of this paper is to validate whether local popula- tions of P. viridis collected from ...... between commercial and heritage turkeys (Meleagris gallopavo). Poultry Sci. 86, 46–49. Kimura M. and Crow J. F. 1964 The number of alleles that can be maintained in ...

  8. Genetic characterization of Perna viridis L. in peninsular Malaysia

    Indian Academy of Sciences (India)

    A total of 19 polymorphic microsatellite loci were used to analyse levels of genetic variation for 10 populations of Perna viridis L. collected from all over peninsular Malaysia. The populations involved in this study included Pulau Aman in Penang, Tanjung Rhu in Kedah, Bagan Tiang in Perak, Pulau Ketam in Selangor, Muar, ...

  9. Intoxication of sheep exposed to ozark milkweed (Asclepias viridis Walter).

    Science.gov (United States)

    Smith, R A; Scharko, P; Bolin, D; Hong, C B

    2000-12-01

    Some 20 sheep died 1 at a time on a farm in Fleming County, KY, in late July of 1999 after consumption of Asclepias viridis Walter. Major histological lesions were mild multifocal nonsuppurative myocarditis. Gross pathology revealed wet and heavy lungs. Many affected animals had a hunched appearance, and marked posterior paresis was also observed.

  10. Tolerance of High Inorganic Mercury of Perna viridis: Laboratory ...

    African Journals Online (AJOL)

    MICHAEL

    interesting. In this study, we looked into the metal accumulation by P. viridis exposed to a 'very' high level of inorganic Hg from the dissolved solution phase of seawater since the bioavailability of ... of the Straits of Malacca ranged from 0.8 to 41 ng/L. We used .... dominance of the gill as a site of Hg uptake (George,. 1982 ...

  11. Factors affecting in vitro seed germination and shoot multiplication of a pitcher plant (Nepenthes mirabilis (Lour. Druce

    Directory of Open Access Journals (Sweden)

    Tokhao, W

    2007-03-01

    Full Text Available Mature seeds of a pitcher plant (Nepenthes mirabilis (Lour. Druce were cultured in liquid and solid MS medium (Murashige and Skoog, 1962 supplemented with BA (6-benzyladenine at 1, 3 or 5 mg/l or withcoconut water (20% v/v. The cultures were incubated under light and dark conditions. Seeds germinated only under light incubation and BA supplemented to both types of media, and solid medium with 3 mg/l BAresulted the highest seed germination (26% with good development of seedlings. On the contrary, the addition of coconut water to the basal medium produced poor seed germination and seedling growth. Moreover,all cultures in liquid medium terminated their growth after 6 weeks of culture. Young seedlings were subsequently transferred to fresh media of the same treatments after 15 weeks of seed culture. Multipleshoots were proliferated in all levels of BA after 6 weeks of transferring and more shoots were produced as BA level was increased. However, at high BA level of 5 mg/l, rosetting of shoots occurred while lowering BA level to 3 mg/l, fewer shoots were produced but they were vigorous, larger shoots with complete leaves. Rootdevelopment finally occurred in all BA treatments except the addition of coconut water.To evaluate the potential of shoot multiplication in different strengths of MS macromutrient, two types of explants, viz. shoot explants and stem explants (both approx. 1.5 cm long from in vitro seedlings,were cultured on full-strength MS macronutrient medium, 1/2 MS, 1/4 MS and 1/8 MS medium. Following 16 weeks of culture, shoot production (number/ explant increased in both explant types as the macronutrientstrength decreased. However, when lowering to 1/8 MS, the fewest shoots were produced and exhibited nutrient deficiency of leaf chlorosis. The optimum strength of MS macronutrient for the maximumproduction of normal shoots with complete leaves was 1/2 MS medium while 1/4 MS medium produced the highest shoot number from stem explants but

  12. Breeding phenology of Bufo viridis Laurenti, 1768 in Sicily

    Directory of Open Access Journals (Sweden)

    Alessandra Sicilia

    2006-11-01

    Full Text Available Bufo viridis Laurenti, 1768 is a common species that inhabits a wide variety of habitats. The different climates characterising its broad range lead to a high degree of variability in its seasonal activity and reproductive cycle. This paper reports some observations carried out on the breeding phenology of this species over a two year period in Mediterranean temporary ponds in Sicily. The reproductive period of Sicilian green toads extends into the autumn months, making it longer than that of other Italian populations. This behaviour seems due to the impact of xeric environmental conditions on the seasonal activity of the studied populations. The present study confirms that B. viridis is an opportunistic breeder with a wide margin of variability in annual reproductive cycle patterns, as would be expected of an ecologically variable species. The duration of the reproductive season varied between populations in the same year and between different years for the same population.

  13. Taxsonomical States of Lacerta viridis (LACERTIDAE) Populations from Turkey

    OpenAIRE

    ÇEVİK, İ. Ethem

    2014-01-01

    In this research, , A total of 64 MM and 37 VV adult specimens from Turkish Thrace and 158 MM and 188 VV adult specimens from Anatolia were investigated comparatively as two separate populations groups to determine the subspecific status of the species in Turkey. No significant differences are discernible between the two population groups from the viewpoints of pholidosis, morphometrical measurements and rations and pattern and coloration characteıistics. So the Turkish L. viridis populations...

  14. The complete mitochondrial genome of the green lizard Lacerta viridis viridis (Reptilia: Lacertidae) and its phylogenetic position within squamate reptiles.

    Science.gov (United States)

    Böhme, M U; Fritzsch, G; Tippmann, A; Schlegel, M; Berendonk, T U

    2007-06-01

    For the first time the complete mitochondrial genome was sequenced for a member of Lacertidae. Lacerta viridis viridis was sequenced in order to compare the phylogenetic relationships of this family to other reptilian lineages. Using the long-polymerase chain reaction (long PCR) we characterized a mitochondrial genome, 17,156 bp long showing a typical vertebrate pattern with 13 protein coding genes, 22 transfer RNAs (tRNA), two ribosomal RNAs (rRNA) and one major noncoding region. The noncoding region of L. v. viridis was characterized by a conspicuous 35 bp tandem repeat at its 5' terminus. A phylogenetic study including all currently available squamate mitochondrial sequences demonstrates the position of Lacertidae within a monophyletic squamate group. We obtained a narrow relationship of Lacertidae to Scincidae, Iguanidae, Varanidae, Anguidae, and Cordylidae. Although, the internal relationships within this group yielded only a weak resolution and low bootstrap support, the revealed relationships were more congruent with morphological studies than with recent molecular analyses.

  15. The greening of the coasts: review of the Perna viridis success story.

    NARCIS (Netherlands)

    Rajagopal, S.; Venugopalan, V.P.; Velde, G. van der; Jenner, H.A.

    2006-01-01

    The green mussel Perna viridis has been receiving a lot of attention from workers working in the research areas of intertidal ecology, aquaculture, pollution monitoring, biofouling, zoogeography and invasion biology. P. viridis is a remarkable species in terms of its ability to reach very high

  16. A Serological Investigation of Lacerta viridis (Laurenti, 1768) (Sauria: Lacertidae) Populations in Turkey

    OpenAIRE

    ARIKAN, Hüseyin; ATATÜR, Mehmet K.; ÇEVIK, I. Ethem

    1999-01-01

    A total of 58 (24 MM , 34 VV ) Lacerta viridis specimens, which were collected from Turkish Thrace and the Black Sea region of Anatolia, were evaluated serologically. The analyses support the view that a single race of L. viridis (L. v. meridionalis) inhabits Turkey.

  17. Parasites of prairie rattlesnakes (Crotalus viridis viridis) and gopher snakes (Pituophis melanoleucus sayi) from the eastern high plains of New Mexico.

    Science.gov (United States)

    Pfaffenberger, G S; Jorgensen, N M; Woody, D D

    1989-04-01

    Three prairie rattlesnakes (Crotalus viridis viridis) and two gopher snakes (Pituophis melanoleucus sayi) from the eastern high plains of New Mexico (USA) were examined for parasites. One cestode (Oochoristica osheroffi), and two nematode (Kalicephalus inermis and Physoloptera retusa) species were recovered from two infected rattlesnakes. One female gopher snake was infected with two nematode (K. inermis and Rhabdias spp.) and one mite (Entonyssus halli) species.

  18. Oxygen consumption under copper and zinc stress in Perna viridis

    OpenAIRE

    Prabhudeva, K.N.; Menon, N.R.

    1986-01-01

    The rate of oxygen consumption by Perna viridis pre-exposed to copper and zinc was studied. Those test individuals pre-exposed to various zinc concentrations showed variability in oxygen consumption irrespective of concentrations and pre-exposure period. While those animals pre-exposed to various copper concentrations registered decrease in oxygen consumption at concentrations above 0.06 p.p.m. copper, pre-exposure to concentrations below 0.02 p.p.m. copper did not result in any clear cut cha...

  19. Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis

    Directory of Open Access Journals (Sweden)

    Deleury Emeline

    2009-07-01

    Full Text Available Abstract Background Coral reef ecosystems are renowned for their diversity and beauty. Their immense ecological success is due to a symbiotic association between cnidarian hosts and unicellular dinoflagellate algae, known as zooxanthellae. These algae are photosynthetic and the cnidarian-zooxanthellae association is based on nutritional exchanges. Maintenance of such an intimate cellular partnership involves many crosstalks between the partners. To better characterize symbiotic relationships between a cnidarian host and its dinoflagellate symbionts, we conducted a large-scale EST study on a symbiotic sea anemone, Anemonia viridis, in which the two tissue layers (epiderm and gastroderm can be easily separated. Results A single cDNA library was constructed from symbiotic tissue of sea anemones A. viridis in various environmental conditions (both normal and stressed. We generated 39,939 high quality ESTs, which were assembled into 14,504 unique sequences (UniSeqs. Sequences were analysed and sorted according to their putative origin (animal, algal or bacterial. We identified many new repeated elements in the 3'UTR of most animal genes, suggesting that these elements potentially have a biological role, especially with respect to gene expression regulation. We identified genes of animal origin that have no homolog in the non-symbiotic starlet sea anemone Nematostella vectensis genome, but in other symbiotic cnidarians, and may therefore be involved in the symbiosis relationship in A. viridis. Comparison of protein domain occurrence in A. viridis with that in N. vectensis demonstrated an increase in abundance of some molecular functions, such as protein binding or antioxidant activity, suggesting that these functions are essential for the symbiotic state and may be specific adaptations. Conclusion This large dataset of sequences provides a valuable resource for future studies on symbiotic interactions in Cnidaria. The comparison with the closest

  20. Taxonomy of Nephroselmis viridis sp. nov. (Nephroselmidophyceae, Chlorophyta), a sister marine species to freshwater N. olivacea.

    Science.gov (United States)

    Yamaguchi, Haruyo; Suda, Shoichiro; Nakayama, Takeshi; Pienaar, Richard N; Chihara, Mitsuo; Inouye, Isao

    2011-01-01

    The genus Nephroselmis (Nephroselmidophyceae), which had been placed in the Prasinophyceae, is one of the primitive green flagellates that are important to our understanding of the early evolution of green plants. We studied a new species of Nephroselmis isolated from Japan, Fiji and South Africa. This species has been known for a long time as undescribed species 'N. viridis.' N. viridis possesses some ultrastructural characters shared with only the freshwater type species N. olivacea, including a disc-like structure beneath the pyrenoid and bipolar spiny body scales with 1-5-8-5-1 spines. Molecular phylogenetic analysis based on 18S rDNA also supports a sister relationship between N. viridis and N. olivacea. However, N. viridis is distinguishable from N. olivacea by the shape of its starch sheath, its scales, its pigment composition and its habitat. In this paper, we designate the formal description of N. viridis sp. nov. We also describe variability in the 18S rDNA introns of various N. viridis strains. This detailed study of N. viridis provides some insights into the evolution of Nephroselmis.

  1. Transcriptome profiling of the Australian arid-land plant Eremophila serrulata (A.DC.) Druce (Scrophulariaceae) for the identification of monoterpene synthases.

    Science.gov (United States)

    Kracht, Octavia Natascha; Ammann, Ann-Christin; Stockmann, Julia; Wibberg, Daniel; Kalinowski, Jörn; Piotrowski, Markus; Kerr, Russell; Brück, Thomas; Kourist, Robert

    2017-04-01

    Plant terpenoids are a large and highly diverse class of metabolites with an important role in the immune defense. They find wide industrial application as active pharmaceutical ingredients, aroma and fragrance compounds. Several Eremophila sp. derived terpenoids have been documented. To elucidate the terpenoid metabolism, the transcriptome of juvenile and mature Eremophila serrulata (A.DC.) Druce (Scrophulariaceae) leaves was sequenced and a transcript library was generated. We report on the first transcriptomic dataset of an Eremophila plant. IlluminaMiSeq sequencing (2 × 300 bp) revealed 7,093,266 paired reads, which could be assembled to 34,505 isogroups. To enable detection of terpene biosynthetic genes, leaves were separately treated with methyl jasmonate, a well-documented inducer of plant secondary metabolites. In total, 21 putative terpene synthase genes were detected in the transcriptome data. Two terpene synthase isoenzymatic genes, termed ES01 and ES02, were successfully expressed in E. coli. The resulting proteins catalyzed the conversion of geranyl pyrophosphate, the universal substrate of monoterpene synthases to myrcene and Z-(b)-ocimene, respectively. The transcriptomic data and the discovery of the first terpene synthases from Eremophila serrulata are the initial step for the understanding of the terpene metabolism in this medicinally important plant genus. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. A serine protease inhibitor from hemolymph of green mussel, Perna viridis

    Digital Repository Service at National Institute of Oceanography (India)

    Khan, M.S.; Goswami, U.; Rojatkar, S.R.; Khan, M.I.

    Bioactivity guided fractions of cell-free hemolymph of bacterially challenged marine mussel, Perna viridis led to the isolation of a novel quaternary alkaloid 1, which was identified by its spectral data. The isolated molecule 1 has been found...

  3. Application of oxidative stress indices in natural populations of Perna viridis as biomarker of environmental pollution

    Digital Repository Service at National Institute of Oceanography (India)

    Jena, K.B.; Verlecar, X.N.; Chainy, G.B.N.

    Oxidative stress indices were measured in gills and digestive glands of Perna viridis collected from three coastal locations in Goa i.e., Bambolim, Marmugao Harbour and Malim. In addition to lipid peroxidation, the activities of antioxidant enzymes...

  4. The complete mitochondrial genome of Lacerta bilineata and comparison with its closely related congener L. Viridis.

    Science.gov (United States)

    Kolora, Sree Rohit; Faria, Rui; Weigert, Anne; Schaffer, Stefan; Grimm, Annegret; Henle, Klaus; Sahyoun, Abdullah H; Stadler, Peter F; Nowick, Katja; Bleidorn, Christoph; Schlegel, Martin

    2017-01-01

    We sequenced the mitochondrial genome of the Western green lizard (Lacerta bilineata) using Illumina technology and additional Sanger sequencing. The assembled 17 086 bp mitogenome had a GC content of 40.32% and consisted of 13 protein-coding genes, 22 tRNA genes, two rRNA genes, and one control region (CR), with a gene order identical to the chordate consensus. In addition, we re-sequenced the mitogenome of the closely related Eastern green lizard L. viridis using the same techniques as for L. bilineata. The mitogenomes of L. bilineata and L. viridis showed a sequence identity of 94.4% and 99.9%, respectively, relative to the previously published L. viridis mitogenome. The phylogenetic reconstruction based on 17 Lacertinae mitogenomes using Anolis carolinensis as the outgroup supported L. bilineata and its sister species L. viridis as distinct lineages.

  5. Borrelia lusitaniae and green lizards (Lacerta viridis), Karst Region, Slovakia.

    Science.gov (United States)

    Majláthová, Viktória; Majláth, Igor; Derdáková, Marketa; Víchová, Bronislava; Pet'ko, Branislav

    2006-12-01

    In Europe, spirochetes within the Borrelia burgdorferi sensu lato complex are transmitted by Ixodes ricinus ticks. Specific associations are described between reservoir hosts and individual genospecies. We focused on green lizard (Lacerta viridis) as a host for ticks and potential host for borreliae. In 2004 and 2005, a total of 146 green lizards infested by ticks were captured, and 469 I. ricinus ticks were removed. Borrelial infection was detected in 16.6% of ticks from lizards. Of 102 skin biopsy specimens collected from lizards, 18.6% tested positive. The most frequently detected genospecies was B. lusitaniae (77.9%-94.7%). More than 19% of questing I. ricinus collected in areas where lizards were sampled tested positive for borreliae. B. garinii was the dominant species, and B. lusitaniae represented 11.1%. The presence of B. lusitaniae in skin biopsy specimens and in ticks that had fed on green lizards implicates this species in the transmission cycle of B. lusitaniae.

  6. Psychotria viridis: Chemical constituents from leaves and biological properties

    Directory of Open Access Journals (Sweden)

    DÉBORA B.S. SOARES

    Full Text Available ABSTRACT The phytochemical study of hexane, chloroform and methanol extracts from leaves of Psychotria viridis resulted in the identification of: the pentacyclic triterpenes, ursolic and oleanolic acid; the steroids, 24-methylene-cycloartanol, stigmasterol and β-sitosterol; the glycosylated steroids 3-O-β-D-glucosyl-β-sitosterol and 3-O-β-D-glucosyl-stigmasterol; a polyunsaturated triterpene, squalene; the esters of glycerol, 1-palmitoylglycerol and triacylglycerol; a mixture of long chain hydrocarbons; the aldehyde nonacosanal; the long chain fat acids hentriacontanoic, hexadecanoic and heptadenoic acid; the ester methyl heptadecanoate; the 4-methyl-epi-quinate and two indole alkaloids, N,N-dimethyltryptamine (DMT and N-methyltryptamine. The chemical structures were determined by means of spectroscopic (IR, 1H and 13C NMR, HSQC, HMBC and NOESY and spectrometric (CG-MS and LCMS-ESI-ITTOF methods. The study of biologic properties of P. viridis consisted in the evaluation of the acetylcholinesterase inhibition and cytotoxic activities. The hexane, chloroform, ethyl acetate and methanol extracts, the substances 24-methylene-cycloartanol, DMT and a mixture of 3-O-β-D-glucosyl-β-sitosterol and 3-O-β-D-glucosyl-stigmasterol showed cholinesterase inhibiting activity. This activity induced by chloroform and ethyl acetate extracts was higher than 90%. The methanol and ethyl acetate extracts inhibit the growth and/or induce the death of the tumor cells strains B16F10 and 4T1, without damaging the integrity of the normal cells BHK and CHO. DMT also demonstrated a marked activity against tumor cell strains B16F10 and 4T1.

  7. Mapping of HABs Contaminated In Green Shells (Perna viridis) in Semarang Bay

    Science.gov (United States)

    A'in, Churun; Suryanti, Suryanti; Haeruddin, Haeruddin

    2018-02-01

    The existence of Harmful Algae Blooms (HABs) can adversely affect the water like a mass death of fish and oxygen depletion. Some types of HABs can be contaminated with seafood and contain biotoxins that are detrimental to the health of humans who consume them. Green mussels (Perna viridis) has the properties of filter feeders so vulnerable to contamination HABs. This research was conducted to produce spatially thematic maps contaminated HABs in P. viridis so providing information about risk prediction P. viridis when consumed by humans. Sampling was done purposively in three (3) stations that represent the Bay Semarang namely western boundary waters (Kendal), middle (Semarang) and the eastern boundary (Demak). Sampling done two (2) times, namely East season (June -July) and the second transitional season (September) 2016. Analysis of HABs done either in water or body tissues of P. viridis through the analysis of food habit. The results shows that P. viridis genus positive contaminated HABs phytoplankton Tricodesmium and Ceratium. Spatial distribution and abundance of Tricodesmium genus Fitoplankton is wider and taller than the HABs Phytoplankton genus Ceratium. Group HABs are found in the tissues of P. viridis no potential as biotoxin that does not cause adverse health risks.

  8. Interferência interespecífica entre Amaranthus hybridus L. e Amaranthus viridis L. Interspecific interference between Amaranthus hybridus L. and Amaranthus viridis L.

    Directory of Open Access Journals (Sweden)

    Angela Maria Maluf

    1999-05-01

    Full Text Available O objetivo deste trabalho foi estudar a interferência interespecífica entre duas espécies de Amaranthus -- A. viridis e A. hybridus ¾, esta última com dois biótipos distintos (verde e roxo; ambas ocorriam associadas em dois locais. Nas populações de cada local foram feitos ensaios de substituição independentes, em vasos, nos quais observou-se que as populações que germinam mais prontamente são as que vencem em competição, ou seja, se estabelecem e produzem maior número de sementes. Houve tendência de A. hybridus (tipo verde dominar tanto A. hybridus (tipo roxo como A. viridis, e de A. hybridus (tipo roxo dominar A. viridis. Em cultivo misto, houve casos em que as espécies estavam competindo pelos mesmos recursos, ou explorando recursos diferentes do ambiente, ou mesmo com antagonismo mútuo.The objective of this paper was to study the interspecific interference between two Amaranthus species -- A. viridis and A. hybridus --, the latter with two distinct biotypes (green and purple; both species ocurred in two localities. In the populations of each of the locations, some independent substitution trials were made in pots, and it could be concluded that the populations that germinate more readily are those which are superior in competition i.e., those that establish themselves and produce the largest number of seeds. There was a tendency for A. hybridus (green biotype to dominate both A. hybridus (purple biotype and A. viridis, and for A. hybridus (purple biotype to dominate A. viridis. In mixed stands, there were cases where the species were competing for the same resources, cases where they were exploiting different environmental resources, and even cases of mutual antagonism.

  9. A high-frequency in vitro multiplication, micromorphological studies and ex vitro rooting of Cadaba fruticosa (L.) Druce (Bahuguni): a multipurpose endangered medicinal shrub.

    Science.gov (United States)

    Lodha, Deepika; Patel, Ashok Kumar; Shekhawat, N S

    2015-07-01

    An efficient and reproducible in vitro propagation protocol has been established for Cadaba fruticosa (L.) Druce. Surface-sterilized nodal stem segments of mature plant were used as explants for culture establishment. Multiple shoots were optimally differentiated from the nodal stem explants through bud breaking on Murashige and Skoog (1962) medium containing 3.0 mg l(-1) benzyladenine (BA). The effect of different plant growth regulators and minerals were studied on different stages of micropropagation procedure (i.e., explant establishment, shoot multiplication/growth and ex vitro rooting). Additionally, for enhancing shoot multiplication during subculture, MS medium was modified (MMS) with higher levels of magnesium, potassium and sulphate ions. Out of these, MMS3 medium containing 0.25 mg l(-1) each of BA and Kin (N6-furfuryladenine), with 0.1 mg l(-1) NAA (α-naphthalene acetic acid) was found the best for shoot multiplication (42.45 ± 3.82 per culture vessel). The in vitro regenerated shoots were rooted under ex vitro conditions on treating the shoot base with 500 mg l(-1) of IBA (indole-3 butyric acid) for 3 min on sterile Soilrite®. The ex vitro rooted plants were hardened in the greenhouse and transferred to the field with ≈85 % survival rate. There were not any visual differences between wild and micropropagated plants in the field, although the later underwent significant changes during acclimatization. Micromorphological changes on leaf surface characters from in vitro to acclimatized plantlets were studied in terms of development of glandular trichomes, changes in vein spacing and vein structure in order to understand the nature of plant responses towards environmental conditions. The method developed and defined can be applied for commercial cultivation, which may be important for extraction of bioactive compounds and may facilitate conservation of this multipurpose endangered medicinal shrub.

  10. Setaria viridis floral-dip: A simple and rapid Agrobacterium-mediated transformation method

    Directory of Open Access Journals (Sweden)

    Polyana Kelly Martins

    2015-06-01

    Full Text Available Setaria viridis was recently described as a new monocotyledonous model species for C4 photosynthesis research and genetic transformation. It has biological attributes (rapid life cycle, small genome, diploid, short stature and simple growth requirements that make it suitable for use as a model plant. We report an alternative method of S. viridis transformation using floral dip to circumvent the necessity of tissue culture phase for transgenic plant regeneration. S. viridis spikes at boot stage were selected to be immersed in Agrobacterium suspension. T1 seeds could be identified in 1.5–2 months after floral dipping. We demonstrated through molecular analysis and RFP expression that seeds and resulting plants from dipped inflorescences were transformed. Our results suggest the feasibility of S. viridis floral dip transformation as a time-saving and cost-effective compared with traditional methods. To our knowledge, this is the first report using floral dip in S. viridis as an Agrobacterium-mediated transformation method.

  11. High mortality and poor growth of green mussels, Perna viridis, in high chlorophyll- a environment

    Science.gov (United States)

    Soon, Tan Kar; Denil, Delta Jenetty; Ransangan, Julian

    2016-03-01

    The current study was carried out from May 2014 to April 2015 to estimate the stock status of P. viridis in Marudu Bay. The gonad development was monitored by histological examination, while the population parameters including asymptotic length ( L ∞), growth coefficient ( K), mortality rate ( Z, F and M), exploitation level ( E) and recruitment of P. viridis were estimated using the lengthfrequency data. Results of the current study demonstrated that P. viridis in Marudu Bay spawned throughout the year with two major peaks, one in April to May and another one in October to December. The recruitment pattern was continuous with the peak in May to June 2014, which corresponded to the first spawning peak in April. However, no significant recruitment was observed from the second spawning peak due to the difference in spawning timing between male and female populations. The estimated asymptotic length ( L ∞), growth coefficient ( K), total mortality ( Z), natural mortality ( M), fishing mortality ( F) and growth performance ( φ) of P. viridis in Marudu Bay were estimate to be 117 mm, 0.97 yr-1, 4.39 yr-1, 1.23 yr-1, 3.16 yr-1 and 4.123, respectively. The exponent b of the lengthweight relationship was 2.4 and exploitation level ( E) was 0.72. The high mortality, low condition indices and negative allometric of P. viridis in Marudu Bay is caused by a lack of suitable food in the surrounding water.

  12. Heavy metals concentration relationship with Perna viridis physical properties in Mengkabong Lagoon, Sabah, Malaysia.

    Science.gov (United States)

    Abdullah, Noraini; Tair, Rohana; Abdullah, Mohd Harun

    2014-01-01

    Perna viridis (P. viridis) has been identified as a good biological indicator in identifying environmental pollution, especially when there are various types of Heavy Metals Accumulations (HMA) inside its tissue. Based on the potential of P. viridis to accumulate heavy metals and the data on its physical properties, this study proffers to determine the relationships between both properties. The similarities of the physical properties are used to mathematical model their relationships, which included the size (length, width, height) and weight (wet and dry) of P. viridis, whilst the heavy metals are focused on concentrations of Pb, Cu, Cr, Cd and Zn. The concentrations of metal elements are detected by using Flame Atomic Adsorption Spectrometry. Results show that the mean concentration of Pb, Cu, Cr, Cd, Zn, length, width, height, wet weight and dry weight are: 1.12 +/- 1.00, 2.36 +/- 1.65, 2.12 +/- 2.74, 0.44 +/- 0.41 and 16.52 +/- 10.64 mg kg(-1) (dry weight), 105.08 +/- 14.35, 41.64 +/- 4.64, 28.75 +/- 3.92 mm, 14.56 +/- 3.30 and 2.37 +/- 0.86 g, respectively. It is also found out that the relationships between the Heavy Metals Concentrations (HMA) and the physical properties can be represented using Multiple Linear Regressions (MLR) models, relating that the HMA of Zinc has affected significantly the physical growth properties of P. viridis.

  13. Molecular characterization, ecology, and epidemiology of a novel Tymovirus in Asclepias viridis from Oklahoma.

    Science.gov (United States)

    Min, Byoung-Eun; Feldman, Tracy S; Ali, Akhtar; Wiley, Graham; Muthukumar, Vijay; Roe, Bruce A; Roossinck, Marilyn; Melcher, Ulrich; Palmer, Michael W; Nelson, Richard S

    2012-02-01

    Native virus-plant interactions require more understanding and their study will provide a basis from which to identify potential sources of emerging destructive viruses in crops. A novel tymovirus sequence was detected in Asclepias viridis (green milkweed), a perennial growing in a natural setting in the Tallgrass Prairie Preserve (TGPP) of Oklahoma. It was abundant within and frequent among A. viridis plants and, to varying extents, within other dicotyledonous and one grass (Panicum virgatum) species obtained from the TGPP. Extracts from A. viridis containing the sequence were infectious to a limited number of species. The virus genome was cloned and determined to be closely related to Kennedya yellow mosaic virus. The persistence of the virus within the Oklahoma A. viridis population was monitored for five successive years. Virus was present in a high percentage of plants within representative areas of the TGPP in all years and was spreading to additional plants. Virus was present in regions adjacent to the TGPP but not in plants sampled from central and south-central Oklahoma. Virus was present in the underground caudex of the plant during the winter, suggesting overwintering in this tissue. The RNA sequence encoding the virus coat protein varied considerably between individual plants (≈3%), likely due to drift rather than selection. An infectious clone was constructed and the virus was named Asclepias asymptomatic virus (AsAV) due to the absence of obvious symptoms on A. viridis.

  14. Abscission zone development in Setaria viridis and its domesticated relative, Setaria italica.

    Science.gov (United States)

    Hodge, John G; Kellogg, Elizabeth A

    2016-06-01

    Development of an abscission zone (AZ) is needed for dispersal of seeds, and AZ loss was a critical early step in plant domestication. The AZ forms in different tissues in different species of plants, but whether the AZ is developmentally similar wherever it occurs is unknown. AZ development in Setaria viridis was studied as a representative of the previously uncharacterized subfamily Panicoideae. One accession of the wild species S. viridis and two of its domesticate, S. italica, were studied. Strength of the AZ was measured with a force gauge. Anatomy of the AZ was studied throughout development using bright field and confocal microscopy. The force required to remove a spikelet of S. viridis from the parent plant dropped steadily during development, whereas that required to remove spikelets of S. italica increased initially before stabilizing at a high level. Despite the clear difference in tensile strength of the AZ, anatomical differences between S. viridis and S. italica were subtle, and the position of the AZ was not easy to determine in cross sections of pedicel apices. Staining with DAPI showed that nuclei were present up to and presumably through abscission in S. viridis, and acridine orange staining showed much less lignification than in other cereals. The AZ in Setaria is developmentally and anatomically different from that characterized in rice, barley, and many eudicots. In particular, no set of small, densely cytoplasmic cells is obvious. This difference in anatomy could point to differential genetic control of the structure. © 2016 Botanical Society of America.

  15. Morphological, phylogenetic, and ecological diversity of the new model species Setaria viridis (Poaceae: Paniceae) and its close relatives.

    Science.gov (United States)

    Layton, Daniel J; Kellogg, Elizabeth A

    2014-03-01

    Species limits of the emerging model organism Setaria viridis (tribe Paniceae, subtribe Cenchrinae) are not well defined. It is thought to be related to S. adhaerens, S. faberi, S. verticillata, and S. verticilliformis and in North America occurs with the morphologically similar S. pumila. An integrated approach was taken to evaluate its variation and relationships with the other taxa. Statistical morphology, flow cytometry, molecular phylogenetics, and growth experiments were employed to examine the group's physical variation, polyploidy, evolutionary relationships, and drought ecology, respectively. SETARIA VIRIDIS contributed one genome to the tetraploids S. faberi, S. verticillata, and S. verticilliformis; the other genome of the latter two was contributed by S. adhaerens. Setaria pumila is unrelated. Morphologically, S. viridis is most similar to S. faberi, but all tested accessions of S. viridis were diploid, whereas those of S. faberi were all tetraploid. Principal component analysis of 70 morphological characters consistently separated S. viridis from S. faberi, largely by spikelet characters. The diagnostic morphological characters are not affected by watering. Setaria faberi is far more sensitive to drought, in terms of mortality and morphological stunting, than S. viridis or S. pumila. SETARIA VIRIDIS is a diploid species and has contributed to several polyploid derivatives. The most morphologically similar of the polyploids is S. faberi, which differs in spikelet features, phylogenetics, genome size, and ecological response to drought. Researchers using field-collected S. viridis as a model organism will benefit from the clear delimitation provided in this study.

  16. Assessment of pollution in road runoff using a Bufo viridis biological assay

    International Nuclear Information System (INIS)

    Dorchin, A.; Shanas, U.

    2010-01-01

    Road runoff is a major source of environmental pollution, significantly threatening nearby aquatic habitats. Chemical analyses indicate high pollutant concentrations in the road's 'first flush', but bioassays are more advantageous for addressing the cumulative effects of the numerous pollutants within the runoff. We used Bufo viridis embryos and larvae to assess the toxicity of road runoff from two major highways in Israel. We show, for the first time, that exposure to midseason runoff not only has an adverse effect on growth and development rates of B. viridis larvae but can also lead to increased rates of morphological deformations. Seasonal first flushes, despite having higher metal concentrations, did not adversely affect the toad larvae, apparently due to a counter effect of organic matter that potentially served as a supplementary energy resource. Road runoff can be a major cause for a qualitative decrease in the quality of aquatic habitats threatening amphibians in Israel. - Highway runoff has detrimental effects on the development of B. viridis larvae.

  17. Complete genome sequence of Saccharomonospora viridis type strain (P101T)

    Energy Technology Data Exchange (ETDEWEB)

    Pati, Amrita; Sikorski, Johannes; Nolan, Matt; Lapidus, Alla; Copeland, Alex; Glavina Del Rio, Tijana; Lucas, Susan; Chen, Feng; Tice, Hope; Pitluck, Sam; Cheng, Jan-Fang; Chertkov, Olga; Brettin, Thomas; Han, Cliff; Detter, John C.; Kuske, Cheryl; Bruce, David; Goodwin, Lynne; Chain, Patrick; D' haeseleer, Patrik; Chen, Amy; Palaniappan, Krishna; Ivanova, Natalia; Mavromatis, Konstantinos; Mikhailova, Natalia; Rohde, Manfred; Tindall, Brian J.; Goker, Markus; Bristow, Jim; Eisen, Jonathan A.; Markowitz, Victor; Hugenholtz, Philip; Kyrpides1, Nikos C.; Klenk, Hans-Peter

    2009-05-20

    Saccharomonospora viridis (Schuurmans et al. 1956) Nonomurea and Ohara 1971 is the type species of the genus Saccharomonospora which belongs to the family Pseudonocardiaceae. S. viridis is of interest because it is a Gram-negative organism classified amongst the usually Gram-positive actinomycetes. Members of the species are frequently found in hot compost and hay, and its spores can cause farmer?s lung disease, bagassosis, and humidifier fever. Strains of the species S. viridis have been found to metabolize the xenobiotic pentachlorophenol (PCP). The strain described in this study has been isolated from peat-bog in Ireland. Here we describe the features of this organism, together with the complete genome sequence, and annotation. This is the first complete genome sequence of the family Pseudonocardiaceae, and the 4,308,349 bp long single replicon genome with its 3906 protein-coding and 64 RNA genes is part of the Genomic Encyclopedia of Bacteria and Archaea project.

  18. A simple and highly efficient Agrobacterium-mediated transformation protocol for Setaria viridis

    Directory of Open Access Journals (Sweden)

    Polyana Kelly Martins

    2015-06-01

    Full Text Available The production and use of sugarcane in Brazil is very important for bioenergy production and is recognized as one of the most efficient in the world. In our laboratory, Setaria viridis is being tested as a model plant for sugarcane. S. viridis has biological attributes (rapid life cycle, small genome, diploid, short stature and simple growth requirements that make it suitable for use as a model system. We report a highly efficient protocol for Agrobacterium-mediated genetic transformation of S. viridis. The optimization of several steps in tissue culture allowed the rapid regeneration of plants and increased the rate of transformation up to 29%. This protocol could become a powerful tool for functional genomics in sugarcane.

  19. Heavy Metal Pb Content in the Seawater, Sediment and Green Mussel Tissue Perna Viridis

    OpenAIRE

    Haryono, M. Gandri; Mulyanto,; Kilawati, Yuni

    2017-01-01

    Accumulation of heavy metal Pb into the tissue can proceed through a food chain or environmental exposure. This study was to determine the content of heavy metals Pb in water, sediments and mussels (perna viridis). This research was conducted in March 2016, in the waters of Lekok Pasuruan at the three stations. TPI Station 1, Station 2 at the mouth of the Rejoso river and station 3 nearby PLTU 3. The water, sediments and green mussels (Perna viridis) samples were collected for Pb analysis usi...

  20. The Western Green Lizard Lacerta (viridis) bilineata Daudin, 1804 (Sauria: Lacertidae) in Slovenia and Croatia

    OpenAIRE

    Tvrtković, Nikola; Lazar, Bojan; Tome, Staša; Grbac, Irena

    1998-01-01

    Through a review of egg incubation times and the colour patterns of hatchlings of green lizards from the left side of the Soča (Isonzo) River, and the island of Cres, it has been found that they belong to a recently established species, Lacerta (viridis) bilineata Daudin 1802. It is from now on a member of the list of the herpetofauna of Slovenia and Croatia. At the same time L. viridis (Laurenti 1768) has been confirmed on the sand dunes around Đurđevac (Croatia). On the basis of the known d...

  1. Moessbauer spectroscopy on the reaction center of Rhodopseudomonas viridis

    International Nuclear Information System (INIS)

    Frolov, E.; Goldanskii, V.I.; Birk, A.; Parak, F.; Fritzsch, G.; Sinning, I.; Michel, H.

    1992-01-01

    Proteins called 'reaction centers' (RC) can be isolated from many photosynthetic bacteria. They have one non-heme iron in a quinone acceptor region. The RC of Rhodopseudomonas viridis contains an additional tightly bound tetra-heme cytochrome c subunit. The electronic configuration of both cytochrome and the non-heme iron has been studied in the crystallized protein by Moessbauer spectroscopy at different redox potentials, pH-values, and with an addition of o-phenanthroline. At high potentials (E h =+500 mV) all heme irons are in the low spin Fe 3+ -state, and at low potential (E h = 1 50 mV) they are low spin Fe 2+ with the same Moessbauer parameters for all hemes independent of pH. Redox titrations change the relative area of the reduced and oxidized states in agreement with other methods. The non-heme iron shows a high spin Fe 2+ configuration independent of E h and pH with parameters comparable to those of Rhodopseudomonas sphaeroides. Surprisingly, there is strong evidence for another non-heme iron species in part of the molecules with a Fe 2+ low spin configuration. Incubation with o-phenanthroline decreases the relative Fe 2+ hs-area and increases the contribution of Fe 2+ ls-area. Above 210 K the mean square displacement, 2 >, of the RC-crystals increases more than linearly with temperature. This may be correlated with the increase of the electron transfer rate and indicates that intramolecular mobility influences the functional activity of a protein. (orig.)

  2. Oxygen dynamics and porewater transport in sediments inhabited by the invasive polychaete Marenzelleria viridis

    DEFF Research Database (Denmark)

    Jovanovic, Zeljko; Larsen, Morten; Quintana, Cintia Organo

    2014-01-01

    The polychaete Marenzelleria viridis is an invasive species and often replaces the native Nereis diversicolor. This shift leads to more reduced conditions and changes in the biogeochemical function of the sediments. By combining imaging techniques for O2 (planar optodes) and irrigation patterns...

  3. Kleptoplasts photoacclimation state modulates the photobehaviour of the solar-powered sea slug Elysia viridis.

    Science.gov (United States)

    Cartaxana, Paulo; Morelli, Luca; Quintaneiro, Carla; Calado, Gonçalo; Calado, Ricardo; Cruz, Sónia

    2018-04-30

    Some sacoglossan sea slugs incorporate intracellular functional algal chloroplasts (kleptoplasty) for periods ranging from a few days to several months. Whether this association modulates the photobehaviour of solar-powered sea slugs is unknown. In this study, the long-term retention species Elysia viridis showed avoidance of dark independently of light acclimation state. On the contrary, Placida dendritica , which shows non-functional retention of kleptoplasts, showed no preference over dark, low or high light. High light acclimated (HL ac ) E. viridis showed a higher preference for high light than low light acclimated (LL ac ) conspecifics. The position of the lateral folds (parapodia) was modulated by irradiance, with increasing light levels leading to a closure of parapodia and protection of kleptoplasts from high light exposure. Furthermore, closure of parapodia occurred at higher irradiances in HL ac E. viridis Our results strongly indicate that kleptoplasts photoacclimation state modulates the photobehaviour of the solar-powered sea slug E. viridis . © 2018. Published by The Company of Biologists Ltd.

  4. Setaria viridis floral-dip: A simple and rapid Agrobacterium-medicated transformation method

    Science.gov (United States)

    Setaria viridis was recently described as a new monocotyledonous model species for C4 photosynthesis research and genetic transformation. It has biological attributes (rapid life cycle, small genome, diploid, short stature and simple growth requirements) that make it suitable for use as a model plan...

  5. Chloride transport in toad skin (Bufo viridis). The effect of salt adaptation

    DEFF Research Database (Denmark)

    Katz, U; Larsen, Erik Hviid

    1984-01-01

    The steady-state Cl- current across the skin of Bufo viridis adapted to tap water was found to be rectified. In skins bathed with NaCl Ringer on both sides, a large outward current, carried by influx of Cl-, was observed at a clamping voltage (V) of less than -50 mV (outside of the skin negative...

  6. Il rospo smeraldino Bufo viridis in Val d’Ossola (Amphibia: Anura: Bufonidae

    Directory of Open Access Journals (Sweden)

    Franco Zanghellini

    2006-11-01

    Full Text Available Vengono riportate le osservazioni di rospo smeraldino (Bufo viridis compiute tra il 1998 e il 2004 in Val d’Ossola (provincia del Verbano Cusio Ossola, un’area nella quale questa specie non era stata mai precedentemente segnalata.

  7. The invasive Asian green mussel Perna viridis in South Africa: all ...

    African Journals Online (AJOL)

    The Asian green mussel Perna viridis is an invasive Indo-Pacific species recently reported from South African harbours. To verify the invasion, a phylogenetic (and morphological) analysis of green-shelled mussels (n = 39), found in six South African harbours, was conducted using the mitochondrial cytochrome c oxidase ...

  8. A novel DNase like compound that inhibits virus propagation from Asian green mussel, Perna viridis (Linn.)

    Digital Repository Service at National Institute of Oceanography (India)

    Iqbal, A.N.M.Z.; Khan, M.S.

    with activity against bacteria and cancer cells10,17,26. In this study, we have identified potent DNases like bioactivity in CME and PPC from Perna viridis which indiscriminately digested both low molecular weight DNA (pBR 322) and high molecular weight...

  9. Sex determination in Bonellia viridis (Echiura : Bonelliidae): population dynamics and evolution

    Czech Academy of Sciences Publication Activity Database

    Berec, Luděk; Schembri, P. J.; Boukal S., David

    2005-01-01

    Roč. 108, č. 3 (2005), s. 473-484 ISSN 0030-1299 R&D Projects: GA AV ČR(CZ) KSK6005114; GA AV ČR(CZ) IAB1007201 Institutional research plan: CEZ:AV0Z50070508 Keywords : Bonellia viridis Subject RIV: EH - Ecology, Behaviour Impact factor: 3.309, year: 2005

  10. [Cutaneous lesions with papillomatous structure associated with viruses in the green lizard (Lacerta viridis Laur.)].

    Science.gov (United States)

    Raynaud, A; Adrian, M

    1976-10-04

    Numerous papillomata affecting the skin of the dorsal part of the body occur in a population of Lacerta viridis reared in the laboratory. Electron microscopic study of three of these growths revealed the presence of viral particles belonging, from the morphological aspect, to the groups of the viruses of Herpes, Reo and Papova.

  11. Intestinal helminth communities in the green lizard, lacerta viridis, from bulgaria

    Science.gov (United States)

    Biserkov; Kostadinova

    1998-09-01

    A data set comprising individual host/parasite lists from 100 Lacerta viridis (Reptilia: Lacertidae) belonging to four isolated populations in Bulgaria was studied. A total of seven helminth species was recovered (Leptophallus nigrovenosus, Plagiorchis molini, Oswaldocruzia filiformis, Spauligodon extenuatus, Skrjabinelazia hoffmanni, Physaloptera clausa and Mesocestoides sp.). Lacerta viridis is a new host record for the first five of these species. Communities of intestinal helminths of L. viridis consist of a few species which resulted in a low species richness, abundance and diversity of infracommunities, which exhibit substantial homogeneity among the four samples. A similar pattern of dominance of two nematode species leading to a relatively high community similarity at both infra- and component community levels was observed. While intestinal helminth communities in lizards from 'marginal' habitats were dominated by the host generalist, O. filiformis, those in hosts from 'typical' habitats were dominated by the lizard specialist S. extenuatus. The results indicate that the characteristics of the host's habitat are important in determining the composition rather than structure of intestinal helminth communities in L. viridis.

  12. Content Heavy Metal Pb, Cd In Perna viridis And Sediments In Semarang Bay

    Science.gov (United States)

    Suprapto, D.; Suryanti, S.; Latifah, N.

    2018-02-01

    Waste disposal from human activities, generally contain heavy metals such as Pb and Cd which derived from industrial activities. The aims of the study were to know the concentration of Pb and Cd heavy metals contained in Perna viridis tissue, sediment and water at Semarang Bay. This study was conducted in May 2017 at Semarang Bay. - Samples were collected using purposive sampling method. The heavy metal content in the water and clam was observed using- APHA method and was analyzed using AAS (Atomic Absorption Spectrophotometer). The results showed that concentration of heavy metal of Pb in the water was 0.00-50.5mg/L and the Cd content was of 26.9-51.7 mg/L, whereas the concentration of Pb in the sediment is 445.5-2.053.0mg/L and Cd 963.3-2,150.0 mg/L. Pb content in soft tissue of Perna viridis - is 67.1-1.933.9 mg/L and the concentration of Cd was 203.5-5.787.3 mg/L. The analysis of Pb and Cd in seawater, sediment and soft tissue of Perna viridis according to Enviroment Ministerial decree (KepMenLH ) number 51 of 2004 and applied by NOAA 1999 does not exceed the quality standard, that meant that the Perna viridis has been contaminated by metal Pb it is controversial with the above sentence and Cd. It concluded that the metal content of Pb and Cd in Perna viridis tissue exceeds the quality standard, so it is not suitable to be consumed, especially in high quantity

  13. Chemical composition and antimicrobial and antioxidant activities of Mentha (longifolia L. and viridis) essential oils.

    Science.gov (United States)

    Mkaddem, Mounira; Bouajila, Jalloul; Ennajar, Monia; Lebrihi, Ahmed; Mathieu, Florence; Romdhane, Mehrez

    2009-09-01

    The study was aimed to investigate essential oil chemical composition (gas chromatography/flame ionization detection [GC-FID] and gas chromatography/mass spectrometry [GC-MS]) and antioxidant (1,1-diphenyl-2-picrylhydrazyl free radical (DPPH) and 2,2'-azinobis-3-ethylbenzothiazoline-6-sulphonate [ABTS] assays) and antimicrobial (Gram-positive and Gram-negative bacteria, fungi, and yeast) activities of essential oils extracted from leaves of Mentha longifolia L. and Mentha viridis. GC-MS analysis revealed that M. longifolia was constituted by pulegone (54.41%) as a major component followed by isomenthone (12.02%), 1,8-cineole (7.41%), borneol (6.85%), and piperitenone oxide (3.19%). M. viridis was rich in carvone (50.47%), 1,8-cineole (9.14%), and limonene (4.87%). The antioxidant activity by ABTS assay showed IC(50) values of 476.3 +/- 11.7 and 195.1 +/- 4.2 mg/L for M. longifolia and M. viridis, respectively, the DPPH assays have resulted in a moderate IC(50) (>8000 mg/L and 3476.3 +/- 133 mg/L for M. longifolia and M. viridis, respectively). Antimicrobial activity showed that Listeria monocytogenes and Klebsiella pneumoniae bacteria were more inhibited by the 2 essential oils tested. Escherichia coli was least susceptible. A strong activity was also observed on fungi and yeasts. Carvone, thymol, and piperitone oxide have not been detected in Tunisian M. longifolia. Camphor is reported for the 1st time for M. viridis. Antioxidant and antibacterial activities were correlated to chemical composition.

  14. Complete mitochondrial genomes of the three brown algae (Heterokonta : Phaeophyceae) Dictyota dichotoma, Fucus vesiculosus and Desmarestia viridis

    NARCIS (Netherlands)

    Secq, MPO; Goer, SL; Stam, WT; Olsen, JL; Oudot-LeSecq, M.-P.

    We report the complete mitochondrial sequences of three brown algae (Dictyota dichotoma, Fucus vesiculosus and Desmarestia viridis) belonging to three phaeophycean lineages. They have circular mapping organization and contain almost the same set of mitochondrial genes, despite their size differences

  15. Response of DNA, proteins, lipids and antioxidant enzymes as measure of toxicity to mercury exposures in green mussel Perna viridis

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Chainy, G.B.N.

    Studies on exposures of gills of green-lipped mussel Perna viridis to sublethal levels of mercury (Hg) indicates that oxidative stress marker like lipids peroxidation and protein carbonyl content increase. With the exception of superoxide dismutase...

  16. PRELIMINARY STUDY ON EUBLEMMA SP. (EUBLEMMINAE: A LEPIDOPTERAN PREDATOR OF COCCUS VIRIDIS (HEMIPTERA: COCCIDAE ON COFFEE PLANTS IN BANDARLAMPUNG, INDONESIA

    Directory of Open Access Journals (Sweden)

    Indriyati .

    2015-03-01

    Full Text Available Preliminary study on Eublemma sp. (Eublemminae: a Lepidopteran predator of Coccus viridis (Hemiptera: Coccidae on coffee plants in Bandarlampung, Indonesia. The objectives of this study were 1 to identify a Lepidopteran predator of the soft green scale Coccus viridis and 2 to present preliminary data on the predator’s feeding rate. Some coffee leaves where eggs of the Lepidopteran predator have been laid in C. viridis colonies were taken from the field and observed in the laboratory. The predator’s growth and development was noted and the specimens were identified up to generic level based on the caterpillar morphology. Ten coffee leaves each with certain number of C. viridis were also collected from the field, transferred to the laboratory, and each was inoculated with one starved caterpillar that had just formed its protective casing. The number of surviving C. viridis was counted daily. This study reveals that the caterpillar, identified as Eublemma sp. Is found to feed obligately on C. viridis. The predation rate of Eublemma sp. in laboratory is 97 + 11 scales / caterpillar.

  17. Perdas causadas por Coccus viridis (Hemiptera: Coccidae em mudas de Coffea arabica L.

    Directory of Open Access Journals (Sweden)

    Flávio Lemes Fernandes

    2009-08-01

    Full Text Available Coccus viridis (Green danifica plantas jovens e adultas de Coffea arabica Linnaeu. No entanto, nada se sabe sobre a magnitude dos danos causados por esta praga. Assim, este trabalho teve por objetivo estudar as relações entre o ataque de C. viridis e as perdas causadas por este inseto a C. arabica. Este trabalho foi conduzido em casa de vegetação na Universidade Federal de Viçosa. Foram utilizadas sementes da linhagem IAC 15 da variedade “Catuaí vermelho” de café (C. arabica. Para a confecção dos tratamentos esta praga foi criada em casa de vegetação separada do experimento. Os tratamentos foram: plantas infestadas e não infestadas por adultos e ninfas da cochonilha verde. As plantas foram nutridas com solução nutritiva. Durante 110 dias foram avaliados: números de adultos e de ninfas de primeiro, segundo e terceiro ínstares, área foliar, diâmetro do caule, altura das plantas em todas repetições. No final do experimento avaliou-se o peso das raízes, caule, folhas e total. Os pesos das raízes, matéria seca total, área foliar e diâmetro do caule de plantas não atacadas por C. viridis superaram em 1,31; 1,41; 1,50 e 8,93 vezes, respectivamente o peso de plantas atacadas. As variáveis selecionadas foram: diâmetro do caule (cm, área foliar (cm², peso de raízes (g, ninfas, adultos e total das cochonilhas. Concluindo que a planta de C. arabica é afetada de forma diferente entre seus órgãos e que a ninfa de terceiro ínstar e adultos são as fases que mais causam danos a C. arabica.Losses Caused by Coccus viridis (Green (Hemiptera: Coccidae on Seedlings of Coffea arabica L.Abstract. Coccus viridis (Green cause losses on seedling and old plants of Coffea arabica (Green. However, nothing is known about of the damages caused by this pest. Thus, the objective of this work was to evaluate the relations between atack of C. viridis and the losses caused by this insect. on C. arabica. This work was conduced in greenhouse at

  18. Proteomic profile in Perna viridis after exposed to Prorocentrum lima, a dinoflagellate producing DSP toxins.

    Science.gov (United States)

    Huang, Lu; Zou, Ying; Weng, Hui-wen; Li, Hong-Ye; Liu, Jie-Sheng; Yang, Wei-Dong

    2015-01-01

    In the current study, we compared protein profiles in gills of Perna viridis after exposure to Prorocentrumlima, a dinoflagellate producing DSP toxins, and identified the differential abundances of protein spots using 2D-electrophoresis. After exposure to P. lima, the level of okadaic acid (a main component of DSP toxins) in gills of P. viridis significantly increased at 6 h, but mussels were all apparently healthy without death. Among the 28 identified protein spots by MALDI TOF/TOF-MS, 12 proteins were up-regulated and 16 were down-regulated in the P. lima-exposed mussels. These identified proteins were involved in various biological activities, such as metabolism, cytoskeleton, signal transduction, response to oxidative stress and detoxification. Taken together, our results indicated that the presence of P. lima caused DSP toxins accumulation in mussel gill, and might consequently induce cytoskeletonal disorganization,oxidative stress, a dysfunction in metabolism and ubiquitination/proteasome activity.

  19. Disseminated Mycobacterium celatum infection in a white-tailed trogon (Trogon viridis)

    DEFF Research Database (Denmark)

    Bertelsen, M. F.; Grondahl, C.; Giese, Steen Bjørck

    2006-01-01

    An adult female white-tailed trogon (Trogon viridis) was presented with abdominal enlargement and hard subcutaneous masses. Necropsy findings included bony masses extending from skeletal structures, disseminated pale foci in the liver, and a pale mass in the kidney. Histological examination revea...... revealed multifocal to coalescing granulomatous inflammation in the bone, liver, kidney, lung and spleen. Mycobacterium celatum was isolated from the liver and identified by DNA sequencing. This is the first report of M. celatum infection in an avian species....

  20. Comparative performance of the mussels Perna perna and Perna viridis, cultivated at four different depths

    Directory of Open Access Journals (Sweden)

    Marielyn García

    Full Text Available Abstract This study aims to evaluate the effect of environmental variability on the growth and survival of the subtropical and tropical mussels Perna perna and Perna viridis at four different culture depths in the Gulf of Cariaco during an annual cycle. Juveniles of P. perna (39.1±1.88 mm in shell length and P. viridis (36.7±1.87 mm were sown on nylon ropes (3/4" and suspended from a raft at 1, 3, 6 and 9 m depths. Every six weeks, three replicates of each species were sampled (10 individuals per replicate at each depth. Growth parameters were determined: mass and shell length, dry mass of soft tissues as well as fouling and survival rates. Temperature, transparency, chlorophyll a, oxygen, salinity and particulate organic and inorganic matter were recorded at each culture depth for the purpose of relating growth and survival to environmental change. The results show that the growth of both species was linked to the environment, especially with regard to the influence of the food and temperature. A period of stagnant growth of P. perna was associated with the higher temperature and lower phytoplankton biomass that is characteristic of the season with prevalent water column stratification (August-November 2007. By contrast, the growth of P. viridis did not stagnate, although it was gradual and relatively lower. At the end, P. perna achieved higher growth rates than P. viridis. Possible culture strategies to improve the production of both mussel species are discussed.

  1. Identification of lysozyme activity from two edible bivalves - Perna viridis (Linnaeus) and Meretrix casta (Chemnitz)

    Digital Repository Service at National Institute of Oceanography (India)

    Sharma, S.; Tanu; Chatterji, A.

    Pertanika J. Trop. Agric. Sci. 32(1): 85 - 90 (2009) ISSN: 1511-3701 ©Universiti Putra Malaysia Press Received: 20 May 2008 Accepted: 8 October 2008 * Corresponding Author Identification of Lysozyme Activity from Two Edible Bivalves - Perna viridis... (Linnaeus) and Meretrix casta (Chemnitz) Sumita Sharma 1* , Tanu 2 and Anil Chatterji 3 1 National Institute of Oceanography, Dona Paula, Goa, India 2 Banasthali Universiti, Rajasthan 3 Institute of Tropical Aquaculture, Universiti Malaysia Terengganu...

  2. Parasites and pathological condition in Green mussel Perna viridis Linnaeus, 1758 from western Johor Straits, Malaysia

    Science.gov (United States)

    Azmi, Nur-Fauzana; Ghaffar, Mazlan Abd.; Cob, Zaidi Che

    2018-04-01

    This study describes the parasites and pathological condition of infected organ of the green mussel Perna viridis from Merambong Shoal, Western Johor Straits, Malaysia. Samples were collected randomly in November and December 2013. Histopathology techniques using Masson's Trichrome staining protocol were performed and the thin sections were observed under light microscope. Result showed that gonad was the most infected organ followed by the digestive tubule, adductor muscle, intestine and mantle tissue. The parasites (apicomplexa) such as spore-like Nematopsis, macrogamont-like coccidian, mature oocyst-like coccidian, unidentified coccidian and protozoan were found in the adductor muscle, gonad and mantle. Meanwhile, the pathological conditions were found in all infected organs except the gill, such as particular melanin deposits in cytoplasm, Rickettsia-like or Chlamydiae organism and bacteria-like inclusions. Haemocytic infiltrations were found in the surrounding connective tissues of all infected organs. However, these light infections are not causing morbidity and mortalityof the green mussel P.viridis. This study provides baseline information on health profile of the green mussel P.viridis. Further investigations are needed particularly on parasite species identification and their ecology. Understanding of the morphology and pathology of parasites infecting mollusks are very important for management of the resources.

  3. Interaction of Temperature and Photoperiod Increases Growth and Oil Content in the Marine Microalgae Dunaliella viridis.

    Directory of Open Access Journals (Sweden)

    Soundarya Srirangan

    Full Text Available Eukaryotic marine microalgae like Dunaliella spp. have great potential as a feedstock for liquid transportation fuels because they grow fast and can accumulate high levels of triacylgycerides with little need for fresh water or land. Their growth rates vary between species and are dependent on environmental conditions. The cell cycle, starch and triacylglycerol accumulation are controlled by the diurnal light:dark cycle. Storage compounds like starch and triacylglycerol accumulate in the light when CO2 fixation rates exceed the need of assimilated carbon and energy for cell maintenance and division during the dark phase. To delineate environmental effects, we analyzed cell division rates, metabolism and transcriptional regulation in Dunaliella viridis in response to changes in light duration and growth temperatures. Its rate of cell division was increased under continuous light conditions, while a shift in temperature from 25 °C to 35 °C did not significantly affect the cell division rate, but increased the triacylglycerol content per cell several-fold under continuous light. The amount of saturated fatty acids in triacylglycerol fraction was more responsive to an increase in temperature than to a change in the light regime. Detailed fatty acid profiles showed that Dunaliella viridis incorporated lauric acid (C12:0 into triacylglycerol after 24 hours under continuous light. Transcriptome analysis identified potential regulators involved in the light and temperature-induced lipid accumulation in Dunaliella viridis.

  4. Setaria viridis as a model system to advance millet genetics and genomics

    Directory of Open Access Journals (Sweden)

    Pu Huang

    2016-11-01

    Full Text Available Millet is a common name for a group of polyphyletic, small-seeded cereal crops that include pearl, finger and foxtail millet. Millet species are an important source of calories for many societies, often in developing countries. Compared to major cereal crops such as rice and maize, millets are generally better adapted to dry and hot environments. Despite their food security value, the genetic architecture of agronomically important traits in millets, including both morphological traits and climate resilience remains poorly studied. These complex traits have been challenging to dissect in large part because of the lack of sufficient genetic tools and resources. In this article, we review the phylogenetic relationship among various millet species and discuss the value of a genetic model system for millet research. We propose that a broader adoption of green foxtail (Setaria viridis as a model system for millets could greatly accelerate the pace of gene discovery in the millets, and summarize available and emerging resources in S. viridis and its domesticated relative S. italica. These resources have value in forward genetics, reverse genetics and high throughput phenotyping. We describe methods and strategies to best utilize these resources to facilitate the genetic dissection of complex traits. We envision that coupling cutting-edge technologies and the use of S. viridis for gene discovery will accelerate genetic research in millets in general. This will enable strategies and provide opportunities to increase productivity, especially in the semi-arid tropics of Asia and Africa where millets are staple food crop.

  5. Assessment of pollution in road runoff using a Bufo viridis biological assay

    Energy Technology Data Exchange (ETDEWEB)

    Dorchin, A., E-mail: adorchin@campus.haifa.ac.i [Department of Evolutionary and Environmental Biology, Faculty of Natural Sciences, University of Haifa, Mount Carmel, Haifa 31905 (Israel); Shanas, U., E-mail: shanas@research.haifa.ac.i [Department of Evolutionary and Environmental Biology, Faculty of Natural Sciences, University of Haifa, Mount Carmel, Haifa 31905 (Israel); Department of Biology, Faculty of Natural sciences, University of Haifa - Oranim, Tiv' on 36006 (Israel)

    2010-12-15

    Road runoff is a major source of environmental pollution, significantly threatening nearby aquatic habitats. Chemical analyses indicate high pollutant concentrations in the road's 'first flush', but bioassays are more advantageous for addressing the cumulative effects of the numerous pollutants within the runoff. We used Bufo viridis embryos and larvae to assess the toxicity of road runoff from two major highways in Israel. We show, for the first time, that exposure to midseason runoff not only has an adverse effect on growth and development rates of B. viridis larvae but can also lead to increased rates of morphological deformations. Seasonal first flushes, despite having higher metal concentrations, did not adversely affect the toad larvae, apparently due to a counter effect of organic matter that potentially served as a supplementary energy resource. Road runoff can be a major cause for a qualitative decrease in the quality of aquatic habitats threatening amphibians in Israel. - Highway runoff has detrimental effects on the development of B. viridis larvae.

  6. STUDI BIOAKUMULASI MERKURI DARI JALUR AIR LAUT OLEH KERANG DARAH (ANADARA GRANOSA DAN KERANG HIJAU (PERNA VIRIDIS

    Directory of Open Access Journals (Sweden)

    Heny Suseno

    2016-10-01

    Full Text Available ABSTRACT Blood cockle and green mussel are source of protein that vulnerable to contamination by mercury (Hg through bioaccumulation process. The research of Hg2+ bioaccumulation ability by bloodcockle (Anadara granosa and green mussel (Perna viridis using the radiotracer 203Hg2+ was conducted based on laboratory experiments design. Biokinetic parameters, such as the uptake and depuration rate and Concentration Factor, were determined to obtain predictions of Bioconcentration Factor (BCF and steady state conditions. The results of experiment using non-linear model showed that blood cockle and green mussel have the capability to accumulate Hg2+ by 15429.38 and 6963.68 times higher than its concentration in seawater after 51 days. Based on the BCF value obtained from the experiments, the predicted concentration of mercury in Anadara granosa and Perna viridis from Jakarta Bay was 1.327 and 0.599 mg.Kg-1 respectively. The predicted concentration of Hg2+ in Anadara granosa exceeds those required by ISO 7387:2009. On the other hand, the predicted in Perna viridis still meet the requirements of ISO 7387 2009. Keywords: Bioaccumulation, mercury, Perna viridis, Anadara granosa   ABSTRAK Kerang darah dan kerang hijau merupakan salah satu sumber protein yang rentan terkontaminasi merkuri (Hg melalui proses bioakumulasi. Penelitian kemampuan bioakumulasi Hg2+ oleh kerang darah (Anadara granosa dan kerang hijau (Perna viridis menggunakan radiotracer 203Hg2+ dilakukan dengan desain eksperimen di laboratorium. Parameter biokinetika seperti kecepatan pengambilan, kecepatan pelepasan dan Faktor Konsentrasi ditetapkan untuk memprediksi Faktor Biokonsentrasi dan kondisi steady state proses bioakumulasi. Hasil percobaan yang dimodelkan dalam persamaan non linier menunjukkan bahwa Anadara granosa maupun Perna viridis mampu mengakumulasi Hg2+ masing-masing 15429,38 dan 6963,68 kali dari konsentrasinya di dalam air laut setelah 51 hari. Berdasarkan nilai BCF masing

  7. [Ultrastructure of primordial germ cells of Lacerta muralis and Lacerta viridis. Comparison with Lacerta vivipara (author's transl)].

    Science.gov (United States)

    Hubert, J

    1974-01-01

    The ultrastructure of primordial germ cells migrating through the embryo and situated in genital crests is described in Lacerta viridis and Lacerta muralis. It is compared with the germ cells of Lacerta vivipara previously studied. The cytoplasmic ultrastructure is the same in the three Lacertilians, but several nuclear differences are observed. The outline of the nucleus is regular and his shape is spheric in Lacerta vivipara, but in the two others Lacertilians the nucleus shows a very sinuous outline with deep cytoplasmic invaginations. There are fibrous nuclear bodies in the three Lacertilians but the germ cells of Lacerta muralis have in addition granular bodies. The nucleolus in Lacerta viridis and Lacerta muralis is very different from the annular nucleolus of the germ cells of Lacerta vivipara. It is possible to distinguish three types of nucleoli: a compact nucleolus in Lacerta viridis and Lacerta muralis, a granular cords nucleolus in Lacerta viridis, a vacuolar nucleolus in Lacerta muralis. Each type can be seen during the migration of the gonocytes or during the colonisation of the genital region. Probably there is a relationship between these different architectures and the activity of nucleolus in synthesis and liberation of ribosomal RNA. However the nuclear fibrillar area which we have previosly called "masse para nucléolaire" in Lacerta vivipara, is present in the germ cells of Lacerta viridis and Lacerta muralis.

  8. P-glycoprotein expression in Perna viridis after exposure to Prorocentrum lima, a dinoflagellate producing DSP toxins.

    Science.gov (United States)

    Huang, Lu; Wang, Jie; Chen, Wen-Chang; Li, Hong-Ye; Liu, Jie-Sheng; Tao Jiang; Yang, Wei-Dong

    2014-08-01

    Bivalves naturally exposed to toxic algae have mechanisms to prevent from harmful effects of diarrhetic shellfish poisoning (DSP) toxins. However, quite few studies have examined the mechanisms associated, and the information currently available is still insufficient. Multixenobiotic resistance (MXR) is ubiquitous in aquatic invertebrates and plays an important role in defense against xenobiotics. Here, to explore the roles of P-glycoprotein (P-gp) in the DSP toxins resistance in shellfish, complete cDNA of P-gp gene in the mussel Perna viridis was cloned and analyzed. The accumulation of okadaic acid (OA), a main component of DSP toxins, MXR activity and expression of P-gp in gills of P. viridis were detected after exposure to Prorocentrum lima, a dinoflagellate producing DSP toxins in the presence or absence of P-gp inhibitors PGP-4008, verapamil (VER) and cyclosporin A (CsA). The mussel P. viridis P-gp closely matches MDR/P-gp/ABCB protein from various organisms, having a typical sequence organization as full transporters from the ABCB family. After exposure to P. lima, OA accumulation, MXR activity and P-gp expression significantly increased in gills of P. viridis. The addition of P-gp-specific inhibitors PGP-4008 and VER decreased MXR activity induced by P. lima, but had no effect on the OA accumulation in gills of P. viridis. However, CsA, a broad-spectrum inhibitor of ABC transporter not only decreased MXR activity, but also increased OA accumulation in gills of P. viridis. Together with the ubiquitous presence of other ABC transporters such as MRP/ABCC in bivalves and potential compensatory mechanism in P-gp and MRP-mediated resistance, we speculated that besides P-gp, other ABC transporters, especially MRP might be involved in the resistance mechanisms to DSP toxins. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. The relationship of heavy metals and condition indices of green-lipped mussel perna viridis from contaminated and uncontaminated environments

    International Nuclear Information System (INIS)

    Ahmad Ismail; Yap Chee Kong

    1999-01-01

    Heavy metal concentrations and condition indices of green-fipped mussel Perna viridis were detemiined at two different sites of Peninsular Malaysia. Significant negative correlations (p< 0.001) between condition indices and heavy metals were observed. Samples from Kuala Perlis which relatively showed high heavy metals concentrations in mussels exhibited lower condition index while Kg. Tg. Batu with lower heavy metal levels, showed higher condition index. The environmental stress is believed to be responsible for the different physiological index in green-fipped mussel P. viridis. (author)

  10. Nidovirus-Associated Proliferative Pneumonia in the Green Tree Python (Morelia viridis).

    Science.gov (United States)

    Dervas, Eva; Hepojoki, Jussi; Laimbacher, Andrea; Romero-Palomo, Fernando; Jelinek, Christine; Keller, Saskia; Smura, Teemu; Hepojoki, Satu; Kipar, Anja; Hetzel, Udo

    2017-08-09

    In 2014 we observed a noticeable increase in sudden deaths of green tree pythons ( Morelia viridis ). Pathological examination revealed accumulation of mucoid material within airways and lung, associated with enlargement of the entire lung. We performed full necropsy and histological examination on 12 affected green tree pythons from 7 different breeders to characterise the pathogenesis of this "mucinous" pneumonia. By histology we could show a marked hyperplasia of the airway epithelium and of faveolar type II pneumocytes. Since routine microbiological tests failed to identify a causative agent, we studied lung samples of a few diseased snakes by next-generation sequencing (NGS). From the NGS data we could assemble a piece of RNA genome <85% identical to nidoviruses previously identified in ball pythons and Indian pythons. We then employed RT-PCR to demonstrate the presence of the novel nidovirus in all diseased snakes. To attempt virus isolation, we established primary cell cultures of Morelia viridis liver and brain, which we inoculated with lung homogenates of infected individuals. Ultrastructural examination of concentrated cell culture supernatants showed the presence of nidovirus particles, and subsequent NGS analysis yielded the full genome of the novel virus, Morelia viridis nidovirus (MVNV). We then generated an antibody against MVNV nucleoprotein, which we used alongside RNA in situ hybridisation to demonstrate viral antigen and RNA in the affected lungs. This suggests that in natural infection MVNV damages the respiratory tract epithelium which then results in epithelial hyperplasia, most likely as an exaggerated regenerative attempt in association with increased epithelial turnover. Importance Fairly recently novel nidoviruses associated with severe respiratory disease were identified in ball pythons and Indian pythons. Herein we report isolation and identification of a further nidovirus from green tree pythons ( Morelia viridis ) with fatal pneumonia

  11. Peucetia viridis (Blackwall, 1858), caracteres y discusión (Aranae, Oxyopidae)

    OpenAIRE

    Barrientos Alfageme, José Antonio

    1991-01-01

    New records of the type-species of the genus Peucetia from the south of the Iberian Peninsula, near the Mediterranean Sea, confirm its presence in Europe. P. viridis has been recently the subject of taxonomical confussion. In this paper a more complete description of the species is proposed, illustraded with drawings of its general aspect and genital organs. Algunas citas nuevas de la banda mediterránea, en el sur de la Península Ibérica, confirman la presencia en Europa de la especie-tipo...

  12. Karyological and flow cytometric evidence of triploid specimens in Bufo viridis (Amphibia Anura

    Directory of Open Access Journals (Sweden)

    D Cavallo

    2010-01-01

    Full Text Available Karyological and flow cytometric (FCM analyses were performed on a group of 14 green toads of the Bufo viridis species from seven Eurasian populations. Both approaches gave concordant results concerning the DNA ploidy level. All the populations examined were represented exclusively by diploid or tetraploid specimens, except one, where triploids were found. Results evidenced an interpopulation variability in DNA content against the same ploidy level, as well as an unusually high number of triploids in a particular reproductive place. The origin of polyploidy and the presence and persistence of a high number of triploids in a particular population are discussed.

  13. Propagação Assexuada de Chacrona (Psychotria viridis Ruiz & Pavon) Via Estaquia Foliar

    OpenAIRE

    Salgado, Moisés Pereira Galvão; Universidade de Taubaté - UNITAU; Furlan, Marcos Roberto; Universidade de Taubaté; Aoyama, Elisa Mitsuko; Universidade Federal do Espírito Santo - UFES; Rodrigues, Eliana; Universidade Federal de São Paulo; Cruz, Lilian Pereira; Universidade Estadual de Campinas - UNICAMP

    2011-01-01

    This study aimed to assess the asexual propagation of Psychotria viridis by leaf cuttings. The treatments were: A - Whole leaf cuttings, B - leaf cuttings with the top third cut off; C - with the lower third of the cuttings removed; D - with cuts on the primary vein of leaf cuttings, and E - poles with cuts on the leaf ’s secondary veins. The cuttings were immersed in distilled water for a period of 70 days. In all the treatments, the rooting was observed to occur in the region of the cut, or...

  14. High speed translocation of /sup 86/Rb in the phloem of Tradescantia viridis

    Energy Technology Data Exchange (ETDEWEB)

    Penot, M.

    1976-01-01

    An autoradiographic study of the rooted shoots of Tradescantia viridis showed a high speed translocation of /sup 86/Rb applied to a leaf for short periods of time (5 to 2.5 min). The speed of this translocation (between 840 and 1.440 cm h/sup -1/) speaks for the existence of a very rapid phloem component translocating ions to an active sink, represented here by the growing roots. Pretreatment with cycloheximide (48 h, 50 mg 1/sup -1/) decreases the quantity of this long distance transport but not the velocity.

  15. Response of the regenerating telencephalon of Lacerta viridis to nerve growth factor.

    Science.gov (United States)

    Del Grande, P; Minelli, G

    1980-01-01

    To identify the nature of the dividing cells during the regenerative process of the telencephalon, the authors administered nerve growth factor (NGF) to Lacerta viridis with a wedge of telencephalon removed. Some known centers of cell proliferation were unresponsive to the treatment, whereas the ventral end of the telencephalic ventricle underwent an increase of up to 200% in proliferation rate. On the basis of this observation and data in the literature, the authors propose that the cell proliferation beginning in the medial area during the regeneration of the telencephalic ventricle is due to catecholaminergic neuroblasts still present in the adult.

  16. Anti-HMG-CoA Reductase, Antioxidant, and Anti-Inflammatory Activities of Amaranthus viridis Leaf Extract as a Potential Treatment for Hypercholesterolemia

    Directory of Open Access Journals (Sweden)

    Shamala Salvamani

    2016-01-01

    Full Text Available Inflammation and oxidative stress are believed to contribute to the pathology of several chronic diseases including hypercholesterolemia (elevated levels of cholesterol in blood and atherosclerosis. HMG-CoA reductase inhibitors of plant origin are needed as synthetic drugs, such as statins, which are known to cause adverse effects on the liver and muscles. Amaranthus viridis (A. viridis has been used from ancient times for its supposedly medically beneficial properties. In the current study, different parts of A. viridis (leaf, stem, and seed were evaluated for potential anti-HMG-CoA reductase, antioxidant, and anti-inflammatory activities. The putative HMG-CoA reductase inhibitory activity of A. viridis extracts at different concentrations was determined spectrophotometrically by NADPH oxidation, using HMG-CoA as substrate. A. viridis leaf extract revealed the highest HMG-CoA reductase inhibitory effect at about 71%, with noncompetitive inhibition in Lineweaver-Burk plot analysis. The leaf extract showed good inhibition of hydroperoxides, 2,2-diphenyl-1-picrylhydrazyl (DPPH, nitric oxide (NO, and ferric ion radicals in various concentrations. A. viridis leaf extract was proven to be an effective inhibitor of hyaluronidase, lipoxygenase, and xanthine oxidase enzymes. The experimental data suggest that A. viridis leaf extract is a source of potent antioxidant and anti-inflammatory agent and may modulate cholesterol metabolism by inhibition of HMG-CoA reductase.

  17. Review of the genus Qinshuiacris (Orthoptera: Acrididae) from China with proposal of Caryanda viridis-species group and description of a new species.

    Science.gov (United States)

    Mao, Ben-Yong; Niu, Yao; Zheng, Zhe-Min; Scott, Matthew B

    2015-07-07

    Based on an examination of type and additional material, Qinshuiacris viridis Zheng & Mao, 1996 and some allied species in the genus Caryanda are reviewed. Q. viridis Zheng & Mao, 1996 is transferred to Caryanda as a new combination: C. viridis (Zheng & Mao, 1996) comb. nov.. The female of C. viridis is described for the first time and sixty-two topotypes are designated. The genus Qinshuiacris Zheng & Mao, 1996 is synonymized with Caryanda Stål, 1878 because of the transfer of the type species. C. yini Mao & Ren, 2006 is proposed as a new junior synonym of C. dehongensis Mao, Xu & Yang, 2003. A new species, C. eshana Mao sp. nov., is also described and illustrated. Additionally, the conception of the Caryanda viridis-species group is proposed to contain the four allied species with falciform cerci: C. albomaculata Mao, Ren & Ou, 2007, C. dehongensis Mao, Xu & Yang, 2003, C. eshana Mao sp. nov., and C. viridis (Zheng & Mao, 1996) comb. nov.. A key to the species of C. viridis-species group is provided. Type specimens are deposited in the Biological Science Museum, Dali University (BMDU), Yunnan Province, China, in the Institute of Zoology, Shaanxi Normal University (IZSNU), Shaanxi Province, China and in the Institute of Zoology, Chinese Academy of Sciences, Beijing, China (IZCAS).

  18. Comparative venomics of the Prairie Rattlesnake (Crotalus viridis viridis) from Colorado: Identification of a novel pattern of ontogenetic changes in venom composition and assessment of the immunoreactivity of the commercial antivenom CroFab®.

    Science.gov (United States)

    Saviola, Anthony J; Pla, Davinia; Sanz, Libia; Castoe, Todd A; Calvete, Juan J; Mackessy, Stephen P

    2015-05-21

    Here we describe and compare the venomic and antivenomic characteristics of both neonate and adult Prairie Rattlesnake (Crotalus viridis viridis) venoms. Although both neonate and adult venoms contain unique components, similarities among protein family content were seen. Both neonate and adult venoms consisted of myotoxin, bradykinin-potentiating peptide (BPP), phospholipase A2 (PLA2), Zn(2+)-dependent metalloproteinase (SVMP), serine proteinase, L-amino acid oxidase (LAAO), cysteine-rich secretory protein (CRISP) and disintegrin families. Quantitative differences, however, were observed, with venoms of adults containing significantly higher concentrations of the non-enzymatic toxic compounds and venoms of neonates containing higher concentrations of pre-digestive enzymatic proteins such as SVMPs. To assess the relevance of this venom variation in the context of snakebite and snakebite treatment, we tested the efficacy of the common antivenom CroFab® for recognition of both adult and neonate venoms in vitro. This comparison revealed that many of the major protein families (SVMPs, CRISP, PLA2, serine proteases, and LAAO) in both neonate and adult venoms were immunodepleted by the antivenom, whereas myotoxins, one of the major toxic components of C. v. viridis venom, in addition to many of the small peptides, were not efficiently depleted by CroFab®. These results therefore provide a comprehensive catalog of the venom compounds present in C. v. viridis venom and new molecular insight into the potential efficacy of CroFab® against human envenomations by one of the most widely distributed rattlesnake species in North America. Comparative proteomic analysis of venoms of neonate and adult Prairie Rattlesnake (Crotalus viridis viridis) from a discrete population in Colorado revealed a novel pattern of ontogenetic shifts in toxin composition for viperid snakes. The observed stage-dependent decrease of the relative content of disintegrins, catalytically active D49-PLA2s

  19. Brassinosteroids Modulate Meristem Fate and Differentiation of Unique Inflorescence Morphology in Setaria viridis[OPEN

    Science.gov (United States)

    Thames, Shuiyi; Jiang, Hui

    2018-01-01

    Inflorescence architecture is a key determinant of yield potential in many crops and is patterned by the organization and developmental fate of axillary meristems. In cereals, flowers and grain are borne from spikelets, which differentiate in the final iteration of axillary meristem branching. In Setaria spp, inflorescence branches terminate in either a spikelet or a sterile bristle, and these structures appear to be paired. In this work, we leverage Setaria viridis to investigate a role for the phytohormones brassinosteroids (BRs) in specifying bristle identity and maintaining spikelet meristem determinacy. We report the molecular identification and characterization of the Bristleless1 (Bsl1) locus in S. viridis, which encodes a rate-limiting enzyme in BR biosynthesis. Loss-of-function bsl1 mutants fail to initiate a bristle identity program, resulting in homeotic conversion of bristles to spikelets. In addition, spikelet meristem determinacy is altered in the mutants, which produce two florets per spikelet instead of one. Both of these phenotypes provide avenues for enhanced grain production in cereal crops. Our results indicate that the spatiotemporal restriction of BR biosynthesis at boundary domains influences meristem fate decisions during inflorescence development. The bsl1 mutants provide insight into the molecular basis underlying morphological variation in inflorescence architecture. PMID:29263085

  20. Acquired phototrophy through retention of functional chloroplasts increases growth efficiency of the sea slug Elysia viridis.

    Directory of Open Access Journals (Sweden)

    Finn A Baumgartner

    Full Text Available Photosynthesis is a fundamental process sustaining heterotrophic organisms at all trophic levels. Some mixotrophs can retain functional chloroplasts from food (kleptoplasty, and it is hypothesized that carbon acquired through kleptoplasty may enhance trophic energy transfer through increased host growth efficiency. Sacoglossan sea slugs are the only known metazoans capable of kleptoplasty, but the relative fitness contributions of heterotrophy through grazing, and phototrophy via kleptoplasts, are not well understood. Fitness benefits (i.e. increased survival or growth of kleptoplasty in sacoglossans are commonly studied in ecologically unrealistic conditions under extended periods of complete darkness and/or starvation. We compared the growth efficiency of the sacoglossan Elysia viridis with access to algal diets providing kleptoplasts of differing functionality under ecologically relevant light conditions. Individuals fed Codium fragile, which provide highly functional kleptoplasts, nearly doubled their growth efficiency under high compared to low light. In contrast, individuals fed Cladophora rupestris, which provided kleptoplasts of limited functionality, showed no difference in growth efficiency between light treatments. Slugs feeding on Codium, but not on Cladophora, showed higher relative electron transport rates (rETR in high compared to low light. Furthermore, there were no differences in the consumption rates of the slugs between different light treatments, and only small differences in nutritional traits of algal diets, indicating that the increased growth efficiency of E. viridis feeding on Codium was due to retention of functional kleptoplasts. Our results show that functional kleptoplasts from Codium can provide sacoglossan sea slugs with fitness advantages through photosynthesis.

  1. A taxonomic review of the Dark-winged Trumpeter Psophia viridis (Aves: Gruiformes: Psophiidae

    Directory of Open Access Journals (Sweden)

    Marina Oppenheimer

    2009-01-01

    Full Text Available The Dark-winged Trumpeter, Psophia viridis (Gruiformes, Psophiidae is a Brazilian endemic species and includes three subspecies: Psophia viridis viridis Spix, 1825; Psophia v. dextralis Conover, 1934, and Psophia v. obscura Pelzeln, 1857, as well as P. v. interjecta Griscom & Greenway, 1937, whose validity has been questioned by several authors. These taxa are allopatric in distribution along the south of the Amazon River, although the precise limits of their distribution still remain unknown. This complex has never been taxonomically reviewed and this work aims to test the validity of its taxa based on the Phylogenetic Species Concept. Morphometrical characters and plumage colour patterns were analyzed, and the distribution of the taxa was also revised. In this study, 108 specimens from 41 localities were examined (all types included, with each reliable literature-based locality being included in order to delimit the geographical distribution of the complex. Morphometrical data did not point out significant differences between the taxa, also showing no sexual dimorphism among them. Meanwhile, plumage characters showed consistent and distinct patterns for each of the taxa, except for P. v. interjecta, whose features indicated by authors as diagnosable are the result of individual variation. No clinal variation or intergradation were observed, even at regions close to the rivers headwaters, where supposedly populations could be in contact. It is suggested that the currently accepted subspecies be elevated to the species level, such as: Psophia viridis Spix, 1825, distributed in the Madeira-Tapajós interfluvium, P. dextralis, found in the Tapajós-Tocantins interfluvium, and P. obscura, which occurs from the right bank of the Tocantins River to the west of the State of Maranhão.Os jacamins-de-costas-verdes, Psophia viridis (Gruiformes, Psophiidae são endêmicos da Amazônia brasileira e contam, atualmente, com três subespécies reconhecidas

  2. First documentation and molecular confirmation of three trematode species (Platyhelminthes: Trematoda) infecting the polychaete Marenzelleria viridis (Annelida: Spionidae).

    Science.gov (United States)

    Phelan, Krystin; Blakeslee, April M H; Krause, Maureen; Williams, Jason D

    2016-01-01

    Polychaete worms are hosts to a wide range of marine parasites; yet, studies on trematodes using these ecologically important species as intermediate hosts are lacking. During examination of the spionid polychaete Marenzelleria viridis collected on the north shore of Long Island, New York, putative trematode cysts were discovered in the body cavity of these polychaetes. In order to verify these cysts as metacercariae of trematodes, specimens of the eastern mudsnail Ilyanassa obsoleta (a very common first intermediate host of trematodes in the region) were collected for molecular comparison. DNA barcoding using cytochrome C oxidase I regions confirmed the presence of three species of trematodes (Himasthla quissetensis, Lepocreadium setiferoides, and Zoogonus lasius) in both M. viridis and I. obsoleta hosts. Brown bodies were also recovered from polychaetes, and molecular testing confirmed the presence of L. setiferoides and Z. lasius, indicating an immune response of the polychaete leading to encapsulation of the cysts. From the 125 specimens of M. viridis collected in 2014, 95 (76.8 %) were infected with trematodes; of these 95 infected polychaetes, 86 (90.5 %) contained brown bodies. This is the first confirmation that trematodes use M. viridis as a second intermediate host and that this intermediate host demonstrates a clear immune response to metacercarial infection. Future research should explore the role of these polychaetes in trematode life cycles, the effectiveness of the immune response, and transmission pathways to vertebrate definitive hosts.

  3. Cultivation of green mussel, Perna viridis L., on a floating raft in an estuary along the west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rivonker, C.U.; Ansari, Z.A.; Parulekar, A.H.

    Total production of green mussels, Perna viridis, grown on a raft (16 m sup(2)) for 1 year was 2144.64 kg and biomass (meat weight) was 1040.00 kg. Annual production (P) and biomass (B) estimated were 33.51 and 16.25 kg m sup(-1) respectively...

  4. Modulation of antioxidant and biotransformation enzymes in the gills of Perna viridis (L.) exposed to water accomodate fraction of diesel

    Digital Repository Service at National Institute of Oceanography (India)

    Jena, K.B.; Verlecar, X.N.; Chainy, G.B.N.

    Investigations on the effect of oils on the oxidative stress and antioxidant molecules in gills of Perna viridis were carried out under controlled laboratory conditions. For this purpose water accommodate fraction of diesel oil at 0.5 arid 5% were...

  5. Trace element profiles of the sea anemone Anemonia viridis living nearby a natural CO2 vent.

    Science.gov (United States)

    Horwitz, Rael; Borell, Esther M; Fine, Maoz; Shaked, Yeala

    2014-01-01

    Ocean acidification (OA) is not an isolated threat, but acts in concert with other impacts on ecosystems and species. Coastal marine invertebrates will have to face the synergistic interactions of OA with other global and local stressors. One local factor, common in coastal environments, is trace element contamination. CO2 vent sites are extensively studied in the context of OA and are often considered analogous to the oceans in the next few decades. The CO2 vent found at Levante Bay (Vulcano, NE Sicily, Italy) also releases high concentrations of trace elements to its surrounding seawater, and is therefore a unique site to examine the effects of long-term exposure of nearby organisms to high pCO2 and trace element enrichment in situ. The sea anemone Anemonia viridis is prevalent next to the Vulcano vent and does not show signs of trace element poisoning/stress. The aim of our study was to compare A. viridis trace element profiles and compartmentalization between high pCO2 and control environments. Rather than examining whole anemone tissue, we analyzed two different body compartments-the pedal disc and the tentacles, and also examined the distribution of trace elements in the tentacles between the animal and the symbiotic algae. We found dramatic changes in trace element tissue concentrations between the high pCO2/high trace element and control sites, with strong accumulation of iron, lead, copper and cobalt, but decreased concentrations of cadmium, zinc and arsenic proximate to the vent. The pedal disc contained substantially more trace elements than the anemone's tentacles, suggesting the pedal disc may serve as a detoxification/storage site for excess trace elements. Within the tentacles, the various trace elements displayed different partitioning patterns between animal tissue and algal symbionts. At both sites iron was found primarily in the algae, whereas cadmium, zinc and arsenic were primarily found in the animal tissue. Our data suggests that A. viridis

  6. Trace element profiles of the sea anemone Anemonia viridis living nearby a natural CO2 vent

    Directory of Open Access Journals (Sweden)

    Rael Horwitz

    2014-09-01

    Full Text Available Ocean acidification (OA is not an isolated threat, but acts in concert with other impacts on ecosystems and species. Coastal marine invertebrates will have to face the synergistic interactions of OA with other global and local stressors. One local factor, common in coastal environments, is trace element contamination. CO2 vent sites are extensively studied in the context of OA and are often considered analogous to the oceans in the next few decades. The CO2 vent found at Levante Bay (Vulcano, NE Sicily, Italy also releases high concentrations of trace elements to its surrounding seawater, and is therefore a unique site to examine the effects of long-term exposure of nearby organisms to high pCO2 and trace element enrichment in situ. The sea anemone Anemonia viridis is prevalent next to the Vulcano vent and does not show signs of trace element poisoning/stress. The aim of our study was to compare A. viridis trace element profiles and compartmentalization between high pCO2 and control environments. Rather than examining whole anemone tissue, we analyzed two different body compartments—the pedal disc and the tentacles, and also examined the distribution of trace elements in the tentacles between the animal and the symbiotic algae. We found dramatic changes in trace element tissue concentrations between the high pCO2/high trace element and control sites, with strong accumulation of iron, lead, copper and cobalt, but decreased concentrations of cadmium, zinc and arsenic proximate to the vent. The pedal disc contained substantially more trace elements than the anemone’s tentacles, suggesting the pedal disc may serve as a detoxification/storage site for excess trace elements. Within the tentacles, the various trace elements displayed different partitioning patterns between animal tissue and algal symbionts. At both sites iron was found primarily in the algae, whereas cadmium, zinc and arsenic were primarily found in the animal tissue. Our data

  7. Microsporidia in a woodland pool I. Lanatospora costata sp. n. (Opisthosporidia, Microsporidia), parasite of Megacyclops viridis (Crustacea, Copepoda): fine structure and molecular phylogeny

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Hyliš, M.; Fiala, Ivan; Refardt, D.; Larsson, J.I.R.

    2016-01-01

    Roč. 55, č. 4 (2016), s. 269-280 ISSN 0065-1583 Institutional support: RVO:60077344 Keywords : microsporidian parasite * Megacyclops viridis * SSU rRNA Subject RIV: EE - Microbiology, Virology Impact factor: 1.481, year: 2016

  8. Chloride transport in toad skin (Bufo viridis). The effect of salt adaptation

    DEFF Research Database (Denmark)

    Katz, U; Larsen, Erik Hviid

    1984-01-01

    The steady-state Cl- current across the skin of Bufo viridis adapted to tap water was found to be rectified. In skins bathed with NaCl Ringer on both sides, a large outward current, carried by influx of Cl-, was observed at a clamping voltage (V) of less than -50 mV (outside of the skin negative......, and apparent leakage conductance was reduced. Application of the phosphodiesterase inhibitor 3-isobutyl-1-methyl-xanthine to skin of fully salt-adapted toads increased the transepithelial Cl- conductance, and the time courses of voltage clamp currents became more like those of water-adapted toads. Apparent...... leakage conductance was increased.(ABSTRACT TRUNCATED AT 400 WORDS)...

  9. Pemanfaatan Limbah Cangkang Kerang Hijau (Perna Viridis Menjadi Kitin Sebagai Biokoagulan Air Sungai

    Directory of Open Access Journals (Sweden)

    Syamsidar HS

    2017-06-01

    Full Text Available This study aims to determine the optimum weight of chitin that used as biocoagulant of river water. The water sample is taken from Kajenjeng river and the chitin used for research are isolated from green mussels (Perna viridis shell powder through three steps such as deproteination by NaOH 3%, demineralization by HCl 1,25 N and depigmentation by NaOCl 4%. Then, the obtained chitin are contacted into water with variation of 0,25 gram; 0,5 gram; 0,75 gram and 1 gram in an hour. The result showed that optimum weight of chitin for COD determination, total hardness, calcium and turbidity is 0,75 gram, while optimum weight of chitin for magnesium determination is 0,5 gram.

  10. Lipophilic compounds from the femoral gland secretions of male Hungarian green lizards, Lacerta viridis.

    Science.gov (United States)

    Kopena, Renata; López, Pilar; Martín, José

    2009-01-01

    In spite of the importance of chemical signals (pheromones) in the reproductive behaviour of lizards, only a few studies have examined the role of specific chemical compounds as sexual signals. The secreted chemicals vary widely between species but whether this variation reflects phylogenetic or environmental differences remains unclear. Based on mass spectra, obtained by GC-MS, we found 40 lipophilic compounds in femoral gland secretions of male green lizards (Lacerta viridis), including several steroids, alpha-tocopherol, and esters of n-C16 to n-C20 carboxylic acids, and minor components such as alcohols between C12 and C20, squalene, three lactones and one ketone. We compared these chemicals with those previously found in other closely related green lizard species, and discussed how phylogenetical differences and/or environmental conditions could be responsible for the differential presence of chemicals in different lizard species.

  11. Preliminary study of the regenerative processes of the dorsal cortex of the telencephalon of Lacerta viridis.

    Science.gov (United States)

    Minelli, G; del Grande, P; Mambelli, M C

    1977-01-01

    The authors removed from Lacerta viridis specimens part of the dorsal hippocampus of one telencephalic hemisphere. The animals were sacrificed 110 and 260 days after the operation; 24 hours before the operation on the encephalon, each was dosed with 6--3H thymidine. An examination of the historadiographic slides showed a clear remedial process in the operated area which, 260 days after has renewed in thickness but was still minus its characteristic cellular layer. The area of the telencephalon affected by the remedial process was examined by the authors and they have put forward the hypothesis that in relation to the type of operation performed, said area is localized prevalently in the dorsal hippocampus of the caudal half of the telencephalic hemispherg. The authors have also shown that the remedial procress, though attenuated is still in progress. 260 days after the operation.

  12. Functional anatomy of the lungs of the green lizard, Lacerta viridis.

    Science.gov (United States)

    Meban, C

    1978-02-01

    The gas-exchange area in the lung of Lacerta viridis has been studied by light microscopy and electron microscopy. The interior of the lung in this species is partitioned into air sacs by radially disposed septa. The surfaces of each septum are covered by a continuous epithelium, the cells of which are termed 'pneumonocytes'. Deep to the epithelium there is a close-meshed plexus of capillaries. The middle layer of the septum contains smooth muscle and fibrous tissue. Two varieties of pneumonocytes can be identified. The type I cells are squamous and give off attenuated sheets of cytoplasm which spread widely over the septal surface; these sheets contain few organelles. The type II cells are more compact and possess many organelles; their osmiophilic inclusion bodies are especially conspicuous. The pulmonary capillaries of Lacerta are evaginated into the air sacs and often display marked attenuation of their endothelium. The possible functional significance of these features is discussed.

  13. An hypothesis on the influence of the temperature on the telencephalic reparative processes in Lacerta viridis.

    Science.gov (United States)

    Minelli, G; Del Grande, P

    1980-01-01

    The authors removed a simple plug from the dorsal hippocampus, or from the dorsal hippocampus and part of the medial hippocampus in a telencephalic hemisphere in specimens of Lacerta viridis. The specimens were sacrificed some time after the operation after administration of 6-3 H thymidina. The examination of the emulsified slides showed that in these experimental condition no reparative process is observed, except for an impressive proliferation of cells and fibres which, from the meninx, bridges the cortical gap and, penetrating the telencephalic ventricle, attaches itself to the surrounding nerve tissue. The authors also described a limited cellular proliferation in the ependima of the telencephalic ventricles as a result of resection of the medial hippocampus; this observation is interpreted as a phenomenum connected to compensatory hypertrophy.

  14. Development of fibre and parenchyma cells in the bamboo Phyllostachys viridi-glaucescens

    CERN Document Server

    Crow, E

    2000-01-01

    The development of the shoot apex and the ontogeny of fibre and parenchyma cells in elongating shoots of the bamboo Phyllostachys viridi-glaucescens (Carr.) Riv. and Riv., seen under the light microscope is described. Fibre cells differentiated from cells of the procambium, whilst the parenchyma cells differentiated from cells of the primary thickening meristem which surround the procambium strands. Three stages of early fibre and parenchyma cell development were identified and these are referred to in subsequent studies of cell wall development. The cytology of developing internodal fibre and parenchyma cells seen under the transmission electron microscope (TEM) is described. There were few ultrastructural features to distinguish the two cell types. Thiery's PATAg test was performed to identify organelles which may be associated with the synthesis of polysaccharides destined for the cell wall. The ultrastructural results are discussed in terms of the process of cell wall deposition. Observations were made of...

  15. Identification of Listeria monocytogenes on Green Mussels (Perna viridis and Cockle Shell (Anadara granosa

    Directory of Open Access Journals (Sweden)

    Winiati Puji Rahayu

    2016-12-01

    Full Text Available Green mussel (Perna viridis and cockle shell (Anadara granosa are one of many sources of animalprotein which is many cultivated in Indonesia because their price is relatively affordable. This study wasconducted to identify the presence of Listeria monocytogenes in 27 samples of green mussels and 3 samplesof cockle shells using real-time Polymerase Chain Reaction (real-time PCR and biochemical methods. Thetarget gene for amplification in real-time PCR was an hlyA gene because this gene was a determinant ofvirulence genes that produce listeriolysin O. Primers used in this study were forward primer DG69 (GTGCCG GGT AAA AGA CCA TA and reverse primer DG74 (CGC CAC TGA GAT ACT AT and fluorescencesignals indicator using SYBR Green I. The results of analysis using real-time PCR were negative Listeriamonocytogenes in all samples, while using biochemical methods there was one of 30 samples contaminatedby Listeria welshimeri.

  16. Active urea transport by the skin of Bufo viridis: Amiloride- and phloretin-sensitive transport sites

    Energy Technology Data Exchange (ETDEWEB)

    Rapoport, J.; Abuful, A.; Chaimovitz, C.; Noeh, Z.; Hays, R.M. (Soroka Medical Center, Beersheva (Israel) Albert Einstein College of Medicine, New York, NY (USA))

    1988-09-01

    Urea is actively transported inwardly (J{sub i}) across the skin of the green toad Bufo viridis. J{sub i} is markedly enhanced in toads adapted to hypertonic saline. The authors studied urea transport across the skin of Bufo viridis under a variety of experimental conditions, including treatment with amiloride and phloretin, agents that inhibit urea permeability in the bladder of Bufo marinus. Amiloride (10{sup {minus}4} M) significantly inhibited J{sub i} in both adapted and unadapted animals and was unaffected by removal of sodium from the external medium. Phloretin (10{sup {minus}4} M) significantly inhibited J{sub i} in adapted animals by 23-46%; there was also a reduction in J{sub i} in unadapted toads at 10{sup {minus}4} and 5 {times} 10{sup {minus}4} M phloretin. A dose-response study revealed that the concentration of phloretin causing half-maximal inhibition (K{sub {1/2}}) was 5 {times} 10{sup {minus}4} M for adapted animals. J{sub i} was unaffected by the substitution of sucrose for Ringer solution or by ouabain. They conclude (1) the process of adaptation appears to involve an increase in the number of amiloride- and phloretin-inhibitable urea transport sites in the skin, with a possible increase in the affinity of the sites for phloretin; (2) the adapted skin resembles the Bufo marinus urinary bladder with respect to amiloride and phloretin-inhibitable sites; (3) they confirm earlier observations that J{sub i} is independent of sodium transport.

  17. Morphological, behavioral and biological aspects of Azya luteipes Mulsant fed on Coccus viridis (Green

    Directory of Open Access Journals (Sweden)

    Juliana Nais

    2012-02-01

    Full Text Available One of the major pests of nursery seedlings of coffee (Coffea arabica L. is the green scale, Coccus viridis (Green (Hemiptera: Coccidae. The main predators of this species are beetles of the family Coccinellidae, especially Azya luteipes Mulsant. Morphological, behavioral and biological aspects of A. luteipes feeding on C. viridis on coffee plants were examined under laboratory conditions. Tests were conducted in room temperature at 28 ± 2 ºC. A. luteipes oviposits on the underside of the scale's body, laying two to four eggs per insect. The eggs have a subelliptical form and a white-clear color, and the incubation period is 8.3 ± 1.2 days. The number of eggs laid per female per day varies between eight and ten. A. luteipes undergoes four larval instars with durations of 2.0 ± 0, 3.2 ± 0.5, 3.6 ± 0.5 and 4.6 ± 0 days for the 1st, 2nd, 3rd and 4th instars, respectively. The average durations of the prepupal and pupal stages were 2.0 ± 0 and 10.9 ± 1.3 days, respectively. The viability of the larvae during each instar was 91.9, 89.3, 90.2 and 96.4 %, respectively, and the viabilities of prepupae and pupae were 99.1 and 98.2 %. The average duration of the egg-adult cycle was 34.3 ± 2.6 days, and the sex ratio was 0.52 %. Females presented a gray-colored head, while males presented a yellow head.

  18. Physicochemical properties, immunomodulation and antitumor activities of polysaccharide from Pavlova viridis.

    Science.gov (United States)

    Sun, Liqin; Chu, Jinling; Sun, Zhongliang; Chen, Lihong

    2016-01-01

    Polysaccharides synthesized by microalgae can be used as the functional ingredients of food or drugs. Here, we investigated the physicochemical properties and bioactivities of the polysaccharide from microalgae Pavlova viridis, and indicated the structure-activity relationship. The polysaccharides (PPS0) were degraded with H2O2-vitamin C assisted by ultrasonic waves. The functional group content, monosaccharide composition, and average molecular weight (avg-MW) were detected by chemical or chromatographic method. The immunomodulatory activities were evaluated in vitro by detecting nitric oxide (NO) emission, neutral red uptake and macrophage proliferation. Antitumor activities of degraded fragments were detected using S180-tumor-bearing mouse model by intragastric administration. Degraded polysaccharides PPS1 and PPS2 were obtained at avg-MW of 386.96 and 54.99 kDa. The sulfate group content of polysaccharide was 16%, and the uronic acid content was 5.88 and 8.48%. PPS mainly consisted of fructose, glucose and mannose. All the degraded PPSs could increase phagocytosis and proliferation of macrophages, and stimulated NO emission in a dose-dependently way. PPS2 in Low-MW fragments had the strongest immunoenhancing activities. Different doses of PPS all could inhibit the growth of implanted S180 tumor. At dose of 200 mg/kg/day, the tumor inhibition rate of PPS2 was 57.06%, about 23.6% less than that of CTX-treated group. Different-MW PPS significantly increased lymphocyte proliferation. At 200 mg/L, the proliferation index of PPS2 was 1.37, 2.03 times higher than that of CTX-treated group. The polysaccharides of Pavlova viridis had potential antitumor activities by improving immune response. Moreover, the bioactivities depend on their molecular weight. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. MODULACIÓN DE LA SINTESIS DE METALOTIONINAS EN Perna viridis PREEXPUESTOS A COBRE Y EXPUESTOS A CADMIO | MODULATION OF METALLOTHIONEIN SYNTHESIS IN Perna viridis PRE EXPOSED TO COPPER AND EXPOSED TO CADMIUM

    Directory of Open Access Journals (Sweden)

    Marín Lemus,

    2014-02-01

    Full Text Available The metallothioneins (Mts have been used as biomarkers because toxic metals such as Hg, Cd, Cu can induce their synthesis; however, environmental factors and the presence of other xenobiotics can determine the magnitude of the response in future exposures to metal ions. Metallothionein concentration was determinate in the soft tissue of Perna viridis juveniles pre-exposed to Cu and exposed to Cd (Cu/Cd for 21 days. For this, three experimental groups were established: exposed to Cd, pre-exposed to Cu and exposed to Cd and the control group (no metal. Cadmium accumulation in tissues of P. viridis was significantly higher in pre-exposed organisms to Cu, with an average value of 6.6 ± 1.9 mg/g, while in those exposed to Cd, was 4.7 ± 2.4 mg/g. Mts concentrations were also higher in the Cu/Cd experimental group, with a value of 1.36 ± 0.52 mg/g in relation to those exposed to Cd which had a value of 0.79 ± 0.47 mg/g. The relationship between Mts and bioaccumulation of Cd was significant in the group exposed to Cd, but not in the exposed Cu/Cd. These results suggest that Cu possibly acted as an inducer of Mts in the body, which led to increased accumulation of Cd in P. viridis and increase in Mts concentration. Tolerance and bioaccumulation of Cd in P. viridis was determined by previous exposure of the organism and hence its response on levels of MTs also depends on it.

  20. Bases débiles minoritarias de la raíz de Rauvolfia viridis Roem. et Schult.

    Directory of Open Access Journals (Sweden)

    Jorge A Martínez Pérez

    1997-12-01

    Full Text Available Se realizó un estudio químico de la raíz de la especie Rauvolfia viridis Roem. et Schult. que crece en Cuba, con el objetivo de profundizar en este tema. Se aislaron, purificaron y caracterizaron diferentes alcaloides correspondientes a las bases débiles, entre los que se encuentran la ajmalidina, la a-yohimbina, la quebrachidina, la reserpinina y la yohimbina. Se descarta la presencia de reserpina.It was conducted a chemical study of the root of the species Rauwolfia viridis Roem. et Schult. that grows in Cuba aimed at depening in this topic. Different alkaloids corresponding to the weak bases, such as ajmaline, a-yohimbin, quebrachidine, reserpine and yohimbin, were isolated, purified and characterized. The presence of reserpine is discarded.

  1. Mortalities of the Green Toad (Epidalea viridis (Laurenti, 1768) in Urban Environment: A Case Study from the City of Plovdiv

    OpenAIRE

    Miglena V. Valkanova; Ivelin A. Mollov; Bogdan N. Nikolov

    2009-01-01

    The current study analyzes the types of mortalities of the green toad (Epidalea viridis) in the city of Plovdiv. Among all recorded mortalities (n=42), the road kill was the most common cause of death (65 % of the cases), followed by killing by humans (usually children) – 31%. Killing of green toads by dogs (2%) and domestic cats (2%) has the lowest impact. Both most significant factors (road kill and killing by humans) affect mainly the adult specimens. No statistically significant differenc...

  2. The role of photo-osmotic adaptation in semi-continuous culture and lipid particle release from Dunaliella viridis

    OpenAIRE

    Davis, Ryan W.; Carvalho, Benjamin J.; Jones, Howland D. T.; Singh, Seema

    2014-01-01

    Although great efforts have been made to elucidate the phenotypic responses of alga to varying levels of nutrients, osmotic environments, and photosynthetically active radiation intensities, the role of interactions among these variables is largely nebulous. Here, we describe a general method for establishing and maintaining semi-continuous cultures of the halophilic microalgal production strain, Dunaliella viridis, that is independent of variations in salinity and illumination intensity. Usi...

  3. Ecology,ethology and variability of european green lizard Lacerta viridis in Natural reservation Tiché údolí

    OpenAIRE

    Chmelař, Jan

    2014-01-01

    The european green lizard, Lacerta viridis is a critically endangered reptile species which is in the region of Bohemia present only in relict isolated populations. These populations are closely linked to slopes with a southern exposition in deeply engorged river valleys. These valleys exhibit a unique climatic effect also known as the river phenomenon which allows numerous animal and plant species to survive far beyond their standard northern range. The chosen locality in Tiché údolí is a su...

  4. Characterization of Translationally Controlled Tumour Protein from the Sea Anemone Anemonia viridis and Transcriptome Wide Identification of Cnidarian Homologues

    Directory of Open Access Journals (Sweden)

    Aldo Nicosia

    2018-01-01

    Full Text Available Gene family encoding translationally controlled tumour protein (TCTP is defined as highly conserved among organisms; however, there is limited knowledge of non-bilateria. In this study, the first TCTP homologue from anthozoan was characterised in the Mediterranean Sea anemone, Anemonia viridis. The release of the genome sequence of Acropora digitifera, Exaiptasia pallida, Nematostella vectensis and Hydra vulgaris enabled a comprehensive study of the molecular evolution of TCTP family among cnidarians. A comparison among TCTP members from Cnidaria and Bilateria showed conserved intron exon organization, evolutionary conserved TCTP signatures and 3D protein structure. The pattern of mRNA expression profile was also defined in A. viridis. These analyses revealed a constitutive mRNA expression especially in tissues with active proliferation. Additionally, the transcriptional profile of A. viridis TCTP (AvTCTP after challenges with different abiotic/biotic stresses showed induction by extreme temperatures, heavy metals exposure and immune stimulation. These results suggest the involvement of AvTCTP in the sea anemone defensome taking part in environmental stress and immune responses.

  5. Comparative feedstock analysis in Setaria viridis L. as a model for C4 bioenergy grasses and Panicoid crop species

    Directory of Open Access Journals (Sweden)

    Carloalberto ePetti

    2013-06-01

    Full Text Available Second generation feedstocks for bioethanol will likely include a sizable proportion of perennial C4 grasses, principally in the Panicoideae clade. The Panicoideae contain agronomically important annual grasses including Zea mays L. (maize, Sorghum bicolor (L. Moench (sorghum, and Saccharum officinarum L. (sugar cane as well as promising second generation perennial feedstocks including Miscanthus x giganteus and Panicum virgatum L. (switchgrass. The underlying complexity of these polyploid grass genomes is a major limitation for their direct manipulation and thus driving a need for rapidly cycling comparative model. Setaria viridis (green millet is a rapid cycling C4 Panicoid grass with a relatively small and sequenced diploid genome and abundant seed production. Stable, transient and protoplast transformation technologies have also been developed for S. viridis making it a potentially excellent model for other C4 bioenergy grasses. Here, the lignocellulosic feedstock composition, cellulose biosynthesis inhibitor (CBI response and saccharification dynamics of S. viridis are compared with the annual s00orghum and maize and the perennial switchgrass bioenergy crops as a baseline study into the applicability for translational research. A genome-wide systematic investigation of the cellulose synthase-A (CesA genes was performed identifying eight candidate sequences. Two-developmental stages; a metabolically active young tissue and b metabolically plateaued (mature material are examined to compare biomass performance metrics.

  6. Phytolith analysis for differentiating between foxtail millet (Setaria italica and green foxtail (Setaria viridis.

    Directory of Open Access Journals (Sweden)

    Jianping Zhang

    2011-05-01

    Full Text Available Foxtail millet (Setaria italica is one of the oldest domesticated cereal crops in Eurasia, but identifying foxtail millets, especially in charred grains, and differentiating it from its wild ancestor, green foxtail (Setaria viridis, in the archaeobotanical remains, is still problematic. Phytolithic analysis provides a meaningful method for identifying this important crop. In this paper, the silicon structure patterns in the glumes, lemmas, and paleas from inflorescence bracts in 16 modern plants of foxtail millet and green foxtail from China and Europe are examined using light microscopy with phase-contrast and a microscopic interferometer. Our research shows that the silicon structure of ΩIII from upper lemmas and paleas in foxtail millet and green foxtail can be correspondingly divided into two groups. The size of ΩIII type phytolith of foxtail millet is bigger than that from green foxtail. Discriminant function analysis reveals that 78.4% of data on foxtail millet and 76.9% of data on green foxtail are correctly classified. This means certain morphotypes of phytoliths are relatively reliable tools for distinguishing foxtail millet from green foxtail. Our results also revealed that the husk phytolith morphologies of foxtail millets from China and Eastern Europe are markedly different from those from Western Europe. Our research gives a meaningful method of separating foxtail millet and green foxtail. The implications of these findings for understanding the history of foxtail millet domestication and cultivation in ancient civilizations are significant.

  7. Dioxin and phthalate uptake and assimilation by the green mussel Perna viridis

    International Nuclear Information System (INIS)

    Wang, Wen-Xiong; Zhang, Qiong

    2013-01-01

    In this study, the aqueous uptake and dietary assimilation (trophic transfer) of two endocrine disrupting compounds (dioxin and phathalic acid) in the green mussel Perna viridis were quantified. During short-term exposure period, dioxin rapidly sorbed onto phytoplankton and its accumulation was much higher than that of phthalate. The uptake of these two compounds by the mussels increased with increasing temperature and salinity (for dioxin only). The dietary assimilation of the two contaminants was rather modest (10–64% for dioxin and 20–47% for phthalate), and was greatly dependent on the food species and concentration. Interestingly, dietary assimilation increased with increasing diatom food concentration. Gut passage time was partially responsible for the variable dietary assimilation. Given the high dissolved uptake rate and the modest dietary assimilation, aqueous exposure was predicted to be the dominant bioaccumulation source for both dioxin and phthalate in the green mussels under most conditions. -- Capsule: Aqueous uptake was the predominant pathway for dioxin and phthalate accumulation in marine green mussels

  8. Phytolith Analysis for Differentiating between Foxtail Millet (Setaria italica) and Green Foxtail (Setaria viridis)

    Science.gov (United States)

    Zhang, Jianping; Lu, Houyuan; Wu, Naiqin; Yang, Xiaoyan; Diao, Xianmin

    2011-01-01

    Foxtail millet (Setaria italica) is one of the oldest domesticated cereal crops in Eurasia, but identifying foxtail millets, especially in charred grains, and differentiating it from its wild ancestor, green foxtail (Setaria viridis), in the archaeobotanical remains, is still problematic. Phytolithic analysis provides a meaningful method for identifying this important crop. In this paper, the silicon structure patterns in the glumes, lemmas, and paleas from inflorescence bracts in 16 modern plants of foxtail millet and green foxtail from China and Europe are examined using light microscopy with phase-contrast and a microscopic interferometer. Our research shows that the silicon structure of ΩIII from upper lemmas and paleas in foxtail millet and green foxtail can be correspondingly divided into two groups. The size of ΩIII type phytolith of foxtail millet is bigger than that from green foxtail. Discriminant function analysis reveals that 78.4% of data on foxtail millet and 76.9% of data on green foxtail are correctly classified. This means certain morphotypes of phytoliths are relatively reliable tools for distinguishing foxtail millet from green foxtail. Our results also revealed that the husk phytolith morphologies of foxtail millets from China and Eastern Europe are markedly different from those from Western Europe. Our research gives a meaningful method of separating foxtail millet and green foxtail. The implications of these findings for understanding the history of foxtail millet domestication and cultivation in ancient civilizations are significant. PMID:21573069

  9. Williamsia spongiae sp. nov., an actinomycete isolated from the marine sponge Amphimedon viridis.

    Science.gov (United States)

    Afonso de Menezes, Cláudia Beatriz; Afonso, Rafael Sanches; Souza, Wallace Rafael de; Parma, Márcia; Melo, Itamar Soares de; Zucchi, Tiago Domingues; Fantinatti-Garboggini, Fabiana

    2017-05-01

    A novel actinobacterium, designated isolate B138T, was isolated from the marine sponge, Amphimedon viridis, which was collected from Praia Guaecá (São Paulo, Brazil), and its taxonomic position was established using data from a polyphasic study. The organism showed a combination of chemotaxonomic and morphological characteristics consistent with its classification in the genus Williamsia and it formed a distinct phyletic line in the Williamsia 16S rRNA gene tree. It was most closely related to Williamsia serinedens DSM 45037T and Williamsia deligens DSM 44902T (99.0 % 16S rRNA gene sequence similarity) and Williamsia maris DSM 44693T (97.5 % 16S rRNA gene sequence similarity), but was distinguished readily from these strains by the low DNA-DNA relatedness values (62.3-64.4 %) and by the discriminatory phenotypic properties. Based on the data obtained, the isolate B138T (=CBMAI 1094T=DSM 46676T) should be classified as the type strain of a novel species of the genus Williamsia, for which the name Williamsia spongiae sp. nov. is proposed.

  10. The effect of Euglena viridis on immune response of rohu, Labeo rohita (Ham.).

    Science.gov (United States)

    Das, Basanta Kumar; Pradhan, Jyotirmayee; Sahu, Swagatika

    2009-06-01

    The study evaluated the effect of dietary doses of Euglena viridis on the immune response and disease resistance of Labeo rohita fingerlings against infection with the bacterial pathogen Aeromonas hydrophila. L. rohita fingerlings were fed with diet containing 0 (Control), 0.1 g, 0.5 g, 1.0 g Euglena powder kg(-1) dry diet for 90 days. Biochemical (serum total protein, albumin, globulin, albumin:globulin ratio), haematological (WBC, RBC, haemoglobin content) and immunological (superoxide anion production, lysozyme, serum bactericidal activity) parameters of fish were examined after 30, 60 and 90 days of feeding. Fish were challenged with A. hydrophila 90 days post-feeding and mortalities were recorded over 10 days post-infection. The results demonstrate that fish fed with Euglena showed increased levels of superoxide anion production, lysozyme, serum bactericidal activity, serum protein and albumin (P Euglena kg(-1) dry diet showed the highest percentage survival (75%). These results indicate that Euglena stimulates the immunity and makes L. rohita more resistant to A. hydrophila infection.

  11. Kelayakan Kualitas Perairan Sekitar Mangrove Center Tuban Untuk Aplikasi Alat Pengumpul Kerang Hijau (Perna viridis L.

    Directory of Open Access Journals (Sweden)

    Syarifah Hikmah Julinda Sari

    2015-04-01

    Full Text Available The coastal waters around the Mangrove Center Tuban, East Java is a potential habitat for the green mussel (Perna viridis L.. Therefore, the water quality of this area need to be assessment. The study was aimed to determine the feasibility of water quality in coastal water f Mangrove Center Tuban for application collecting gear of green mussels. The sampling was conducted by set up three stations randomly in studied area. Parameters was measured including temperature, pH, salinity, DO, depth, turbidity, BOD and TSS. The results showed that the coastal waters around the Mangrove Center Tuban, owned temperature that ranged from 29.10 to 30.67 0C, the pH ranged from 8.23 to 8.37, salinity ranged from 26.87 to 30.30 ‰, DO fall in the range of 6,63- 6.87 mg / L, the water depth at the time of measurement ranges from 40-85 cm. TSS ranged from 206.2 mg / L to 353.7 mg / L, BOD value between 4.05 to 12.2 mg / L, while the turbidity ranged from 134 to 400 NTU. Parameters that below the standard namely temperature, pH, DO, salinity and BOD, while TSS and turbidity were exceed the threshold quality standards set by the government.

  12. Responses of European green lizards Lacerta viridis following administration of Leishmania agamae promastigotes.

    Science.gov (United States)

    Ingram, G A; Molyneux, D H

    1984-12-01

    European green lizards (Lacerta viridis) were injected intraperitoneally, subcutaneously or orally with viable Leishmania agamae promastigotes. Neither promastigotes nor amastigotes were later found in blood and tissue impression smears, or in blood and selected organ cultures. However, by the use of an immunoperoxidase technique, parasite antigens were detected in the liver, stomach, small intestine, kidney, gonad, heart, lung and skin but not in the bone marrow, brain or spleen. Non-precipitating antibodies with beta 2-electrophoretic mobility were induced against L. agamae. They were detected in the sera by enzyme-linked immunosorbent assay 3-7 days post-infection. The titres increased significantly above background levels (P less than 0.001) and reached maxima after 6-7 weeks, with 27 out of 29 lizards producing antibodies. The mean serum protein concentration significantly increased after infection (P less than 0.005) with no significant differences in mean values between male and female animals. Lizard sera separated into 7 components on cellulose acetate membranes with migration rates comparable to albumin, alpha- and beta-globulins of human serum; gamma-globulins were absent. Significant decreases occurred (P less than 0.05) in the albumin fraction, with significant increases in the beta-globulin region of anti-L. agamae sera. C-reactive protein was not detected in either normal or immune lizard sera.

  13. The sensory component of the facial nerve of a reptile (Lacerta viridis).

    Science.gov (United States)

    Jacobs, V L

    1979-04-01

    The sensory fibers of the facial nerve in Lacerta viridis have been studied with a silver impregnation method to follow the course of axonal degeneration. Destruction of the geniculate ganglion demonstrated the degenerated sensory component of the facial nerve adjacent to the anterior vestibular root. Within the lateral vestibular area the facial sensory fibers consist of numerous rootlets separated by vestibular fibers and cells. These rootlets may join to form a main or paired sensory tract that passes through the vestibular nuclei to enter the tractus solitarius and divide into a small ascending prefacial component and a major descending prevagal division. A few fibers continue into the postvagal part of tractus solitarius and extend caudally to terminate in the nucleus commissura infima. Prefacial fibers terminate along the periventricular gray while prevagal fibers terminate within the tractus solitarius on the dendrites of cells of nucleus tractus solitarius and near the periphery of the dorsal motor nucleus of X. There was no noticeable degeneration in the descendens tractus trigemini. Terminal degeneration to descendens nucleus trigemini and motor nucleus of VII followed the tractus solitarius course. Most facial sensory fibers are probably related to taste and other visceral information.

  14. The mucosubstance coating the pneumonocytes in the lungs of Xenopus laevis and Lacerta viridis.

    Science.gov (United States)

    Meban, C

    1975-01-01

    The layer of mucosubstance that is associated with the free surface membranes of the pneumonocytes in the lungs of the toad Xenopus laevis and the lizard Lacerta viridis was demonstrated by electron microscopy using iron oxide stain. The form and staining reactions of the mucosubstance layer were similar in both animals. In electron micrographs the mucosubstance was represented by a band of densely stained material (25-50 nm thick) which coated the entire free surface of the pneumonocytes. It appeared to be firmly attached to the outer leaflet of the superficial plasma membrane. Short lengths of osmiophilic membranes, presumed to be fragments of pulmonary surfactant, were often observed lying free in the air spaces but they did not show any affinity for iron stain. Incubation of lung sections in a solution of neuraminidase produced a marked decrease in the intensity of the surface staining; no change was detected after incubation in trypsin, papain, hyaluronidase, N-acetyl cysteine, or phosphate buffer. It is, therefore, concluded that the pneumonocyte surface coat consists mainly of a sialomucin.

  15. Ultraviolet nuptial colour determines fight success in male European green lizards (Lacerta viridis).

    Science.gov (United States)

    Bajer, Katalin; Molnár, Orsolya; Török, János; Herczeg, Gábor

    2011-12-23

    Animal communication through colour signals is a central theme in sexual selection. Structural colours can be just as costly and honest signals as pigment-based colours. Ultraviolet (UV) is a structural colour that can be important both in intrasexual competition and mate choice. However, it is still unknown if a UV signal alone can determine the outcome of male-male fights. European green lizard (Lacerta viridis) males develop a nuptial throat coloration with a strong UV component. Among males differing only in their manipulated UV colour, females prefer males with higher UV. Here, we experimentally decreased the UV coloration of randomly chosen males from otherwise similar male pairs to test the hypothesis that a difference in UV colour alone can affect fight success during male-male competition. Our results fully supported the hypotheses: in almost 90 per cent of the contests the male with reduced UV lost the fight. Our results show that UV can be an important signal, affecting both female mate choice and determining male fight success.

  16. The primary humoral immune response of European green lizards (Lacerta viridis) to Leishmania agamae.

    Science.gov (United States)

    Ingram, G A; Molyneux, D H

    1983-01-01

    European green lizards, Lacerta viridis, produced relatively thermostable, dithiothreitol-sensitive, non-precipitating, agglutinins and complement-fixing antibodies (CFA) to Leishmania agamae administered subcutaneously (SC), intraperitoneally (IP) or orally (OR). Antibodies were also detected by the immobilization test (IMM) and by enzyme-linked immunosorbent assay (ELISA). The most sensitive method for the detection of stimulated immunoglobulins was ELISA. Antibodies were detected as early as 3 days post-infection with ELISA and between 5 and 7 for CFA, direct agglutination (DA) and indirect haemagglutination (IHA). In the case of IMM, the times of first detection varied from 14 to 28 days. Maximum CFA (2(-8)), DA (2(-8)), IHA (2(-11)) and ELISA (2(-16)) titres were reached from 42 to 49 days with significantly higher values occurring in the OR and IP groups. With IMM, maxima occurred after 5 or 6 weeks. Following exposure, two- to five-fold significant increases in serum lysozyme levels were demonstrated but the concentrations in sera following SC, IP or OR routes of antigen administration were not significantly different when the groups were compared with each other. The highest lysozyme values (approximately 12.3 - 12.5 micrograms ml(-1)) were found in the SC and OR groups when compared to the IP (7.40 micrograms ml(-1)).

  17. Life History of the Camelthorn Gall Leafhopper, Scenergates viridis (Vilbaste (Hemiptera, Cicadellidae

    Directory of Open Access Journals (Sweden)

    Roman Rakitov

    2012-01-01

    Full Text Available The world’s only member of Hemiptera Auchenorrhyncha known to form true galls, the leafhopper Scenergates viridis (Vilbaste (Cicadellidae, transforms leaves of camelthorn (Alhagi maurorum Medikus, Fabaceae into pod-like chambers, up to 35 mm long, inside which individual leafhoppers develop, mate, and lay eggs. At the study site 40 km SE of Bukhara (Uzbekistan, two generations develop annually. First-instar nymphs cause young leaves to fold along the midrib. The subsequent development takes place inside the tightly closed growing gall, plugged at both ends with a mixture of leafhopper excrement, brochosomes, and crushed exuviae. These plugs act as mechanical barriers and sticky traps for intruders. The inner surface of the gall, lined with brochosomes and wax platelets, is hydrophobic. Adult males emerge from their galls and squeeze into female galls. Fertilized females insert an average of 146 eggs under the gall’s inner epidermis and remain inside, possibly protecting the brood, until they die. The walls of the galls containing eggs are approximately three times thicker than regular leaves. The galls are subject to predation by Gelechiidae caterpillars; the eggs of the leafhopper are parasitized by two species of Trichogrammatidae and one Mymaridae (Hymenoptera, and its larvae by one species of Pipunculidae (Diptera.

  18. Establishing the thermal threshold of the tropical mussel Perna viridis in the face of global warming.

    Science.gov (United States)

    Goh, B P L; Lai, C H

    2014-08-30

    With increasing recognition that maximum oxygen demand is the unifying limit in tolerance, the first line of thermal sensitivity is, as a corollary, due to capacity limitations at a high level of organisational complexity before individual, molecular or membrane functions become disturbed. In this study the tropical mussel Perna viridis were subjected to temperature change of 0.4 °C per hour from ambient to 8-36 °C. By comparing thermal mortality against biochemical indices (hsp70, gluthathione), physiological indices (glycogen, FRAP, NRRT) and behavioural indices (clearance rate), a hierarchy of thermal tolerance was therein elucidated, ranging from systemic to cellular to molecular levels. Generally, while biochemical indices indicated a stress signal much earlier than the more integrated behavioural indices, failure of the latter (indicating a tolerance limit and transition to pejus state) occurred much earlier than the other indices tending towards thermal extremities at both ends of the thermal spectrum. Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. Inter-population thermal variability and physiological response in the intertidal fish Scartichthys viridis (Blenniidae Variabilidad térmica intrapoblacional y respuesta fisiológica en el pez intermareal Scartichthys viridis (Blenniidae

    Directory of Open Access Journals (Sweden)

    JOSÉ M PULGAR

    2007-12-01

    Full Text Available Determining habitat conditions that generate individual physiological variability represents key basic knowledge to understand the direction of animal's responses to habitat change. The coastal fish Scartichthys viridis inhabits low intertidal pools along the Chilean coast. Because seawater in the low intertidal is renewed during every tidal cycle, this zone is characterized by a low thermal variation and abundant food within and between localities. We evaluated whether seawater thermal conditions and food availability of low intertidal pools registered in three localities of Chilean coast are sufficient to generate physiological and energetic differences in individuals of S. viridis captured from three geographic separate populations spanning approximately 1,200 km. Southern fishes acclimatized to 25 °C showed higher metabolic rates than those from other localities and thermal treatments. On the other hand, southern fishes in natural conditions showed higher condition factor than northern fishes. This evidence is sufficient to indicate that slight latitudinal differences in tidepool seawater temperature associated to differential food availability induced an energetic constraint in this species. Moreover, southern population of S. viridis may suffer important effects on energetic allocation if seawater temperature increases slightly, with repercussions on its geographic distribution in southern Pacific OceanDeterminar las condiciones del ambiente que generan variabilidad fisiológica, representa un conocimiento básico para comprender el sentido de la respuesta de los animales a los cambios en su habitat. El pez costero Scartichthys viridis habita las pozas bajas del intermareal a lo largo de la costa chilena. Debido a que el agua de mar se renueva en cada ciclo de marea en las pozas bajas, esta zona está caracterizada por una baja variación térmica y abundante alimento entre localidades. Nosotros evaluamos si las condiciones térmicas y la

  20. Crecimiento y supervivencia de los mejillones Perna perna, Perna viridis y de un morfotipo indefinido bajo cultivo suspendido

    Directory of Open Access Journals (Sweden)

    2005-01-01

    Full Text Available Se evaluaron el crecimiento y la influencia de factores ambientales bajo condiciones de cultivo suspendido del mejillón Perna perna L., P. viridis L. y una variante o morfotipo indefinido, que comparte sustrato y características morfológicas y de color de ambas especies. El estudio fue conducido durante 10 meses en la localidad de Turpialito, Golfo de Cariaco, Venezuela. Las tres poblaciones experimentales, sembradas con una talla inicial homogénea (45–50 mm presentaron un patrón de crecimiento similar; sin embargo, P. viridis mostró tasas de crecimiento significativamente menores a las de P. perna y del morfotipo, alcanzando al final del estudio 71.2, 77.0 y 77.8 mm de longitud dorso-ventral de la concha, respectivamente. Los análisis de correlatividad de los factores ambientales y el crecimiento no mostraron una modulación definida del crecimiento somático debido a factores ambientales; no obstante, la actividad reproductiva, especialmente cuando se inicia por primera vez, puede actuar como factor endógeno negativo. Aunque los resultados muestran similar respuesta fisiológica de los mejillones, se observó mayor similitud entre P. perna y el morfotipo y diferencias suficientes entre éstas y P. viridis, sugiriendo que las dos primeras pueden estar más relacionadas genéticamente. Sin embargo, existieron diferencias entre el morfotipo y P. perna, en cuanto a las características fenotípicas de la concha, supervivencia e índice gonadosomático, que pueden establecer diferencias genéticas definidas. La mayor producción gonádica en la variante sugiere su selección para el cultivo.

  1. Characterization of small HSPs from Anemonia viridis reveals insights into molecular evolution of alpha crystallin genes among cnidarians.

    Directory of Open Access Journals (Sweden)

    Aldo Nicosia

    Full Text Available Gene family encoding small Heat-Shock Proteins (sHSPs containing α-crystallin domain are found both in prokaryotic and eukaryotic organisms; however, there is limited knowledge of their evolution. In this study, two small HSP genes termed AvHSP28.6 and AvHSP27, both organized in one intron and two exons, were characterised in the Mediterranean snakelocks anemone Anemonia viridis. The release of the genome sequence of Hydra magnipapillata and Nematostella vectensis enabled a comprehensive study of the molecular evolution of α-crystallin gene family among cnidarians. Most of the H. magnipapillata sHSP genes share the same gene organization described for AvHSP28.6 and AvHSP27, differing from the sHSP genes of N. vectensis which mainly show an intronless architecture. The different genomic organization of sHSPs, the phylogenetic analyses based on protein sequences, and the relationships among Cnidarians, suggest that the A.viridis sHSPs represent the common ancestor from which H. magnipapillata genes directly evolved through segmental genome duplication. Additionally retroposition events may be considered responsible for the divergence of sHSP genes of N. vectensis from A. viridis. Analyses of transcriptional expression profile showed that AvHSP28.6 was constitutively expressed among different tissues from both ectodermal and endodermal layers of the adult sea anemones, under normal physiological conditions and also under different stress condition. Specifically, we profiled the transcriptional activation of AvHSP28.6 after challenges with different abiotic/biotic stresses showing induction by extreme temperatures, heavy metals exposure and immune stimulation. Conversely, no AvHSP27 transcript was detected in such dissected tissues, in adult whole body cDNA library or under stress conditions. Hence, the involvement of AvHSP28.6 gene in the sea anemone defensome is strongly suggested.

  2. Mortalities of the Green Toad (Epidalea viridis (Laurenti, 1768 in Urban Environment: A Case Study from the City of Plovdiv

    Directory of Open Access Journals (Sweden)

    Miglena V. Valkanova

    2009-08-01

    Full Text Available The current study analyzes the types of mortalities of the green toad (Epidalea viridis in the city of Plovdiv. Among all recorded mortalities (n=42, the road kill was the most common cause of death (65 % of the cases, followed by killing by humans (usually children – 31%. Killing of green toads by dogs (2% and domestic cats (2% has the lowest impact. Both most significant factors (road kill and killing by humans affect mainly the adult specimens. No statistically significant difference between the mortalities of the two sexes was detected.

  3. Disseminated Mycosis in Veiled Chameleons (Chamaeleo calyptratus) Caused by Chamaeleomyces granulomatis, a New Fungus Related to Paecilomyces viridis

    DEFF Research Database (Denmark)

    Sigler, Lynne; Gibas, Connie Fe C.; Kokotovic, Branko

    2010-01-01

    An outbreak of disseminated granulomatous disease occurred in a group of veiled chameleons (Chamaeleo calyptratus) in a zoo collection. An adult female and six offspring developed large granulomas in multiple organs and were euthanized. At necropsy, roughly spherical yellow-to-white nodules 1 to 3...... of morphology results to represent Paecilomyces viridis, a species known only from one outbreak of fatal mycosis in carpet chameleons (Furcifer lateralis). Data obtained from morphological studies and from phylogenetic analyses of nuclear ribosomal rRNA (rDNA) sequence data revealed the Danish chameleon....... Chamaeleomyces species appear to be rare but aggressive pathogens of chameleons....

  4. Behavioural and neurotoxic effects of ayahuasca infusion (Banisteriopsis caapi and Psychotria viridis) in female Wistar rat.

    Science.gov (United States)

    Pic-Taylor, Aline; da Motta, Luciana Gueiros; de Morais, Juliana Alves; Junior, Willian Melo; Santos, Alana de Fátima Andrade; Campos, Leandro Ambrósio; Mortari, Marcia Renata; von Zuben, Marcus Vinicius; Caldas, Eloisa Dutra

    2015-09-01

    Ayahuasca, a psychoactive beverage used by indigenous and religious groups, is generally prepared by the coction of Psychotria viridis and Banisteriopsis caapi plants containing N,N-dimethyltryptamine (DMT) and β-carboline alkaloids, respectively. To investigate the acute toxicity of ayahuasca, the infusion was administered by gavage to female Wistar rats at doses of 30X and 50X the dose taken during a religious ritual, and the animals observed for 14 days. Behavioural functions were investigated one hour after dosing at 15X and 30X using the open field, elevated plus maze, and forced swimming tests. Neuronal activation (c-fos marked neurons) and toxicity (Fluoro-Jade B and Nissl/Cresyl staining) were investigated in the dorsal raphe nuclei (DRN), amygdaloid nucleus, and hippocampal formation brain areas of rats treated with a 30X ayahuasca dose. The actual lethal oral dose in female Wistar rats could not be determined in this study, but was shown to be higher than the 50X (which corresponds to 15.1mg/kg bw DMT). The ayahuasca and fluoxetine treated groups showed a significant decrease in locomotion in the open field and elevated plus-maze tests compared to controls. In the forced swimming test, ayahuasca treated animals swam more than controls, a behaviour that was not significant in the fluoxetine group. Treated animals showed higher neuronal activation in all brain areas involved in serotoninergic neurotransmission. Although this led to some brain injury, no permanent damage was detected. These results suggest that ayahuasca has antidepressant properties in Wistar female at high doses, an effect that should be further investigated. Copyright © 2015 Elsevier B.V. All rights reserved.

  5. Comparative genome scan detects host-related divergent selection in the grasshopper Hesperotettix viridis.

    Science.gov (United States)

    Apple, Jennifer L; Grace, Tony; Joern, Anthony; St Amand, Paul; Wisely, Samantha M

    2010-09-01

    In this study, we used a comparative genome scan to examine patterns of population differentiation with respect to host plant use in Hesperotettix viridis, a Nearctic oligophagous grasshopper locally specialized on various Asteraceae including Solidago, Gutierrezia, and Ericameria. We identified amplified fragment length polymorphism (AFLP) loci with significantly elevated F(ST) (outlier loci) in multiple different-host and same-host comparisons of populations while controlling for geographic distance. By comparing the number and identities of outlier loci in different-host vs. same-host comparisons, we found evidence of host plant-related divergent selection for some population comparisons (Solidago- vs. Gutierrezia-feeders), while other comparisons (Ericameria- vs. Gutierrezia-feeders) failed to demonstrate a strong role for host association in population differentiation. In comparisons of Solidago- vs. Gutierrezia-feeding populations, a relatively high number of outlier loci observed repeatedly in different-host comparisons (35% of all outliers and 2.7% of all 625 AFLP loci) indicated a significant role for host-related selection in contributing to overall genomic differentiation in this grasshopper. Mitochondrial DNA sequence data revealed a star-shaped phylogeny with no host- or geography-related structure, low nucleotide diversity, and high haplotype diversity, suggesting a recent population expansion. mtDNA data do not suggest a long period of isolation in separate glacial refugia but are instead more compatible with a single glacial refugium and more recent divergence in host use. Our study adds to research documenting heterogeneity in differentiation across the genome as a consequence of divergent natural selection, a phenomenon that may occur as part of the process of ecological speciation. © 2010 Blackwell Publishing Ltd.

  6. Reactions of green lizards (Lacerta viridis) to major repellent compounds secreted by Graphosoma lineatum (Heteroptera: Pentatomidae).

    Science.gov (United States)

    Gregorovičová, Martina; Černíková, Alena

    2015-06-01

    The chemical defence of Heteroptera is primarily based on repellent secretions which signal the potential toxicity of the bug to its predators. We tested the aversive reactions of green lizards (Lacerta viridis) towards the major compounds of the defensive secretion of Graphosoma lineatum, specifically: (i) a mixture of three aldehydes: (E)-hex-2-enal, (E)-oct-2-enal, (E)-dec-2-enal; (ii) a mixture of these three aldehydes and tridecane; (iii) oxoaldehyde: (E)-4-oxohex-2-enal; (iv) secretion extracted from metathoracic scent glands of G. lineatum adults and (v) hexane as a non-polar solvent. All chemicals were presented on a palatable food (Tenebrio molitor larvae). The aversive reactions of the green lizards towards the mealworms were evaluated by observing the approach latencies, attack latencies and approach-attack intervals. The green lizards exhibited a strong aversive reaction to the mixture of three aldehydes. Tridecane reduced the aversive reaction to the aldehyde mixture. Oxoaldehyde caused the weakest, but still significant, aversive reaction. The secretion from whole metathoracic scent glands also clearly had an aversive effect on the green lizards. Moreover, when a living specimen of G. lineatum or Pyrrhocoris apterus (another aposematic red-and-black prey) was presented to the green lizards before the trials with the aldehyde mixture, the aversive effect of the mixture was enhanced. In conclusion, the mixture of three aldehydes had the strong aversive effect and could signal the potential toxicity of G. lineatum to the green lizards. Copyright © 2015 Elsevier GmbH. All rights reserved.

  7. Environment-dependence of behavioural consistency in adult male European green lizards (Lacerta viridis).

    Science.gov (United States)

    Horváth, Gergely; Mészáros, Boglárka; Urszán, Tamás János; Bajer, Katalin; Molnár, Orsolya; Garamszegi, László Zsolt; Herczeg, Gábor

    2017-01-01

    Understanding the background mechanisms affecting the emergence and maintenance of consistent between-individual variation within population in single (animal personality) or across multiple (behavioural syndrome) behaviours has key importance. State-dependence theory suggests that behaviour is 'anchored' to individual state (e.g. body condition, gender, age) and behavioural consistency emerges through behavioural-state feedbacks. A number of relevant state variables are labile (e.g. body condition, physiological performance) and expected to be affected by short-term environmental change. Yet, whether short-term environmental shifts affect behavioural consistency during adulthood remains questionable. Here, by employing a full-factorial laboratory experiment, we explored if quantity of food (low vs. high) and time available for thermoregulation (3h vs. 10h per day) had an effect on activity and risk-taking of reproductive adult male European green lizards (Lacerta viridis). We focussed on different components of behavioural variation: (i) strength of behavioural consistency (repeatability for animal personality; between-individual correlation for behavioural syndrome), (ii) behavioural type (individual mean behaviour) and (iii) behavioural predictability (within-individual behavioural variation). Activity was repeatable in all treatments. Risk-taking was repeatable only in the low basking treatments. We found significant between-individual correlation only in the low food × long basking time group. The treatments did not affect behavioural type, but affected behavioural predictability. Activity predictability was higher in the short basking treatment, where it also decreased with size (≈ age). Risk-taking predictability in the short basking treatment increased with size under food limitation, but decreased when food supply was high. We conclude that short-term environmental change can alter various components of behavioural consistency. The effect could be

  8. Environment-dependence of behavioural consistency in adult male European green lizards (Lacerta viridis.

    Directory of Open Access Journals (Sweden)

    Gergely Horváth

    Full Text Available Understanding the background mechanisms affecting the emergence and maintenance of consistent between-individual variation within population in single (animal personality or across multiple (behavioural syndrome behaviours has key importance. State-dependence theory suggests that behaviour is 'anchored' to individual state (e.g. body condition, gender, age and behavioural consistency emerges through behavioural-state feedbacks. A number of relevant state variables are labile (e.g. body condition, physiological performance and expected to be affected by short-term environmental change. Yet, whether short-term environmental shifts affect behavioural consistency during adulthood remains questionable. Here, by employing a full-factorial laboratory experiment, we explored if quantity of food (low vs. high and time available for thermoregulation (3h vs. 10h per day had an effect on activity and risk-taking of reproductive adult male European green lizards (Lacerta viridis. We focussed on different components of behavioural variation: (i strength of behavioural consistency (repeatability for animal personality; between-individual correlation for behavioural syndrome, (ii behavioural type (individual mean behaviour and (iii behavioural predictability (within-individual behavioural variation. Activity was repeatable in all treatments. Risk-taking was repeatable only in the low basking treatments. We found significant between-individual correlation only in the low food × long basking time group. The treatments did not affect behavioural type, but affected behavioural predictability. Activity predictability was higher in the short basking treatment, where it also decreased with size (≈ age. Risk-taking predictability in the short basking treatment increased with size under food limitation, but decreased when food supply was high. We conclude that short-term environmental change can alter various components of behavioural consistency. The effect could be

  9. Biological Carbon Dioxide Assimilation Process Using Marine Phytoplankton Tetraselmis suecica and Bivalve Perna viridis

    Directory of Open Access Journals (Sweden)

    Sirichai Dharmvanij

    2012-01-01

    Full Text Available The Biological CO2 assimilation process using marine phytoplankton and marine bivalve was evaluated by carbon assimilation of the green mussel Perna viridis fed with Tetraselmis suecica under laboratory condition. Incorporation of carbon dioxide into phytoplankton biomass was performed through aeration. The experiment consisted of three treatments i.e. mussels without feeding (Control, mussels fed with T. suecica cultured with air (Treatment 1: T-Air, and mussels fed with T. suecica cultured with 1.5% CO2 in air (Treatment 2: T-CO2. The results showed that growth of mussels in T-Air and T-CO2 was 22.4 ± 4.0 mg/individual/day and 28.9 ± 12.3 mg/individual/day, respectively, which was significantly higher than control (mussels without feeding. Growth of mussels in T-Air was significantly lower than in T-CO2. Carbon content in shell (15.59 ± 0.57 % D.W. and meat (38.28 ± 1.72 % D.W. of mussels fed with aerated T. suecica (T-Air was significantly higher than that found in mussels fed with 1.5% CO2 T. suecica (14.2 ± 0.47 and 36.61± 0.43 % D.W. in shell and in meat, respectively (p≤0.05. With T-Air, 1.95±0.27 and 9.36±1.24% of carbon from T. suecica cells was assimilated into shell and meat of the mussel, respectively, while in T-CO2 , carbon assimilation from T. suecica cells in shell and meat was 2.19±0.55 and 11.22±2.76% respectively.

  10. HUBUNGAN KEKERABATAN BEBERAPA POPULASI KERANG HIJAU (Perna viridis DI INDONESIA BERDASARKAN SEKUEN CYTROCROME B mtDNA

    Directory of Open Access Journals (Sweden)

    Achmad Sudradjat

    2016-11-01

    Full Text Available Penelitian ini dilakukan untuk mengetahui hubungan kekerabatan stok kerang hijau (Perna viridis di beberapa perairan Indonesia sebagai informasi dasar bagi program pemuliaan. Sampel kerang hijau yang berasal dari populasi alam perairan Tanjung Kait, Kamal, Panimbang, Cirebon, Pasuruan, Kenjeran, dan Pangkep diambil secara acak. Amplifikasi PCR dan sekuensing mitokondria daerah cytochrome B adalah HCO (F: 5’-TAA ACT TCA GGG TGA CCA AAA AAT CA-3’ (26 bp dan LCO (R: 5’-GGT CAA CAA ATC ATA AAG ATA TTG G-3’ (25 bp. Sekuen DNA yang diperoleh digunakan untuk analisis homologi, analisis genetic distance dan analisis kekerabatan. Hasil analisis homologi susunan nukleotida berdasarkan BLAST-N terhadap sekuen mtDNA Perna viridis yang tersimpan di Genebank menunjukkan similaritas 97%. Hasil analisis didapatkan jarak genetik yang terdekat adalah populasi Tanjung Kait dengan Kenjeran sedangkan jarak genetik terjauh adalah populasi Cirebon dengan Kamal. Hubungan kekerabatan yang ditunjukkan dengan dendrogram diperoleh 2 kelompok yaitu 6 populasi membentuk satu kelompok dan populasi Cirebon membentuk kluster tersendiri. Sekuens tersebut mungkin dapat digunakan sebagai penanda dalam program breeding kerang hijau di Indonesia

  11. Molecular identification of Sarcocystis spp. helped to define the origin of green pythons (Morelia viridis) confiscated in Germany.

    Science.gov (United States)

    Moré, Gastón; Pantchev, Nikola; Herrmann, Daland C; Vrhovec, Majda Globokar; Öfner, Sabine; Conraths, Franz J; Schares, Gereon

    2014-04-01

    Sarcocystis spp. represent apicomplexan parasites. They usually have a heteroxenous life cycle. Around 200 species have been described, affecting a wide range of animals worldwide, including reptiles. In recent years, large numbers of reptiles have been imported into Europe as pets and, as a consequence, animal welfare and species protection issues emerged. A sample of pooled feces from four confiscated green pythons (Morelia viridis) containing Sarcocystis spp. sporocysts was investigated. These snakes were imported for the pet trade and declared as being captive-bred. Full length 18S rRNA genes were amplified, cloned into plasmids and sequenced. Two different Sarcocystis spp. sequences were identified and registered as Sarcocystis sp. from M. viridis in GenBank. Both showed a 95-97% sequence identity with the 18S rRNA gene of Sarcocystis singaporensis. Phylogenetic analysis positioned these sequences together with other Sarcocystis spp. from snakes and rodents as definitive and intermediate hosts (IH), respectively. Sequence data and also the results of clinical and parasitological examinations suggest that the snakes were definitive hosts for Sarcocystis spp. that circulate in wild IH. Thus, it seems unlikely that the infected snakes had been legally bred. Our research shows that information on the infection of snakes with Sarcocystis spp. may be used to assess compliance with regulations on the trade with wildlife species.

  12. The solute specificity profiles of nucleobase cation symporter 1 (NCS1) from Zea mays and Setaria viridis illustrate functional flexibility.

    Science.gov (United States)

    Rapp, Micah; Schein, Jessica; Hunt, Kevin A; Nalam, Vamsi; Mourad, George S; Schultes, Neil P

    2016-03-01

    The solute specificity profiles (transport and binding) for the nucleobase cation symporter 1 (NCS1) proteins, from the closely related C4 grasses Zea mays and Setaria viridis, differ from that of Arabidopsis thaliana and Chlamydomonas reinhardtii NCS1. Solute specificity profiles for NCS1 from Z. mays (ZmNCS1) and S. viridis (SvNCS1) were determined through heterologous complementation studies in NCS1-deficient Saccharomyces cerevisiae strains. The four Viridiplantae NCS1 proteins transport the purines adenine and guanine, but unlike the dicot and algal NCS1, grass NCS1 proteins fail to transport the pyrimidine uracil. Despite the high level of amino acid sequence similarity, ZmNCS1 and SvNCS1 display distinct solute transport and recognition profiles. SvNCS1 transports adenine, guanine, hypoxanthine, cytosine, and allantoin and competitively binds xanthine and uric acid. ZmNCS1 transports adenine, guanine, and cytosine and competitively binds, 5-fluorocytosine, hypoxanthine, xanthine, and uric acid. The differences in grass NCS1 profiles are due to a limited number of amino acid alterations. These amino acid residues do not correspond to amino acids essential for overall solute and cation binding or solute transport, as previously identified in bacterial and fungal NCS1, but rather may represent residues involved in subtle solute discrimination. The data presented here reveal that within Viridiplantae, NCS1 proteins transport a broad range of nucleobase compounds and that the solute specificity profile varies with species.

  13. ARCTIC-ANTARCTIC DISJUNCTIONS IN THE BENTHIC SEAWEEDS ACROSIPHONIA-ARCTA (CHLOROPHYTA) AND DESMARESTIA-VIRIDIS-WILLII (PHAEOPHYTA) ARE OF RECENT ORIGIN

    NARCIS (Netherlands)

    VANOPPEN, MJH; OLSEN, JL; STAM, WT; VANDENHOEK, C; WIENCKE, C

    Two examples of the most extreme biogeographic disjunctions in benthic marine algae are found in Acrosiphonia arcta (Chlorophyta) and Desmarestia viridis/willii (Phaeophyta). Both species are members of the Arctic and Antarctic boreal and subboreal marine floras. Although both genera have temperate

  14. [Effects of ablation of the hindlimb on the organization of the ventral horn of the spinal cord in the lumbar region of green lizard embryos (Lacerta viridis Laur.)].

    Science.gov (United States)

    Raynaud, A; Clairambault, P

    1978-01-01

    After extirpation of an hind limb in embryos of Lacerta viridis, numerous motor neuroblasts degenerate on the operated side, in the ventral horn of the lumbar spinal cord and the corresponding motor column is reduced or disappears. The lumbar spinal ganglia are affected and reduced on the operated side.

  15. [Ultrastructural characteristics of several constituants of limb buds in the embryos of the slowworm (Anguis fragilis L.) and the green lizard (Lacerta viridis Laur.)].

    Science.gov (United States)

    Raynaud, A; Adrian, M

    1975-06-09

    Ultrastructural characteristics of the cells of the apical crest, of the mesoblast and of the ventral processes of somites, in the anlage of the anterior limb buds of embryos of the slow-worm (Anguis fragilis) and of the green lizard (Lacerta viridis) are described at early stages of the development. Differences between the two species studied are brought to light.

  16. N2 fixing alder (Alnus viridis spp.fruticosa) effects on soil properties across a secondary successional chronosequence in interior Alaska

    Science.gov (United States)

    Jennifer S. Mitchell; Roger W. Ruess

    2009-01-01

    Green alder (Alnus viridis ssp. fruticosa) is a dominant understory shrub during secondary successional development of upland forests throughout interior Alaska, where it contributes substantially to the nitrogen (N) economy through atmospheric N2 fixation. Across a replicated 200+ year old vegetation...

  17. Sédentarité, déplacements et répartition des individus dans une population de Lacerta viridis (Laurenti, 1768) (Lacertilia, Lacertidae)

    NARCIS (Netherlands)

    Girons, Saint H.; Bradshaw, S.D.

    1989-01-01

    A mark-and-recapture study was undertaken in August 1983, May and September 1987, and May 1988 of a small discrete population of Lacerta viridis occupying an area of 260 x 11—25 m, along the length of a canal in western France. A total of 21 recaptures, over periods of time varying from four months

  18. Assessing the herbivore role of the sea-urchin Echinometra viridis: Keys to determine the structure of communities in disturbed coral reefs.

    Science.gov (United States)

    Sangil, Carlos; Guzman, Hector M

    2016-09-01

    Echinometra viridis previously was considered a cryptic species unable to control the development and growth of macroalgae on coral reefs. Its role as a herbivore was seen as minor compared to other grazers present on the reef. However, the present disturbed state of some reefs has highlighted the role played by this sea-urchin. Combining field data with experiments on the Caribbean coast of Panama, we demonstrate that the current community organization on disturbed coral reefs in the Mesoamerican Caribbean is largely due to the action of E. viridis. It is the most abundant sea-urchin species, together with two others (Diadema antillarum and Echinometra lucunter). Field data also indicate that the relationship between its density and the abundance of macroalgae is stronger and it is more negative in impact than those of the other two. However, the niche this urchin exploits most efficiently is confined to leeward reefs with low levels of sedimentation. Outside these habitats, their populations are not decisive in controlling macroalgal growth. Grazing experiments showed that E. viridis consumes more fresh macroalgae per day and per weight of sea-urchin, and is a more effective grazer than D. antillarum or E. lucunter. E. viridis showed food preferences for early-successional turf macroalgae (Acanthophora spicifera), avoiding the less palatable late-successional and fleshy macroalgae (Lobophora variegata, Halimeda opuntia). However, it becomes a generalist herbivore feeding on all varieties of macroalgae when resources are scarce. H. opuntia is the macroalga that most resists E. viridis activity, which may explain its wide distribution. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Leaf oxygen and Carbon Isotopic Signatures Reflect Drought Resistance and Water Use Efficiency in the C4 Grass, Setaria viridis

    Science.gov (United States)

    Ellsworth, P.; Cousins, A. B.

    2014-12-01

    Low water availability is a major constraint in crop production, especially as agriculture is pushed to marginal lands. Therefore, improving drought resistance such as increasing water use efficiency (WUE) through plant breeding is needed to expand the range of soil water availability adequate for food production. With the goal of finding the genomic basis for WUE in C4 grasses, Setaria viridis makes an ideal model species because of its small size, short lifespan, and sequenced genome. Also it is part of the panicoid grass clade, which is one of the most important clades for food and biofuel production. In plant breeding programs, large numbers of genotypes must be quickly screened for drought resistance traits, but there is no well-defined method of screening for WUE in C4 grasses. However, bulk leaf oxygen (Δ18OBL) and carbon (δ13C) isotopic signatures have shown potential as recorders of transpiration rate (E) and stomatal conductance (gs), and combined with biomass production potentially serve as a measure of WUE. Values of Δ18OBL record differences in transpiration rate because leaf water becomes more enriched as transpiration rate decreases, and leaf tissue records the isotopic composition of leaf water in which it is synthesized. Additionally, in C4 plants δ13C values decrease as gs decreases but the change in δ13C in response to gs may not be adequate to tease apart differences in WUE. In this study, we grew S. viridis plants under well-watered and water-limited conditions to determine if Δ18OBL and δ13C could be used as proxies for E and gs, and be used to screen S. viridis for differences in WUE in breeding programs. The Δ18OBL and δ13C were significantly different between well-watered and water-limited plants and correlated with each other and with E, gs, and instantaneous water use efficiency (Anet/gs). Therefore, Δ18OBL and δ13C can be useful proxies to screen genotypes for drought resistance by recording differences in E, gs, and WUE

  20. Componentes bioquímicos de los tejidos de Perna perna y P. viridis (Lineo, 1758 (Bivalvia: Mytilidae, en relación al crecimiento en condiciones de cultivo suspendido Biochemical components of the tissues of Perna perna and P. viridis (Lineo, 1758 (Bivalvia: Mytilidae, in relation to the growth under conditions of suspended cultivation

    Directory of Open Access Journals (Sweden)

    Vanessa Acosta

    2010-01-01

    Full Text Available Se evaluó los cambios ocurridos en carbohidratos, proteínas y lípidos de la glándula digestiva, músculo y lóbulos gonadales de los mejillones Perna perna y P. viridis bajo condiciones de cultivo suspendido en el Golfo de Cariaco, Venezuela. Paralelamente, se llevaron registros de la condición reproductiva de ambas especies y de temperatura, clorofila a y seston. Los resultados muestraron que en los tejidos analizados de ambas especies, los lóbulos gonadales presentaron las mayores variaciones de los sustratos energéticos estudiados. La variación de los sustratos energéticos se explicó en ambos mejillones mediante desarrollo gonádico y la disponibilidad de alimento, particularmente clorofila a para P. perna y seston total para P. viridis. La temperatura fue un factor que afectó negativamente a P. viridis. Los contenidos de los diferentes sustratos energéticos observados en P. perna fueron más altos que en P. viridis, a lo largo de casi todo el periodo experimental, lo que indicó que esta especie mostró una mayor capacidad para explotar de manera más eficiente los recursos alimenticios presentes en las condiciones de cultivo suspendido.In the organisms, the variations of the biochemical composition of reproductive and somatic tissues in the growth permit to infer about its adaptative to environment. In the present study, we evaluate the changes observed in carbohydrates, lipids and proteins of digestive gland, muscle and gonad tissues of Perna perna and P. viridis, growing in suspended culture at Cariaco Gulf , Venezuela. The reproductive condition of both mussels and environmental factors (temperature, chlorophyll a and of the seston were determinate. The results show that, in both species, the gonadic lobes showed the highest variations in the biochemical component. The variations in the biochemical components were direct explained by the variations in the gonad development and the food availability, particularly chlorophyll a

  1. Metalotioninas en Perna viridis (Bivalvia: Mytilidae: variación estacional y su relación con la biología reproductiva Metallothioneins in Perna viridis (Bivalvia: Mytilidae: seasonal variation and its relation to reproductive biology

    Directory of Open Access Journals (Sweden)

    Mairin Lemus

    2013-06-01

    Full Text Available Las metalotioninas (Mts son proteínas de baja masa molecular que juegan un rol importante en la detoxificación de metales, en vista de su papel ecotoxicológico se evaluaron las metalotioneínas (MTs en 350 ejemplares del bivalvo Perna viridis en dos localidades de la costa norte del estado Sucre, desde febrero hasta diciembre 2003. Se determinaron los índices biométricos: índice de condición (IC, rendimiento de carne (RC y relación peso seco-talla (PSL. Las Mts fueron separadas por cromatografía de exclusión molecular, Sephadex G-50 y se cuantificaron por saturación con cadmio. Los índices biométricos (RC y PSL mostraron variaciones estacionales, entre localidades y estados de madurez, con la excepción del CI. No se encontraron diferencias significativas entre sexos. Las Mts mostraron variaciones estacionales, con concentraciones más elevadas entre febrero y marzo y mínimos entre septiembre y diciembre, que coincidieron con los períodos de alta y baja productividad en el área, respectivamente. Los mejillones de Río Caribe presentaron una mayor concentración de Mts que los de Chacopata. Los mejillones inmaduros mostraron la mayor concentración de Mts y la más baja en los desovados. Se encontró una relación negativa y significativa entre Mts y CI. Los resultados demuestran que las Mts de Perna viridis están influidas por el índice de condición y la condición reproductiva, asi como también pot los factores físico-químicos del ambiente marino.Metallothionein is a cytosolic protein found in a variety of tissues and have been involved in the regulation of essential trace metals such as copper and zinc, and in the detoxification of essential and nonessential metals. With the aim to study their seasonal variation and their possible role in reproductive behavior, we evaluated metallothioneins (Mts in Perna viridis, taken from Rio Caribe and Chacopata localities in the North coast of Sucre state, Venezuela. A total of 325

  2. Temporal variations of heavy metals levels in Perna viridis, on the Chacopata-Bocaripo lagoon axis, Sucre State, Venezuela.

    Science.gov (United States)

    Pinto, Rafael; Acosta, Vanessa; Segnini, Mary Isabel; Brito, Leonor; Martínez, Gregorio

    2015-02-28

    Perna viridis was used as biomonitor to assess heavy metal levels in the Chacopata-Bocaripo lagoon axis, Venezuela, during rain and drought seasons. The mussels were weighed and measured. The metal concentrations were determined by atomic absorption spectrophotometry. For rain period, the order of bioavailability was: Cu>Ni>Mn>Co>Cd>Pb, and for drought: Cu>Mn>Ni>Co>Pb>Cd. The concentrations of Ni, Co, Cd and Pb showed significant differences (P<0.05) in both periods. There was higher metal accumulation during drought season, possibly related to upwelling, since it produces an increase in primary productivity, which translates more food into organisms, making metals bioavailable for mussels. Only Cu and Mn showed significant relationships between the size and metal concentration, during drought period, it may be because of the organisms need for these essential metals in different physiological processes. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Partially Purified Extracts of Sea Anemone Anemonia viridis Affect the Growth and Viability of Selected Tumour Cell Lines

    Directory of Open Access Journals (Sweden)

    Matteo Bulati

    2016-01-01

    Full Text Available In the last few years, marine species have been investigated for the presence of natural products with anticancer activity. Using reversed phase chromatography, low molecular weight proteins were fractionated from the sea anemone Anemonia viridis. Four different fractions were evaluated for their cytotoxic activity by means of erythrocyte haemolysis test, MTS, and LDH assays. Finally, the antiproliferative activities of three of these fractions were studied on PC3, PLC/PRF/5, and A375 human cancer cell lines. Our analysis revealed that the four fractions showed different protein contents and diverse patterns of activity towards human PBMC and cancer cell lines. Interestingly, fractions III and IV exerted cytotoxic effects on human cells. Conversely, fractions I and II displayed very low toxic effects associated with antiproliferative activities on cancer cell lines.

  4. Effect of body size on accumulation and distribution of 125I in the green mussel (Perna Viridis)

    International Nuclear Information System (INIS)

    Chen Shunhua; Shi Qiong; Zhao Xiaokui

    1997-10-01

    Effect of body size on accumulation and distribution of 125 I in the green mussel (Perna Viridis), has been studied. The results showed that concentration capacity of every part in smaller mussels was higher than that in larger ones. Concentration factors of 125 I in byssus (about 0.5 x 10 3 ∼1.5 x 10 3 ), the highest in all parts of the mussels, were 30∼200 times as that in soft tissues, 200∼600 times as that in feet, 600∼1000 times as that in shells. Although wet weight of byssus was no more than 1% of whole body's wet weight, the content of 125 I accumulated in it accounted for as high as 75% of total 125 I content. The relationship between concentration factor of 125 I in byssus and whole body's wet weight (or shell length) can be described as a negative power function. (16 refs., 2 figs., 3 tabs.)

  5. Qualitative Assessment and Management of Microplastics in Asian Green Mussels (Perna viridis Cultured in Bacoor Bay, Cavite, Phillipines

    Directory of Open Access Journals (Sweden)

    Cristian Ryan Argamino

    2016-07-01

    Full Text Available Microplastics (> 5 mm have gained popularity in research and the public eye in recent years. This is due to the fact that they contain persistent organic pollutants (POPs which pose potential risks to the environment and human health. Bivalves, which are filter feeders, are considered to be good indicators of marine pollution. In this preliminary study, Asian green mussel (Perna viridis, an example of edible bivalve, cultured in Bacoor Bay, Cavite, Philippines was subjected to qualitative analysis to determine the presence of microplastics. Through microscopic analysis, microplastics were found present in the acid-digested mussel soft tissue. A management program is suggested for policy makers and stakeholders to reduce the negative impact of microplastic pollution to both humans and the marine environment.

  6. Lectin cytochemical localisation of glycoconjugates in the olfactory system of the lizards Lacerta viridis and Podarcis sicula.

    Science.gov (United States)

    Franceschini, V; Lazzari, M; Ciani, F

    2000-07-01

    To investigate the presence of defined carbohydrate moieties on the cell surface of the olfactory and vomeronasal receptor cells and the projections of the latter into the olfactory bulbs, a lectin binding study was performed on the olfactory system of the lizards: Lacerta viridis and Podarcis sicula. Both lizards showed a high lectin binding for N-acetyl-glucosamine in the sensory neurons. The lectin binding patterns in Lacerta indicated that the main olfactory system possessed a moderate density of N-acetyl-galactosamine residues and detectable levels of galactose ones. The vomeronasal system on the other hand contained a high density of N-acetyl-galactosamine moieties and a moderate density of glucosamine ones. In Podarcis the main olfactory system and vomeronasal organ contained respectively detectable and moderate levels of galactose residues. The expression of specific glycoconjugates may be associated with outgrowth, guidance and fasciculation of olfactory and vomeronasal axons.

  7. Lophotrochozoan neuroanatomy: An analysis of the brain and nervous system of Lineus viridis(Nemertea using different staining techniques

    Directory of Open Access Journals (Sweden)

    Loesel Rudi

    2011-07-01

    Full Text Available Abstract Background The now thriving field of neurophylogeny that links the morphology of the nervous system to early evolutionary events relies heavily on detailed descriptions of the neuronal architecture of taxa under scrutiny. While recent accounts on the nervous system of a number of animal clades such as arthropods, annelids, and molluscs are abundant, in depth studies of the neuroanatomy of nemerteans are still wanting. In this study, we used different staining techniques and confocal laser scanning microscopy to reveal the architecture of the nervous system of Lineus viridis with high anatomical resolution. Results In L. viridis, the peripheral nervous system comprises four distinct but interconnected nerve plexus. The central nervous system consists of a pair of medullary cords and a brain. The brain surrounds the proboscis and is subdivided into four voluminous lobes and a ring of commissural tracts. The brain is well developed and contains thousands of neurons. It does not reveal compartmentalized neuropils found in other animal groups with elaborate cerebral ganglia. Conclusions The detailed analysis of the nemertean nervous system presented in this study does not support any hypothesis on the phylogenetic position of Nemertea within Lophotrochozoa. Neuroanatomical characters that are described here are either common in other lophotrochozoan taxa or are seemingly restricted to nemerteans. Since detailed descriptions of the nervous system of adults in other nemertean species have not been available so far, this study may serve as a basis for future studies that might add data to the unsettled question of the nemertean ground pattern and the position of this taxon within the phylogenetic tree.

  8. Analysis of [Gossypium capitis-viridis × (G.hirsutum × G.australe2] Trispecific Hybrid and Selected Characteristics.

    Directory of Open Access Journals (Sweden)

    Di Chen

    Full Text Available Speciation is always a contentious and challenging issue following with the presence of gene flow. In Gossypium, there are many valuable resources and wild diploid cotton especially C and B genome species possess some excellent traits which cultivated cotton always lacks. In order to explore character transferring rule from wild cotton to upland tetraploid cotton, the [G. capitis-viridis × (G. hirsutum × G. australe2] triple hybrid was synthesized by interspecies hybridization and chromosome doubling. Morphology comparisons were measured among this hybrid and its parents. It showed that trispecific hybrid F1 had some intermediate morphological characters like leaf style between its parents and some different characters from its parents, like crawl growth characteristics and two kind flower color. It is highly resistant to insects comparing with other cotton species by four year field investigation. By cytogenetic analysis, triple hybrid was further confirmed by meiosis behavior of pollen mother cells. Comparing with regular meiosis of its three parents, it was distinguished by the occurrence of polyads with various numbers of unbalanced microspores and finally generating various abnormal pollen grains. All this phenomenon results in the sterility of this hybrid. This hybrid was further identified by SSR marker from DNA molecular level. It showed that 98 selected polymorphism primers amplified effective bands in this hybrids and its parents. The genetic proportion of three parents in this hybrid is 47.8% from G. hirsutum, 14.3% from G. australe, 7.0% from G. capitis-viridis, and 30.9% recombination bands respectively. It was testified that wild genetic material has been transferred into cultivated cotton and this new germplasm can be incorporated into cotton breeding program.

  9. Egg parasitoids (Hymenoptera: Mymaridae and Trichogrammatidae) of the gall-making leafhopper Scenergates viridis (Hemiptera: Cicadellidae) from Uzbekistan, with taxonomic notes on the Palaearctic species of Aphelinoidea.

    Science.gov (United States)

    Rakitov, Roman; Triapitsyn, Serguei V

    2013-01-01

    A new species of the Aphelinoidea Girault (Hymenoptera: Trichogrammatidae), A. (Aphelinoidea) sariq Triapitsyn & Rakitov sp. n., is described from Uzbekistan. Both sexes were reared from eggs of the only known truly gall-making leafhopper, Scenergates viridis (Vilbaste), laid inside its galls on camelthorn, Alhagi maurorum Medikus; additional females were found dead inside the galls. Aphelinoidea sariq is the only known species of the nominate subgenus of Aphelinoidea whose body color is predominantly yellow. Taxonomic notes on other Palaearctic species of Aphelinoidea are provided; A. scythica Fursov, syn. n. is synonymized underA. (Aphelinoidea) turanica S. Trjapitzin. Another trichogrammatid, Par-acentrobia (Paracentrobia) sp., was reared from eggs of S. viridis in much smaller numbers. Also described from the same locality and host is Gonatocerus (Lymaenon) mitjaevi Triapitsyn & Rakitov sp. n. (Hymenoptera: Mymaridae).

  10. A case of massive infestation of a male green lizard Lacerta viridis/bilineata by castor bean tick Ixodes ricinus (Linnaeus, 1758):

    OpenAIRE

    Carretero, Miguel A.; Gomes, Veronika; Žagar, Anamarija

    2013-01-01

    Infestation by ticks affects several vertebrate groups, including reptiles. Castor bean tick Ixodes ricinus is the most widespread tick species. Here we report an impressive tick infestation of a male green lizard Lacerta viridis/bilineata found in 2012 in the vicinity of Bilpa cave in the Kolpa valley, Slovenia. Lizards as tick hosts can play an important role in the life cycle of I. ricinus and may also be potential vectors of Lyme disease. Zaprarazitiranost s klopi je pogost pojav pri v...

  11. [Electron microscopic study of the penetration and distribution of somitic cells in the mesoblast of the limb buds of reptiles (Anguis fragilis and Lacerta viridis)].

    Science.gov (United States)

    Raynaud, A; Adrian, M

    1975-09-29

    Based on characteristics of mitochondria and on the amount of lipid inclusions, a distinction between somitic cells and mesoblastic somatopleural cells is possible, at the early stages of the development of the limb bud in Reptiles (Anguis fragilis and Lacerta viridis). The dislocation of the ventral processes of the somites and the localisation of the somitic cells in the mesoblast of the anterior limb buds could be studied.

  12. Autekologie lokální populace ještěrky zelené (\\kur{Lacerta viridis}) v Českém krasu.

    OpenAIRE

    BLAŽEK, David

    2013-01-01

    European green lizard (Lacerta viridis) is critically endangered species. Bohemian populations are usually isolated and with lower degree of genetical variability, which gives them a higher degree of vulnerability. Isolated populations are interesting because animals often live there under ultimate possible life conditions for given species, usually in original environment. For the sake of an effective protection of the species morfological, ethological and ecological data are necessary, as w...

  13. OCCURRENCE IN THE SOIL AND DISPERSAL OF Lecanicillium lecanii, A FUNGAL PATHOGEN OF THE GREEN COFFEE SCALE (Coccus viridis AND COFFEE RUST (Hemileia vastatrix

    Directory of Open Access Journals (Sweden)

    Doug William Jackson

    2012-08-01

    Full Text Available The fungus Lecanicillium lecanii attacks the green scale (Coccus viridis, a pest of coffee, and is also a hyperparasite of coffee rust (Hemileia vastatrix. Knowledge of the epizootiology of this fungus is potentially important for conservation biological control in coffee agroecosystems. The presence of viable propagules of L. lecanii in the soil, a possible environmental reservoir, was assessed using two baiting methods: the standard Galleria mellonella bait method and a C. viridis bait method. Infectious propagules of L. lecanii were detected in soil samples taken from a 45 ha study plot, both nearby and far from recent epizootics of L. lecanii. To test the potential for the transmission of L. lecanii conidia from the soil via rain splash or wind, coffee seedlings with populations of C. viridis were placed near L. lecanii-inoculated soil and then subjected to artificial rain and wind treatments. Rain splash was shown to be a potential transmission mechanism. Dispersal of L. lecanii conidia by the ant Azteca instabilis was tested using field and laboratory ant-exclusion experiments. Azteca instabilis was shown to transport conidia of L. lecanii; however, dispersal by A. instabilis may not be important under field conditions.

  14. Mapping of quantitative trait locus (QTLs) that contribute to germination and early seedling drought tolerance in the interspecific cross Setaria italica×Setaria viridis.

    Science.gov (United States)

    Qie, Lufeng; Jia, Guanqing; Zhang, Wenying; Schnable, James; Shang, Zhonglin; Li, Wei; Liu, Binhui; Li, Mingzhe; Chai, Yang; Zhi, Hui; Diao, Xianmin

    2014-01-01

    Drought tolerance is an important breeding target for enhancing the yields of grain crop species in arid and semi-arid regions of the world. Two species of Setaria, domesticated foxtail millet (S. italica) and its wild ancestor green foxtail (S. viridis) are becoming widely adopted as models for functional genomics studies in the Panicoid grasses. In this study, the genomic regions controlling germination and early seedling drought tolerance in Setaria were identified using 190 F7 lines derived from a cross between Yugu1, a S. italica cultivar developed in China, and a wild S. viridis genotype collected from Uzbekistan. Quantitative trait loci were identified which contribute to a number of traits including promptness index, radical root length, coleoptile length and lateral root number at germinating stage and seedling survival rate was characterized by the ability of desiccated seedlings to revive after rehydration. A genetic map with 128 SSR markers which spans 1293.9 cM with an average of 14 markers per linkage group of the 9 linkage groups was constructed. A total of eighteen QTLs were detected which included nine that explained over 10% of the phenotypic variance for a given trait. Both the wild green foxtail genotype and the foxtail millet cultivar contributed the favorite alleles for traits detected in this trial, indicating that wild Setaria viridis populations may serve as a reservoir for novel stress tolerance alleles which could be employed in foxtail millet breeding.

  15. Sub-lethal effects of cadmium and copper on RNA/DNA ratio and energy reserves in the green-lipped mussel Perna viridis.

    Science.gov (United States)

    Yeung, Jamius W Y; Zhou, Guang-Jie; Leung, Kenneth M Y

    2016-10-01

    This study aims to test if RNA/DNA ratio and various energy reserve parameters (i.e., glycogen, lipid, protein content and total energy reserves) are sensitive biomarkers for indicating stresses induced by metal contaminants in the green-lipped mussel Perna viridis, a common organism for biomonitoring in Southeast Asia. This study was, therefore, designed to examine the effects of cadmium (Cd) and copper (Cu) on these potential biomarkers in two major energy storage tissues, adductor muscle (AM) and hepatopancreas (HP), of P. viridis after sub-lethal exposure to either metal for 10 days. The results showed that neither Cd nor Cu treatments affected the RNA/DNA ratio, glycogen and protein contents in AM and HP. As the most sensitive biomarker in P. viridis, the total lipid content in both AM and HP was significantly decreased in the treatment of 5μg Cu/L and 0.01-0.1μgCd/L, respectively. However, soft-tissue body burdens of Cu or Cd did not significantly correlate with each of the four biomarkers regardless of the tissue type. In addition, AM generally stored more glycogen than HP, whereas HP stored more lipids than AM. We proposed that multiple biomarkers may be employed as an integrated diagnostic tool for monitoring the health condition of the mussels. Copyright © 2016 Elsevier Inc. All rights reserved.

  16. Spatiotemporal variations in metal accumulation, RNA/DNA ratio and energy reserve in Perna viridis transplanted along a marine pollution gradient in Hong Kong.

    Science.gov (United States)

    Yeung, Jamius W Y; Zhou, Guang-Jie; Leung, Kenneth M Y

    2017-11-30

    We examined spatiotemporal variations of metal levels and three growth related biomarkers, i.e., RNA/DNA ratio (RD), total energy reserve (Et) and condition index (CI), in green-lipped mussels Perna viridis transplanted into five locations along a pollution gradient in the marine environment of Hong Kong over 120days of deployment. There were significant differences in metal levels and biomarker responses among the five sites and six time points. Mussels in two clean sites displayed better CI and significantly lower levels of Ag, Cu, Pb and Zn in their tissues than the other sites. Temporal patterns of RD in P. viridis were found to be site-specific. Across all sites, Et decreased in P. viridis over the deployment period, though the rate of decrease varied significantly among the sites. Therefore, temporal variation of biomarkers should be taken to consideration in mussel-watch programs because such information can help discriminate pollution-induced change from natural variation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. Morphostasis in a novel eukaryote illuminates the evolutionary transition from phagotrophy to phototrophy: description of Rapaza viridis n. gen. et sp. (Euglenozoa, Euglenida

    Directory of Open Access Journals (Sweden)

    Yamaguchi Aika

    2012-03-01

    Full Text Available Abstract Background Morphostasis of traits in different species is necessary for reconstructing the evolutionary history of complex characters. Studies that place these species into a molecular phylogenetic context test hypotheses about the transitional stages that link divergent character states. For instance, the transition from a phagotrophic mode of nutrition to a phototrophic lifestyle has occurred several times independently across the tree of eukaryotes; one of these events took place within the Euglenida, a large group of flagellates with diverse modes of nutrition. Phototrophic euglenids form a clade that is nested within lineages of phagotrophic euglenids and that originated through a secondary endosymbiosis with green algae. Although it is clear that phototrophic euglenids evolved from phagotrophic ancestors, the morphological disparity between species representing these different nutritional modes remains substantial. Results We cultivated a novel marine euglenid, Rapaza viridis n. gen. et sp. ("green grasper", and a green alga, Tetraselmis sp., from the same environment. Cells of R. viridis were comprehensively characterized with light microscopy, SEM, TEM, and molecular phylogenetic analysis of small subunit rDNA sequences. Ultrastructural and behavioral observations demonstrated that this isolate habitually consumes a specific strain of Tetraselmis prey cells and possesses a functional chloroplast that is homologous with other phototrophic euglenids. A novel feeding apparatus consisting of a reduced rod of microtubules facilitated this first and only example of mixotrophy among euglenids. R. viridis also possessed a robust photoreception apparatus, two flagella of unequal length, euglenoid movement, and a pellicle consisting of 16 strips and one (square-shaped whorl of posterior strip reduction. The molecular phylogenetic data demonstrated that R. viridis branches as the nearest sister lineage to phototrophic euglenids

  18. [Effects of cytosine-arabinofuranoside on the development of reptilian embryos (Lacerta viridis, Laur. and Anguis fragilis, L.)].

    Science.gov (United States)

    Raynaud, A

    1982-01-01

    Administered into the yolk sac of eggs of Lacerta viridis as a single dose of 17 to 40 micrograms, cytosine-arabinoside (Ara-C) was compatible with survival of the embryo, from the sixth day of incubation, for at least 20 to 25 days. The LD50 was 40 to 50 micrograms per egg. Doses of 20 to 40 micrograms of Ara-C introduced in the yolk sac of eggs of the slow-worm (Anguis fragilis) cultured in vitro, at stages of the allantoid bud of 0,5 mm to 2,5 mm long, killed the embryo in 4 to 8 days (possibly due to alterations of capillary blood vessels of allantois and area vasculosa). In the two species, these doses caused cytotoxic effects on embryonic proliferating tissues, growth inhibition and a variety of developmental defects. In young embryos of Anguis fragilis, similar doses of 20 to 40 micrograms of Ara-C caused, in 2 to 4 days, death of many cells in the anlagen of growing organs: neural tube, sensory organs, bronchi, mesoderm of the limb bud, subcutaneous mesenchyme, anlage of dorsal skeletal structures, etc.; followed by growth inhibition and malformations. On the other hand, in the limb bud, the apical ridge was less retrogressed than in control embryos; the limb buds showed slightly better development in treated embryos than in controls, but, Ara-C induced severe damage in their mesoderm. In all embryos of Lacerta viridis, treated at the stage of 6 days or of 10 days of incubation by doses of 20 to 40 micrograms of Ara-C and killed 15 to 35 days later, there was a general reduction of size and of weight and external and internal malformations, more or less severe, were present: modifications of the form of the head, shortening of the lower jaw, labial clefts, microphthalmia, micromelia and other limbs defects, developmental defects of the tail. In some embryos, the only external defects observed were missing fingers and toes; in three of these embryos, the same digits were missing in the four limbs. Modifications of limb morphogenesis induced by Ara-C are

  19. Sublethal effects of the pyrethroid insecticide deltamethrin on oxidative stress parameters in green toad (Bufotes viridis L.).

    Science.gov (United States)

    Radovanović, Tijana B; Nasia, Mohammed; Krizmanić, Imre I; Prokić, Marko D; Gavrić, Jelena P; Despotović, Svetlana G; Gavrilović, Branka R; Borković-Mitić, Slavica S; Pavlović, Slađan Z; Saičić, Zorica S

    2017-10-01

    Pyrethroids are synthetic insecticides widely used in agriculture, public health, and veterinary medicine. Deltamethrin, a type II pyrethroid insecticide, has attracted particular attention because of its frequent use. The mechanisms of the toxicity of most pesticides (including pyrethroids) in nontarget organisms is linked to the production of free radicals, oxidative stress induction, increased lipid peroxidation, and disruption of the total antioxidant potential. The aim of the present study was to investigate the effects of acute toxicity of 3 different concentrations (8, 16, and 32 mg/kg body wt) of orally applied deltamethrin after 96 h of treatment. Some of the front-line oxidative stress parameters as well as cholinesterase (ChE) activity and cytochrome P4501A (CYP1A) expression in the liver, muscle, skin, and gastrointestinal tissue of the adult green toad Bufotes viridis were determined. Compared with the control group, the activity of catalase and glutathione reductase was increased in the liver and skin, while the concentration of sulfhydryl groups was reduced. In the liver and muscle, concentrations of thiobarbituric reactive substances were increased, as well as liver CYP1A expression. In the muscle and skin, glutathione-S-transferase activity was higher in treated toads. The oxidative stress parameters examined were affected by different deltamethrin concentrations. We conclude that the assessed parameters represent good biomarkers of pesticide-induced oxidative stress. Environ Toxicol Chem 2017;36:2814-2822. © 2017 SETAC. © 2017 SETAC.

  20. Study of the behavior of Euglena viridis, Euglena gracilis and Lepadella patella cultured in all-glass microaquarium.

    Science.gov (United States)

    Podwin, Agnieszka; Kubicki, Wojciech; Dziuban, Jan A

    2017-09-01

    In the paper, the microaquarium fabricated in a form of entirely glass lab-on-a-chip for culturing and microscale study of microorganisms has been presented. A new approach towards cellular studies that brings a significant improvement over commonly utilized - polymer-based solutions has been shown. For the first time, all-borosilicate glass chip was applied for the culturing of the selected microorganisms and enabled notable population growth and behaviorism investigation. The chip fabrication method in comparison to typical glass chip technology was notably simplified, including quick patterning and low temperature bonding in 80 °C. In the studies, both a single-cell (Euglena gracilis and Euglena viridis) and multi-cell microorganisms (Lepadella patella) were cultured in the microaquarium. Behaviorism of the selected microorganisms was investigated by supplying various proportions of carbon dioxide, nitrogen and air into the chip. Tests included studies of microorganisms chemotaxis, viability (mostly based on photosynthesis process) and coexistence in the lab-on-a-chip environment. The experiments confirmed that the developed chip is a tool that fits the requirements for the culturing and behavioral studies of microorganisms and constitute ground-works to propel its further application in broadly defined cellular study field.

  1. Relationship of Genetics and Cs-137 in Asian Green Mussel (Perna viridis from Nuclear Activities in Asia-Pacific Region

    Directory of Open Access Journals (Sweden)

    Wanwiwa Tumnoi

    2017-03-01

    Full Text Available This study focuses on the relationship of genetics and Cs-137 radiation doses in Asian green mussel (Perna viridis collected from Chonburi province, Thailand. They might accumulate the radiocaesium from the nuclear power plants in the Asia-Pacific region including the Fukushima-Daiichi nuclear power plant via their routine or accidental releases. The radiation doses, estimated using ERICA Tool in the bivalves categorized into 3 different size classes including 4-6, 6-8, and 8-10 cm, were below 0.02 nGy/h. In parallel, Micronucleus test and Comet assay were used to investigate genetic responses in the mussels. They revealed minimum micronucleus frequency (MNF and %Tail DNA varying from 1.80-2.90% and 1.36-1.70%, respectively. The result indicates that neither particular accumulation of Cs-137 nor genetic responses among different size classes of the animals were observed. Furthermore, the radiation doses in the mussels were below the dose limit of 10 µGy/h. Therefore, no radiation effect caused by Cs-137 was found and it was also confirmed by minimal genetic damages. Data obtained can be used as site-specific data for radiological dose and impact assessment and as baseline data to establish the national radiation safety levels to protect Thai marine biota from any possible future nuclear accidents.

  2. Biomonitoring of Mercury Contamination at Petroleum Production Platforms in the Gulf of Thailand using Transplanted Green Mussel, Perna viridis

    Directory of Open Access Journals (Sweden)

    Chatree Ritthong

    2011-01-01

    Full Text Available Assessment of mercury contamination was conducted using transplanted green mussels (Perna viridis. Mussels were first exposed to HgCl2 at 0.5, 1.0, 2.5, and 5.0 nmol/L for 8 weeks at laboratory conditions. The result showed that Hg level in the water decreased rapidly, while Hg in mussels increased coincidentally with the applied doses. After 8 weeks the Hg, levels in tissue were a thousand-fold higher than that in the water. Mussels were then transplanted to 3 petroleum production platforms for field study. The result revealed that survival and growth rates of transplanted mussels at all 3 stations were in close to each other but significantly lower than that from the reference site. Hg concentrations in the tissues of transplanted mussels ranged from less than 0.010 to 0.173 µg/g, and Hg concentrations in mussel tissues from all stations were significantly increased within 2 months, while Hg levels in mussel tissues from reference site were not changed. Hg levels of transplanted mussels increased with increasing depths of the water. The transplanted mussels showed no signs of any physical anomalies, indicating that transplanted mussels could be maintained for up to 3 months in an un-natural habitat, such as petroleum production platforms, where food is much less abundant.

  3. European green lizard (Lacerta viridis) personalities: Linking behavioural types to ecologically relevant traits at different ontogenetic stages.

    Science.gov (United States)

    Bajer, Katalin; Horváth, Gergely; Molnár, Orsolya; Török, János; Garamszegi, László Zsolt; Herczeg, Gábor

    2015-02-01

    Consistent individual differences within (animal personality) and across (behavioural syndrome) behaviours became well recognized during the past decade. Nevertheless, our knowledge about the evolutionary and developmental mechanisms behind the phenomena is still incomplete. Here, we explored if risk-taking and exploration were consistent and linked to different ecologically relevant traits in wild-caught adult male European green lizards (Lacerta viridis) and in their 2-3 weeks old laboratory-reared offspring. Both adults and juveniles displayed animal personality, consistency being higher in juveniles. We found correlation between risk-taking and exploration (suggestive of a behavioural syndrome) only in adults. Juveniles were more explorative than adults. Large or ectoparasite-free adult males were more explorative than small or parasitized males. Juvenile females tended to be more risk-taking than males. Behaviour of fathers and their offspring did not correlate. We conclude that European green lizards show high behavioural consistency and age is an important determinant of its strength and links to traits likely affecting fitness. Copyright © 2014 Elsevier B.V. All rights reserved.

  4. Retrospective evaluation of the effect of antivenom administration on hospitalization duration and treatment cost for dogs envenomated by Crotalus viridis: 113 dogs (2004-2012).

    Science.gov (United States)

    Katzenbach, Julia E; Foy, Daniel S

    2015-01-01

    To compare the effect of antivenom administration on mortality, hospitalization duration, and cost of hospitalization for dogs envenomated by Crotalus viridis. Retrospective study (January 2004-December 2012). Private veterinary emergency and referral center. One hundred thirteen dogs with confirmed C. viridis envenomation. None. Dogs were divided into groups treated with either supportive care only (group 1) or supportive care plus antivenin crotalidae polyvalent (group 2). A modified snakebite severity score was used to compare patients from group 1 and group 2. Patients in group 2 received one 10 mL vial of antivenin crotalidae polyvalent over 4-6 hours. The mortality rate was 1.8% (2/113).  Group 1 had a median duration of hospitalization of 20 hours (range, 8-50 hours), while group 2 had a median duration of hospitalization of 24 hours (range, 1.5-74 hours). Group 1 had a median cost of hospitalization of 1050.00 USD (range, 423.52-2266.09 USD) while group 2 had a median cost of hospitalization of 2002.19 USD (range, 1139.91-6908.01 USD). Both the duration of hospitalization (P dogs receiving antivenom. Both the cost and the duration of hospitalization were significantly greater in the group of dogs that received antivenom. The difference in cost between the groups was approximately the cost of the antivenom vial and administration. Amongst the parameters evaluated, no significant benefit was associated with antivenom administered to dogs envenomated by C. viridis. © Veterinary Emergency and Critical Care Society 2015.

  5. Deciphering the growth, organic acid exudations, and ionic homeostasis of Amaranthus viridis L. and Portulaca oleracea L. under lead chloride stress.

    Science.gov (United States)

    Javed, Muhammad Tariq; Akram, Muhammad Sohail; Habib, Noman; Tanwir, Kashif; Ali, Qasim; Niazi, Nabeel Khan; Gul, Huma; Iqbal, Naeem

    2018-01-01

    Lead (Pb) stress adversely affects in planta nutrient homeostasis and metabolism when present at elevated concentration in the surrounding media. The present study was aimed at investigation of organic acid exudations, elemental contents, growth, and lipid peroxidation in two wild plants (Amaranthus viridis L. and Portulaca oleracea L.), exhibiting differential root to shoot Pb translocation, under Pb stress. Plants were placed in soil spiked with lead chloride (PbCl 2 ) concentrations of 0, 15, 30, 45, or 60 mg Pb/kg soil, in rhizoboxes supplied with nylon nets around the roots. The plant mucilage taken from root surfaces, mirroring the rhizospheric solution, was analyzed for various organic acids. Lead stress resulted in a release of basified root exudates from both plants. Exudates of P. oleracea roots showed a higher pH. In both plants, the pH rising effect was diminished at the highest Pb treatment level. The exudation of citric acid, glutamic acid (in both plants), and fumaric acid (in P. oleracea only) was significantly increased with applied Pb levels. In both plant species, root and shoot Pb contents increased while nutrients (Ca, Mg, and K) decreased with increasing Pb treatment levels, predominantly in A. viridis. At 60 mg Pb/kg soil, shoot Na content of A. viridis was significantly higher as compared to untreated control. Higher Pb treatment levels decreased plant fresh and dry masses as well as the quantity of photosynthetic pigments due to enhanced levels of plant H 2 O 2 and thiobarbituric acid reactive substances in both species. Photosynthetic, growth, and oxidative stress parameters were grouped into three distinct dendrogram sections depending on their similarities under Pb stress. A positive correlation was identified between Pb contents of studied plants and secretion of different organic acids. It is concluded that Pb stress significantly impaired the growth of A. viridis and P. oleracea as a result of nutritional ion imbalance, and the

  6. Effects of the invasive polychaete, Marenzelleria viridis, on the fate of sediment associated pollutants – a microcosm study with 14C-labelled pyrene

    DEFF Research Database (Denmark)

    Banta, Gary Thomas; Hedman, Jenny Elisabet

    on the fate of deeply buried sediment-associated pollutants in the historically polluted Baltic Sea. We report here the results of an experimental microcosm study examining the fate of 14C radiolabelled pyrene (a 4-ring PAH) in sediment microcosms with and without Marenzelleria viridis. We also investigated......The deep burrowing, invasive spionid polychaete, Marenzelleria spp. (3 sibling species), is rapidly expanding its range in the Baltic Sea ecosystem, increasing the depth of the bioturbated zone dramatically relative to the native benthic community. One concern is the effect of this invasion...

  7. Understanding the Differential Response of Setaria viridis L. (green foxtail) and Setaria pumila Poir. (yellow foxtail) to Pyroxsulam.

    Science.gov (United States)

    Satchivi, Norbert M; deBoer, Gerrit J; Bell, Jared L

    2017-08-30

    Green foxtail [Setaria viridis (L) Beauv.] and yellow foxtail [Setaria pumila (Poir.) Roem. & Schult.] are among the most abundant and troublesome annual grass weeds in cereal crops in the Northern Plains of the United States and the Prairie Provinces of Canada. Greenhouse and laboratory experiments were conducted to examine the differential responses of both weed species to foliar applications of the new triazolopyrimidine sulfonamide acetolactate synthase-inhibiting herbicide, pyroxsulam, and to determine the mechanism(s) of differential weed control. Foliar applications of pyroxsulam resulted in >90% control of yellow foxtail at rates between 7.5 and 15 g ai ha -1 , whereas the same rates resulted in a reduced efficacy on green foxtail (≤81%). The absorption and translocation of [ 14 C]pyroxsulam in green and yellow foxtail were similar and could not explain the differential whole-plant efficacy. Studies with [ 14 C]pyroxsulam revealed a higher percentage of absorbed pyroxsulam was metabolized into an inactive metabolite in the treated leaf of green foxtail than in the treated leaf of yellow foxtail. Metabolism studies demonstrated that, 48 h after application, 50 and 35% of pyroxsulam in the treated leaf was converted to 5-hydroxy-pyroxsulam in green and yellow foxtail, respectively. The acetolactate synthase (ALS) inhibition assay showed that ALS extracted from green foxtail was more tolerant to pyroxsulam than the enzyme extracted from yellow foxtail was. The in vitro ALS assay showed IC 50 values of 8.39 and 0.26 μM pyroxsulam for green and yellow foxtail, respectively. The ALS genes from both green and yellow foxtail were sequenced and revealed amino acid differences; however, the changes are not associated with known resistance-inducing mutations. The differential control of green and yellow foxtail following foliar applications of pyroxsulam was attributed to differences in both metabolism and ALS sensitivity.

  8. Variationas of 210Po Activity in Mussels (Perna viridis) of Samut Sakhon and Its Contribution to Dose Assessment

    International Nuclear Information System (INIS)

    Porntepkasemsan, B; Srisuksawad, K.; Permnamtip, V.

    2014-01-01

    Levels of 210 Po and its effective dose in green mussel (Perna viridis) collected from mussel farming area at the Samut Sakhon province during the period of 2012-2013 are presented. Several parameters including maximum shell length and the physiological performance of mussels using condition index and physical properties of seawater (pH, salinity, conductivity, TDS, DO and cation-anion elements) were measured. Each individual mussel was measured on its maximum shell length which was adopted as size class. The activity concentration of 210Po was determined spectroscopically through its 5.30 MeV alpha particle emission, using 209 Po as an internal tracer. The 210 Po activity concentration in mussels was found to vary between 1.044 and 6.951 Bq.kg-1 wet weight. The 210 Po concentration was higher in smaller sized classes (>35 mm) and lowest in larger ones (40-70 mm). This confirms that larger mussels have lower 210Po levels on a weight basis. The 210 Po body burden (activity per mussel) ranged from 1.035 to 17.183 mBq. Contrary to the 210 Po concentrations, results of the body burden revealed the lower activities in smaller sized mussels (>35 mm) and the higher in larger sized ones (40-70 mm). The type of fluctuations observed with 210 Po concentrations are interpreted as a seasonal effect. Total annual effective 210 Po dose due to mussel consumption was calculated to be in the range of 3.081 to 16.401 μSv. Based on the international guideline, the average dose calculated due to 210 Po in mussels of Samut Sakhon would not pose any significant radiological impact on human health and the mussels are considered to be safe for intake.

  9. The role of photo-osmotic adaptation in semi-continuous culture and lipid particle release fromDunaliella viridis.

    Science.gov (United States)

    Davis, Ryan W; Carvalho, Benjamin J; Jones, Howland D T; Singh, Seema

    Although great efforts have been made to elucidate the phenotypic responses of alga to varying levels of nutrients, osmotic environments, and photosynthetically active radiation intensities, the role of interactions among these variables is largely nebulous. Here, we describe a general method for establishing and maintaining semi-continuous cultures of the halophilic microalgal production strain, Dunaliella viridis , that is independent of variations in salinity and illumination intensity. Using this method, the cultures were evaluated to elucidate the overlapping roles of photosynthetic and osmotic adaptation on the accumulation and compositional variation of the biomass, photosynthetic productivity, and physiological biomarkers, as well as spectroscopic and morphological details at the single-cell level. Correlation matrices defining the relationships among the observables and based on variation of the illumination intensity and salinity were constructed for predicting bioproduct yields for varying culture conditions. Following maintenance of stable cultures for 6-week intervals, phenotypic responses to photo-osmotic drift were explored using a combination of single-cell hyperspectral fluorescence imaging and flow cytometry. In addition to morphological changes, release of lipid microparticles from the cells that is disproportionate to cell lysis was observed under hypotonic drift, indicating the existence of a reversible membrane permeation mechanism in Dunaliella . This phenomenon introduces the potential for low-cost strategies for recovering lipids and pigments from the microalgae by minimizing the requirement for energy intensive harvesting and dewatering of the biomass. The results should be applicable to outdoor culture, where seasonal changes resulting in variable solar flux and precipitation and evaporation rates are anticipated.

  10. Bioreduction of trivalent aurum to nano-crystalline gold particles by active and inactive cells and cell-free extract of Aspergillus oryzae var. viridis

    Energy Technology Data Exchange (ETDEWEB)

    Binupriya, A.R. [Department of Food Science and Technology, College of Agriculture and Life Science, Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Sathishkumar, M., E-mail: cvemuthu@nus.edu.sg [Singapore-Delft Water Alliance, National University of Singapore, 2 Engineering Drive 2, Singapore 117577 (Singapore); Vijayaraghavan, K. [Singapore-Delft Water Alliance, National University of Singapore, 2 Engineering Drive 2, Singapore 117577 (Singapore); Yun, S.-I., E-mail: siyun@chonbuk.ac.kr [Department of Food Science and Technology, College of Agriculture and Life Science, Chonbuk National University, Jeonju 561-756 (Korea, Republic of)

    2010-05-15

    Bioreduction efficacy of both active (AB) and inactive (IB) cells/biomass of Aspergillus oryzae var. viridis and their respective cell-free extracts (ACE and ICE) to convert trivalent aurum to gold nanoparticles were tested in the present study. Strong plasmon resonance of gold nanoparticles was observed between 540 and 560 nm in the samples obtained from AB, IB, ACE and ICE. Transmission electron microscopy (TEM), field emission scanning electron microscopy (FE-SEM), energy dispersive X-ray (EDX) and X-ray diffraction (XRD) were performed to examine the formation of gold nanoparticles. Comparing all four forms of A. oryzae var. viridis, ICE showed high gold nanoparticle productivity. The nanoparticles formed were quite uniform in shape and ranged in size from 10 to 60 nm. In addition some triangle, pentagon and hexagon-shaped nanoplates with size range of 30-400 nm were also synthesized especially at lower pH. Organics from the inactive cells are believed to be responsible for reduction of trivalent aurum to nano-sized gold particles. Organic content of the ICE was found to be double the amount of ACE. High productivity of gold nanoparticles by metabolic-independent process opens up an interesting area of nanoparticle synthesis using waste fungal biomass from industries.

  11. Relationship of leaf oxygen and carbon isotopic composition with transpiration efficiency in the C4 grasses Setaria viridis and Setaria italica.

    Science.gov (United States)

    Ellsworth, Patrick Z; Ellsworth, Patrícia V; Cousins, Asaph B

    2017-06-15

    Leaf carbon and oxygen isotope ratios can potentially provide a time-integrated proxy for stomatal conductance (gs) and transpiration rate (E), and can be used to estimate transpiration efficiency (TE). In this study, we found significant relationships of bulk leaf carbon isotopic signature (δ13CBL) and bulk leaf oxygen enrichment above source water (Δ18OBL) with gas exchange and TE in the model C4 grasses Setaria viridis and S. italica. Leaf δ13C had strong relationships with E, gs, water use, biomass, and TE. Additionally, the consistent difference in δ13CBL between well-watered and water-limited plants suggests that δ13CBL is effective in separating C4 plants with different availability of water. Alternatively, the use of Δ18OBL as a proxy for E and TE in S. viridis and S. italica was problematic. First, the oxygen isotopic composition of source water, used to calculate leaf water enrichment (Δ18OLW), was variable with time and differed across water treatments. Second, water limitations changed leaf size and masked the relationship of Δ18OLW and Δ18OBL with E. Therefore, the data collected here suggest that δ13CBL but not Δ18OBL may be an effective proxy for TE in C4 grasses. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  12. Is Hybridization a Source of Adaptive Venom Variation in Rattlesnakes? A Test, Using a Crotalus scutulatus × viridis Hybrid Zone in Southwestern New Mexico

    Directory of Open Access Journals (Sweden)

    Giulia Zancolli

    2016-06-01

    Full Text Available Venomous snakes often display extensive variation in venom composition both between and within species. However, the mechanisms underlying the distribution of different toxins and venom types among populations and taxa remain insufficiently known. Rattlesnakes (Crotalus, Sistrurus display extreme inter- and intraspecific variation in venom composition, centered particularly on the presence or absence of presynaptically neurotoxic phospholipases A2 such as Mojave toxin (MTX. Interspecific hybridization has been invoked as a mechanism to explain the distribution of these toxins across rattlesnakes, with the implicit assumption that they are adaptively advantageous. Here, we test the potential of adaptive hybridization as a mechanism for venom evolution by assessing the distribution of genes encoding the acidic and basic subunits of Mojave toxin across a hybrid zone between MTX-positive Crotalus scutulatus and MTX-negative C. viridis in southwestern New Mexico, USA. Analyses of morphology, mitochondrial and single copy-nuclear genes document extensive admixture within a narrow hybrid zone. The genes encoding the two MTX subunits are strictly linked, and found in most hybrids and backcrossed individuals, but not in C. viridis away from the hybrid zone. Presence of the genes is invariably associated with presence of the corresponding toxin in the venom. We conclude that introgression of highly lethal neurotoxins through hybridization is not necessarily favored by natural selection in rattlesnakes, and that even extensive hybridization may not lead to introgression of these genes into another species.

  13. [Cytophotometric studies on the levels of proteins and RNA in the nuclei of the apical crest ane the epiblast of the limb bud of the green lizard (Lacerta viridis Laur.) and the blindworm (Anguis fragilis L)].

    Science.gov (United States)

    Raynaud, A; Jeanny, J C; Gontcharoff, M

    1975-06-16

    Cytophotometric determinations establish that in the limb buds of young embryos of the slow worm (Anguis fragilis L.) and of the green lizard (Lacerta viridis Laur.) the level of nuclear proteins and RNA is higher in the cells of the apical crest than in the cells of the epiblast on either side of the crest. This relative increase is progressively y reduced.

  14. Present levels of heavy metals in some molluscs of the Upper Gulf of Thailand. [Pernia viridis; Crassostrea commercialis; Anadara granosa; Paphia undulata; Amusium pleuronectes

    Energy Technology Data Exchange (ETDEWEB)

    Hungspreugs, M.; Yuangthong, C.

    1984-05-01

    This investigation was carried out as part of Thailand's participation in the global 'Mussel Watch' program. The levels of Cd, Cr, Cu, Pb, and Zn in the green mussel, Perna viridis, oyster, Crassostrea commercialis, and the cockle, Anadara granosa, were studied from July 1982 to November 1982. Comparison was made with the previous study in August 1981 which also included the short necked clam, Paphia undulata and moon scallop, Amusium pleuronectes. It was found that the metal levels were sufficiently low that the molluscs could be consumed without any danger to health. The salinity of the water appeared to influence the uptake as higher levels of metals were found during the flood season when salinity was lower.

  15. Mercury depuration effectiveness on green mussel (Perna viridis L.) and blood cockle (Anadara granosa L.) from Jakarta Bay using ozone, chitosan and hydrodynamic technique

    Science.gov (United States)

    Widiah Ningrum, Endar; Duryadi Solihin, Dedy; Butet, Nurlisa A.

    2016-01-01

    Depuration has been used to eliminate microorganism and toxic chemical contaminants in bivalve. However, scientific research still needs to discover the effectiveness of depuration. This research aimed at assessing the best depuration effectiveness in decreasing mercury (Hg) concentration level in two species of bivalves, green mussel (Perna viridis L.) and blood cockle (Anadara granosa L.). The depuration treatments applied 1.5 ppm ozon, 0.5 ppm chitosan, hydrodynamic technique (1.3 m/s), combination between hydrodynamic-ozon, hydrodynamic-chitosan and ozon-chitosan. The experiment were conducted in mini aquaria for 60 minutes. Mercury concentration was measured in 10 g dry weight of green mussel (4.05±0.020 ppm) and blood cockle (3.27 ± 0.666 ppm). The result showed that mercury depuration were highly effective by combination of ozone-chitosan in green mussel (96.51%) and 1.5 ppm ozone in blood cockle (87.06%).

  16. Tolerancia a la anoxia y defensas antioxidantes en el mejillón verde Perna viridis (Linneus, 1758 bajo exposición aguda al cadmio

    Directory of Open Access Journals (Sweden)

    Edgar Zapata-Vívenes

    2014-07-01

    Full Text Available Se estimó la sobrevivencia a la anoxia del mejillón verde Perna viridis después de siete días de exposición a 50 μg L-1 de cadmio (Cd, seguido de un período de recuperación en el mar durante 21 días. En la glándula digestiva de los organismos experimentales se determinó los niveles de Cd acumulados, y marcadores de estrés oxidativo tales como: metalotioneínas (MT, glutatión reducido (GSH, peroxidación lipídica (TBARS y las actividades de las enzimas catalasa (CAT, glutatión reductasa (GR y glutatión-S-transferasa (GST. Los organismos expuestos a Cd mostraron una menor tolerancia al tratamiento anóxico, sin embargo una vez recuperados en el mar presentaron valores de sobrevivencia relativamente mayores en comparación a sus controles. Los organismos expuestos a Cd revelaron un incremento en la concentración de MT y la actividad de CAT, correlacionado al ingreso corporal de Cd. Los organismos transplantados al mar mostraron una disminución del metal acumulado, manteniendo niveles de MT incrementados. Los mejillones tratados y controles no exhibieron diferencias significativas en los marcadores de estrés oxidativo determinados (TBARS, GSH, GR y GST. El Cd acumulado posiblemente afectó algunas estrategias bioquímicas relacionadas con la tolerancia a la anoxia de P. viridis. Sin embargo, los altos niveles de MT en organismos pre-expuestos y posteriormente recuperados, podría condicionar la protección contra la toxicidad del Cd e indirectamente una mayor tolerancia a la anoxia.

  17. Application of a novel alkali-tolerant thermostable DyP-type peroxidase from Saccharomonospora viridis DSM 43017 in biobleaching of eucalyptus kraft pulp.

    Directory of Open Access Journals (Sweden)

    Wangning Yu

    Full Text Available Saccharomonospora viridis is a thermophilic actinomycete that may have biotechnological applications because of its dye decolorizing activity, though the enzymatic oxidative system responsible for this activity remains elusive. Bioinformatic analysis revealed a DyP-type peroxidase gene in the genome of S. viridis DSM 43017 with sequence similarity to peroxidase from dye-decolorizing microbes. This gene, svidyp, consists of 1,215 bp encoding a polypeptide of 404 amino acids. The gene encoding SviDyP was cloned, heterologously expressed in Escherichia coli, and then purified. The recombinant protein could efficiently decolorize several triarylmethane dyes, anthraquinonic and azo dyes under neutral to alkaline conditions. The optimum pH and temperature for SviDyP was pH 7.0 and 70°C, respectively. Compared with other DyP-type peroxidases, SviDyP was more active at high temperatures, retaining>63% of its maximum activity at 50-80°C. It also showed broad pH adaptability (>35% activity at pH 4.0-9.0 and alkali-tolerance (>80% activity after incubation at pH 5-10 for 1 h at 37°C, and was highly thermostable (>60% activity after incubation at 70°C for 2 h at pH 7.0. SviDyP had an accelerated action during the biobleaching of eucalyptus kraft pulp, resulting in a 21.8% reduction in kappa number and an increase of 2.98% (ISO in brightness. These favorable properties make SviDyP peroxidase a promising enzyme for use in the pulp and paper industries.

  18. A Single Transcriptome of a Green Toad (Bufo viridis Yields Candidate Genes for Sex Determination and -Differentiation and Non-Anonymous Population Genetic Markers.

    Directory of Open Access Journals (Sweden)

    Jörn F Gerchen

    Full Text Available Large genome size, including immense repetitive and non-coding fractions, still present challenges for capacity, bioinformatics and thus affordability of whole genome sequencing in most amphibians. Here, we test the performance of a single transcriptome to understand whether it can provide a cost-efficient resource for species with large unknown genomes. Using RNA from six different tissues from a single Palearctic green toad (Bufo viridis specimen and Hiseq2000, we obtained 22,5 Mio reads and publish >100,000 unigene sequences. To evaluate efficacy and quality, we first use this data to identify green toad specific candidate genes, known from other vertebrates for their role in sex determination and differentiation. Of a list of 37 genes, the transcriptome yielded 32 (87%, many of which providing the first such data for this non-model anuran species. However, for many of these genes, only fragments could be retrieved. In order to allow also applications to population genetics, we further used the transcriptome for the targeted development of 21 non-anonymous microsatellites and tested them in genetic families and backcrosses. Eleven markers were specifically developed to be located on the B. viridis sex chromosomes; for eight markers we can indeed demonstrate sex-specific transmission in genetic families. Depending on phylogenetic distance, several markers, which are sex-linked in green toads, show high cross-amplification success across the anuran phylogeny, involving nine systematic anuran families. Our data support the view that single transcriptome sequencing (based on multiple tissues provides a reliable genomic resource and cost-efficient method for non-model amphibian species with large genome size and, despite limitations, should be considered as long as genome sequencing remains unaffordable for most species.

  19. Application of a novel alkali-tolerant thermostable DyP-type peroxidase from Saccharomonospora viridis DSM 43017 in biobleaching of eucalyptus kraft pulp.

    Science.gov (United States)

    Yu, Wangning; Liu, Weina; Huang, Huoqing; Zheng, Fei; Wang, Xiaoyu; Wu, Yuying; Li, Kangjia; Xie, Xiangming; Jin, Yi

    2014-01-01

    Saccharomonospora viridis is a thermophilic actinomycete that may have biotechnological applications because of its dye decolorizing activity, though the enzymatic oxidative system responsible for this activity remains elusive. Bioinformatic analysis revealed a DyP-type peroxidase gene in the genome of S. viridis DSM 43017 with sequence similarity to peroxidase from dye-decolorizing microbes. This gene, svidyp, consists of 1,215 bp encoding a polypeptide of 404 amino acids. The gene encoding SviDyP was cloned, heterologously expressed in Escherichia coli, and then purified. The recombinant protein could efficiently decolorize several triarylmethane dyes, anthraquinonic and azo dyes under neutral to alkaline conditions. The optimum pH and temperature for SviDyP was pH 7.0 and 70°C, respectively. Compared with other DyP-type peroxidases, SviDyP was more active at high temperatures, retaining>63% of its maximum activity at 50-80°C. It also showed broad pH adaptability (>35% activity at pH 4.0-9.0) and alkali-tolerance (>80% activity after incubation at pH 5-10 for 1 h at 37°C), and was highly thermostable (>60% activity after incubation at 70°C for 2 h at pH 7.0). SviDyP had an accelerated action during the biobleaching of eucalyptus kraft pulp, resulting in a 21.8% reduction in kappa number and an increase of 2.98% (ISO) in brightness. These favorable properties make SviDyP peroxidase a promising enzyme for use in the pulp and paper industries.

  20. Metalotioninas en Perna viridis (Bivalvia: Mytilidae: variación estacional y su relación con la biología reproductiva

    Directory of Open Access Journals (Sweden)

    Mairin Lemus

    2013-06-01

    Full Text Available Las metalotioninas (Mts son proteínas de baja masa molecular que juegan un rol importante en la detoxificación de metales, en vista de su papel ecotoxicológico se evaluaron las metalotioneínas (MTs en 350 ejemplares del bivalvo Perna viridis en dos localidades de la costa norte del estado Sucre, desde febrero hasta diciembre 2003. Se determinaron los índices biométricos: índice de condición (IC, rendimiento de carne (RC y relación peso seco-talla (PSL. Las Mts fueron separadas por cromatografía de exclusión molecular, Sephadex G-50 y se cuantificaron por saturación con cadmio. Los índices biométricos (RC y PSL mostraron variaciones estacionales, entre localidades y estados de madurez, con la excepción del CI. No se encontraron diferencias significativas entre sexos. Las Mts mostraron variaciones estacionales, con concentraciones más elevadas entre febrero y marzo y mínimos entre septiembre y diciembre, que coincidieron con los períodos de alta y baja productividad en el área, respectivamente. Los mejillones de Río Caribe presentaron una mayor concentración de Mts que los de Chacopata. Los mejillones inmaduros mostraron la mayor concentración de Mts y la más baja en los desovados. Se encontró una relación negativa y significativa entre Mts y CI. Los resultados demuestran que las Mts de Perna viridis están influidas por el índice de condición y la condición reproductiva, asi como también pot los factores físico-químicos del ambiente marino.

  1. Hypolipidemic Activity of Prosopis cineraria L (Druce) Fruit Extract ...

    African Journals Online (AJOL)

    Purpose: To investigate the hypolipidemic potential of the 70 % ethanol fruit extract of Prosopis cineraria (Fabaceae) (Et. PCF) in triton-induced hyperlipidemia in rats. Methods: Et-PCF was obtained by pulverizing whole dried fruits and extracting with 70 % ethanol. Adult Sprague Dawley rats were divided into six groups of ...

  2. Nomenclatural availability of the names applied to “varieties” of the green toad (Bufo viridis subgroup in the Italian territory, with emphasis on the variety lineata of Ninni (Anura: Bufonidae

    Directory of Open Access Journals (Sweden)

    Nicola Novarini

    2010-07-01

    Full Text Available Recent molecular investigations on Eurasian green toads led to the recognition of distinct lineages and to the establishment of new taxa within the former Bufo viridis; as a consequence, significant range-wide nomenclatural changes have been proposed, although some uncertainties remained on the available names applicable within the Italian territory. In order to contribute to clarify the matter, we evaluated, under the provisions of the International Code of Zoological Nomenclature, the nomenclatural availability of all the names that have been applied to infrasubspecific entities of the Bufo viridis subgroup within the Italian territory. We also provided a historical overview of the usage of all these names, as well as detailed information on the original material upon which the variety lineata of A.P. Ninni was established. Our analysis supports the view that only the names crucigera Eichwald, 1831 and balearica Boettger, 1880 are available, the former being however junior synonym of B. viridis Laurenti, 1768, whereas the names acutirostris and obtusirostris of Lessona, lineata of Ninni, concolor and maculata of Camerano, and nardoi of Paolucci, Fuhn and Bruno are all not available.

  3. Changes in growth, carbon and nitrogen enzyme activity and mRNA accumulation in the halophilic microalga Dunaliella viridis in response to NaCl stress

    Science.gov (United States)

    Wang, Dongmei; Wang, Weiwei; Xu, Nianjun; Sun, Xue

    2016-12-01

    Many species of microalga Dunaliella exhibit a remarkable tolerance to salinity and are therefore ideal for probing the effects of salinity. In this work, we assessed the effects of NaCl stress on the growth, activity and mRNA level of carbon and nitrogen metabolism enzymes of D. viridis. The alga could grow over a salinity range of 0.44 mol L-1 to 3.00 mol L-1 NaCl, but the most rapid growth was observed at 1.00 mol L-1 NaCl, followed by 2.00 mol L-1 NaCl. Paralleling these growth patterns, the highest initial and total Rubisco activities were detected in the presence of 1.00 mol L-1 NaCl, decreasing to 37.33% and 26.39% of those values, respectively, in the presence of 3.00 mol L-1 NaCl, respectively. However, the highest extracellular carbonic anhydrase (CA) activity was measured in the presence of 2.00 mol L-1 NaCl, followed by 1.00 mol L-1 NaCl. Different from the two carbon enzymes, nitrate reductase (NR) activity showed a slight change under different NaCl concentrations. At the transcriptional level, the mRNAs of Rubisco large subunit ( rbcL), and small subunit ( rbcS), attained their highest abundances in the presence of 1.00 and 2.00 mol L-1 NaCl, respectively. The CA mRNA accumulation was induced from 0.44 mol L-1 to 3.00 mol L-1 NaCl, but the NR mRNA showed the decreasing tendency with the increasing salinity. In conclusion, the growth and carbon fixation enzyme of Rubisco displayed similar tendency in response to NaCl stress, CA was proved be salt-inducible within a certain salinity range and NR showed the least effect by NaCl in D. viridis.

  4. Habitat degradation correlates with tolerance to climate-change related stressors in the green mussel Perna viridis from West Java, Indonesia.

    Science.gov (United States)

    Wendling, Carolin Charlotte; Huhn, Mareike; Ayu, Nurina; Bachtiar, Ramadian; von Juterzenka, Karen; Lenz, Mark

    2013-06-15

    It is unclear whether habitat degradation correlates with tolerance of marine invertebrates to abiotic stress. We therefore tested whether resistance to climate change-related stressors differs between populations of the green mussel Perna viridis from a heavily impacted and a mostly pristine site in West Java, Indonesia. In laboratory experiments, we compared their oxygen consumption and mortality under lowered salinity (-13 and -18 units, both responses), hypoxia (0.5 mg/l, mortality only) and thermal stress (+7 °C, mortality only). Mussels from the eutrophied and polluted Jakarta Bay showed a significantly smaller deviation from their normal oxygen consumption and higher survival rates when stressed than their conspecifics from the unaffected Lada Bay. This shows that human induced habitat degradation correlates with mussel tolerance to environmental stress. We discuss possible mechanisms - e.g. the selection of tolerant genotypes or habitat-specific differences in the nutritional status of the mussels - that could explain our observation. Copyright © 2013 Elsevier Ltd. All rights reserved.

  5. Depuration Study of Heavy Metal Lead (Pb) and Copper (Cu) in Green Mussels Perna viridis through Continues-discontinues and Acid Extraction Methods

    Science.gov (United States)

    Budiawan; Bakri, Ridla; Cahaya Dani, Intan; Handayani, Sri; Ade Kurnia Putri, Rizki; Tamala, Riska

    2018-01-01

    Green mussel or Perna viridis is filter feeder, which is very susceptible to heavy metals. It takes an effort to release heavy metal contents on the green shell, one of method that can be used to release heavy metal from green shell is depuration proccess. In this research, the depuration process was conducted by continues method of depuration, discontinues method by using various kind of water and acid extraction. The optimum time of continues depuration method is 1.5 hours, with circulation speed 250 L/h and result of Pb metal content decreased is equal to 30.048% and 29.748% for Cu. In the discontinues method, the optimum result was reached at 100oC by using PAM water as the media at 3 h immersion period with decrease of Pb metal content 35.001% and Cu metal content 39.015%. In the acid extraction method, the optimum condition was achieved by 11% acetic acid solvent with decreasing of Pb and Cu levels are 88.224% and 76.298%. For the determination of protein content, the decrease of protein content obtained by treatment with 11% acetic acid extract showed decrease of protein content 36.656% with Kjeldahl method.

  6. Differential proteomic responses in hepatopancreas and adductor muscles of the green-lipped mussel Perna viridis to stresses induced by cadmium and hydrogen peroxide

    Energy Technology Data Exchange (ETDEWEB)

    Leung, Priscilla T.Y. [Swire Institute of Marine Science and School of Biological Sciences, University of Hong Kong, Pokfulam Road, Hong Kong (Hong Kong); Wang Yu [Department of Pharmacology and Pharmacy, University of Hong Kong, Sassoon Road, Hong Kong (Hong Kong); Mak, Sarah S.T.; Ng, W.C. [Swire Institute of Marine Science and School of Biological Sciences, University of Hong Kong, Pokfulam Road, Hong Kong (Hong Kong); Leung, Kenneth M.Y., E-mail: kmyleung@hkucc.hku.hk [Swire Institute of Marine Science and School of Biological Sciences, University of Hong Kong, Pokfulam Road, Hong Kong (Hong Kong)

    2011-09-15

    This study aimed to reveal the proteomic responses in the hepatopancreas and adductor muscle of a common biomonitor, Perna viridis after 14-day exposure to two model chemicals, cadmium (Cd; a toxic metal) and hydrogen peroxide (H{sub 2}O{sub 2}; a pro-oxidant), using two-dimensional gel electrophoresis coupled with multivariate statistical analyses. Unique sets of tissue-specific protein expression signatures were revealed corresponding to the two treatment groups. In the hepatopancreas, 15 and 2 spots responded to Cd and H{sub 2}O{sub 2} treatments respectively. 6 and 7 spots were differentially expressed in the adductor muscle for Cd and H{sub 2}O{sub 2} treatments, respectively. 15 differentially expressed spots were successfully identified by MALDI-TOF/TOF MS analysis. These proteins are involved in glycolysis, amino acid metabolism, energy homeostasis, oxidative stress response, redox homeostasis and protein folding, heat-shock response, and muscle contraction modulation. This is the first time, to have demonstrated that Cd exposure not only leads to substantial oxidative stress but also results in endoplasmic reticulum stress in hepatopancreas of the mussel. Such notable stress responses may be attributable to high Cd accumulation in this tissue. Our results suggested that investigations on these stress-associated protein changes could be used as a new and complementary approach in pollution monitoring by this popular biomonitor species.

  7. Computed tomography of the lung of healthy snakes of the species Python regius, Boa constrictor, Python reticulatus, Morelia viridis, Epicrates cenchria, and Morelia spilota.

    Science.gov (United States)

    Pees, Michael; Kiefer, Ingmar; Thielebein, Jens; Oechtering, Gerhard; Krautwald-Junghanns, Maria-Elisabeth

    2009-01-01

    Thirty-nine healthy boid snakes representing six different species (Python regius, Boa constrictor, Python reticulatus, Morelia viridis, Epicrates cenchria, and Morelia spilota) were examined using computed tomography (CT) to characterize the normal appearance of the respiratory tissue. Assessment was done subjectively and densitometry was performed using a defined protocol. The length of the right lung was calculated to be 11.1% of the body length, without a significant difference between species. The length of the left lung in proportion to the right was dependent on the species examined. The most developed left lung was in P. regius (81.2%), whereas in B. constrictor, the left lung was vestigial or absent (24.7%). A median attenuation of -814.6 HU and a variability of 45.9 HU were calculated for all species with no significant difference between species. Within the species, a significantly higher attenuation was found for P. regius in the dorsal and cranial aspect of the lung compared with the ventral and caudal part. In B. constrictor, the reduced left lung was significantly hyperattenuating compared with the right lung. Results of this study emphasize the value of CT and provide basic reference data for assessment of the snake lung in these species. Veterinary Radiology &

  8. Crecimiento del mejillón verde Perna viridis (Bivalvia: Mytilidae bajo sistema de cultivo de fondo en la ensenada de Turpialito, Golfo de Cariaco, Venezuela Growth and survival of the green mussel P. viridis (Bivalvia: Mytilidae in bottom culture conditions in Turpialito, Golfo de Cariaco, Venezuela

    Directory of Open Access Journals (Sweden)

    Vanessa Acosta

    2012-12-01

    Full Text Available Los moluscos representan uno de los grupos más importantes desde el punto de vista económico en la acuicultura marina, debido a los bajos costos de producción y a su alta rentabilidad. En este estudio se planteó probar la hipótesis de un mayor crecimiento de Perna viridis en cultivo de fondo, por un mejor aprovechamiento de alimento presente en el medio, lo cual permitirá descartarla o no como especie de cultivo para el Golfo de Cariaco. En este sentido, se evaluó el crecimiento y la supervivencia del mejillón verde P. viridis en condiciones de cultivo de fondo entre julio 2007 y febrero 2008. Las semillas del mejillón (35.81±1.41mm de longitud fueron obtenidas en la localidad de Guaca (costa norte del estado Sucre y trasladadas hasta la Estación Hidrobiológica de Turpialito, golfo de Cariaco, estado Sucre-Venezuela, en donde se sembraron en cestas “españolas”. Mensualmente se determinó supervivencia así como la longitud máxima de la concha, la masa seca del músculo, resto de tejidos y de la gónada. Los parámetros ambientales (temperatura del agua, salinidad, oxígeno disuelto, clorofila a, seston total y su fracción orgánica, en la zona de cultivo se determinaron cada 15 días. Mensualmente se realizaron determinaciones de proteínas, lípidos y carbohidratos al seston. Durante todo el estudio el mejillón mantuvo un crecimiento continuo, alcanzando al final una longitud máxima de 78.7±4.43mm. Sin embargo, la tasa de crecimiento de la masa seca de los tejidos somáticos (músculo, resto de tejido y reproductivo, mostraron variabilidad a lo largo del estudio, produciéndose al final un incremento significativo en dichos tejidos. Las variaciones observadas en la tasa de crecimiento de la masa del tejido reproductivo, dependió de las reservas acumuladas y del alimento ofertado por el medio ambiente. El seston orgánico durante toda la experiencia mostró una independencia de la temperatura y de la clorofila a

  9. Identification of fruit volatiles from green hawthorn (Crataegus viridis) and blueberry hawthorn (Crataegus brachyacantha) host plants attractive to different phenotypes of Rhagoletis pomonella flies in the southern United States.

    Science.gov (United States)

    Cha, Dong H; Powell, Thomas H Q; Feder, Jeffrey L; Linn, Charles E

    2011-09-01

    The apple maggot fly, Rhagoletis pomonella, infests several hawthorn species in the southern USA. In a companion paper, we showed that R. pomonella flies infesting two different mayhaw species (Crataegus opaca and C. aestivalis) can discriminate between volatile blends developed for each host fruit, and that these blends are different from previously constructed blends for northern fly populations that infest domestic apple (Malus domestica), downy hawthorn (Crataegus mollis), and flowering dogwood (Cornus florida). Here, we show by using coupled gas chromatography and electroantennographic detection (GC-EAD), gas chromatography with mass spectrometry (GC-MS), and flight tunnel bioassays, that two additional southern hawthorn fly populations infesting C. viridis (green hawthorn) and C. brachyacantha (blueberry hawthorn) also can discriminate between volatile blends for each host fruit type. A 9-component blend was developed for C. viridis (3-methylbutan-1-ol [5%], butyl butanoate [19.5%], propyl hexanoate [1.5%], butyl hexanoate [24%], hexyl butanoate [24%], pentyl hexanoate [2.5%], 1-octen-3-ol [0.5%], pentyl butanoate [2.5%], and (3E)-4,8-dimethyl-1,3,7-nonatriene (DMNT) [20.5%]) and an 8-component blend for C. brachyacantha (3-methylbutan-1-ol [0.6%], butyl acetate [50%], pentyl acetate [3.5%], butyl butanoate [9%], butyl hexanoate [16.8%], hexyl butanoate [16.8%], 1-octen-3-ol [0.3%], and pentyl butanoate [3%]). Crataegus viridis and C. brachyacantha-origin flies showed significantly higher levels of upwind oriented flight to their natal blend in flight tunnel assays compared to the alternate, non-natal blend and previously developed northern host plant blends. The presence of DMNT in C. viridis and butyl acetate in C. brachyacantha appeared to be largely responsible for driving the differential response. This sharp behavioral distinction underscores the diversity of odor response phenotypes in the southern USA, points to possible host race formation in these

  10. Neuro-endocrine effects of aqueous extract of Amaranthus viridis (Linn. leaf in male Wistar rat model of cyclophosphamide-induced reproductive toxicity

    Directory of Open Access Journals (Sweden)

    Ayoka Oladele Abiodun

    2016-01-01

    Full Text Available Cyclophosphamide (CP is a widely used cytotoxic alkylating agent with antitumor and immunosuppressant properties that is associated with various forms of reproductive toxicity. The significance of natural antioxidants of plant origin should be explored, especially in a world with increasing incidence of patients in need of chemotherapy. The neuro-endocrine effects of aqueous extract of Amaranthus viridis (Linn. leaf (AEAVL in Wistar rats with CP-induced reproductive toxicity was determined. Forty rats were used for this study such that graded doses of the extract were administered following CP-induced reproductive toxicity and comparisons were made against control, toxic and standard (vitamin E groups at p < 0.05. The synthetic drugs (CP, 65 mg/kg i.p. for 5 days; Vitamin E, 100 mg/kg p.o. for 30 days as well as the extract (100, 200 and 400 mg/kg p.o. for 30 days were administered to the rats at 0.2 mL/100 g. CP induced reproductive toxicity as evidenced by significantly lowered levels of FSH, LH and testosterone, perturbation of sperm characterization, deleterious disruptions of the antioxidant system as evidenced by decreased levels of GSH as well as elevation of TBARS activity. Histopathological examination showed hemorrhagic lesions with scanty and hypertrophied parenchymal cells in the pituitary while the testis showed ballooned seminiferous tubules with loosed connective tissues and vacuolation of testicular interstitium. These conditions were significantly reversed (p < 0.05 following administration of the graded doses of the extract. It was, therefore, concluded that AEAVL could potentially be a therapeutic choice in patients with CP-induced neuro-endocrine dysfunction and reproductive toxicity.

  11. Seasonal variation in antioxidative responses and acetylcholinesterase activity in Perna viridis in eastern oceanic and western estuarine waters of Hong Kong

    Science.gov (United States)

    Lau, P. S.; Wong, H. L.; Garrigues, Ph.

    2004-10-01

    A year-round study was conducted to assess the seasonal variations and potential influence of the riverine discharge from the Pearl River on biomarker responses in Hong Kong waters. A suite of biomarkers including antioxidant enzymes superoxide dismutase (SOD), catalase (CAT), the lipid peroxidation product malondialdehyde (MDA), a Phase II detoxification enzyme glutathione-S-transferase (GST) and the neural transmitter enzyme acetylcholinesterase (AChE) in the green mussel, Perna viridis, were monitored from three coastal sites, Port Shelter, Tung Chung and Tai O, stretching from the east to the west of Hong Kong. Despite of the seasonal variations, the total protein profiles suggested that mussels from the three sites had a growth cycle that was in phase with each other. This implied that intrinsic variation between sites due to a different phase of growth was minimal. Seasonal variations of the biomarker responses in the mussels were found to be significant (Tukey multiple comparison test, pbiomarker responses at Tai O in relation to the extreme low salinity of 8‰. Mussels from the western site also revealed a higher oxidative stress than those from the eastern side throughout the year (Tukey multiple comparison test, pbiomarker responses. Gill tissues of the mussels were more advantageous for biomarker studies or monitoring because their protein levels were less sensitive to seasonal variations and they yielded a higher protein normalized biomarker response than the whole body tissues. This increases their discrimination ability for site comparisons. The feasibility of biomarker monitoring in areas of sub-lethal or low chemical contamination will also be discussed.

  12. De novo assembly and comparative transcriptome analysis of the foot from Chinese green mussel (Perna viridis in response to cadmium stimulation.

    Directory of Open Access Journals (Sweden)

    Xinhui Zhang

    Full Text Available The Chinese green mussel, Perna viridis, is a marine bivalve with important economic values as well as biomonitoring roles for aquatic pollution. Byssus, secreted by the foot gland, has been proved to bind heavy metals effectively. In this study, using the RNA sequencing technology, we performed comparative transcriptomic analysis on the mussel feet with or without inducing by cadmium (Cd. Our current work is aiming at providing insights into the molecular mechanisms of byssus binding to heavy metal ions. The transcriptome sequencing generated a total of 26.13-Gb raw data. After a careful assembly of clean data, we obtained a primary set of 105,127 unigenes, in which 32,268 unigenes were annotated. Based on the expression profiles, we identified 9,048 differentially expressed genes (DEGs between Cd treatment (50 or 100 μg/L at 48 h and the control, suggesting an extensive transcriptome response of the mussels during the Cd stimulation. Moreover, we observed that the expression levels of 54 byssus protein coding genes increased significantly after the 48-h Cd stimulation. In addition, 16 critical byssus protein coding genes were picked for profiling by quantitative real-time PCR (qRT-PCR. Finally, we reached a primary conclusion that high content of tyrosine (Tyr, cysteine (Cys, histidine (His residues or the special motif plays an important role in the accumulation of heavy metals in byssus. We also proposed an interesting model for the confirmed byssal Cd accumulation, in which biosynthesis of byssus proteins may play simultaneously critical roles since their transcription levels were significantly elevated.

  13. The complete chloroplast DNA sequence of the green alga Oltmannsiellopsis viridis reveals a distinctive quadripartite architecture in the chloroplast genome of early diverging ulvophytes

    Directory of Open Access Journals (Sweden)

    Lemieux Claude

    2006-02-01

    Full Text Available Abstract Background The phylum Chlorophyta contains the majority of the green algae and is divided into four classes. The basal position of the Prasinophyceae has been well documented, but the divergence order of the Ulvophyceae, Trebouxiophyceae and Chlorophyceae is currently debated. The four complete chloroplast DNA (cpDNA sequences presently available for representatives of these classes have revealed extensive variability in overall structure, gene content, intron composition and gene order. The chloroplast genome of Pseudendoclonium (Ulvophyceae, in particular, is characterized by an atypical quadripartite architecture that deviates from the ancestral type by a large inverted repeat (IR featuring an inverted rRNA operon and a small single-copy (SSC region containing 14 genes normally found in the large single-copy (LSC region. To gain insights into the nature of the events that led to the reorganization of the chloroplast genome in the Ulvophyceae, we have determined the complete cpDNA sequence of Oltmannsiellopsis viridis, a representative of a distinct, early diverging lineage. Results The 151,933 bp IR-containing genome of Oltmannsiellopsis differs considerably from Pseudendoclonium and other chlorophyte cpDNAs in intron content and gene order, but shares close similarities with its ulvophyte homologue at the levels of quadripartite architecture, gene content and gene density. Oltmannsiellopsis cpDNA encodes 105 genes, contains five group I introns, and features many short dispersed repeats. As in Pseudendoclonium cpDNA, the rRNA genes in the IR are transcribed toward the single copy region featuring the genes typically found in the ancestral LSC region, and the opposite single copy region harbours genes characteristic of both the ancestral SSC and LSC regions. The 52 genes that were transferred from the ancestral LSC to SSC region include 12 of those observed in Pseudendoclonium cpDNA. Surprisingly, the overall gene organization of

  14. Diferenças morfológicas entre Amaranthus cruentus, cv. BRS Alegria, e as plantas daninhas A. hybridus, A. retroflexus, A. viridis e A. spinosus Morphological differences between Amaranthus cruentus, cv. BRS Alegria, and the weed species A. hybridus, A. retroflexus, A. viridis and A. spinosus

    Directory of Open Access Journals (Sweden)

    C.R. Spehar

    2003-12-01

    Full Text Available O pseudocereal amaranto, com as espécies Amaranthus caudatus, A. cruentus e A. hypochondriacus, domesticado pelas populações indígenas antes que a América fosse descoberta, tem se adaptado aos sistemas produtivos dos cerrados. A planta apresenta panículas apicais, divididas em pequenos ramos com frutos do tipo pixídio, com uma semente cada. Estas germinam rapidamente em presença de umidade, após atingirem a maturação fisiológica. No início da fase vegetativa, o amaranto cultivado pode confundir-se com espécies de plantas daninhas do mesmo gênero (A. hybridus, A. retroflexus, A. viridis e A. spinosus, as quais estão associadas à expansão agrícola. As diferenças morfológicas tornam-se mais visíveis após o florescimento: ramificações com flores axilares e terminais, em contraste com o amaranto, no qual a inflorescência (panícula é apical; as sementes claras das espécies cultivadas contrastam com as das invasoras, que são escuras. BRS Alegria (A. cruentus, cultivar pioneiro no Brasil, apresenta plantas com 180 cm, das quais a panícula ocupa 48 cm; maturação fisiológica aos 90 dias; resistência ao acamamento; e 0,68 g por 1.000 sementes, com produção de 2,3 t ha¹ (sementes e 5,6 t ha-1 (biomassa total. As sementes nas plantas daninhas são menores, germinam gradativamente e podem permanecer no solo por muitos anos, infestando as áreas. As diferenças morfológicas detectadas na experimentação demonstram que as espécies são distinguíveis; elas contribuem para orientar a produção de sementes e o cultivo comercial de amaranto, enfatizando as características de adaptação, em contraste com as das invasoras do mesmo gênero botânico.The pseudocereal grain amaranth, with the species Amaranthus caudatus, A. ruentus e A. hypochondriacus, domesticated by indigenous populations before America was discovered, has shown adaptability to production systems in the Brazilian savannah. The plants present apical

  15. Estabilidad temporal de las infracomunidades de parásitos en la borrachilla Scartichthys viridis (Valenciennes, 1836 (Pisces : Blenniidae en la costa central de Chile Temporal stability in parasite infracommunities of the blenny Scartichthys viridis(Valenciennes, 1836 (Pisces: Blenniidae on the central coast of Chile

    Directory of Open Access Journals (Sweden)

    FREDDY DÍAZ

    2002-12-01

    Full Text Available Se comparan las infracomunidades de parásitos de la borrachilla Scartichthys viridis (Pisces: Blenniidae de tres muestras tomadas en un lapso de 17 meses, entre 1999 y 2001, desde pozas intermareales vecinas a Las Cruces (33°27' S, 71°37' O, Chile central. El objetivo es averiguar si la riqueza, diversidad, abundancia y composición de las infracomunidades de parásitos son persistentes o no en el tiempo ontogenético y cronológico. Se recolectaron 10 taxa parasitarios en cerca del 89 % de los 63 huéspedes examinados, de los cuales ocho eran metazoarios. La búsqueda de protozoos se realizó sólo en los últimos 2 años. El 75 % de los ocho taxa de metazoos ocurrieron en los tres años, uno no estuvo presente en un año, y otro fue encontrado solamente en un año. La mayoría de los huéspedes examinados albergaba protozoos parásitos. La prevalencia de los protozoos Cryptobia sp. fue alta para ambos años, y menor en Trichodina sp. La longitud total de los huéspedes era un predictor relevante de las variaciones en la riqueza, abundancia, diversidad y composición infracomunitaria en el conjunto de los tres años. En cambio, el año de muestreo no lo fue, en particular al comparar entre huéspedes de similar longitud total. Estos resultados son similares a los encontrados en infracomunidades de parásitos de otras especies de peces en Chile, en que hay baja variabilidad en las propiedades agregadas de las infracomunidades en el tiempo cronológico. Se discute acerca de la extensión relativa del tiempo ontogenético en contraste al tiempo cronológico al ser probablemente ambos de importancia en las características de las infracomunidades, y se propone que se explore la medida en la cual estos resultados constituyen un patrón.Parasite infracommunities of the blenny Scartichthys viridis (Pisces: Blenniidae are compared among three samples taken within a 17-month period during three consecutive years (1999-2001, from intertidal pools at

  16. Radiation Dose and Risk Assessments from Polonium-210 in Green Mussels (Perna viridis) and Seafood Consumers Living nearby the Industrial Area in Chonburi Province, Thailand

    Energy Technology Data Exchange (ETDEWEB)

    Tumnoi, Y.; Phaopeng, N. [Office of Atoms for Peace - OAP (Thailand)

    2014-07-01

    Marine environmental samples including seawater (filtered and unfiltered), suspended particles, and green mussels (Perna viridis) were collected from Sriracha and Angsira areas located in Chonburi province in order to determine Po-210 radioactivity. The former was chosen because it is generally believed that this area has been contaminated by one of the largest industrial estates in Thailand and others human-activities (non-nuclear activities) nearby such as oil refineries and Coal Power Plants. Discharges, ashes, and wastes released from these activities may result in an increase of Po-210 concentration in marine environment when compared to other areas. The later was designated to serve as a control site in this study since this area is unlikely to be impacted by industrial activities. Our results revealed that, in the filtered seawater, averaged values of Po-210 level were 0.26 + 0.14 mBq/L (Sriracha) and 0.56 + 0.42 mBq/L (Angsira) and, in the unfiltered seawater, means of Po-210 radioactivity were 2.37 + 0.32 mBq/L (Sriracha) and 4.20 + 2.78 mBq/L (Angsira). Furthermore, the suspended particles contained Po-210 concentrations with averaged values of 14.11 + 8.87 Bq/kg dw (Sriracha) and 102.21 + 51.49 Bq/kg dw (Angsira) while averaged Po-210 levels of 35.74 + 17.53 Bq/kg dw (Sriracha) and 71.12 + 62.88 Bq/kg dw (Angsira) were found in the green mussels examined. The present finding indicates that there is no radiological impact caused by those human activities to the marine environment at Sriracha. Radiation dose assessment was also performed in both the green mussels and human who consume green mussels. The results show that the green mussels farmed at Sriracha and Angsira received averaged radiation dose rates from Po-210 at 0.0007 and 0.0015 mGy/d, respectively. In addition, our results reveal that populations living in Chonburi province and ingesting the green mussels from these 2 locations received radiation dose rates from Po-210 at the means of 44.25 and

  17. [Demonstration, by means of electron microscopy, of the penetration of somitic cells into the mesoblast of the limb buds of reptile embryos (Anguis fragilis, Lacerta viridis)].

    Science.gov (United States)

    Raynaud, A; Adrian, M

    1975-01-01

    An electron microscopic study of the components of anterior limb buds of the slow-worm (Anguis fragilis) and of the green lizard (Lacerta viridis) (embryos of Anguis whose allantoic bud reach 0,7 to 4 mm of length; embryos of Lacerta 2 to 7 days old) provides data on the cytological characteristics of the components of the limb bud at these early stages. 1. The cells of the distal extremity of the somitic processes extending in the limb bud of Anguis and Lacerta, are elongated cells with ovoid nuclei containing large nucleolus; they possess mitochondria always thin and with dense matrix; they are rich in lipid droplets; they possess cilia; they are devoid of myofilaments; endoplasmic reticulum, free ribosomes and polyribosomes are abundant. Golgi networks display signs of activity. These characteristics are also observed in the cells of the "dermatome" layer of the dermo-myotome; and so, it appears probable that the cells of the "dermatome". Furthermore, in Anguis embryos, the cells of the distal extremities of the somitic processes possess numerous lysosomes and a certain number of cells among them, degenerate early. 2. The somatopleural mesoblastic cells of the limb bud of Anguis and Lacerta embryos keep the characters of the cells of the mesodermic layer of lateral plate from which they originate; they have rounded nuclei, cilia, and their mitochondria are always larger and more transparent to electrons, than the ones of cells of the somitic processes and of cells of the epiblastic apical crest. Golgi networks are well developped, endoplasmic reticulum is abundant, lipid droplets are rare. 3. The processes of somites which extend in the dorsal part of the limb bud of Anguis embryos are cords of cells with thin lumina; at the stage of the allantoic bud of 0,6 to 0,8 mm long, the distal extremity of these processes dislocate in group of cells which afterwards dissociate, releasing individual somitic cells which are integrated among the mesoblastic somatopleural

  18. DEVELOPMENT OF LEPTOPELIS VIRIDIS CINNAMOMEUS ...

    African Journals Online (AJOL)

    (BOCAGE) WITH NOTES ON ITS SYSTEMATIC POSITION. IAN LINDEN. Dept. of Bi%gy, University of Ma/awi. The taxonomic studies of J. Poynton (1964a, 1964b and 1966) and A. Schiotz (1967) indicate a remarkable parallel between the speciation of the genus Leptope/is in West, South and East. Mrica. The tree, ground ...

  19. Comunidad de moluscos asociados al mejillón verde Perna viridis (Mollusca: Bivalvia y sus relaciones tróficas en la costa norte de la Península de Araya, Estado Sucre, Venezuela

    Directory of Open Access Journals (Sweden)

    Sioliz Villafranca

    2006-12-01

    Full Text Available Perna viridis es un bivalvo procedente del Indo-Pacífico que habita en la zona intermareal y ha invadido varios ecosistemas de la costa norte del estado Sucre, Venezuela. Con la finalidad de realizar un estudio sobre las comunidades de moluscos asociadas a esta especie y sus relaciones tróficas, se llevaron a cabo muestreos bimensuales entre octubre/97 y agosto/98, en un banco natural de mejillones a dos metros de profundidad en la costa norte de la península de Araya (10°40’N -48°63’W. Los organismos fueron recolectados delimitando el área con una cuadrícula de 0.25 m². Se identificaron los organismos hasta la categoría de especies utilizando claves específicas para moluscos y bibliográficamente se les determinó categoría trófica.Se capturó un total de 1 235 individuos de P. viridis y asociados a la especie 3 163 especímenes pertenecientes al phylum Mollusca, contenidos en tres clases: Bivalvia,Gastropoda y Polyplacophora. Éstas estuvieron representadas por 50 especies correspondientes a 10 órdenes, 24 familias; para los gasterópodos se contabilizaron 25 especies, para los bivalvos 22 y tres para los poliplacóforos. Del total de las especies, 40% fueron filtradoras, 26% carnívoras, 24% herbívoras y el 10% restante presentó dos categorías.De las filtradoras las más representativas fueron: Perna perna, Musculus lateralis, Crassostrea rhizophorae y Ostrea equestris; en el grupo de los carnívoros dominaron tres especies de la familia Columbellidae:Mitrella lunata, Anachis obesa y Nitidella ocellata y para el grupo de los herbívoros destacaron dos especies de la familia Fisurellidae: Diodora cayenensis y D. minuta. Se registraron dos especies filtradoras-detritívoras, y tres especies herbívoras-filtradoras representantes del género C repidula. El alto porcentaje de filtradores sería un indicativo de que dentro de este sistema probablemente hay una mayor disponibilidad de fracciones alimenticias para este grupo

  20. Perfil de lípidos y ácidos grasos de Perna viridis, mejillón verde (Mollusca: Bivalvia en el oriente venezolano y la costa oeste de Trinidad

    Directory of Open Access Journals (Sweden)

    Tamar Koftayan

    2011-03-01

    Full Text Available Los lípidos totales fueron extraídos, identificados y cuantificados por gravimetría, mediante TLC/FID (sistema Iatroscan. Los ácidos grasos de los lípidos totales, fosfolípidos y triacilgliceroles fueron identificados y cuantificados por cromatografía de gases. Las mayores concentraciones de lípidos totales se presentaron en las muestras de Los Cedros, La Brea y Chaguaramas con valores de 7.92, 7.74 y 7.53%; respectivamente y los valores mínimos en las de La Restinga (6.08%. En la composición lípidica, las muestras de Chacopata presentaron la menor concentración de fosfolípidos (48.86% y los máximos valores de colesterol (38.87% y triacilgliceroles (12.26%, y las muestras de La Esmeralda y Río Caribe exhibieron concentraciones máximas de fosfolípidos (88.71-84.93%, respectivamente y mínimas de colesterol (6.50-4.42%. En los lípidos totales, los ácidos grasos saturados se encontraron entre 15.04 y 65.55%, con máximos en muestras de La Esmeralda y mínimos en Chacopata y los poliinsaturados estuvieron entre 7.80 y 37.18%, con máximos valores en la Brea y mínimos en la Esmeralda. En los fosfolípidos, la concentración de ácidos grasos saturados estuvo entre 38.81 y 48.68% para las muestras de Chaguaramas y Chacopata, respectivamente; los ácidos grasos poliinsaturados se encontraron entre no detectado y 34.51%, con altas concentraciones en muestras de Los Cedros (27.97% y Chaguaramas (34.51%. En los triacilgliceroles, la composición de ácidos grasos saturados variaron entre 14.27 y 53.80%, con baja concentración en Chacopata y alta concentración en La Restinga; los ácidos grasos poliinsaturados estuvieron entre 4.66 y 35.55%, con valores menores en las muestras de Chacopata (4.66% y mayores en Chaguaramas. El consumo frecuente de Perna viridis es recomendable, debido a su alto contenido de fosfolípidos y ácidos grasos insaturados.Lipid and fatty acid profile of Perna viridis, Green Mussel (Mollusca: Bivalvia in

  1. Saponin rich fractions from Polygonatum odoratum (Mill.) Druce with more potential hypoglycemic effects.

    Science.gov (United States)

    Deng, Yafei; He, Kai; Ye, Xiaoli; Chen, Xin; Huang, Jing; Li, Xuegang; Yuan, Lujiang; Jin, Yalan; Jin, Qing; Li, Panpan

    2012-05-07

    The root of Polygonatum odoratum (YuZhu), also a medicinal food has long been used for the treatment of diabetes. The objective of the study was to characterize the anti-diabetic active fractions or compounds in this herb. Fractions with a different polarity were prepared by solvent extraction and macroporous absorptive resin (D101) column and their anti-diabetic potentials were evaluated by glucose uptake in HepG2 cells and STZ-induced diabetic rats. In addition, α-glycosidase inhibitory activities of active fractions were measured in vitro and chemical compositions including saponin, total flavonoids and total sugar in the fractions were determined. The n-buthanol fraction, a saponin-rich fraction obtained by partitioning the ethanol extract with n-buthanol after petroleum ether and acetic ether showed the highest anti-diabetic potential in glucose uptake in HepG2 cells followed by acetic ether fraction which was rich in flavonoids. Further fractionation the saponin-rich fraction using macroporous resin column (D101), polysaccharide, flavonoid and saponin rich fractions were obtained by elution with water, 40% and 60% ethanol, respectively and their anti-diabetic potentials proved by glucose uptake test in HepG2 cells and STZ-induced diabetic rats were in the order of saponin rich fraction>flavonoid rich fraction>polysaccharide rich fraction. Long-term therapy test (60d) in severe diabetic rats indicated that saponin-rich fraction significantly ameliorated clinical symptoms of diabetes including the elevated blood glucose, body weight loss as well as the increased food and water intake while flavonoid-rich fraction was more potential than saponin-rich fraction to increase superoxide dismutase (SOD) activity and decrease malondialdehyde (MDA) level in rat plasma. Additionally, saponin-rich fraction and flavonoid-rich fraction showed α-glycosidase inhibitory activity with IC(50) value of 2.05±0.32 and 3.92±0.65mg/ml, respectively. The results suggested that saponin in this herb was more important than flavonoid in exhibiting anti-diabetic activity and flavonoid contributed more to anti-oxidant activity in vivo. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  2. Pharmacological Evaluation of Prosopis cineraria (L. Druce in Gastrointestinal, Respiratory, and Vascular Disorders

    Directory of Open Access Journals (Sweden)

    Khalid Hussain Janbaz

    2012-01-01

    Full Text Available In this paper, a crude methanolic extract from the stem bark of Prosopis cineraria, a plant native of Pakistan, was tested for its possible presence of spasmolytic, bronchodilator, and vasodilator activities in an attempt to validate some of its folkloric uses. Moreover, attempts were made to provide plausible explanations of the observed biological activities. The extract caused relaxation of the spontaneous as well as K+ (80 mM-induced contractions at tissue bath concentrations of 3–10 mg/mL in isolated rabbit jejunum preparations, probably mediated through blockade of Ca+2 channels. This finding was further confirmed by the shifting of the Ca+2 concentration response curves to the rightward in a manner similar to verapamil used as a standard Ca+2 channel blocker. The extract also exhibited nonspecific relaxant effect on carbachol (1 μM- and K+ (80 mM-induced contractions in isolated rabbit tracheal preparations. The same effect was recorded for phenylephrine (11 μM and K+ (80 mM-induced contractions in isolated rabbit aortic preparations in a manner similar to verapamil. These observations confirm that observed bronchodilator and vasodilator activities were possibly mediated through blockade of Ca+2 channels. The above-mentioned observations validate the traditional use of the plant in the treatment of respiratory and gastrointestinal ailments.

  3. A new pentacyclic triterpene with potent antibacterial activity from Limnophila indica Linn. (Druce).

    Science.gov (United States)

    Brahmachari, Goutam; Mandal, Narayan C; Roy, Rajiv; Ghosh, Ranjan; Barman, Soma; Sarkar, Sajal; Jash, Shyamal K; Mondal, Sadhan

    2013-10-01

    A new pentacyclic triterpenoid constituent, characterized as 3-oxo-olean-12(13),18(19)-dien-29α-carboxylic acid (1) on the basis of detailed spectral studies, was isolated from the aerial parts and roots of Limnophila indica (Scrophulariaceae). Compound 1 exhibited considerable antibacterial activity against three Gram-positive bacteria viz. Bacillus subtilis, Staphylococcus aureus and Listeria monocytogenes (MICs within a range of 25-30 μg/ml) and moderate activity against four Gram-negative bacteria Salmonella typhimurium, Escherichia coli, Pseudomonas aeruginosa, and Pantoea ananatis (MICs within a range of 30-100 μg/ml). The plant pathogenic bacterium P. ananatis and human pathogenic S. typhimurium responded at comparatively higher concentrations of the compound 1, which were 75 and 100 μg/ml respectively. The compound inhibited the growth of Gram-positive B. subtilis and Gram-negative P. aeruginosa completely with a clear bactericidal mode of action at their MIC values. The compound upon treatment on both B. subtilis and P. aeruginosa released substantial amount of nucleic acid in the external medium and also effected the change of morphology towards pleomorphicity, thereby indicating its probable action on cell membrane. Furthermore, the triterpenoid 1 was found not to inhibit a probiotic lactic acid bacterium Lactococcus lactis subsp. lactis LABW4 under in vitro condition and to possess no toxicity in Swiss albino mice. © 2013.

  4. Phytoextraction assessment of green amaranth ( Amaranthus viridis ...

    African Journals Online (AJOL)

    Disposal of sewage sludge is the major challenge facing wastewater treatment facilities. Several reports claimed that land application is the best option to manage sludge disposal. However, there is perception that sludge contains heavy metals that are potentially harmful to the living organisms. Thus, the study assessed ...

  5. Tertiary Structural studies of Myotoxin a from Crotalus viridis viridis Venom by Nuclear Magnetic Resonance

    Science.gov (United States)

    1993-05-01

    electrophorus electri... 47 47 47 Sw:Ibb2SWheat P09864 wheat (triticum aestivum). proteina ... 46 46 51 Sw:Pa29$Pseau P20253 mulga snake (pseudechis...Sw:Pa2bSPsepo P20259 red-bellied black snake (pseudechis... 34 46 37 Sw:IbblSWheat P09863 wheat (triticum aestivum). proteina ... 46 46 52 Sw:Pa2a$Psepo P20258 red

  6. Efeito de cascas de café e de arroz dispostas nas camadas do solo sobre a germinação e o crescimento inicial do caruru-de-mancha Allelopathic effect of coffee and rice husks arranged in soil layers on the germination and initial growth of Amaranthus viridis

    Directory of Open Access Journals (Sweden)

    J.C.F. Santos

    2001-08-01

    Full Text Available Estudos dos efeitos dos resíduos de plantas pela utilização de coberturas mortas no controle das plantas daninhas têm apresentado dificuldade de determinar a diferenciação entre alelopatia e competição. Atualmente, muitas pesquisas têm se referido a critérios que propõem evidência à alelopatia. Este trabalho em casa de vegetação visou determinar os efeitos alelopáticos proporcionados pelas cascas de café e de arroz sobre o caruru-de-mancha, por meio das disposições desses resíduos nas camadas do solo. O delineamento experimental foi o de blocos casualizados, com os tratamentos em quatro repetições e organizados num esquema fatorial (3x3, sendo cascas de café e de arroz e vermiculita expandida como um fator e suas disposições, com resíduos depositados no topo, incorporados na superfície e incorporados no fundo, como segundo fator. Como testemunha foi usado um tratamento adicional sem cobertura. De modo geral, resíduos de cascas proporcionaram inibição da germinação e estímulo ao crescimento do caruru-de-mancha. A casca de arroz proporcionou menor índice de velocidade de emergência e germinação de sementes do que a casca de café. A casca de café depositada no topo proporcionou maior crescimento e maior peso da matéria seca do caruru-de-mancha, seguido pela mesma casca incorporada na superfície do solo.Studies of plant residue effects involving mulches to control weeds in perennial crops are difficult to carry out due to the need to differentiate between allelopathy and competition. Many researches, nowadays, refer to criteria proving allelopathy. This work was established under greenhouse conditions to determine the allelopathic effects of coffee and rice husks on Amaranthus viridis through their arrangements in soil layers. The experimental design was a randomized block with four replications, arranged in a 3 x 3 factorial scheme, with coffee and rice husks and expanded vermiculite being one factor and

  7. Phytochemical and antimicrobial studies of Olax viridis OLIV. (Fam ...

    African Journals Online (AJOL)

    A 1-kg portion of the pulverized crude drug was defatted using n-hexane (F1) and subsequently extracted with methanol in soxhlet, and the methanol extract (F2) fractionated into F3-F8. All the fractions were screened for activity against some clinical strains of bacteria and fungi. Their phytochemical composition was, ...

  8. Tolerance of High Inorganic Mercury of Perna viridis : Laboratory ...

    African Journals Online (AJOL)

    ... a 'very' high level of inorganic Hg, it has a high bioaccumulative capability and a high tolerance to inorganic Hg. The mussel byssus was found to have the highest depuration rate coefficient, indicating that it could act as one of the excretion routes for Hg and it can be proposed as a sensitive biomonitoring material for Hg.

  9. A new species of Elasmia Möschler from New Mexico and Texas, and a new subspecies of Elasmia mandela (Druce from Texas and Oklahoma (Lepidoptera, Notodontidae, Nystaleinae

    Directory of Open Access Journals (Sweden)

    Eric Metzler

    2011-11-01

    Full Text Available Hippia packardii (Morrison and Hippia insularis (Grote are moved to the genus Elasmia Möschler as comb. n. Elasmia cave Metzler, sp. n. is described from New Mexico and Texas, and Elasmia mandela santaana Metzler & Knudson, ssp. n. is described from Texas and Oklahoma. A key to the species of Elasmia of southwestern U.S. is provided. Adult male and female moths of Elasmia from southwestern U.S. and their genitalia are illustrated.

  10. Two new derivatives of griseofulvin from the mangrove endophytic fungus Nigrospora sp. (strain No. 1403) from Kandelia candel (L.) Druce.

    Science.gov (United States)

    Xia, Xuekui; Li, Qing; Li, Jia; Shao, Changlun; Zhang, Jianye; Zhang, Yonggang; Liu, Xin; Lin, Yongcheng; Liu, Changheng; She, Zhigang

    2011-10-01

    Two new compounds, methyl 3-chloro-6-hydroxy-2-(4-hydroxy-2-methoxy-6-methylphenoxy)-4-methoxybenzoate (1) and (2 S,5' R,E)-7-hydroxy-4,6-dimethoxy-2-(1-methoxy-3-oxo-5-methylhex-1-enyl)-benzofuran-3(2H)-one (2), together with four known compounds, griseofulvin (3), dechlorogriseofulvin (4), bostrycin (5), and deoxybostrycin (6), were isolated from the marine endophytic fungus NIGROSPORA sp. (No. 1403) collected from the South China Sea. The structures were elucidated by spectroscopic methods, 1D, 2D NMR, and HREIMS. Compounds 5 and 6 showed moderate antitumor and moderate antimicrobial activity. © Georg Thieme Verlag KG Stuttgart · New York.

  11. Chemical composition and general toxicity of essential oils extracted from the aerial parts of Artemisia armeniaca Lam. and A. incana (L.) Druce growing in Iran.

    Science.gov (United States)

    Mojarrab, M; Delazar, A; Esnaashari, S; Afshar, F Heshmati

    2013-01-01

    The essential oils of the aerial parts of A. armeniaca and A. incana, collected from Arasbaran area (East Azarbaijan province, Iran) were extracted by hydrodistillation and analyzed by GC-MS. In total, 16 and 40 constituents were identified and quantified in the oils of A. armeniaca and A. incana representing 80.5% and 84.6% of the oils, respectively. The essential oil of A. armeniaca was mainly composed of non-terpene hydrocarbons (24.8%). The major components of the oil were α-pinene (10.7%), nonadecane (10.0%), 6,10,14-trimethyl-2-pentadecanone (9.4%), spathulenol (7.8%) and Z-verbenol (5.8%). The essential oil of A. incana was dominated by oxygenated monoterpenes (41.6%), with camphor (20.4%), 1,8-cineol (10.3%), Z-verbenol (8.7%), β-thujone (8.3%) and α-thujone (5.6%), as major components. The essential oils were also subjected to general toxicity assay using brine shrimp lethality method. The toxicity profile of both oils indicated some degree of toxicity in comparison with podophyllotoxin.

  12. ETUDE THEORIQUE ET EXPERIMENTALE DU SECHAGE SOLAIRE DES FEUILLES DE LA MENTHE VERTE (MENTHA VIRIDIS).

    OpenAIRE

    BOUMEDIENE, TOUATI

    2014-01-01

    LES PLANTES MÉDICINALES ET AROMATIQUES ET EN PARTICULIER LES FEUILLES DE LA MENTHE VERTE ONT BEAUCOUP D'IMPORTANCE POUR LA PHARMACOPÉE, LA PARFUMERIE ,LA CONFISERIE ET LA LIQUORISTE RIE . CE TRAVAIL ENTRE DANS LE CADRE DE LA VALORISATION DE CETTE PLANTE PRODUITE EN GRANDE QUANTITÉ DANS LE SUD ET LE SUD-OUEST ALGÉRIEN .IL S'AGIT RÉÉTUDIER LE SÉCHAGE DE CETTE PLANTE ET DE DÉVELOPPER L'UTILISATION DE L’ÉNERGIE POUR SE'CHER LA MENTHE VIRIDES.

  13. Preparation of Nanoparticles by Electroagulation From Soluble Exopolysaccharide Produced by Claviceps viridis

    Czech Academy of Sciences Publication Activity Database

    Flieger, Miroslav; Kantorová, Michaela; Benada, Oldřich; Kofroňová, Olga; Sobotka, Miroslav; Cvak, Jan; Votruba, Jaroslav

    2004-01-01

    Roč. 85, č. 2 (2004), s. 234-236 ISSN 0006-3592 R&D Projects: GA ČR GA525/00/1283 Institutional research plan: CEZ:AV0Z5020903 Keywords : electroagulation * exopolysaccharides * nanoparticles Subject RIV: EE - Microbiology, Virology Impact factor: 2.216, year: 2004

  14. Antifouling activity of Indian marine invertebrate against the green mussel Perna viridis L.

    Digital Repository Service at National Institute of Oceanography (India)

    PrabhaDevi; Jayasree, V.; Naik, C.G.; Parameswaran, P.S.; Raveendran, T.V.; Kamat, S.Y.

    Development, New Delhi, for financial assistance. References Bakus GT (1981) Chemical defence mechanisms and fish behaviour on the Great Barrier Reef, Australia. Science 211:497–499 Bakus GT, Green (1974) Toxicity in sponges and holothurians: A geo- graphic...

  15. Cytogenetic studies in green mussel, Perna viridis (Mytiloida: Pteriomorphia), from West Coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Iqbal, A.N.M.Z.; Khan, M.S.; Goswami, U.

    ) Chromosome number and karyotype of Donax trunculus L. (Mollusca, Bivalvia, Tellinacea). Genetica 82(2):93–97 Cross I, Dı´az E, Sa´nchez I, Rebordinos L (2005) Molecular and cytogenetic characterization of Crassostrea angulata chromo- somes. Aquaculture 247... maximus and Mimachlamys varia (Bivalvia: Pectinidae). Genetica 126(3):291–301 Justo CC, Murofushi, Maida K, Hanyu I (1991) Karyological studies on the freshwater prawn Macrobrachium rosenbergii. Aquacul- ture 97:327–334 Levan A, Fredga K, Sandberg AA (1964...

  16. Proximate biochemical composition and caloric potential in the raft-grown green mussel Perna viridis

    Digital Repository Service at National Institute of Oceanography (India)

    Rivonker, C.U.; Parulekar, A

    .5-34.2 and 3.1-21.2% respectively. Major biochemical constituents were found to be influenced by phytoplankton abundance and were also found to vary with maturation and spawning cycle. The caloric potential in the raft-grown mussel varied from 3.33 to 4.9 K cal...

  17. Antioxidative potential of Perna viridis and its protective role against ROS induced lipidperoxidation and protein carbonyl

    Digital Repository Service at National Institute of Oceanography (India)

    Jena, K.B.; Jagtap, T.G.; Verlecar, X.N.

    ) represent various forms of oxygen centered molecules (1). In living beings, ROS are formed endogenously during normal cellular metabolism. Exogenously ROS is obtained during exposure to ionization radiations and many xenobiotic substances (1). In cellular... atherogenicity. New England Journal of Medicine, 320: 915-924. 6. Muramatsu, H., Kogawa, K., Tanaka, M., Okumura, K., Koike, K. and Kuga, T. (1995) Superoxide dismutase in SAS human tongue carcinoma cell line is a factor defining invasiveness and cell motility...

  18. Extract of Indian green mussel, Perna viridis (L.) shows inhibition of blood capillary formation in vitro

    Digital Repository Service at National Institute of Oceanography (India)

    Mirshahi, M.; Mirshahi, P.; Negro, S.; Soria, J.; Sreekumar, P.K.; Kotnala, S.; Therwath, A.; Chatterji, A.

    , in these fractions, was done using the matrigel bi-dimensional models. Bi-dimensional Angiogenesis Assay In the bi-dimensional model (matrigel which is a standardized cancer cell extra-cellular matrix), the endothelial cells were seeded on the matrigel..., are useful in cancer therapy. Anti-angiogenic substances can be used to inhibit the growth of tumour mass by preventing neo-vascularization of an early developing tumour. Therefore, such substances are of importance, not only to prevent the development...

  19. Modulation of antioxidant defences in digestive gland of Perna viridis (L.), on mercury exposures

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Chainy, G.B.N.

    , and mixtures of B[a]P and Aroclor 1254. Mar. Pollut. Bull. 46, 1285–1293. Sweetman, S.F., Strain, J.J., McKelvey-Martin, V.J., 1997. Effect of antioxidant vitamin supplementation on DNA damage and repair in human lymphoblastoid cells. Nutrit. Cancer 27, 122...

  20. DNA damage in male gonad cells of Green mussel (Perna viridis) upon exposure to tobacco products

    Digital Repository Service at National Institute of Oceanography (India)

    Nagarajappa; Ganguly, A.; Goswami, U.

    , heavy metals, etc. Some of these chemicals are known genotoxicants and can cause damage to the genetic material of the exposed organism (Shugart, 1990). Damaged DNA may potentiate subsequent deleterious cellular events such as disease (e.g., cancer...

  1. Biomarkers of petroleum contamination in the digestive gland of Perna viridis (L.)

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Desai, S.R.; Das, P.B.; Chainy, G.B.N.

    lipid peroxidation, protein carbonyl, DNA integrity, and hydrogen peroxide in WAF-exposed specimens are indicative of oxidative damage due to dissolved petroleum extracts. A consistent increase in superoxide dismutase, catalase, glutathione peroxidase...

  2. Growth parameters in the cultured green mussel Perna viridis L. from the Zuari Estuary, Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Rivonker, C.U.; Sreepada, R.A.; Parulekar, A.H.

    inverse relationship. In contrast, growth expressed in terms of weight was significantly influencEd. by chl-a and DO. It was also observed that chl-a either singly or in combination with particulate organic matter had significant effect on growth...

  3. Relative toxicity of oil dispersants to Mytilus viridis and Macrobrachium idella

    Digital Repository Service at National Institute of Oceanography (India)

    DeSilva, C.; Row, A.

    There was a great variation in the relative toxicity of different oil dispersants. Dispersant IB 2/80 was most toxic and dispersant IB 11/80 was not lethal at the highest concentration tested. The ranking order of the emulsions (oil dispersant...

  4. Tumours of reptiles 4. Multiple osteomas in the lizard Laceria viridis

    NARCIS (Netherlands)

    Stolk, A.

    1958-01-01

    Whereas in fishes several osteomas (Bell, 1793; Gervais, 1875; Bland-Sutton, 1885 ; Plehn, 1906 ; Schroeders, 1908 ; Fiebiger, 1909 ; Williamson, 1913 ; Beatti, 1916 ; Kazama, 1924 ; Sagawa, 1925; Williams, 1929; Takahashi, 1929; Thomas, 1932, 1933; Lucké and Schlumberger, not published, see the

  5. [Chemically induced ectropodia in the Lacerta viridis embryo and formation of styliform limbs in reptiles].

    Science.gov (United States)

    Raynaud, A; Clergue-Gazeau, M

    1984-01-01

    Administered into the eggs of Lacerta virifis on days 10 and 11 of incubation (at 25 degrees C), Cytosine-arabinofuranoside induces ectropodia in embryos, with a high frequency, which may reach 66%. The resulting styliform limbs display a general structure similar to that of the limbs of several species of serpentiform Reptilia.

  6. Growth of the green mussel, Perna viridis L., in a sea water circulating system

    Digital Repository Service at National Institute of Oceanography (India)

    Chatterji, A.; Ansari, Z.A.; Ingole, B.S.; Parulekar, A.H.

    parameters did not show any marked correlation with growth rate, which was chiefly influenced by the availability of food. A significant relationship was noted between the shell length and total weight of the mussel, i.e. W = 3.7522 L sup(1.3007). The maximum...

  7. Radioprotection against DNA damage by an extract of Indian green mussel, Perna viridis (L.)

    Digital Repository Service at National Institute of Oceanography (India)

    Kumaran, S.P.; Kutty, B.C.; Chatterji, A.; Parameswaran, P.S.; Mishra, K.P.

    studies by trypan blue dye exclusion and MTT assay showed that pre incubation of mice splenic lymphocytes with MH protected them from Gamma-radiation mediated killing Moreover, the presence of MH during irradiation of isolated mice lymphocytes...

  8. Environment-dependence of behavioural consistency in adult male European green lizards (Lacerta viridis)

    OpenAIRE

    Horváth, Gergely; Mészáros, Boglárka; Urszán, Tamás János; Bajer, Katalin; Molnár, Orsolya; Garamszegi, László Zsolt; Herczeg, Gábor

    2017-01-01

    Understanding the background mechanisms affecting the emergence and maintenance of consistent between-individual variation within population in single (animal personality) or across multiple (behavioural syndrome) behaviours has key importance. State-dependence theory suggests that behaviour is 'anchored' to individual state (e.g. body condition, gender, age) and behavioural consistency emerges through behavioural-state feedbacks. A number of relevant state variables are labile (e.g. body con...

  9. Biochemical markers of oxidative stress in Perna viridis exposed to mercury and temperature

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Chainy, G.B.N.

    lipid peroxidation in mussels Perna perna exposed to different metals, Mar.Poll.Bull. 49 (2004) 386-392. [27] K. D. Oakes, G. J. V.D. Kraak, Utility of the TBARS assay in detecting oxidative stress in white sucker (Catostomus commersoni...

  10. Influence of rearing water temperature on induced gonadal development and spawning behaviour of tropical green mussel, Perna viridis

    Directory of Open Access Journals (Sweden)

    Parathattil Rathan Sreedevi

    2014-09-01

    Conclusion: According to the present study temperature induced spawning method is very simple and cost effective and can accelerate the production of mussel seeds in hatchery units and further stock improvement through genetic manipulation.

  11. BUDIDAYA KERANG HIJAU (Perna viridis L. DENGAN METODE DAN KEPADATAN BERBEDA DI PERAIRAN PESISIR KUALA LANGSA, ACEH

    Directory of Open Access Journals (Sweden)

    Andi Sagita

    2017-05-01

    Full Text Available Kerang hijau merupakan komoditas budidaya laut yang sangat prospektif untuk dikembangkan pada suatu sistem budidaya, karena dapat dilakukan dengan biaya produksi yang rendah namun menghasilkan profitabilitas yang tinggi. Penelitian ini bertujuan untuk mengetahui metode dan kepadatan yang paling optimal untuk budidaya kerang hijau di perairan pesisir Kuala Langsa, Aceh. Metode penelitian menggunakan rancangan acak lengkap faktorial yang terdiri atas faktor metode (long line dan stick dan faktor kepadatan (20, 30, dan 40 individu/kantong 5,30 L, masing-masing diulang sebanyak empat kali. Berdasarkan sidik ragam data Specific Growth Rate (SGR dari panjang (SGL L dan bobot (SGR W menunjukkan semua perlakuan metode, kepadatan dan interaksi berbeda signifikan pada taraf uji 5% (P<0,05, di mana perlakuan yang paling optimal yaitu perlakuan metode long line dengan kepadatan 20 individu/kantong 5,30 L diperoleh rata-rata nilai SGR (L sebesar 0,86 ± 0,01%/hari dan SGR (W sebesar 1,18 ± 0,04%/hari dengan sintasan mencapai 92,50 ± 2,89%. Parameter kualitas perairan selama periode budidaya masih sesuai untuk mendukung kehidupan kerang hijau di mana suhu berkisar 27,5-34,0°C; salinitas 28,5-33,0 ppt; pH 7,8-8,6; dan oksigen terlarut 4,5-6,5 mg/L; serta kecepatan arus 0,1-0,3 m/s. Budidaya kerang hijau dengan metode long line pada kepadatan 20 individu/kantong 5,30 L merupakan pola budidaya yang paling optimal untuk diterapkan di perairan pesisir Kuala Langsa, Aceh. Green mussel is a very prospective marine aquaculture commodity due to its low cost production but with high profitability. This research aimed to determine the most optimal method and densities for green mussel culture in coastal waters of Kuala Langsa, Aceh. The research used a completely randomized factorial design consisting of methods factor (long line and stick and densities factor (20, 30, and 40 individuals/basket 5.30 L, each repeated four times. Based on the variance analysis of specific growth rate (SGR data of the length (SGR L and weight (SGR W, all treatments of different methods and densities as well as their interactions were significant different (P<0.05. This study suggested that long line method with a densities of 20 individuals/basket 5.30 L was found to be the most optimal treatment for green mussel culture in coastal waters of Kuala Langsa. With this long line method an average SGR (L value of 0.86 ± 0.01%/day, SGR (W value of 1.18 ± 0.04%/day, and survival rate of 92.50 ± 2.89% were obtained. Water quality parameters during the culture period are still within the suitable range for green mussel culture, with the range of temperature 27.5-34.0°C, salinity 28.5-33.0 ppt, pH 7.8-8.6, dissolved oxygen 4.5-6.5 mg/L, and current velocity 0.1-0.3 m/s.

  12. Seasonal variation of oxidative biomarkers in gills and digestive gland of green-lipped mussel Perna viridis from Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Verlecar, X.N.; Jena, K.B.; Chainy, G.B.N.

    as nmol TBARS formed per mg protein. 2.6.Antioxidant enzymes The activity of total SOD was determined by the method of Paoletti et al. (1990) by monitoring rate of oxidation of NADH. One unit of SOD activity was defined as 50 % inhibition of oxidation...) and endogenous factors such as reproductive cycle (Filho et al., 2001). It is difficult therefore to draw exact conclusion as to which parameter is most effective to bring the changes in the antioxidant observed. However it is clear from the data...

  13. Biometric and morphometric studies of Perna viridis and Perna indica along the southwest coast of India: a statistical approach

    Digital Repository Service at National Institute of Oceanography (India)

    Jayalakshmy, K.V.; Nair, M.; DileepKumar, R.; Vijayan, M.

    of India (Figure 1) and the samples were immediately taken for morphometric measurements. This involves the measurement of Shell Length (LT), Height (HT), Width (WI), Volume (VL), Shell weight (empty shell weight without organism) (WT), Wet weight... (weight of the organism alone) (WW), Total weight (weight of shell and organism) (TW) and Dry weight (weight of dried organism) (DW) of the two mussel species. LT, HT and WI were measured in the laboratory using the vernier calipers accurate to 0.01cm...

  14. Strategi Pemanfaatan Perairan Pesisir untuk Budi Daya Kerang Hijau (Perna viridis L. di Kuala Langsa, Provinsi Aceh

    Directory of Open Access Journals (Sweden)

    Andi Sagita

    2017-12-01

    Full Text Available Development of green mussel culture currently still requires the determination of strategies in accordance with the potential and conditions of coastal areas as well as management culture system. This research aims to formulate strategies of the utilization coastal waters for green mussel culture in coastal Kuala Langsa, Aceh Province. Data collected to identify internal factors and external, including primary and secondary data, while the determination of respondents using purposive sampling method. SWOT Analysis is used for strategy determined while prioritizing strategy using Quantitative Strategies Planning Matrix (QSPM analysis. Based on SWOT analysis, identified 9 strength factors, 4 weakness factors, 6 opportunity factors, and 5 threat factors and 8 strategies, then the priority of strategies is determined with QSPM analysis, the sequence of the most important priority is: counseling and training to improve the management of green mussel culture for coastal communities (WO1; green mussel culture can be integrated with the involvement of coastal communities as stakeholders (WO2; optimization of coastal waters for green mussel culture is supported by ecology conditions (SO1; green mussel culture can be done with longline method with a density of 20 individuals/basket 5.30 l (SO3; site selection for culture and spat collection of green mussel should consider coastal oceanographic factors (ST1; controlling the level of waste disposal from the mainland so as not to pollute coastal areas (ST2; and to formulate practical guidance of management of green mussel culture based on the food security principle.

  15. Responses of neurons of lizard's, Lacerta viridis, vestibular nuclei to electrical stimulation of the ipsi- and contralateral VIIIth nerves.

    Science.gov (United States)

    Richter, A; Precht, W; Ozawa, S

    1975-03-22

    Field and intracellular potentials were recorded in the vestibular nuclei of the lizard following stimulation of the ipsi- and contralateral vestibular nerves. The field potentials induced by ipsilateral VIIIth nerve stimulation consisted of an early negative or positive-negative wave (presynaptic component) followed by a slow negativity (transsynaptic component). The spatial distribution of the field potential complex closely paralleled the extension of the vestibular nuclei. Mono- and polysynaptic EPSPs were recorded from vestibular neurons after ipsilateral VIIIth nerve stimulation. In some neurons early depolarizations preceded the EPSPs. These potentials may be elicited by electrical transmission. Often spikelike partial responses were superimposed on the EPSPs. It is assumed that these potentials represent dendritic spikes. Contralateral VIIIth nerve stimulation generated disynaptic and polysynaptic IPSPs in some neurons and EPSPs in others. The possible role of commissural inhibition in phylogeny is discussed. In a group of vestibular neurons stimulation of the ipsilateral VIIIth nerve evoked full action potentials with latencies ranging from 0.25-1.1msec. These potentials are caused by antidromic activation of neurons which send their axons to the labyrinth.

  16. Prey selection by a reintroduced lion population in the Greater ...

    African Journals Online (AJOL)

    Prey selection by a reintroduced lion population in the Greater Makalali Conservancy, South Africa. Dave Druce, Heleen Genis, Jonathan Braak, Sophie Greatwood, Audrey Delsink, Ross Kettles, Luke Hunter, Rob Slotow ...

  17. The exotic invasive plant, Amaranthus viridis, suppresses the growth of native acacia by altering soil microbial communities structure and functionalities in a sahelian ecosystem

    International Nuclear Information System (INIS)

    Sanon, A.; Beguiristain, T.; Sylla, S.; Berthelin, J.; Duponnois, R.

    2009-01-01

    The functioning and stability of terrestrial ecosystems are mainly determined by plant specific richness and composition, which in turn, are closely interlinked with soil organisms development, in particular, soil microorganisms. One of the main success ways of invasive plants was these exogenous organisms-mediated modifications in soil microbial communities composition and diversity as well as their functioning, thus compromising native plant survival. (Author)

  18. Comparative effects of the blue green algae Nodularia spumigena and a lysed extract on detoxification and antioxidant enzymes in the green lipped mussel (Perna viridis)

    International Nuclear Information System (INIS)

    Davies, Warren R.; Siu, William H.L.; Jack, Ralph W.; Wu, Rudolf S.S.; Lam, Paul K.S.; Nugegoda, Dayanthi

    2005-01-01

    Nodularia spumigena periodically proliferates to cause toxic algal blooms with some aquatic animals enduring and consuming high densities of the blue green algae or toxic lysis. N. spumigena contains toxic compounds such as nodularin and lipopolysaccharides. This current work investigates physiological effects of exposure from bloom conditions of N. spumigena cells and a post-bloom lysis. Biochemical and antioxidative biomarkers were comparatively studied over an acute 3-day exposure. In general, a post-bloom N. spumigena lysis caused opposite physiological responses to bloom densities of N. spumigena. Specifically, increases in glutathione (GSH) and glutathione peroxidase (GPx) and decreases in glutathione S-transferase (GST) were observed from the N. spumigena lysis. In contrast, N. spumigena cell densities decreased GSH and increased GST and lipid peroxidation (LPO) in mussels. Findings also suggest that at different stages of a toxic bloom, exposure may result in toxic stress to specific organs in the mussel

  19. Seasonal variation of major elements (Ca, Mg) and trace metals (Fe, Cu, Zn, Mn) and cultured mussel Perna viridis L. and seawater in the Dona Paula Bay, Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Rivonker, C.U.; Parulekar, A.H.

    The major elements and trace metals were analysed from nussel tissue and the seawater taken from three depths (0, 5 and 9 meters) from the culture site. Range of variation in Ca, Mg, Fe, Cu, Zn and Mn were 226-399; 708-1329; 0.005-0.084; BDL-0...

  20. Comparative effects of the blue green algae Nodularia spumigena and a lysed extract on detoxification and antioxidant enzymes in the green lipped mussel (Perna viridis)

    Energy Technology Data Exchange (ETDEWEB)

    Davies, Warren R. [Department of Biotechnology and Environmental Biology, RMIT University, Melbourne, Victoria (Australia)]. E-mail: warren.davies@rmit.edu.au; Siu, William H.L. [Department of Biology and Chemistry, City University of Hong Kong, Kowloon, Hong Kong (China); Jack, Ralph W. [Department of Microbiology, University of Otago, Dunedin (New Zealand); Wu, Rudolf S.S. [Department of Biology and Chemistry, City University of Hong Kong, Kowloon, Hong Kong (China); Lam, Paul K.S. [Department of Biology and Chemistry, City University of Hong Kong, Kowloon, Hong Kong (China); Nugegoda, Dayanthi [Department of Biotechnology and Environmental Biology, RMIT University, Melbourne, Victoria (Australia)

    2005-07-01

    Nodularia spumigena periodically proliferates to cause toxic algal blooms with some aquatic animals enduring and consuming high densities of the blue green algae or toxic lysis. N. spumigena contains toxic compounds such as nodularin and lipopolysaccharides. This current work investigates physiological effects of exposure from bloom conditions of N. spumigena cells and a post-bloom lysis. Biochemical and antioxidative biomarkers were comparatively studied over an acute 3-day exposure. In general, a post-bloom N. spumigena lysis caused opposite physiological responses to bloom densities of N. spumigena. Specifically, increases in glutathione (GSH) and glutathione peroxidase (GPx) and decreases in glutathione S-transferase (GST) were observed from the N. spumigena lysis. In contrast, N. spumigena cell densities decreased GSH and increased GST and lipid peroxidation (LPO) in mussels. Findings also suggest that at different stages of a toxic bloom, exposure may result in toxic stress to specific organs in the mussel.

  1. Strong reproductive barriers in a narrow hybrid zone of West-Mediterranean green toads (Bufo viridis subgroup with Plio-Pleistocene divergence

    Directory of Open Access Journals (Sweden)

    Perrin Nicolas

    2010-07-01

    Full Text Available Abstract Background One key question in evolutionary biology deals with the mode and rate at which reproductive isolation accumulates during allopatric speciation. Little is known about secondary contacts of recently diverged anuran species. Here we conduct a multi-locus field study to investigate a contact zone between two lineages of green toads with an estimated divergence time of 2.7 My, and report results from preliminary experimental crosses. Results The Sicilian endemic Bufo siculus and the Italian mainland-origin B. balearicus form a narrow hybrid zone east of Mt. Etna. Despite bidirectional mtDNA introgression over a ca. 40 km North-South cline, no F1 hybrids could be found, and nuclear genomes display almost no admixture. Populations from each side of the contact zone showed depressed genetic diversity and very strong differentiation (FST = 0.52. Preliminary experimental crosses point to a slightly reduced fitness in F1 hybrids, a strong hybrid breakdown in backcrossed offspring (F1 x parental, with very few reaching metamorphosis and a complete and early mortality in F2 (F1 x F1. Conclusion Genetic patterns at the contact zone are molded by drift and selection. Local effective sizes are reduced by the geography and history of the contact zone, B. balearicus populations being at the front wave of a recent expansion (late Pleistocene. Selection against hybrids likely results from intrinsic genomic causes (disruption of coadapted sets of genes in backcrosses and F2-hybrids, possibly reinforced by local adaptation (the ranges of the two taxa roughly coincide with the borders of semiarid and arid climates. The absence of F1 in the field might be due to premating isolation mechanisms. Our results, show that these lineages have evolved almost complete reproductive isolation after some 2.7 My of divergence, contrasting sharply with evidence from laboratory experiments that some anuran species may still produce viable F1 offspring after > 20 My of divergence.

  2. GEOGRAPHIC INFORMATION SYSTEM-BASED MODELING AND ANALYSIS FOR SITE SELECTION OF GREEN MUSSEL, Perna viridis, MARICULTURE IN LADA BAY, PANDEGLANG, BANTEN PROVINCE

    Directory of Open Access Journals (Sweden)

    I Nyoman Radiarta

    2011-06-01

    Full Text Available Green mussel is one of important species cultured in Lada Bay, Pandeglang. To provide a necessary guidance regarding green mussel mariculture development, finding suitable site is an important step. This study was conducted to identify suitable site for green mussel mariculture development using geographic information system (GIS based models. Seven important parameters were grouped into two submodels, namely environmental (water temperature, salinity, suspended solid, dissolve oxygen, and bathymetry and infrastructural (distance to settlement and pond aquaculture. A constraint data was used to exclude the area from suitability maps that cannot be allowed to develop green mussel mariculture, including area of floating net fishing activity and area near electricity station. Analyses of factors and constraints indicated that about 31% of potential area with bottom depth less than 25 m had the most suitable area. This area was shown to have an ideal condition for green mussel mariculture in this study region. This study shows that GIS model is a powerful tool for site selection decision making. The tool can be a valuable tool in solving problems in local, regional, and/or continent areas.

  3. Divergent Host Plant Adaptation Drives the Evolution of Sexual Isolation in the Grasshopper Hesperotettix viridis (Orthoptera: Acrididae) in the Absence of Reinforcement

    Science.gov (United States)

    The beginning stages of lineage divergence can be difficult to detect, as correlations between altered genotypic and phenotypic attributes are often weak early in the process. Shifts in host plant use and divergence in mating signals can lead to sexual isolation and ultimately speciation. To underst...

  4. Comparative effects of the blue green algae Nodularia spumigena and a lysed extract on detoxification and antioxidant enzymes in the green lipped mussel (Perna viridis).

    Science.gov (United States)

    Davies, Warren R; Siu, William H L; Jack, Ralph W; Wu, Rudolf S S; Lam, Paul K S; Nugegoda, Dayanthi

    2005-01-01

    Nodularia spumigena periodically proliferates to cause toxic algal blooms with some aquatic animals enduring and consuming high densities of the blue green algae or toxic lysis. N. spumigena contains toxic compounds such as nodularin and lipopolysaccharides. This current work investigates physiological effects of exposure from bloom conditions of N. spumigena cells and a post-bloom lysis. Biochemical and antioxidative biomarkers were comparatively studied over an acute 3-day exposure. In general, a post-bloom N. spumigena lysis caused opposite physiological responses to bloom densities of N. spumigena. Specifically, increases in glutathione (GSH) and glutathione peroxidase (GPx) and decreases in glutathione S-transferase (GST) were observed from the N. spumigena lysis. In contrast, N. spumigena cell densities decreased GSH and increased GST and lipid peroxidation (LPO) in mussels. Findings also suggest that at different stages of a toxic bloom, exposure may result in toxic stress to specific organs in the mussel.

  5. Author Details

    African Journals Online (AJOL)

    Patterns of prescribing and utilization of asthma medications in a tertiary hospital in Dubai, United Arab Emirates Abstract PDF · Vol 15, No 10 (2016) - Articles Bioactive content, hepatoprotective and antioxidant activities of whole plant extract of Micromeria fruticosa (L) Druce ssp Serpyllifolia F Lamiaceae against Carbon ...

  6. Male secondary sexual characters in Aphnaeinae wings (Lepidoptera: Lycaenidae)

    OpenAIRE

    Bálint, Zsolt; Heath, Alan; Katona, Gergely; Kertész, Krisztián; Sáfián, Szabolcs

    2017-01-01

    Male secondary sexual characters have been discovered on the hindwing verso of genera Aphnaeus Hübner, [1819], Cigaritis Donzel, 1847, Lipaphnaeus Aurivillius, 1916 and Pseudaletis Druce, 1888 representing the Palaeotropical subfamily Aphnaeinae Lycaenidae: Lepidoptera). Relevant wing parts are illustrated, described, and some observations on the organs are briefly annotated. With an appendix and 14 figures.

  7. Biology, behavior, and larval morphology of Salbia lotanalis (Lepidoptera: Crambidae), a potential biological control agent of Miconia calvescens (Myrtales: Melastomataceae) from Costa Rica

    Science.gov (United States)

    Alexander Castillo; M. Tracy Johnson; Francisco R. Badenes-Pérez

    2014-01-01

    The leaf roller Salbia lotanalis Druce (Lepidoptera: Crambidae), a potential biological control agent of Miconia calvescens de Candolle (Melastomataceae), was studied in Costa Rica. Larvae were collected from a field site near San Jose and the insect was reared in the laboratory to study its biology and behavior. Chaetotaxy and...

  8. Male secondary sexu al characters in Aphnaeinae wings (Lepidoptera: Lycaenidae

    Directory of Open Access Journals (Sweden)

    Bálint, Zsolt

    2017-04-01

    Full Text Available Male secondary sexual characters have been discovered on the hindwing verso of genera Aphnaeus Hübner, [1819], Cigaritis Donzel, 1847, Lipaphnaeus Aurivillius, 1916 and Pseudaletis Druce, 1888 representing the Palaeotropical subfamily Aphnaeinae Lycaenidae: Lepidoptera. Relevant wing parts are illustrated, described, and some observations on the organs are briefly annotated. With an appendix and 14 figures.

  9. AXENIC IN-VITRO NITROGEN AND PHOSPHORUS RESPONSES OF SOME DUTCH MARSH ORCHIDS

    NARCIS (Netherlands)

    DIJK, E; ECK, N

    1995-01-01

    Seedlings of Dactylorhiza majalis (Reichb.) Hunt & Summerh., D. praetermissa (Druce) Soo var.junialis (Vermen.) Sengh., D. incarnata (L.) Soo and D. maculata (L.) Soo ssp. maculata were grown axenically in vitro at various concentrations of ammonium nitrate and phosphate to assess the extent of

  10. Pteridologische aantekeningen, 4, De bastaarden van het Dryopteris spinulosa-complex in Nederland

    NARCIS (Netherlands)

    Segal, S.

    1971-01-01

    Hybrids of the Dryopteris spinulosa complex in the Netherlands Kuntze ex Druce (= D. carthusiana X D. cristata) and D. x deweveri Dryopteris x uliginosa (Joh. Jansen) J. & W. ( = D. carthusiana X D. dilatata) have been recorded from several places in the Netherlands. Fern hybrids, generally

  11. 20th International Conference on Solid State Ionics (SSI 20)

    Science.gov (United States)

    2016-05-20

    Catala de Nanociencia i Nanotecnologia , Barcelona, Spain; 2Hydrogen Production, I2CNER, International Institute for Carbon Neutral Energy Research...Druce2, John A. Kilner2 and Tatsumi Ishihara2; 1ICN2 Institut Catala de Nanociencia i Nanotecnologia , Barcelona, Spain; 2Hydrogen Production

  12. Diversity, ecology and herbivory of hairstreak butterflies (Theclinae) associated with the velvet tree, Miconia calvescens in Costa Rica.

    Science.gov (United States)

    F.R. Badenes-Pérez; M.A. Alfaro-Alpízar; M.T. Johnson

    2010-01-01

    Larvae of three species of hairstreak butterflies in the subfamily Theclinae (Lepidoptera: Lycaenidae) were found feeding on developing inflorescences, flower buds, and immature fruits of the velvet tree, (Miconia calvescens) de Candolle (Myrtales: Melastomataceae) in Costa Rica. (Erora opisena) (Druce), (Parrhasius...

  13. Distribution of virulent and pandemic strains of Vibrio parahaemolyticus in three molluscan shellfish species (Meretrix meretrix, Perna viridis, and Anadara granosa) and their association with foodborne disease in southern Thailand.

    Science.gov (United States)

    Vuddhakul, Varaporn; Soboon, Supatinee; Sunghiran, Wattanee; Kaewpiboon, Sukhon; Chowdhury, Ashrafuzzaman; Ishibashi, Masanori; Nakaguchi, Yoshitsugu; Nishibuchi, Mitsuaki

    2006-11-01

    Distribution of pandemic strains of Vibrio parahaemolyticus in seafood, particularly in molluscan shellfish, and their serological and molecular relationships to clinical strains were examined from Hat Yai City in southern Thailand. During 2000 to 2002, virulent strains (tdh+ or trh+) were isolated from 13 of 230 molluscan shellfish samples using alkaline peptone water enrichment followed by immunomagnetic separation. The isolates included 12 pandemic strains (tdh+, trh-, group-specific PCR positive) from five Oriental hard clam samples, five green mussel samples, and one bloody clam sample. Among the pandemic strains, eight belonged to serogroup O3:K6, three belonged to O1:K25, and one was O1:K untypeable. One hundred eighty-seven strains of V. parahaemolyticus were isolated from clinical specimens obtained from a hospital in this city during 2000 to 2001. The pandemic strains comprised 64 and 68% of the isolates in 2000 and 2001, respectively. Among the serotypes of the pandemic strains, O3:K6 was dominant at 73% in 2000 and 76% in 2001 followed by O1:K25 at 20% in 2000 and 13% in 2001. Pulsed-field gel electrophoresis profiles of the pandemic strains from molluscan shellfish were indistinguishable or very similar to those of patient isolates. Similarity of the serotype distribution and DNA fingerprints occurring between the molluscan shellfish strains and clinical strains suggests that molluscan shellfish may be an important source of pandemic V. parahaemolyticus infection in southern Thailand. For public health, proper cooking of molluscan shellfish in this area is strongly recommended.

  14. Protein (Cyanobacteria): 428318141 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available GNDMICGTNRRGFQPPSHSSSRLKPTENSSDDAAGNDMICGTNRRGFQPPSHSSSRLKPTENSSETDVDQLTLQSSFRGLSL ...10 179408:410 ... hypothetical protein Osc7112_3223 Oscillatoria nigro-viridis PCC 7112 MWWQLLRIMPKFAPNLSPDDAT

  15. Effect of cooking methods on the micronutrient profile of selected ...

    African Journals Online (AJOL)

    Effect of cooking methods on the micronutrient profile of selected vegetables: okra fruit ( Abelmoshcus esculentus ), fluted pumpkin ( Telfairia occidentalis ), African spinach ( Amarantus viridis ), and scent leaf ( Ocumum gratissimum.

  16. 76 FR 65985 - Importation of Litchi and Longan Fruit From Vietnam Into the Continental United States

    Science.gov (United States)

    2011-10-25

    ... ombrodelta. Non-Lepidopteran Insect Pests: Bactrocera cucurbitae. Bactrocera dorsalis. Ceroplastes rubens... ombrodelta. Non-Lepidopteran Insect Pests: Bactrocera dorsalis. Ceroplastes rubens. Coccus viridis...

  17. Inventarisasi Nepenthes Di Hutan Adat Kantuk Dan Implementasinya Berupa Buku Saku Keanekaragaman Hayati Indonesia

    OpenAIRE

    Setiawan, Hendra; swisna, Syam; Nurdini, Asriah

    2014-01-01

    This reserch aims to identify Nepenthes species in Hutan Adat Kantuk and to develop a pocket book entitled Entuyut di Hutan Adat Kantuk, Sintang, Kalimantan Barat which was validated as learning media for study Indonesia biodiversity. The reserch was quantitative descriptive, with an explorations methode. The results showed that there were 5 Nepenthes species : Nepenthes ampullaria Jack., Nepenthes bicalcarata Hook.f., Nepenthes gracilis Korth., Nepenthes mirabilis (Lour.) Druce., and Nepenth...

  18. Pyrrhopyginae: new and revalidated genera (Lepidoptera, Hespe-riidae)

    OpenAIRE

    Mielke, Olaf H.H.

    2002-01-01

    The following new genera with their type-species are described: Oxynetrini: Cyclopyge gen. n. - type-species: Pyrrhopyge roscius Hopffer, 1874; Pyrrhopygini: Arnysoria gen. n. - type species: Pyrrhopyga [sic] galgala Hewitson, 1866, Chalypyge gen. n. - type species: Pyrrhopyga [sic] chalybea Scudder, 1872, Creonpyge gen. n. - type species: Pyrrhopyga [sic] creon H. Druce, 1874, Cyanopyge gen. n. - type species: Pyrrhopyge sangaris Skinner, 1921, Gunayan gen. n. - type species: Pyrrhopyga [sic...

  19. Biology of the Central Desert of Oman

    OpenAIRE

    GHAZANFAR, Shahina A

    2004-01-01

    A biological survey of the central desert of Oman was done using long distance transects. Vegetation was sparse and consisted of 200+ plant species, 22 species of mammals, 17 species of reptiles and amphibians, and more than 50 species of birds (migratory and resident). Three main vegetation types were identified based on ground substrate and the dominance of species. These were communities with Acacia Willd., Zygophyllum L., and open woodlands of Prosopis cineraria (L.) Druce. Over-grazing a...

  20. Antiproliferative heparin (glycosaminoglycans) isolated from giant ...

    African Journals Online (AJOL)

    Heparin was isolated from two bivalve mollusks, Tridacna maxima (giant clam) and Perna viridis (green mussel). The isolated heparin was quantified in crude as well as purified samples and they were estimated as 2.72 and 2.2 g/kg (in crude) and 260 and 248 mg/g (in purified samples) in T. maxima and P. viridis, ...

  1. PRELIMINARY DATA CONCERNING THE HERPETOFAUNA IN NEAM COUNTY (ROMANIA)

    OpenAIRE

    Sorin ROŞU; Iulian GHERGHEL

    2005-01-01

    In the researched area we identified 14 amphibian species: (Salamandra salamndra, Triturus vulgaris, Triturus cristatus, Triturus alpestris, Triturus montandoni, Bombina bombina, Bombina variegata, Bufo bufo, Bufo viridis, Pelobates fuscus, Hyla arborea, Rana ridibunda, Rana dalmatina, Rana temporaria) and 8 reptilian species (Lacerta agilis, Lacerta viridis, Zootoca vivipara, Anguis fragilis, Natrix natrix, Elaphe longissima, Coronella austriaca, Vipera berus). Within the region we identi...

  2. HEAVY METALS (Ni, Cu, Zn AND Cd CONTENT IN SERUM OF RAT FED GREEN MUSSELS

    Directory of Open Access Journals (Sweden)

    Muhammad Yudhistira Azis

    2015-11-01

    Full Text Available Green mussel (Perna viridis can playing role as bio-indicator or biomonitoring agent for heavy-metalcontaminations in the sea. In this research, the concentrations of four elements Ni, Cu, Zn and Cd in P. viridis and in the serum of rat which orally feed by P. viridis were determined by Atomic Absorption Spectrometry (AAS following dry acid digestion. Parameter analysis was evaluated by determining confidence limit for the obtained results. The result showed that there was a sequence of heavy-metal content in green mussels sample and laboratory rats serum, such as Ni < Cd < Cu < Zn. Keywords: heavy metals, green mussels, laboratory rats serum, AAS

  3. Riqueza, abundância e sazonalidade de Sphingidae (Lepidoptera num fragmento de Mata Atlântica de Pernambuco, Brasil Species richness, abundance and seasonality of Sphingidae (Lepidoptera in a fragment of Atlantic Rainforest of Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    José A. Duarte Júnior

    2005-09-01

    Full Text Available Na Mata Atlântica de Pernambuco, NE-Brasil (Reserva Biológica de Gurjaú, Cabo de Santo Agostinho foi realizado um levantamento de Sphingidae de dezembro de 2002 a novembro de 2003. Os esfingídeos foram coletados com luz de vapor de mercúrio durante duas noites consecutivas por mês, próximo ao novilúnio. Foram determinadas riqueza de espécies, abundância e sazonalidade. Oitenta e nove espécimes de 23 espécies em 13 gêneros foram registrados; 84% dos indivíduos foram machos. Muitas espécies foram raras e de 13 espécies foi coletado apenas um exemplar. Xylophanes loelia (Druce, 1878, X. libya (Druce, 1878, Hemeroplanes triptolemus (Cramer, 1779, Eumorpha anchemolus (Cramer, 1779, Manduca brasilensis (Jordan, 1911, M. hannibal (Cramer, 1779, Adhemarius gannascus (Stoll, 1790 e Protambulyx astygonus (Boisduval, [1875] foram registradas pela primeira vez no Nordeste do Brasil. A esfingofauna não mostrou nenhum padrão de sazonalidade, e riqueza e abundância de espécies de esfingídeos não se correlacionaram com precipitação mensal e temperatura.In the Atlantic Rainforest of Pernambuco, NE-Brazil (Reserva Biológica de Gurjaú, Cabo de Santo Agostinho a survey of Sphingidae was performed from December 2002 to November 2003. The hawkmoths were collected with vapor mercury light during two consecutive nights per months near new moon. Species richness, abundance and seasonality were determined. Eighty-nine specimens of 23 species in13 genera were recorded; 84% the individuals were males. Most species were rare and from 13 species only one exemplar was collected. Xylophanes loelia (Druce, 1878, X. libya (Druce, 1878, Hemeroplanes triptolemus (Cramer, 1779, Eumorpha anchemolus (Cramer, 1779, Manduca brasilensis (Jordan, 1911, M. hannibal (Cramer, 1779, Adhemarius gannascus (Stoll, 1790 e Protambulyx astygonus (Boisduval, [1875] were recorded for the first time in Northeastern Brazil. The sphingofauna showed no seasonal patterns and

  4. Phycopeltis kosteriana sp. n., an epiphyllous alga of the family Chroolepidaceae from Australia

    NARCIS (Netherlands)

    Cribb, A.B.

    1967-01-01

    Phycopeltis kosteriana A. B. Cribb, sp. n. — Thallus pallidus viridis, usque ad 250 μ diam., margine inaequale; filamenta prostrata, inaequaliter radiata, plerumque contigua extra margine; thallus paucis parvis foraminibus; cellulae inaequales, plerumque inaequaliter 1, 2 vel 3-furcatae,

  5. Description d’un Gyrinide nouveau

    NARCIS (Netherlands)

    Régimbart, M.

    1887-01-01

    Oralis, sat elongatus, valde convexus, corpore subtus pedibusque pallide testaceis, supra subtilissime reticulatus, niger, anguste flavolimbatus, in capite et pronoto viridi-aenescens, elytris nigris vix metallicis, in regionibus punctatis brunneotomentosis, costa discoïdali sat lata, ante apicem

  6. Two new Malaysian Lichens

    NARCIS (Netherlands)

    Groenhart, P.

    1958-01-01

    Thallus epilithieus, crustaceus, uniformis, continuus, late expansus (usque ad 1 m latus), sat crassus, griseus, laevigatus, subnitidus, pseudocyphellis punctiformibus verruculiformibusque, albis, numerosis instructus, zona marginali laete viridi cinctus, K sordide aurantiacus, Ca et KCa immutatus;

  7. Commonly Abused Drugs Charts

    Science.gov (United States)

    ... alcohol’s effects on the body . ^ Back to top Ayahuasca A hallucinogenic tea made in the Amazon from ... containing plant ( Psychotria viridis ) along with another vine ( Banisteriopsis caapi ) that contains an MAO inhibitor preventing the ...

  8. Ecology and culturing of edible bivalves in Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.; Nair, S.A.; Ansari, Z.A.; Harkantra, S.N.; Chatterji, A.; Ingole, B.S.; Roy, J.M.

    Environmental characteristics, growth rate, total production and technically feasible methods for the mass cultivation of Meretrix casta, Paphia malabarica, Villorita cyprinoides, Donax incarnatus, Perna viridis, Modiolus metcalfei and Crassostrea...

  9. Protein (Cyanobacteria): 281754 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MLYNNEILPTLTVESSPRSMNILLYKLLSLRRIEYIAVDR...YP_007115817.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  10. Protein (Cyanobacteria): 281805 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MYLILPDLYANMTYQIDERLNTSPCGFLSFADDGTIVMVN...YP_007118829.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  11. Protein (Cyanobacteria): 281806 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available se with PAS/PAC and GAF sensors Oscillatoria nigro-viridis PCC 7112 MIEESKSIKEKFGVLDSVPVGACLLQDDFVVLFWNTCLEE...YP_007117793.1 1117:4890 1150:2464 1158:318 482564:246 179408:246 diguanylate cycla

  12. Antifouling activities of marine sedentary invertebrates on some macrofoulers

    Digital Repository Service at National Institute of Oceanography (India)

    Wilsanand, V.; Wagh, A.B.; Bapuji, M.

    that the transient presence of active extracts did not cause irreversible damage to P. viridis. The results indicate the possible potentialities of these extracts as natural non toxic antifouling agents....

  13. Improving the Recreational Fishery on Malmstrom Air Force Base

    Science.gov (United States)

    2010-08-01

    24 miles to the south and into Alberta, Canada. Stratigraphic units important to the framework of the region surrounding Malmstrom AFB range in... ranging from standing water (Pow Wow Pond) to intermittent streambeds that flow only after heavy downpour events (USAF 2008). In most cases, these were...viridis viridis), plains garter snake ( Thamnophis radix), and leopard frog (Rana pipiens) were recorded. Six western painted turtles (Chrysemys picta

  14. Assessinent of streptomycesgriseo viridis (mycostop as a biocontrol agent for fusarium oxysporum f. sp. dianthiin two cultivars of standard carnation under commercial conditions Evaluación de Streptomyces griseoviridis (MYCOSTOP en el control de Fusarium oxysporum f.sp. dianthi, en dos variedades de clavel estándar bajo condiciones comerciales

    Directory of Open Access Journals (Sweden)

    Ortega Luis Miguel

    1994-06-01

    Full Text Available The research was carried out in a commercial farm, located in Madrid, Cundinamarca. The purpose of the study was to established the rate and irequency of application of Streptomyces griseoviridis (Mycostop in the control of vascular wilt of carnation caused by Fusarium oxysporum f.sp. dianthi. Two experiments were conducted to compare three rates of application (0,025;0,05 and 0,01 g/m2 and
    three intervals of application (1,2 and 4 weeks of
    Mycostop, in two standard carnation varieties. Disease
    progress data were analized by comparing their godness of fit to Gompertz and Monomolecular epidemiological models. By using the simpler linear regression model, the rate of inlection (k and the coefficient of determination (Al were calculated.
    Inlection rates were subjected to analysis of variance.
    The results showed no satislactory control of the disease. Rates and frecuencies of applícation of Streptomyces griseoviridis (Mycostop did not show appreciable differences. Epidemiologically, "k" values were highly homogeneous among the different Mycostop treatments. Streptomyces
    griseoviridisis highly dependent upon culture media
    pH, and it grows only at a pH 016,4 or higher, with an optimal growth at a pH 7,0. No relation was detected between growth of the biocontrol organism and levels of electrical conductivity.La investigación se realizó en un cultivo comercial de clavel localizado en el municipio de Madrid (Cundinamarca, con el objetivo de determinar la dosis y la frecuencia de aplicación de Streptomyces griseoviridis (Mycostop en el control del
    marchitamiento vascular ocasionado por Fusarium oxysporom lsp. dianthi. En el campo, se realizaron dos experimentos simultáneos, para probar diferentes dosis (0,025; 0,05 y 0,1 g/m2 y frecuencias (1, 2 y 4 semanas de aplicación de
    Streptomyces griseoviridis Mycostop en dos variedades de clavel estándar. El análisis estadístico consistió en utilizar algunos modelos epidemiológicos de predicción de la enfermedad, con el fin de observar su progreso en los dilerentes tratamientos. Posteriormente, mediante un análisis
    de regresión lineal simple, se calculó la tasa de infección (k y el coeficiente de determinación (R2, el cual indicó el modelo que más se ajustó a la realidad. Por medio de un análisis de varianza, se compararon las tasas de infección. Los resultados de los experimentos no fueron satislactorios en el
    control de la entermedady no se encontraron diferencias signilicativas entre las dosis y las frecuencias de aplicación de Streptomyces gríseovirídís (Mycostop utilizadas. Un
    comportamiento epidemiológico estadísticamente homogéneo se observó en las curvas de predicción de la enfermedad por bloque. Streptomyces griseoviridises muy dependiente de las condiciones de pH del medio de cultivo, pues, sólo se desarrolló a partir de un pH de 6,4 y con un óptimo
    crecimiento, a 7,0. No se observó una relación entre el desarrollo del organismo y la conductividad eléctrica.

  15. Nuevos registros para la fauna de Saturniidae (Lepidoptera en Argentina New records for the fauna of Saturniidae (Lepidoptera from Argentina

    Directory of Open Access Journals (Sweden)

    Adriana I. Zapata

    2012-12-01

    Full Text Available Se brindan nuevas citas de 17 especies de Saturniidae para la Argentina. Estos registros corresponden a las subfamilias: Arsenurinae [Arsenura xanthopus (Walker y Titaea tamerlan (Maassen]; Ceratocampinae: [Almeidella approximans (Schaus, Cicia nettia (Schaus, Citheronia aroa Schaus, Citheronia maureillei Wolfe & Herbin, Citioica anthonilis (Herrich-Schäffer, Eacles ducalis (Walker, Othorene cadmus (Herrich-Schäffer, Othorene purpurascens (Schaus y Ptiloscola photophila (Rothschild] y Hemileucinae [Cerodirphia brunnea (Draudt, Dirphia curitiba Draudt, Hirpida nigrolinea (Druce, Hylesia ebalus (Cramer, Leucanella gibbosa (Conte y Molippa strigosa (Maassen & Weyding].New records are provided for 17 species of Saturniidae from Argentina. The new records correpond to the following subfamilies: Arsenurinae [Arsenura xanthopus (Walker and Titaea tamerlan (Maassen]; Ceratocampinae [Almeidella approximans (Schaus, Cicia nettia (Schaus, Citheronia aroa Schaus, Citheronia maureillei Wolfe & Herbin, Citioica anthonilis (Herrich-Schäffer, Eacles ducalis (Walker, Othorene cadmus (Herrich-Schäffer, Othorene purpurascens (Schaus and Ptiloscola photophila (Rothschild]; and Hemileucinae [Cerodirphia brunnea (Draudt, Dirphia curitiba Draudt, Hirpida nigrolinea (Druce, Hylesia ebalus (Cramer, Leucanella gibbosa (Conte and Molippa strigosa (Maassen & Weyding].

  16. Pyrrhopyginae: gêneros novos e revalidados (Lepidoptera, Hesperiidae Pyrrhopyginae: new and revalidated genera (Lepidoptera, Hespe-riidae

    Directory of Open Access Journals (Sweden)

    Olaf H.H. Mielke

    2002-03-01

    Full Text Available The following new genera with their type-species are described: Oxynetrini: Cyclopyge gen. n. - type-species: Pyrrhopyge roscius Hopffer, 1874; Pyrrhopygini: Arnysoria gen. n. - type species: Pyrrhopyga [sic] galgala Hewitson, 1866, Chalypyge gen. n. - type species: Pyrrhopyga [sic] chalybea Scudder, 1872, Creonpyge gen. n. - type species: Pyrrhopyga [sic] creon H. Druce, 1874, Cyanopyge gen. n. - type species: Pyrrhopyge sangaris Skinner, 1921, Gunayan gen. n. - type species: Pyrrhopyga [sic] rhacia Hewitson, 1875, Jonaspyge gen. n. - type species: Pyrrhopyga [sic] Jonas C. Felder & R. Felder, 1859, Melanopyge gen. n. - type species: Pyrrhopyga [sic] maculosa Hewitson, 1866, Mimardaris gen. n. - type species: Pyrrhopyga [sic] sela Hewitson, 1866, Mysarbia gen. n. - type species: Pyrrhopyge sejanus Hopffer, 1874, Ochropyge gen. n. - type species: Pyrrhopyge ruficauda Hayward, 1932. Apyrrothrix Lindsey, 1921 and Yanguna Watson, 1893 are revalidated. The following are revalidated combinations: Apyrrothrix araxes (Hewitson, 1867, Apyrrothrix arizonae (Godman & Salvin, 1893, Yanguna cometes cometes (Cramer, 1770, Yanguna cometes cometides Mabille & Boullet, 1908, Yanguna cometes staudingeri (Plštz, 1879, Yanguna cosyra (H. Druce, 1875, Yanguna spatlosa spatlosa (Hewitson, 1871, Yanguna spatlosa aspllos Mabille & Boullet, 1908, Yanguna spatlosa mabillei H.H. Druce, 1909, Yanguna tetricus Bell, 1931, Yanguna thelersa (Hewitson, 1866, The following are new combinations: Cyclopyge roscius roscius (Hopffer, 1874, Cyclopyge roscius flavomaculata (Bell, 1937, Cyclopyge roscius iphimedia (Plštz, 1886, Yanguna erebus (Plštz, 1879, Gunayan rhacia (Hewitson, 1875, Gunayan rubrlcollts (Sepp, [1841], Gunayan timaeus (Bell, 1931, Chalypyge chalybea chalybea (Scudder, 1872, Chalypyge chalybea chlorts (Evans, 1951, Chalypyge zereda zereda (Hewitson, 1866, Chalypyge zereda hygieia (C. Felder & R. Felder, 1867, Chalypyge zereda insana (Staudinger, 1876, Chalypyge

  17. Canopy-forming seaweeds in urchin-dominated systems in eastern Canada: structuring forces or simple prey for keystone grazers?

    Directory of Open Access Journals (Sweden)

    Caitlin Blain

    Full Text Available Models of benthic community dynamics for the extensively studied, shallow rocky ecosystems in eastern Canada emphasize kelp-urchin interactions. These models may bias the perception of factors and processes that structure communities, for they largely overlook the possible contribution of other seaweeds to ecosystem resilience. We examined the persistence of the annual, acidic (H2SO4, brown seaweed Desmarestia viridis in urchin barrens at two sites in Newfoundland (Canada throughout an entire growth season (February to October. We also compared changes in epifaunal assemblages in D. viridis and other conspicuous canopy-forming seaweeds, the non-acidic conspecific Desmarestia aculeata and kelp Agarum clathratum. We show that D. viridis can form large canopies within the 2-to-8 m depth range that represent a transient community state termed "Desmarestia bed". The annual resurgence of Desmarestia beds and continuous occurrence of D. aculeata and A. clathratum, create biological structure for major recruitment pulses in invertebrate and fish assemblages (e.g. from quasi-absent gastropods to >150,000 recruits kg(-1 D. viridis. Many of these pulses phase with temperature-driven mass release of acid to the environment and die-off in D. viridis. We demonstrate experimentally that the chemical makeup of D. viridis and A. clathratum helps retard urchin grazing compared to D. aculeata and the highly consumed kelp Alaria esculenta. In light of our findings and related studies, we propose fundamental changes to the study of community shifts in shallow, rocky ecosystems in eastern Canada. In particular, we advocate the need to regard certain canopy-forming seaweeds as structuring forces interfering with top-down processes, rather than simple prey for keystone grazers. We also propose a novel, empirical model of ecological interactions for D. viridis. Overall, our study underscores the importance of studying organisms together with cross-scale environmental

  18. Canopy-Forming Seaweeds in Urchin-Dominated Systems in Eastern Canada: Structuring Forces or Simple Prey for Keystone Grazers?

    Science.gov (United States)

    Blain, Caitlin; Gagnon, Patrick

    2014-01-01

    Models of benthic community dynamics for the extensively studied, shallow rocky ecosystems in eastern Canada emphasize kelp-urchin interactions. These models may bias the perception of factors and processes that structure communities, for they largely overlook the possible contribution of other seaweeds to ecosystem resilience. We examined the persistence of the annual, acidic (H2SO4), brown seaweed Desmarestia viridis in urchin barrens at two sites in Newfoundland (Canada) throughout an entire growth season (February to October). We also compared changes in epifaunal assemblages in D. viridis and other conspicuous canopy-forming seaweeds, the non-acidic conspecific Desmarestia aculeata and kelp Agarum clathratum. We show that D. viridis can form large canopies within the 2-to-8 m depth range that represent a transient community state termed “Desmarestia bed”. The annual resurgence of Desmarestia beds and continuous occurrence of D. aculeata and A. clathratum, create biological structure for major recruitment pulses in invertebrate and fish assemblages (e.g. from quasi-absent gastropods to >150 000 recruits kg−1 D. viridis). Many of these pulses phase with temperature-driven mass release of acid to the environment and die-off in D. viridis. We demonstrate experimentally that the chemical makeup of D. viridis and A. clathratum helps retard urchin grazing compared to D. aculeata and the highly consumed kelp Alaria esculenta. In light of our findings and related studies, we propose fundamental changes to the study of community shifts in shallow, rocky ecosystems in eastern Canada. In particular, we advocate the need to regard certain canopy-forming seaweeds as structuring forces interfering with top-down processes, rather than simple prey for keystone grazers. We also propose a novel, empirical model of ecological interactions for D. viridis. Overall, our study underscores the importance of studying organisms together with cross-scale environmental variability

  19. Individual specialization to non-optimal hosts in a polyphagous marine invertebrate herbivore.

    Science.gov (United States)

    Baumgartner, Finn A; Pavia, Henrik; Toth, Gunilla B

    2014-01-01

    Factors determining the degree of dietary generalism versus specialism are central in ecology. Species that are generalists at the population level may in fact be composed of specialized individuals. The optimal diet theory assumes that individuals choose diets that maximize fitness, and individual specialization may occur if individuals' ability to locate, recognize, and handle different food types differ. We investigate if individuals of the marine herbivorous slug Elysia viridis, which co-occur at different densities on several green macroalgal species in the field, are specialized to different algal hosts. Individual slugs were collected from three original algal host species (Cladophora sericea, Cladophora rupestris and Codium fragile) in the field, and short-term habitat choice and consumption, as well as long-term growth (proxy for fitness), on four algal diet species (the original algal host species and Chaetomorpha melagonium) were studied in laboratory experiments. Nutritional (protein, nitrogen, and carbon content) and morphological (dry weight, and cell/utricle volume) algal traits were also measured to investigate if they correlated with the growth value of the different algal diets. E. viridis individuals tended to choose and consume algal species that were similar to their original algal host. Long-term growth of E. viridis, however, was mostly independent of original algal host, as all individuals reached a larger size on the non-host C. melagonium. E. viridis growth was positively correlated to algal cell/utricle volume but not to any of the other measured algal traits. Because E. viridis feeds by piercing individual algal cells, the results indicate that slugs may receive more cytoplasm, and thus more energy per unit time, on algal species with large cells/utricles. We conclude that E. viridis individuals are specialized on different hosts, but host choice in natural E. viridis populations is not determined by the energetic value of seaweed diets

  20. Individual specialization to non-optimal hosts in a polyphagous marine invertebrate herbivore.

    Directory of Open Access Journals (Sweden)

    Finn A Baumgartner

    Full Text Available Factors determining the degree of dietary generalism versus specialism are central in ecology. Species that are generalists at the population level may in fact be composed of specialized individuals. The optimal diet theory assumes that individuals choose diets that maximize fitness, and individual specialization may occur if individuals' ability to locate, recognize, and handle different food types differ. We investigate if individuals of the marine herbivorous slug Elysia viridis, which co-occur at different densities on several green macroalgal species in the field, are specialized to different algal hosts. Individual slugs were collected from three original algal host species (Cladophora sericea, Cladophora rupestris and Codium fragile in the field, and short-term habitat choice and consumption, as well as long-term growth (proxy for fitness, on four algal diet species (the original algal host species and Chaetomorpha melagonium were studied in laboratory experiments. Nutritional (protein, nitrogen, and carbon content and morphological (dry weight, and cell/utricle volume algal traits were also measured to investigate if they correlated with the growth value of the different algal diets. E. viridis individuals tended to choose and consume algal species that were similar to their original algal host. Long-term growth of E. viridis, however, was mostly independent of original algal host, as all individuals reached a larger size on the non-host C. melagonium. E. viridis growth was positively correlated to algal cell/utricle volume but not to any of the other measured algal traits. Because E. viridis feeds by piercing individual algal cells, the results indicate that slugs may receive more cytoplasm, and thus more energy per unit time, on algal species with large cells/utricles. We conclude that E. viridis individuals are specialized on different hosts, but host choice in natural E. viridis populations is not determined by the energetic value of

  1. Analysis of polyphenolic antioxidants from the fruits of three pouteria species by selected ion monitoring liquid chromatography-mass spectrometry.

    Science.gov (United States)

    Ma, Jun; Yang, Hui; Basile, Margaret J; Kennelly, Edward J

    2004-09-22

    Pouteria campechiana, Pouteria sapota, and Pouteria viridis are tropical plants in the Sapotaceae family that bear edible fruits. The fresh fruits of these three Pouteria species were each extracted, and activity-guided fractionations were performed to identify the antioxidant constituents. Seven polyphenolic antioxidants, gallic acid (1), (+)-gallocatechin (2), (+)-catechin (3), (-)-epicatechin (4), dihydromyricetin (5), (+)-catechin-3-O-gallate (6), and myricitrin (7), were isolated and identified. Extracts of the three Pouteria fruits were analyzed by a selected ion monitoring liquid chromatography-mass spectrometry method to quantify their polyphenolic antioxidants. The highest level of the seven measured polyphenols was found in P. sapota, the second highest in P. viridis, and the lowest in P. campechiana. The levels of the seven polyphenols corresponded with the results of the 1,1-diphenyl-2-picrylhydrazyl assay, by which P. sapota had the highest antioxidant activity, P. viridis the second highest, and P. campechiana the lowest.

  2. Spatial distribution-patterns on the Northern Dobrogean mainland ( of the species belonging to ”green lizards” group of the Lacerta genus

    Directory of Open Access Journals (Sweden)

    TÖRÖK Zsolt

    2009-09-01

    Full Text Available Based on the results of field investigations carried out in 1994 – 2008 period, the author established the general distributional patterns in the northern part of the Dobrogean mainland of three lizard species. The Sand Lizards (Lacerta agilis populates habitats with linear shape, the species being present along river valleys and some roads. The Balkan Green Lizards (L. trilineata and the Green Lizards (L. viridis were recorded mostly nearby or inside the forests (or plantations. In case of L. trilineata and L. viridis there is quite obvious the spatial segregation: in areas where the two species were present, the Balkan Green Lizard (L. trilineata occurs mostly at lower altitudes, meanwhile the Green Lizard (L. viridis was more frequently present at higher altitudes.

  3. [Spatial distribution pattern and allometric growth of three common species on moving sand dunes in Horqin Sandy Land, China].

    Science.gov (United States)

    Jia, Mei-yu; Li, Xue-hua; Oh, Choong-hyeon; Park, Hong-chul; Miao, Chun-ping; Han, Xu

    2015-10-01

    Research on fine scale pattern and characteristics of allometric growth could contribute to better understanding plants' adaptation in moving sandy dunes. The abundance, height and biomass of 3 species Agriophilum aquarrosum, Corispermum candelabrum and Setaria viridis in twenty-eight 1 m x 1 m quadrats of Horqin Sandy Land were identified, mapped and described. The nearest neighbor method and O-ring O(r) function analysis were applied to analyze the spatial patterns. The results showed that the individual spatial pattern was mainly aggregated in 1 m x 1 m quadrat at community level but mainly random at population level. At 0-50 cm individual distance scale, both intraspecific and interspecific relationship were facilitation and aggregated distribution occurred at some scales and varied with increasing plant abundance in 1 m x 1 m quadrat. In 0-40 cm, the aggregated distribution of S. viridis and A. aquarrosum increased obviously; in 10-20 cm, both intraspecific and interspecific aggregation increased; in 10-30 cm, the occurrence possibility of positive correlations between S. viridis and A. aquarrosum, S. viridis and C. candelabrum all increased; in 40-50 cm, the possibility of positive correlations between A. squarrosum and S. viridis, A. squarrosum and C. candelabrum all increased. Research on the three species components indicated that the growth rate of above-ground was faster than that of underground. S. viridis had the highest ratio of under-ground biomass to above-ground biomass but its nutritional organs' biomass ratio was medium. C. candelabrum allocated more biomass to propagative organs and stem, but A. squarrosum allocated more biomass to nutritional organs. Based on the spatial distribution and allometric characteristics, the three common species in moving sand dunes preferred r strategy in their life history.

  4. Dicty_cDB: Contig-U08145-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 50 1e-04 AF021822_1( AF021822 |pid:none) Scaptodrosophila lebanonensis supe... ...emonia viridis copper/zinc super... 49 6e-04 AF021824_1( AF021824 |pid:none) Hirtodrosophila pictiventris su

  5. Effect of manures on biomass production and pharmacobiochemical properties of some greens.

    Science.gov (United States)

    Banu, S Naseer; Sivakumar, A; Subramanian, M S

    2003-10-01

    The present paper deals with the study of biomass production of manures in the greens such as Amaranthus polygamus and Amaranthus viridis of the family Amaranthaceae and Spinacea oleracea of the family Chenopodiaceae. The medicinal uses and pharmaco - phytochemical analysis were also carried out for the plant species which are widely used as greens.

  6. EFFECT OF MANURES ON BIOMASS PRODUCTION AND PHARMACOBIOCHEMICAL PROPERTIES OF SOME GREENS

    OpenAIRE

    Banu, S. Naseer; Sivakumar, A.; Subramanian, M. S.

    2003-01-01

    The present paper deals with the study of biomass production of manures in the greens such as Amaranthus polygamus and Amaranthus viridis of the family Amaranthaceae and Spinacea oleracea of the family Chenopodiaceae. The medicinal uses and pharmaco – phytochemical analysis were also carried out for the plant species which are widely used as greens.

  7. Variability of Venom-Neutralizing Properties of Serum from Snakes of the Colubrid Genus Lampropeltis

    Science.gov (United States)

    1992-01-01

    chick in the terciopelo Bothrops asper venom by blood se- zootoxicologic studies on venoms. Copeia 1959: rum of the colubnd snake Cletie dIeia. Toxicon 20...effect of Bothrops jararaca and faded rattlesnake (Crotalus viridis concolor) venom: Waglerophis merremii snake plasma on the coagu- lethal toxicity and

  8. Review of the West Indian genus Monotalla Bechyné (Coleoptera, Chrysomelidae, Galerucinae, Alticini) with description of five new species

    Science.gov (United States)

    Konstantinov, Alexander S.; Linzmeier, Adelita M.; Clark, Shawn M.; Ivie, Michael A.

    2015-01-01

    Abstract The West Indian genus Monotalla Bechyné is reviewed, redescribed and illustrated. Five new species are added: Monotalla dominica sp. n. (Dominica); Monotalla lecticofolia sp. n. (St. Lucia); Monotalla maierae sp. n. (St. Lucia); Monotalla obrienorum sp. n. (Grenada); and Monotalla viridis sp. n. (St. Lucia). A key to Monotalla species is provided. PMID:26052242

  9. On a new species of Lanistes

    NARCIS (Netherlands)

    Schepman, M.M.

    1891-01-01

    Testa sinistrorsa, anguste umbilicata, conico-globosa, aut flavido- aut viridi-olivacea, semper fasciis spiralibus purpureis angustis in anfr. ultimo picta; spira scalaris, magis minusve conica; apex obtusus. Anfr. 5½, superne vel acute angulati vel carinati, supra plani, carina interdum linea

  10. Host species and habitat affect nodulation by specific Frankia genotypes in two species of Alnus in interior Alaska

    Science.gov (United States)

    Michael Damon Anderson; Roger W. Ruess; David D. Myrold; D. Lee. Taylor

    2009-01-01

    This study examined the genetic structure (nifD-K spacer RFLP haplotypes) of Frankia assemblages symbiotic with two species of Alnus (A. tenuifolia and A. viridis) in four successional habitats in interior Alaska. We used one habitat in which both hosts occurred to...

  11. Egg numbers and fecundity traits in nine species of Mantella poison ...

    African Journals Online (AJOL)

    The body size and number of eggs in dissected females were analysed in nine species of the Malagasy frog genus Mantella basing upon preserved specimens. These species were distinguished in terms of habitat and grouped as 'grassland species' (included M. betsileo, M. expectata, M. viridis), and 'rainforest species' ...

  12. Macrofauna Settlement on Pearl Oyster Collectors in Kenya ...

    African Journals Online (AJOL)

    was higher during the northeast monsoon season than the southeast monsoon season. Ascidiians and Sabellidae were significantly more abundant on collectors during the southeast monsoon season. A few bivalve species of commercial value including: P. penguin, Perna viridis and. Anadara antiquata also settled on ...

  13. Volume 9 No. 9 December 2009 POTENTIAL IMPACT ON ...

    African Journals Online (AJOL)

    2009-12-09

    Dec 9, 2009 ... Western Tree- hyrax. Long-tailed/Tree. Pangolin. Dendrohyrax Dorsalis. Manis tricuspis. T. E. C. S. 11. 2. REPTILIA. Reptila. Nile croccodilus. Monitor lizard. Water moccasin. Rock python. Green mamba. Black cobra. Hingeback. Croccodilus niloticus. Veranus niloticus. Python sebae. Dendrospis viridis.

  14. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution.

    Science.gov (United States)

    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vânia Helena

    2015-01-01

    Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapping of morphological characteristics. Cytogenetic studies in Setaria can be useful for taxonomic and evolutionary studies as well as for applications in breeding. Thus, this study is aimed at locating 45S and 5S rDNA sites through fluorescent in situ hybridization (FISH) in Setaria italica, Setaria viridis and Setaria sphacelata (Schumacher, 1827) Stapf, Hubbard, Moss, 1929 cultivars (cvs.) Narok and Nandi. Setaria italica and Setaria viridis have 18 chromosomes with karyotype formulas 6m + 3sm and 9m, respectively. The location of 45S and 5S rDNA for these species was in different chromosome pairs among the evaluated species. Setaria viridis presented a more symmetrical karyotype, strengthening the ancestral relationship with Setaria italica. Setaria sphacelata cvs. Narok and Nandi have 36 chromosomes, and karyotype formulas 11m+7sm and 16m+2sm, respectively. The 45S rDNA signals for both cultivars were also observed in distinct chromosome pairs; however chromosomes bearing 5S rDNA are conserved. Karyotypic variations found among the studied species are evidence of chromosomal rearrangements.

  15. Browse Title Index

    African Journals Online (AJOL)

    Vol 7, No 17 (2008), Anti-emetic activity of Grewia lasiodiscus root extract and fractions, Abstract PDF. AY Tijani, SE Okhale, FE Oga, SZ Tags, OA Salawu, BA Chindo. Vol 13, No 27 (2014), Antifouling potential of seaweed, sponge and cashew nut oil extracts against biofilm bacteria and green mussel Perna viridis from ...

  16. Observations on the activity patterns of the lesser yellow house bat ...

    African Journals Online (AJOL)

    lesser yellow house bat, Scotophilus viridis. F.P.D. Cotterill c/o Department of Zoology, University of Cape Town,. Cape Town. S.R. Giddings·. Department of Zoology, University of Pretoria, Pretoria,. 0002 Republic of South Africa. Received 10 June 1986; accepted 23 July 1986. The activity pattems of the lesser yellow ...

  17. On a new species of toad from southern Morocco

    NARCIS (Netherlands)

    Hoogmoed, M.S.

    1972-01-01

    A new species of toad, related with Bufo calamita Laurenti and B. viridis Laurenti, is described from the southern part of Morocco. Combining the data of the available specimens with literature records it was established that the new species probably ranges from the Sous valley southwards to Cape

  18. The placenta and foetal membranes of the lesser yellow house bat ...

    African Journals Online (AJOL)

    1988-06-05

    Jun 5, 1988 ... Scotophilus viridis (Vespertilionidae) in Kruger National. Park, South Africa. J. Mammal. 66(3): 461-468. FENTON, M.B. & RAUTENBACH, I.L. 1986. A comparison of the roosting and foraging behaviour of three species of African insectivorous bats. (Rhinolophidae, Vespertilionidae, and Molossidae). Can.

  19. Effects of sand burial on the survival and physiology of three ...

    African Journals Online (AJOL)

    Corispermum macrocarpum, Setaria viridis and Agriophyllum squarrosum are dominant psammophytes with strong environmental adaptability in Horqin Sandy Land, a typical agro-pastoral ecotone with frequent and intense sand activity in Northern China. We studied the survival rates, activity of antioxidant enzyme ...

  20. Palynomorphs and floral bloom as taxonomic characters in some ...

    African Journals Online (AJOL)

    Fresh flowers of five species of Amaranthus were studied and documented in detail using light microscope to examine their morphology and pollen characteristics in relation to taxonomy. These species include Amaranthus spinosus, A. viridis, A. hybridus, A. australis and A. tricolor. The species showed close relationship in ...

  1. Phytoplankton Community Responses in A Perturbed Tropical ...

    African Journals Online (AJOL)

    Euglena viridis was the only member of the class Euglenophyceae recorded in the river and it occurred only sporadically in station 1. The low fauna diversity experienced in station 2 throughout the period of sampling showed strong evidence of impact arising from the abattoir waste discharge and heavy human activities at ...

  2. Conditional Reduction of Predation Risk Associated with a Facultative Symbiont in an Insect.

    Directory of Open Access Journals (Sweden)

    Sarah Polin

    Full Text Available Symbionts are widespread among eukaryotes and their impacts on the ecology and evolution of their hosts are meaningful. Most insects harbour obligate and facultative symbiotic bacteria that can influence their phenotype. In the pea aphid Acyrthosiphon pisum, an astounding symbiotic-mediated phenotype has been recently observed: when infected with the symbiotic bacteria Rickettsiella viridis, young red aphid larvae become greener at adulthood and even darker green when co-infected with Rickettsiella viridis and Hamiltonella defensa. As body colour affects the susceptibility towards natural enemies in aphids, the influence of the colour change due to these facultative symbionts on the host survival in presence of predators was tested. Our results suggested that the Rickettsiella viridis infection may impact positively host survival by reducing predation risk. Due to results from uninfected aphids (i.e., more green ones attacked, the main assumption is that this symbiotic infection would deter the predatory ladybird feeding by reducing the profitability of their hosts rather than decreasing host detection through body colour change. Aphids co-infected with Rickettsiella viridis and Hamiltonella defensa were, however, more exposed to predation suggesting an ecological cost associated with multiple infections. The underlying mechanisms and ecological consequences of these symbiotic effects are discussed.

  3. Sidi Saâd reservoir

    African Journals Online (AJOL)

    DR. NJ TONUKARI

    2012-01-12

    Jan 12, 2012 ... with environmental factors in a semi arid area: Sidi. Saâd reservoir .... between changes in environmental parameters, biological factors and ..... Dinophyceae. Copepoda. Anabaena sp. Gonyaulax sp. Acanthocyclops robustus Acanthocyclops viridis. Chroococcus sp. Gonyaulax spinifera. Gloeothece sp.

  4. William Burroughs: Sailor of the Soul.

    Science.gov (United States)

    Lees, Andrew J

    2017-01-01

    In 1953, William Seward Burroughs made several important and largely unrecognized discoveries relating to the composition and clinical pharmacological effects of the hallucinogenic plant potion known as yagé or ayahuasca. Illustrations of Burroughs' voucher sample of Psychotria viridis and his letter to the father of modern ethnobotany, Richard Evans Schultes, are published here for the very first time.

  5. Antifouling potential of seaweed, sponge and cashew nut oil extracts ...

    African Journals Online (AJOL)

    The seaweeds, Sargassum wightii, Ulva lactuca; sponge Desmopsongiae sp., and cashew nut oil extracts were tested in vitro against ten marine fouling bacteria isolated from test panels and the green mussel Perna viridis. The biofilm bacteria growth was inhibited by methanol extracts of the seaweeds S. wightii, U. lactuca, ...

  6. potential antagonistic fungal species from ethiopia for biological ...

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Ten commercial products of these three species were developed for controlling diseases on different crops (Frevel et al., 1998). T. harzianum and T. viridi were reported as biocontrol agent for chocolate spot of grape, apple and strawberry caused by B. cinerea. (Sutton et al., 1997; Hjeljord et al., 2001). Other fungi prevalent ...

  7. The status of Vespertilio borbonicus E. Geoffroy, 1803 (Chiroptera: Vespertilionidae)

    NARCIS (Netherlands)

    Hill, J.E.

    1980-01-01

    The taxonomic history of Scotophilus borbonicus (E. Geoffroy, 1803) from Réunion Island is reviewed and summarised, with the designation of a lectotype. The insular form that it represents is considered conspecific with the small Scotophilus viridis (Peters, 1852) of southern Africa. As a result,

  8. Antiproliferative heparin (glycosaminoglycans) isolated from giant ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-05-18

    May 18, 2009 ... Heparin was isolated from two bivalve mollusks, Tridacna maxima (giant clam) and Perna viridis (green mussel). The isolated heparin was quantified in crude as well as purified samples and they were estimated as 2.72 and 2.2 g/kg (in crude) and 260 and 248 mg/g (in purified samples) in T. maxima and.

  9. Browse Title Index

    African Journals Online (AJOL)

    Vol 15, No 8 (2016), Antiproliferative activity of protein extracts from the black clam (Chione fluctifraga) on human cervical and breast cancer cell lines, Abstract PDF ... Vol 8, No 10 (2009), Antiproliferative heparin (glycosaminoglycans) isolated from giant clam (Tridacna maxima) and green mussel (Perna viridis), Abstract ...

  10. A note on scavenging behaviour of adult Hermann’s tortoise (Testudo hermanni

    Directory of Open Access Journals (Sweden)

    Nikolić, M.

    2016-09-01

    Full Text Available Report of the first observation of scavenging behaviour in the population of Testudo hermanni boettgeri that has been monitored for six years in the village Kunovica near the city of Niš in Serbia. On 31 May 2015 at 10:18 a.m., the adult tortoise was observed while eating a dead European green lizard (Lacerta viridis.

  11. Parasitic helminths of reptiles (Reptilia) in South Moravia (Czech Republic).

    Science.gov (United States)

    Borkovcová, M; Kopriva, J

    2005-01-01

    An helminthological investigation of 104 reptile species was carried out in south Moravia (Czech Republic). We examined Lacerta viridis, L. agilis, Anguis fragilis, Natrix natrix, Coronella austriaca and Vipera berus. Twelve species of parasites were found. Among these, Nematoda occurred most often, followed by Trematoda and Cestoda. No Acanthocephala were detected.

  12. 78 FR 49251 - Notice of Decision To Authorize the Importation of Fresh Pitayas and Pomegranates From Mexico...

    Science.gov (United States)

    2013-08-13

    ... significance by Mexico's NPPO: Aleurodicus disperses, Ceroplastes rubens, Coccus viridis, Maconellicoccus... . The pests A. disperses, C. rubens, M. hirsutus, and D. neobrevipes are on the regulated pest list for..., actionable organisms. We believe it is appropriate that A. disperses, C. rubens, M. hirsutus, and D...

  13. Uptake and loss of mercury, cadmium and lead in marine organisms

    Digital Repository Service at National Institute of Oceanography (India)

    Kureishy, T.W.; DeSilva, C.

    Experiments were conducted on Tilapia mosambica, Perna viridis and Villorita cyprinoides on the uptake and loss of Hg, Cd and Pb in various tissues of these organisms. Hg was found to be highly toxic to the clams as compared to the fish and mussels...

  14. A Unique Model Platform for C4 Plant Systems and Synthetic Biology

    Science.gov (United States)

    2015-12-10

    mediated transformation of Setaria viridis. Agrobacterium tumefaciens strain GV3101 was transformed by electroporation with pBI 121. Agrobacterium ... agrobacterium mediated transformation 15. SUBJECT TERMS 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT Same as Report (SAR) 18. NUMBER OF...successful agrobacterium mediated transformation 15. SUBJECT TERMS synthetic biology, Systems Biology 16. SECURITY CLASSIFICATION OF

  15. Assessment of uniqueness of bufoviridis (Amphibia: Anura populations in terms of rational ecological ethics

    Directory of Open Access Journals (Sweden)

    M. O. Kravchenko

    2005-12-01

    Full Text Available Substantive provisions of rational environmental ethics are stated. This concept presumes to compare a level of uniqueness of different objects, which forms the establishment for giving the ethical value. The developed approach is used for comparison of 26 populations of Bufo viridis Laurenti, 1768 from Left-bank forest-steppe of Ukraine.

  16. Survival and bioturbation effects of common marine macrofauna in coastal soils newly flooded with seawater

    DEFF Research Database (Denmark)

    Valdemarsen, Thomas Bruun; Quintana, Cintia Organo; Thorsen, Sandra Walløe

    Low-lying coastal soils are at risk of being permanently flooded due to global sea level rise, but how will these areas develop as habitat for marine species? We conducted an experiment to evaluate the habitat quality of flooded soils for common marine polychaetes (Marenzelleria viridis, Nereis d...

  17. [Cadmium bioaccumulation and its toxicity in Babylonia areolata under different nutritional status].

    Science.gov (United States)

    Xue, Ming; Ke, Cai-Huan

    2012-07-01

    An indoor exposure experiment with juvenile Babylonia areolata was conducted to study its survival, growth, cadmium (Cd) accumulation, metallothionein (MT) induction, and glycogen content as well as the DNA integrity of hepatopancreas tissue. The juveniles were starved or fed with mussel (Perna viridis) or clamworm (Perinereis aibuhitensis), and exposed to 50 microg x L(-1) of Cd2+ for 10 weeks. Prolonged starvation and simultaneous exposure to Cd reduced the survival rate of B. areolata, and its glycogen was mobilized in great extent. Feeding with P. viridis or P. aibuhitensis helped the B. areolata to combat Cd toxicity and lessen mortality. After exposed to Cd, the damage of the DNA integrity of hepatopancreas tissue for the B. areolata fed with P. viridis or P. aibuhitensis could be recovered with time, but not for the starved B. areolata. Prolonged starvation caused tissue atrophy and led to Cd accumulation and MT increase, while feeding with P. viridis or P. aibuhitensis increased the B. areolata mass and lowered the Cd accumulation and MT level because of the tissue dilution effect. The B. areolata fed with P. viridis had better growth and lower Cd content than that fed with P. aibuhitensis. This study indicated that starvation intensified the toxicity of Cd to B. areolata, while prey type had significant effects on the growth rate of the B. areolata and indirectly affected its Cd accumulation, MT induction, and glycogen consumption. It was suggested that when using gastropods such as B. areolata as the indicator species to monitor marine environmental pollution, it would be necessary to consider the effects of habitat ecological data including food richness and prey type. Moreover, in the high-density cultivation of B. areolata in factory, rational feeding and periodic measurement of Cd concentration in seawater should be made.

  18. Detection of Borrelia burgdorferi sensu lato in lizards and their ticks from Hungary.

    Science.gov (United States)

    Földvári, Gábor; Rigó, Krisztina; Majláthová, Viktória; Majláth, Igor; Farkas, Róbert; Pet'ko, Branislav

    2009-06-01

    To investigate the involvement of lizard species in the natural cycle of Borrelia burgdorferi sensu lato (s.l.) in Hungary, a total of 186 reptiles belonging to three species--126 green lizards (Lacerta viridis), 40 Balkan wall lizards (Podarcis taurica), and 20 sand lizards (Lacerta agilis)--were captured in 2007 and 2008. All ticks removed from the lizards were Ixodes ricinus, either larvae (324/472; 68.6%) or nymphs (148/472; 31.4%). More than half (66/126; 52.4%) of L. viridis individuals were infested, and the prevalence of tick infestation on both the other two species was 35% each. All 472 I. ricinus ticks and tissue samples collected from 134 collar scales and 62 toe clips of lizards were further analyzed for the presence of B. burgdorferi s.l. with polymerase chain reaction. The amplification of B. burgdorferi s.l. DNA was successful in 8% (n = 92) of L. viridis, 9% (n = 32) of P. taurica, and 10% (n = 10) of L. agilis tissue samples. Restriction fragment length polymorphism genotyping identified the species Borrelia lusitaniae in all tested lizard samples. Prevalence of B. burgdorferi s.l. in ticks collected from L. viridis, P. taurica, and L. agilis was 8%, 2%, and 0%, respectively. Most of the infected ticks carried B. lusitaniae (74% of genotyped positives); however, Borrelia afzelii (5%) and B. burgdorferi sensu stricto (21%) were detected in ticks removed from green lizards and Balkan wall lizards, respectively. We conclude that lizards, particularly L. viridis, can be important hosts for I. ricinus larvae and nymphs; thus, they can be regarded as reservoirs of these important pathogen vectors. The role of green lizards has been confirmed, and the implication of Balkan wall lizards is suggested in the natural cycle of B. lusitaniae at our study site.

  19. Efeito do bentazon e bentazon + dichlorprop na cultura do arroz irrigado e sobre as plantas daninhas Effect of bentazon and bentazon + dichlorprop on irrigated rice and weeds

    Directory of Open Access Journals (Sweden)

    C.A.L. dos Santos

    1979-06-01

    Full Text Available Foi instalado um experimento de campo, em solo barrento, com a finalidade de se verificar o efeito do bentazon e da mistura de bentazon + dichlorprop sobre o desenvolvimento do arroz em cultura irrigada e sobre o controle das plantas daninhas. Os tratamentos utilizados foram os seguintes: bentazon á 0,75-1,00 e1,50 kg/ha; bentazon + dichlorprop a 0,80 + 1,00 e 1,00 + 1,40 kg/ha; propanil a 4,20 kg/ha (tratamento padrão; testemunha capinada e testemunha sem capina. Todas as pulverizações foram realizadas em pósemergência. As plantas daninhas encontradas no experimento foram: capituva - Echinochloa colonum (L Link, tiririca amarela - Cyperus esculentus L., beldroega - Portulaca oleracea L. e carurú comum - Amaranthus viridis L. Bentazon a 1,00 e 1,50 kg/ha e bentazon + dichlorprop a 1,00 + 1,40 kg/ha foram eficientes no controle de P. oleracea, A. viridis e C. esculentus; já a dose menor de bentazon apresentou bons resultados contra P. oleracea e A. viridis, enquanto que a dose menor de bentazon + dichlorprop controlou apenas P. oleracea. Propanil, de uma maneira geral, proporcionou eficiente ação sobre as plantas daninhas. Nas condições em que foi realizado o experimento nenhum dos herbicidas, nas suas respectivas doses, apresentou fitotoxicidade para as plantas de arroz da variedade IAC-435 ou prejudicou a produção da cultura.Bentazon at 0.75 - 1.00 and 1.50 kg/ha a.i ., bentazon + dichlorprop at 0.80 + 1.00 and 1.00 + 1.40 kg and propanil at 4.20 kg were applied in post-emergence on irrigated rice, against the following weeds: Echinochloa colonum (L. Link, Cy-perus esc-ulentus L., Portulaca oleracea L. and Amaranthus viridis L. Bentazon at 1.00 - 1.50 kg and bentazon + dichlorprop at 1.00 + 1.40 kg gave good control of P. oleracea, A. viridis and C. esculentus; bentazon at 0.75 kg controlled P. oleracea and A. viridis; bentazon + dichlorprop at 0.80 + 1.00 kg only showed effeciency for P. oleracea; propanil, in general, gave good

  20. PRELIMINARY DATA CONCERNING THE HERPETOFAUNA IN NEAM COUNTY (ROMANIA

    Directory of Open Access Journals (Sweden)

    Sorin ROŞU

    2005-05-01

    Full Text Available In the researched area we identified 14 amphibian species: (Salamandra salamndra, Triturus vulgaris, Triturus cristatus, Triturus alpestris, Triturus montandoni, Bombina bombina, Bombina variegata, Bufo bufo, Bufo viridis, Pelobates fuscus, Hyla arborea, Rana ridibunda, Rana dalmatina, Rana temporaria and 8 reptilian species (Lacerta agilis, Lacerta viridis, Zootoca vivipara, Anguis fragilis, Natrix natrix, Elaphe longissima, Coronella austriaca, Vipera berus. Within the region we identified species quoted (Coglniceanu et al. 2000 to have the lowest altitudinal limit of their spreading area at much higher altitudes. The species Triturus montandoni was identified at 320 m altitude at Agârcia and Doamna. Most of the amphibian and reptilian species are not endangered in the researched area.

  1. Physical Non-Contact Communication between Microscopic Aquatic Species: Novel Experimental Evidences for an Interspecies Information Exchange

    Directory of Open Access Journals (Sweden)

    Daniel Fels

    2016-01-01

    Full Text Available Previous experiments on physical non-contact communication within same species gave rise to test for this type of communication also across the species border, which was the aim of the present study. It was found that autotrophic unicellular organisms (Euglena viridis, separated by cuvettes, affected the proliferation rate of heterotrophic unicellular organisms (Paramecium caudatum. Further, the heterotrophic unicellular organism affected also the proliferation rate of a multicellular heterotrophic organism (Rotatoria sp. and vice versa. In the case when populations (of Euglena viridis and Paramecium caudatum were shielded against electromagnetic fields in the optical spectrum from each other, no effects were measured. The results may support the notion that the organisation of ecosystems relies also on the exchange of electromagnetic fields from their constituting biosystems.

  2. The effect of UV-B radiation on plant growth and development

    International Nuclear Information System (INIS)

    Zuk-Golaszewska, K.; Golaszewski, J.; Upadhyaya, M.K.

    2003-01-01

    In the experiment conducted in the greenhouse, the different doses of UV-B radiation applied to the two species Avena fatua and Setaria viridis induced changes in leaf and plant morphology. It was a decrease of plant height, fresh mass of leaves, shoots and roots as well as leaf area. Besides, it caused the leaf curling in both of the species. The significant differences between Avena fatua and Setaria viridis in the studied traits were mainly due to the tillering ability of the species. The content of chlorophyll varied considerably. The average values of leaf greenness (SPAD units) for oats were about 43 while for green foxtail 32, respectively. U-VB did not reduce leaf weight ratio, shoot dry matter, shoot to root ratio and leaf area ratio

  3. Weed Hosts of Meloidogyne arenaria and M. incognita Common in Tobacco Fields in South Carolina.

    Science.gov (United States)

    Tedford, E C; Fortnum, B A

    1988-10-01

    Thirty-two weed species common in South Carolina and one cultivar of tobacco were evaluated as hosts of Meloidogyne arenaria race 2 and M. incognita race 3 in the greenhouse. Egg mass production and galling differed (P Rumex crispus, Amaranthus hybridus, Ambrosia artemisiifolia, lpomoea hederacea var. integriuscula, Setaria lutescens, Sida spinosa, Portulaca oleracea, and Rumex acetosella were moderate hosts. Taraxacum officinale, Ipomoea hederacea, Cyperus esculentus, Cynodon dactyIon, Echinochloa crus-galli, Eleusine indica, Sorghum halepense, Setaria viridis, Digitaria sanguinalis, and Datura stramonium were poor hosts for M. arenaria. Amaranthus palmeri, Amaranthus hybridus, Chenopodium album, Euphorbia maculata, Setaria lutescens, Vicia villosa, Sida spinosa, Rumex crispus, and Portulaca oleracea were moderate hosts and Ipomoea hederacea var. integriuscula, Xanthium strumarium, Cyperus esculentus, Cynodon dactylon, Paspalum notatum, Eleusine indica, Setaria viridis, and Rumex acetosella were poor hosts for M. incognita. None of the above were good hosts for M. incognita. Tobacco 'PD4' supported large numbers of both nematode species.

  4. 239Pu contamination in snakes inhabiting the Rocky Flats Plant site

    International Nuclear Information System (INIS)

    Geiger, R.A.; Winsor, T.F.

    1975-01-01

    For approximately four years studies have been under way at the Rocky Flats plant to determine contamination patterns and concentrations of Pu in the biota. Contamination of the Rocky Flats environs has resulted from at least three incidents, a September 1957 fire, a May 1969 fire, and leaking barrels containing plutonium-laden cutting oil. The latter incident was considered by far the major source of the plutonium contamination. Results are reported from a study conducted to determine whether snake tissues of the area contained detectable amounts of 239 Pu and, if so, at what concentrations. Eastern yellow-bellied racers (Coluber constrictor flaviventris, bullsnakes (Pituophis melanoleucus sayi, and prairie rattlesnakes (Crotalus viridis viridis, were collected for 239 Pu bioassay of lung, liver, and bone tissues. Snakes were captured using drift fences terminating in funnel traps and by opportunistic sampling. Results led to the conclusion that snakes are not an important organism in the redistribution of 239 Pu

  5. /sup 239/Pu contamination in snakes inhabiting the Rocky Flats Plant site

    Energy Technology Data Exchange (ETDEWEB)

    Geiger, R.A.; Winsor, T.F.

    1975-01-01

    For approximately four years studies have been under way at the Rocky Flats plant to determine contamination patterns and concentrations of Pu in the biota. Contamination of the Rocky Flats environs has resulted from at least three incidents, a September 1957 fire, a May 1969 fire, and leaking barrels containing plutonium-laden cutting oil. The latter incident was considered by far the major source of the plutonium contamination. Results are reported from a study conducted to determine whether snake tissues of the area contained detectable amounts of /sup 239/Pu and, if so, at what concentrations. Eastern yellow-bellied racers (Coluber constrictor flaviventris, bullsnakes (Pituophis melanoleucus sayi, and prairie rattlesnakes (Crotalus viridis viridis, were collected for /sup 239/Pu bioassay of lung, liver, and bone tissues. Snakes were captured using drift fences terminating in funnel traps and by opportunistic sampling. Results led to the conclusion that snakes are not an important organism in the redistribution of /sup 239/Pu. (CH)

  6. Burial of Zostera marina seeds in sediment inhabited by three polychaetes: laboratory and field studies

    DEFF Research Database (Denmark)

    Delefosse, Matthieu; Kristensen, Erik

    2012-01-01

    passively by sedimentation or actively through sediment reworking by benthic fauna.We evaluated the effect of three polychaetes on the burial rate and depth of eelgrass seeds. Burial was first measured in controlled laboratory experiments using different densities of Nereis (Hediste) diversicolor (400......–3200 ind m −2), Arenicola marina (20–80 ind m−2), and the invasive Marenzelleria viridis (400–1600 ind m −2). The obtained results were subsequently compared with burial rates of seed mimics in experimental field plots (1m2) dominated by the respective polychaetes. High recovery of seeds in the laboratory....... At their highest abundance, A. marina andM. viridis buried seeds to amedian depth of 6.7 cmand 0.5 cm, respectively, after amonth. The burial efficiency and depth of these species were, in contrast to N. diversicolor, dependent on animal abundance. Only 2% of seed mimics casted in the field plots were recovered...

  7. Species distribution modeling techniques as a tool in preliminary assessment of special nature reserve ,,Goč-Gvozdac’’

    Directory of Open Access Journals (Sweden)

    Čubrić, T.

    2016-09-01

    Full Text Available Effective conservation actions such as defining new nature reserve require accurate estimates of the spatial distributions of the target species. Species distribution models provide habitat suitability maps for studied species. In this paper we used Maxent software to estimate the distribution and extent of potential suitable habitat of five amphibian and reptilian species (Mesotriton alpestris, Bombina variegata, Testudo hermanni, Lacerta viridis and Vipera ammodytes in the special nature reserve “Goč-Gvozdac” (Central Serbia in order to assess how much of the potential habitats is included in this reserve. Comparing produced suitable habitat maps of the species with a map of the special nature reserve “Goč – Gvozdac” we concluded that the reserve boundaries do not coincide with the proposed distribution of suitable habitats for M. alpestris, T. hermanni, L. viridis and V. ammodytes, and therefore this reserve does not contribute much to the protection of local populations of these species.

  8. Acute toxicity of Amanranthus viridus extract on guppies, Poecilia reticulata.

    Science.gov (United States)

    Arsirapoj, S; Sudthonghong, C; Bullangpoti, V

    2010-01-01

    Many Thai plant species shows the responsible for controlling insects from the host plants. To avoid potential toxic pollutant contaminating aquatic ecosystems, this present study was investigated for acute toxicity from Amaranthus viridis to Guppy fish (Poecilia reticulata) were selected for the bioassay experiments. The experiments were repeated 5 times and the 1-, 3- and 24-h LC50 was determined for the guppies. The acute toxicity experiments were carried out by static method and behavioral changes in guppies were determined for Amaranthus viridis concentration extract which extracted by Soxhlet's extraction method with ethanol as solvent. Water temperature was regulated at 20 +/- 1 degrees C. Data obtained from the acute toxicity tests were evaluated using the Probit analysis statistical method. The 24-h LC50 value for guppy was estimated as ca. 947 mg L(-1) (r2 = 0.95). However, in this concentration, no mortality was observed at higher concentration for 30 second.

  9. Relações de interferência entre plantas daninhas e a cultura do grão-de-bico

    OpenAIRE

    Amaral, Carita Liberato do [UNESP; Pavan, Guilherme Bacarim [UNESP; Souza, Marcelo Claro de; Martins, José Valcir Fidelis [UNESP; Alves, Pedro Luis da Costa Aguiar [UNESP

    2015-01-01

    The grains of chickpea consumed in Brazil are almost entirely imported. Considering that chickpeas presents conditions to be cultivated in some regions of Brazil, this study aimed to study interference of six weed plants (Amaranthus viridis, Bidens pilosa, Raphanus raphanistrum, Cyperus rotundus, Digitaria nuda and Eleusine indica) on the vegetative development of chickpeas. Thus, we evaluated the shoot length, number of leaves, leaf area, chlorophyll content and dry weight of leaves, stem an...

  10. Ribosomal DNA in diploid and polyploid Setaria (Poaceae) species: number and distribution

    OpenAIRE

    Nani, Thaís Furtado; Cenzi, Gisele; Pereira, Daniele Lais; Davide, Lisete Chamma; Techio, Vania Helena

    2015-01-01

    Abstract Setaria Beauvois, 1812 is a genus of economically important forage species, including Setaria italica (Linnaeus, 1753) Beauvois, 1812 and Setaria viridis (Linnaeus, 1753) Beauvois, 1812, closely related species and considered as model systems for studies of C4 plants. However, complications and uncertainties related to taxonomy of other species of the genus are frequent due to the existence of numerous synonyms for the same species or multiple species with the same name, and overlapp...

  11. Inhibition of alpha oscillations through serotonin-2A receptor activation underlies the visual effects of ayahuasca in humans

    OpenAIRE

    Valle, Marta; Ana Elda, Maqueda; Rabella, Mireia; Rodríguez Pujadas, Aina; Antonijoan Arbós, Rosa Maria; Romero Lafuente, Sergio; Alonso López, Joan Francesc; Mañanas Villanueva, Miguel Ángel; Barker, Steven; Friedlander, Pablo; Feilding, Amanda; Riba, Jordi

    2016-01-01

    Ayahuasca is an Amazonian psychotropic plant tea typically obtained from two plants, Banisteriopsis caapi and Psychotria viridis. It contains the psychedelic 5-HT2A and sigma-1 agonist N,N-dimethyltryptamine (DMT) plus ß-carboline alkaloids with monoamine-oxidase (MAO)-inhibiting properties. Although the psychoactive effects of ayahuasca have commonly been attributed solely to agonism at the 5-HT2A receptor, the molecular target of classical psychedelics, this has not been tested experimental...

  12. Rend Lake, Illinois (Operation and Maintenance).

    Science.gov (United States)

    1976-12-01

    Lippia lanc6Tahta Foxtail, Bristly Setaria Faberfi Foxtail, Green Setaria viridis Foxtail, Yellow Setaria lutescens Galingale C Verus strigosus Garlic...altissima Redtop Agrostis alba Reed Phracjmites coinunis Reedgrass, Wood Cinna arundinacea 397 Ribgrass Plantago lanceolata Richweed Pie uia Rock-Cress Arbis...terweed Elodea canadensisWitch-Grass Pa-nicum capillare Yam Dioscorea villosaYarrow, common Chillea miifoiumYerba-de-Tago Eclipta alba 399 APPENDIX B-3

  13. LPS-induced NO inhibition and antioxidant activities of ethanol extracts and their solvent partitioned fractions from four brown seaweeds

    Science.gov (United States)

    Cho, Myoung Lae; Lee, Dong-Jin; Lee, Hyi-Seung; Lee, Yeon-Ju; You, Sang Guan

    2013-12-01

    The nitric oxide inhibitory (NOI) and antioxidant (ABTS and DPPH radical scavenging effects with reducing power) activities of the ethanol (EtOH) extracts and solvent partitioned fractions from Scytosiphon lomentaria, Chorda filum, Agarum cribrosum, and Desmarestia viridis were investigated, and the correlation between biological activity and total phenolic (TP) and phlorotannin (TPT) content was determined by PCA analysis. The yield of EtOH extracts from four brown seaweeds ranged from 2.6 to 6.6% with the highest yield from D. viridis, and the predominant compounds in their solvent partitioned fractions had medium and/or less polarity. The TP and TPT content of the EtOH extracts were in the ranges of 25.0-44.1 mg GAE/g sample and 0.2-4.6 mg PG/g sample, respectively, which were mostly included in the organic solvent partitioned fractions. Strong NOI activity was observed in the EtOH extracts and their solvent partitioned fractions from D. viridis and C. filum. In addition, the EtOH extract and its solvent partitioned fractions of D. viridis exhibited little cytotoxicity to Raw 264.7 cells. The most potent ABTS and DPPH radical scavenging capacity was shown in the EtOH extracts and their solvent partitioned fractions from S. lomentaria and C. filum, and both also exhibited strong reducing ability. In the PCA analysis the content of TPT had a good correlation with DPPH ( r = 0.62), ABTS ( r = 0.69) and reducing power ( r = 0.65), however, an unfair correlation was observed between the contents of TP and TPT and NOI, suggesting that the phlorotannins might be responsible for the DPPH and ABTS radical scavenging activities.

  14. Chemical Composition and Quality Characteristics of Wheat Bread Supplemented with Leafy Vegetable Powders

    OpenAIRE

    Odunlade, T. V.; Famuwagun, A. A.; Taiwo, K. A.; Gbadamosi, S. O.; Oyedele, D. J.; Adebooye, O. C.

    2017-01-01

    The study investigated the effect of supplementation of the leaf powders of Telfairia occidentalis, Amaranthus viridis, and Solanum macrocarpon on the chemical composition and the quality characteristics of wheat bread. The bread samples were supplemented with each of the vegetable leaf powders at 1%, 2%, and 3% during preparation. The bread samples were assayed for proximate composition, mineral composition, physical, sensory, and antioxidant properties using standard methods. The addition o...

  15. Review of world genera of Ceinae, with the description of two new Palaearctic species of Spalangiopelta Masi (Hymenoptera, Chalcidoidea, Pteromalidae

    Directory of Open Access Journals (Sweden)

    Mircea-Dan Mitroiu

    2016-12-01

    Full Text Available The paper provides the first illustrated key to all described genera of Ceinae, i.e., Bohpa Darling, 1991, Cea Walker, 1837, and Spalangiopelta Masi, 1922. Based on the study of the original material, the genus Diparisca Hedqvist, 1964 stat. nov. is removed from the synonymy with Spalangiopelta and its higher classification is discussed. Spalangiopelta rameli sp. nov. and S. viridis sp. nov. are described from Greece and the Canary Islands, respectively.

  16. Bio-accumulation kinetics of radioruthenium in marine bivalves. Laboratory study

    International Nuclear Information System (INIS)

    Mu, D.H.; Yan, S.P.; Gu, Y.J.; Li, D.J.; Du, J.Z.

    2007-01-01

    Three kinds of marine bivalves (wild Saccostrea cucullata, aquacultured Perna viridis and aquacultured Pinctada martens), collected from Daya Bay, the South China Sea, were used to investigate the bio-accumulation of radioruthenium in the glass aquarium with natural seawater (pH 8.20, 35 per mille salinity, filtered by 0.45 μm) at ambient temperature under laboratory feeding conditions. The experimental results show that the stead-state of biology concentration factor (BCF, ml/g) of radioruthenium was approached around 6 days for most species of bivalves. The values of BCF in shells are the highest in organs all the three bivalves. The orders of BCF values (ml x g -1 ) are as: Perna viridis (33.2) < Saccostrea cucullata (47.0) < Pinctada martensi (208.4) for shells and Saccostrea cucullata (1.5) < Pinctada martensi (2.2) ∼ Perma viridis (2.4) for soft tissues, respectively, after exposed for 14 days. The rate constants of uptake and elimination of radioruthenium on marine bivalves were also discussed by first-order kinetics model. The Pinctada martensi may be applicable to be an indictor for monitoring radioruthenium among the three bivalves. (author)

  17. Cryo-mesh: a simple alternative cryopreservation protocol.

    Science.gov (United States)

    Funnekotter, B; Bunn, E; Mancera, R L

    The continued development of new cryopreservation protocols has improved post-cryogenic success rates for a wide variety of plant species. Methods like the cryo-plate have proven beneficial in simplifying the cryopreservation procedure. This study assessed the practicality of a stainless steel mesh strip (cryo-mesh) for cryopreserving shoot tips from Anigozanthos viridis. Shoot tips of A. viridis (Kangaroo Paw) were precultured on 0.4 M sucrose medium for 48 h. Precultured shoot tips were coated in a 2% alginate solution and placed onto the cryo-mesh (a 25 x 7 mm, 0.4 mm aperture, 0.224 mm diameter wire stainless steel mesh strip). The alginate was set for 20 min in a loading solution containing 100 mM CaCl2, anchoring the shoot tips to the cryo-mesh. The cryo-mesh was then transferred to PVS2 on ice for 20, 30 or 40 min prior to plunging the cryo-mesh into liquid nitrogen. The cryo-mesh protocol was compared to the droplet-vitrification protocol. A maximum of 83% post-cryogenic regeneration was achieved with the cryo-mesh when exposed to PVS2 for 30 min. No significant difference in post-cryogenic regeneration was observed between the cryo-mesh and droplet-vitrification protocols. Anigozanthos viridis shoot tips were successfully cryopreserved utilising the new cryo-mesh. The cryo-mesh thus provides a simple and successful alternative for cryopreservation.

  18. Interaction of nemertines and their prey on tidal flats

    Science.gov (United States)

    Thiel, Martin; Reise, Karsten

    Two common nemertines of the European Wadden Sea, Lineus viridis and Amphiporus lactifloreus, occur preferentially in clusters of mussels, spread over sedimentary flats in the upper intertidal near the island of Sylt. The heteronemertine L. viridis preys mainly on the polychaete Nereis diversicolor. The hoplonemertine A. lactifloreus feeds almost exclusively on the amphipod Gammarus locusta. Abundance of both predators and their respective prey in the field showed inverse relationships. Experimentally increased numbers of L. viridis in clusters of mussels caused a gradual decrease of nereid abundance in the sediment underneath over a period of 1 month, suggesting that losses of individuals were caused by prey capture. Experimentally increased numbers of A. lactifloreus were followed by an escape response of gammarids from clusters of mussels within 2 d. In aquaria, both prey species exhibited prolonged swimming activity when their respective predators lurked at the bottom. We conclude that escape behaviour in N. diversicolor may be only effective during its migrant phases, while G. locusta is permanently on the alert to avoid encounters with its predator. This refuging behaviour in response to endobenthic predators has strong implications on prey distribution, while the actual consumption of prey may be relatively modest. Enclosure experiments in the field and in aquaria lead to overestimates of prey capture when refuging behaviour is not accounted for.

  19. Molecular Switch Role of Akt in Polygonatum odoratum Lectin-Induced Apoptosis and Autophagy in Human Non-Small Cell Lung Cancer A549 Cells

    Science.gov (United States)

    Shi, Zheng; Wang, Hailian; Zhang, Bin; Zhao, Kailiang; Qi, Wei; Bao, Jinku; Wang, Yi

    2014-01-01

    Polygonatum odoratum lectin (POL), isolated from traditional Chinese medicine herb (Mill.) Druce, has drawn rising attention due to its wide biological activities. In the present study, anti-tumor effects, including apoptosis- and autophagy-inducing properties of POL, were determined by a series of cell biology methods such as MTT, cellular morphology observation, flow cytometry, immunoblotting. Herein, we found that POL could simultaneously induce apoptosis and autophagy in human non-small cell lung cancer A549 cells. POL initiated apoptosis through inhibiting Akt-NF-κB pathway, while POL triggered autophagy via suppressing Akt-mTOR pathway, suggesting the molecular switch role of Akt in regulating between POL-induced apoptosis and autophagy. Moreover, ROS was involved in POL-induced inhibition of Akt expression, and might therefore mediate both apoptosis and autophagy in A549 cells. In addition, POL displayed no significant cytotoxicity toward normal human embryonic lung fibroblast HELF cells. Due to the anti-tumor activities, POL might become a potent anti-cancer drug in future therapy, which might pave the way for exploring GNA-related lectins into effective drugs in cancer treatment. PMID:24992302

  20. Development of SCAR markers for species identification of the genus Nepenthes (Nepenthaceae).

    Science.gov (United States)

    Anuniwat, A; Chaveerach, A; Tanee, T; Sudmoon, R

    2009-11-15

    Nepenthes species in Thailand, namely N. mirabilis Druce, N. gracilis Korth., N. smilesii Hemsl., N. ampullaria Jack and N. kampotiana Lecomte, were collected for development of Sequence Characterized Amplified Region (SCAR) marker, a genotype identification tool. Forty Random Amplified Polymorphic DNA (RAPD) primers were screened and three successful primers produced different banding patterns including five candidate species-specific markers. The candidate markers were cloned and sequenced. The marker sequences are 602, 379, 420, 473 and 1017 bp for N. mirabilis, N. gracilis, N. smilesii, N. ampullaria and N. kampotiana, respectively. Then the sequences were used to design primers for development of a species-specific band being a SCAR marker, including Mir 1, Mir 2 and Mir 3 for N. mirabilis; Gra 1 and Gra 2 for N. gracilis; Smi 1, Smi 2 and Smi 3 for N. smilesii; Amp 1 and Amp 2 for N. ampullaria and Kam 1 and Kam 2 of N. kampotiana. The primers were evaluated with each other Nepenthes species. Finally, species-specific SCAR markers were successfully developed for N. gracilis, N. ampullaria and N. kampotiana. Application of these markers is feasible for identification of Nepenthes species in Thailand.

  1. Species identification and sex determination of the genus Nepenthes (Nepenthaceae).

    Science.gov (United States)

    Mokkamul, Piya; Chaveerach, Arunrat; Sudmoon, Runglawan; Tanee, Tawatchai

    2007-02-15

    Nepenthes species are well known for their ornamentally attractive pitchers. The species diversity was randomly surveyed in some conservation areas of Thailand and three species were found, namely N. gracilis Korth., N. mirabilis Druce. and N. smilesii Hemsl. Young plants as unknown species from Chatuchak market were added in plant sampled set. Thirty two Inter Simple Sequence Repeat (ISSR) primers were screened and 13 successful primers were used to produce DNA banding patterns for constructing a dendrogram. The dendrogram is potentially power tool to identify unknown species from Chatuchak market, differentiate species population, population by geographical areas and sex determination. The geographical area of N. mirabilis was specified to Southern and Northeastern regions and finally, subdivided into exact areas according to province. Male and female plants of N. gracilis at Phu Wua Wildlife Sanctuary and N. mirabilis at Bung Khonglong non-hunting area were determined. Two unknown species from Chatuchak market were analyzed to be N. mirabilis with the genetic similarities (S) 77.2 to 84.7. Be more sex specific in all sample studied, 37 Random Amplified Polymorphic DNA (RAPD) primers were investigated. The result shows that only one RAPD primer show high resolution results at about 750 bp specific male-related marker.

  2. Phylogenetic systematics of Schacontia Dyar with descriptions of eight new species (Lepidoptera, Crambidae

    Directory of Open Access Journals (Sweden)

    Paul Goldstein

    2013-04-01

    Full Text Available The Neotropical genus Schacontia Dyar (1914 is reviewed and revised to include eleven species. Schacontia replica Dyar, 1914, syn. n. and S. pfeifferi Amsel, 1956, syn. n. are synonymized with S. chanesalis (Druce, 1899 and eight new species are described: Schacontia umbra, sp. n., S. speciosa, sp. n., S. themis, sp. n., S. rasa, sp. n., S. nyx, sp. n., S. clotho, sp. n., S. lachesis, sp. n., and S. atropos, sp. n. Three species, S. medalba, S. chanesalis, and S. ysticalis, are re-described. An analysis of 64 characters (56 binary, 8 multistate; 5 head, 13 thoracic, 13 abdominal, 25 male genitalic, and 8 female genitalic scored for all Schacontia and three outgroup species (Eustixia pupula Hübner, 1823, Glaphyria sesquistrialis Hübner, 1823, and Hellula undalis (Fabricius, 1781 retrieved 8 equally most parsimonious trees (L=102, CI=71, RI=84 of which the strict consensus is: [[[[medalba + umbra] + chanesalis] + speciosa] + [ysticalis + [rasa + themis + [atropos + lachesis + nyx + clotho

  3. Prosopis cineraria: a potential nootropic agent.

    Science.gov (United States)

    Bithu, Bhawani Singh; Reddy, N Ranga; Prasad, Satyendra K; Sairam, Krishnamurthy; Hemalatha, S

    2012-10-01

    Prosopis cineraria (L.) Druce (Leguminosae), a plant of the Thar Desert of India and Pakistan is used traditionally by local people for the treatment of memory disorders and to arrest wandering of the mind. The study includes scientific validation of P. cineraria for nootropic activity. To elucidate the possible mechanism, the anticholinesterase activity was also investigated in different parts of the brain. Methanol extract of P. cineraria stem bark (200, 400 and 600 mg/kg body weight p.o.) was administered once in a day for 7 days to rats and these rats were then subjected to Morris water-maze (MWM) test for spatial reference memory (SRM) and spatial working memory (SWM) versions of memory testing. The inhibitory effect of the extract on acetylcholinesterase (AChE) in discrete rat brain regions (prefrontal cortex [PFC], hippocampus [HIP] and amygdala [AMY]) was also investigated using acetyl thiocholine iodide and dithiobisnitrobenzoic acid reagent. The oral administrations of methanol extract of P. cineraria in all doses tested, significantly (p nootropic activity in the MWM test which may be attributed to the inhibition of brain AChE.

  4. Isolation, characterization and hypolipidemic activity of ferulic acid in high-fat-diet-induced hyperlipidemia in laboratory rats

    Science.gov (United States)

    Jain, Pankaj G.; Surana, Sanjay J.

    2016-01-01

    Prosopis cineraria (L.) Druce (Leguminosae) (syn. Prosopis spicigera L.) has antidiabetic and antioxidant potential. Earlier we reported its hypolipidemic activity obtained from ethanol extract (ET-PCF). Object of this work was to isolate ferulic acid (FA) from ET-PCF and evaluate hypolipidemic activity against high-fat diet (HFD)-induced hyperlipidemic laboratory rats. ET-PCF was subjected to flash column chromatography to isolate FA. The chemical structure of the isolated compound was elucidated by UV, IR, 1H NMR,13C NMR and LC-MS. Further, the antihyperlipidemic effect of FA (10, 20 and 40 mg/kg, p.o.) in HFD-induced hyperlipidemic rats was investigated. Hyperlipidemia was induced in male Sprague-Dawley rats by feeding with HFD for 60 days. Lipid parameters such as total cholesterol (TC), Low-density lipoprotein cholesterol (LDL-C), high-density lipoprotein cholesterol (HDL-C) and triglycerides (TG) levels were measured in serum and hepatic tissue. Hepatic oxido-nitrosative stress (SOD, GSH, MDA and NO) were also determined. Histological evaluation of liver tissue was carried out. The structure of the isolated compound was characterized based on spectral data and confirmed as FA. HFD induced an alteration in serum, and hepatic lipid profile (triglyceride, cholesterol, HDL, and LDL) was significantly restored (p Ferulic acid isolated from ET-PCF showed hypolipidemic effects in HFD-induced hyperlipidemic rats via modulation of elevated oxido-nitrosative stress. PMID:28096790

  5. Plants of restricted use indicated by three cultures in Brazil (Caboclo-river dweller, Indian and Quilombola).

    Science.gov (United States)

    Rodrigues, Eliana

    2007-05-04

    A detailed record of plants cited during ethnopharmacological surveys, suspected of being toxic or of triggering adverse reactions, may be an auxiliary means to pharmacovigilance of phytomedicines, in that it provides greater knowledge of a "bad side" to plant resources in the Brazilian flora. This study describes 57 plant species of restricted use (abortive, contraceptive, contraindicated for pregnancy, prescribed in lesser doses for children and the elderly, to easy delivery, in addition to poisons to humans and animals) as indicated during ethnopharmacological surveys carried out among three cultures in Brazil (Caboclos-river dwellers, inhabitants of the Amazon forest; the Quilombolas, from the pantanal wetlands; the Krahô Indians, living in the cerrado savannahs). These groups of humans possess notions, to a remarkable extent, of the toxicity, contraindications, and interaction among plants. A bibliographical survey in the Pubmed, Web of Science and Dr. Duke's Phytochemical and Ethnobotanical Databases has shown that 5 out of the 57 species have some toxic properties described up to the present time, they are: Anacardium occidentale L. (Anacardiaceae), Brosimum gaudichaudii Trécul (Moraceae), Senna alata (L.) Roxb. (Fabaceae), Senna occidentalis (L.) Link (Fabaceae), Strychnos pseudoquina A. St.-Hil. (Loganiaceae) and Vernonia brasiliana (L.) Druce (Asteraceae).

  6. Larval Biology of Anthophagous Eumaeini (Lepidoptera: Lycaenidae, Theclinae) in the Cerrado of Central Brazil

    Science.gov (United States)

    Silva, Neuza A. P.; Duarte, Marcelo; Araújo, Eliezer B.; Morais, Helena C.

    2014-01-01

    Abstract The biology and morphology of the early stages of 22 species of Eumaeini (Lepidoptera: Lycaenidae, Theclinae) are presented. Observations were collected through the inspection of inflorescences in the field and the rearing of 214 larvae in laboratory. Allosmaitia strophius (Godart) associated with Malpighiaceae species and the polyphagous Strymon mulucha (Hewitson) were the most frequently collected species. Detritivory was observed in two species, Electrostrymon endymion (F.) and Kisutam syllis (Godman & Salvin), and myrmecophily in four other species, A. strophius , Ministrymon azia (Hewitson), Parrhasius polibetes (Stoll), and S. mulucha . Cannibalism was observed in A. strophius ; in addition, the pupa of this and of three other species produced audible sounds. Paiwarria aphaca (Hewitson) was highlighted because of the great difference observed between its first and last instars, as well as the marked difference between that species and the larvae of Paiwarria umbratus (Geyer) documented in Costa Rica. Larvae of Calycopis mimas (Godman & Salvin) displayed “bungee jumping” behavior when stimulated. Parasitoids (Diptera, Hymenoptera) attacked 21 larvae of eight species, A. strophius , K. syllis , M. azia , Pai. aphaca , P. polibetes , Rekoa marius (Lucas), S. mulucha , and Tmolus venustus (H.H. Druce). Illustrations of immatures and parasitoids are provided. PMID:25368090

  7. Evaluation of the antimicrobial potential of two flavonoids isolated from limnophila plants.

    Science.gov (United States)

    Brahmachari, Goutam; Mandal, Narayan C; Jash, Shyamal K; Roy, Rajiv; Mandal, Lalan C; Mukhopadhyay, Arijit; Behera, Biswajit; Majhi, Sasadhar; Mondal, Avijit; Gangopadhyay, Arindam

    2011-06-01

    The antimicrobial potential of two bioflavonoids, i.e., 5,7-dihydroxy-4',6,8-trimethoxyflavone (1) and 5,6-dihydroxy-4',7,8-trimethoxyflavone (2), isolated from Limnophila heterophylla Benth. and L. indica (Linn.) Druce (Scrophulariaceae), respectively, were evaluated against the microbial strains Bacillus subtilis, Staphylococcus aureus, Escherichia coli, Salmonella typhimurium, Alternaria solani, and Candida albicans. Compounds 1 and 2 exhibited moderate but broad antimicrobial activities against both Gram-positive and Gram-negative bacteria and also against the fungal pathogens. Moreover, the mechanism of action of 1 and 2 on the cellular functions or structures of some of the microorganisms was studied. Compound 1 showed a bactericidal effect against E. coli and S. aureus (MICs of 200 and 250 μg/ml, resp.), while compound 2 was found to effectively kill B. subtilis by cell lysis. The growth of A. solani and C. albicans was inhibited by compounds 1 and 2, respectively. The effects of the flavonoids on the cellular structures and the carbohydrate metabolic pathways were studied by scanning electron microscopy (SEM) of the treated cells and by assessing the specific activity of key enzymes of the pathways, respectively. At sublethal doses, they enhanced the activity of gluconeogenic fructose bisphosphatase, but decreased the activity of phosphofructokinase and isocitrate dehydrogenase, the key enzymes of the EmbdenMeyerhofParnas pathway and the tricarboxylic acid cycle, respectively. Copyright © 2011 Verlag Helvetica Chimica Acta AG, Zürich.

  8. Restoration of mangrove plantations and colonisation by native species in Leizhou bay, South China

    Science.gov (United States)

    Ren, H.; Jian, S.; Lu, H.; Zhang, Q.; Shen, W.; Han, W.; Yin, Z.; Guo, Q.

    2008-01-01

    To examine the natural colonisation of native mangrove species into remediated exotic mangrove stands in Leizhou Bay, South China, we compared soil physical-chemical properties, community structure and recruitments of barren mangrove areas, native mangrove species plantations, and exotic mangrove species-Sonneratia apetala Buch.Ham-between plantations and natural forest. We found that severely degraded mangrove stands could not regenerate naturally without human intervention due to severely altered local environments, whereas some native species had been recruited into the 4-10 year S. apetala plantations. In the first 10 years, the exotic species S. apetala grew better than native species such as Rhizophora stylosa Griff and Kandelia candel (Linn.) Druce. The mangrove plantation gradually affected soil physical and chemical properties during its recovery. The exotic S. apetala was more competitive than native species and its plantation was able to restore soil organic matter in about 14 years. Thus, S. apetala can be considered as a pioneer species to improve degraded habitats to facilitate recolonisation by native mangrove species. However, removal to control proliferation may be needed at late stages to facilitate growth of native species. To ensure sustainability of mangroves in South China, the existing mangrove wetlands must be managed as an ecosystem, with long-term scientific monitoring program in place. ?? 2007 The Ecological Society of Japan.

  9. Notes on the genus Abantis Hopffer, 1855 with description of two new species (Lepidoptera: Hesperiidae, Pyrginae

    Directory of Open Access Journals (Sweden)

    Claudio Belcastro

    2016-06-01

    Full Text Available The Afrotropical genus Abantis Hopffer, 1855 includes about 23 species so far, all quite rare. In Evans’ Catalogue of the African Hesperiidae only 14 species were listed but, apart from a few newly discovered ones, some of the subspecies indicated over there have subsequently been raised to species level, although they look very similar in facies with previously recognised taxa. This article shows the presence of an unrecognised species similar to A. lucretia Druce, 1909 in West Africa, namely A. fabiana sp. n., and another one similar to both A. contigua Evans, 1937 and A. elegantula Mabille, 1890 in Central Africa, namely A. torbeni sp. n. The rarity in collections of almost all forest-dwelling Abantis spp. is reported as connected to their habit of flying high in the forest canopy, but the authors have no conclusive evidence of it. Most Abantis are hill-toppers, mud lovers and are attracted by dead animals (fish and turtles, although some of them are also flower-visiting.

  10. Applicability Of A Semi-Automated Clinical Chemistry Analyzer In Determining The Antioxidant Concentrations Of Selected Plants

    Directory of Open Access Journals (Sweden)

    Allan L. Hilario

    2017-07-01

    Full Text Available Plants are rich sources of antioxidants that are protective against diseases associated to oxidative stress. There is a need for high throughput screening method that should be useful in determining the antioxidant concentration in plants. Such screening method should significantly simplify and speed up most antioxidant assays. This paper aimed at comparing the applicability of a semi-automated clinical chemistry analyzer Pointe Scientific MI USA with the traditional standard curve method and using a Vis spectrophotometer in performing the DPPH assay for antioxidant screening. Samples of crude aqueous leaf extract of kulitis Amaranthus viridis Linn and chayote Sechium edule Linn were screened for the Total Antioxidant Concentration TAC using the two methods. Results presented in mean SD amp956gdl were compared using unpaired Students t-test P0.05. All runs were done in triplicates. The mean TAC of A. viridis was 646.0 45.5 amp956gdl using the clinical chemistry analyzer and 581.9 19.4 amp956gdl using the standard curve-spectrophotometer. On the other hand the mean TAC of S. edule was 660.2 35.9 amp956gdl using the semi-automated clinical chemistry analyzer and 672.3 20.9 amp956gdl using the spectrophotometer. No significant differences were observed between the readings of the two methods for A. viridis P0.05 and S. edible P0.05. This implies that the clinical chemistry analyzer can be an alternative method in conducting the DPPH assay to determine the TAC in plants. This study presented the applicability of a semi-automated clinical chemistry analyzer in performing the DPPH assay. Further validation can be conducted by performing other antioxidant assays using this equipment.

  11. Evidence for the late origin of introns in chloroplast genes from an evolutionary analysis of the genus Euglena.

    Science.gov (United States)

    Thompson, M D; Copertino, D W; Thompson, E; Favreau, M R; Hallick, R B

    1995-01-01

    The origin of present day introns is a subject of spirited debate. Any intron evolution theory must account for not only nuclear spliceosomal introns but also their antecedents. The evolution of group II introns is fundamental to this debate, since group II introns are the proposed progenitors of nuclear spliceosomal introns and are found in ancient genes from modern organisms. We have studied the evolution of chloroplast introns and twintrons (introns within introns) in the genus Euglena. Our hypothesis is that Euglena chloroplast introns arose late in the evolution of this lineage and that twintrons were formed by the insertion of one or more introns into existing introns. In the present study we find that 22 out of 26 introns surveyed in six different photosynthesis-related genes from the plastid DNA of Euglena gracilis are not present in one or more basally branching Euglena spp. These results are supportive of a late origin for Euglena chloroplast group II introns. The psbT gene in Euglena viridis, a basally branching Euglena species, contains a single intron in the identical position to a psbT twintron from E.gracilis, a derived species. The E.viridis intron, when compared with 99 other Euglena group II introns, is most similar to the external intron of the E.gracilis psbT twintron. Based on these data, the addition of introns to the ancestral psbT intron in the common ancester of E.viridis and E.gracilis gave rise to the psbT twintron in E.gracilis. Images PMID:8532514

  12. Preliminary data concerning the distribution of amphibian fauna in Suceava county (Romania

    Directory of Open Access Journals (Sweden)

    Alexandru STRUGARIU

    2006-05-01

    Full Text Available The present study focused upon an area in which the herpetofauna had previously been very poorly studied and aimed to identify the species of amphibians from the research area and to establish distribution areas. In the 54 investigated localities 16 species of amphibians (Salamandra salamandra, Triturus vulgaris, Triturus cristatus, Triturus alpestris, Triturus montandoni, Pelobates fuscus, Bombina bombina, Bombina variegata, Hyla arborea, Bufo bufo, Bufo viridis, Rana dalmatina, Rana temporaria, Rana arvalis, Rana ridibunda & Rana lessonae and 2 hybrids (Bombina bombina X Bombina variegata & Rana kl. esculanta have been identified. Of these, the Bombina hybrids have been identified for the first time in the studied region.

  13. Novel genomes and genome constitutions identified by GISH and 5S rDNA and knotted1 genomic sequences in the genus Setaria.

    Science.gov (United States)

    Zhao, Meicheng; Zhi, Hui; Doust, Andrew N; Li, Wei; Wang, Yongfang; Li, Haiquan; Jia, Guanqing; Wang, Yongqiang; Zhang, Ning; Diao, Xianmin

    2013-04-11

    The Setaria genus is increasingly of interest to researchers, as its two species, S. viridis and S. italica, are being developed as models for understanding C4 photosynthesis and plant functional genomics. The genome constitution of Setaria species has been studied in the diploid species S. viridis, S. adhaerans and S. grisebachii, where three genomes A, B and C were identified respectively. Two allotetraploid species, S. verticillata and S. faberi, were found to have AABB genomes, and one autotetraploid species, S. queenslandica, with an AAAA genome, has also been identified. The genomes and genome constitutions of most other species remain unknown, even though it was thought there are approximately 125 species in the genus distributed world-wide. GISH was performed to detect the genome constitutions of Eurasia species of S. glauca, S. plicata, and S. arenaria, with the known A, B and C genomes as probes. No or very poor hybridization signal was detected indicating that their genomes are different from those already described. GISH was also performed reciprocally between S. glauca, S. plicata, and S. arenaria genomes, but no hybridization signals between each other were found. The two sets of chromosomes of S. lachnea both hybridized strong signals with only the known C genome of S. grisebachii. Chromosomes of Qing 9, an accession formerly considered as S. viridis, hybridized strong signal only to B genome of S. adherans. Phylogenetic trees constructed with 5S rDNA and knotted1 markers, clearly classify the samples in this study into six clusters, matching the GISH results, and suggesting that the F genome of S. arenaria is basal in the genus. Three novel genomes in the Setaria genus were identified and designated as genome D (S. glauca), E (S. plicata) and F (S. arenaria) respectively. The genome constitution of tetraploid S. lachnea is putatively CCC'C'. Qing 9 is a B genome species indigenous to China and is hypothesized to be a newly identified species. The

  14. First record of a Neozygites species (Zygomycetes:Entomophthorales) infecting springtails (Insecta:Collembola)

    DEFF Research Database (Denmark)

    Steenberg, T.; Eilenberg, J.; Bresciani, J.

    1996-01-01

    succumbed to fungal disease following incubation in the laboratory. Based on these preliminary morphological studies the fungus appears to be an undescribed species of Neozygites. Field studies showed the fungus to be enzootic with a widespread geographical distribution in Denmark. At one location fungus......A fungal pathogen from the Entomophthorales (Zygomycetes) was discovered in populations of the lucerne flea Sminthurus viridis (Collembola) collected from grassland and leguminous crops in Denmark during July to October. The morphology of the fungus was studied in springtails, collected live, which...

  15. Nouvelles contributions a la connaisance de l'histoire de la vegetation holocene des Monts Rodnei (Carpates Orientales

    Directory of Open Access Journals (Sweden)

    Ioan Tant̡ău

    2004-09-01

    Full Text Available New Contributions to the Knowledge of the Holocene Vegetation History of Rodnei Mountains. Two sequences originating from one peat bog in Poiana Ştiol (Rodnei Mts. were pollen analyzed. The vegetation history is described since the Atlantic period. In this period the vegetation is dominated by Picea together with Corylus, Ulmus and Alnus viridis. The components frequencies of the Quercetum mixtum (Quercus, Fraxinus, Tilia, Corylus rarely exceed 10%. The vegetation of the Subboreal period is dominated by the Carpinus and that of the Subatlantic is dominated by Fagus. Picea pollen is well represented belong the entire sequences.

  16. Herbicide-induced changes in 14CO2 uptake of leaves of some crop and weed species

    International Nuclear Information System (INIS)

    Santakumari, M.; Rama Das, V.S.

    1980-01-01

    The effect of diuron or atrazine on the rate of photosynthetic 14 CO 2 uptake of two each crop (Pisum Sativum and Pennisetum typhoides) and weed species (Amaranthus viridis and Cyperus rotundus) was studied. The results indicated a marked inhibition of 14 CO 2 fixation of leaves within two hours after diuron or atrazine treatment. However the resistant plants were able to exhibit a recovery of the net photosynthetic rate subsequently while the susceptible plants failed to recover. The results suggested that even with fully open stomata and available NADPH, the normal CO 2 fixation was not restored by herbicide treated leaves. (author)

  17. Acute Intoxication following Dimethyltryptamine Ingestion

    Directory of Open Access Journals (Sweden)

    Matthew H. Bilhimer

    2018-01-01

    Full Text Available Ayahuasca is a hallucinogenic tea that is most commonly comprised of the vine Banisteriopsis caapi alone or in combination with other plants such as Psychotria viridis. This concoction results in an orally active form of dimethyltryptamine (DMT, a hallucinogenic amine. Despite use in South America as a medicinal agent and component in religious ceremonies, interest in its recreational use and spiritual effects has led to increased use in the United States. We describe a unique case following ingestion of ayahuasca tea in a patient with history of schizophrenia resulting in personal injury and property damage. A review of ayahuasca toxicity and evaluation of serious adverse effects is also presented.

  18. Acute Intoxication following Dimethyltryptamine Ingestion

    Science.gov (United States)

    Higgs, Kristan V.; Wiegand, Timothy J.; Gorodetsky, Rachel M.

    2018-01-01

    Ayahuasca is a hallucinogenic tea that is most commonly comprised of the vine Banisteriopsis caapi alone or in combination with other plants such as Psychotria viridis. This concoction results in an orally active form of dimethyltryptamine (DMT), a hallucinogenic amine. Despite use in South America as a medicinal agent and component in religious ceremonies, interest in its recreational use and spiritual effects has led to increased use in the United States. We describe a unique case following ingestion of ayahuasca tea in a patient with history of schizophrenia resulting in personal injury and property damage. A review of ayahuasca toxicity and evaluation of serious adverse effects is also presented. PMID:29682363

  19. Final Environmental Assessment Addressing Construction, Operation, and Maintenance of a Hot Cargo Pad at Kirtland Air Force Base, New Mexico

    Science.gov (United States)

    2011-01-01

    natural origins, with a flow direction to the southeast, and is not used for any purpose. The presence of faults has a direct bearing on the movement...filifolia), needle -and-thread grass (Stipa comata), globemallows (Sphaeralcea spp.), Siberian elm (Ulmus pumila), Mormon tea (Ephedra viridis), New...10 acres (lb/day) (lb/day) (lb/day) (lb/day) (lb/day) (lb/day) (lb/day) Paver 1 3.83 0.37 2.06 0.28 0.35 0.34 401.93 Roller 1 4.82 0.44 2.51 0.37

  20. A keystone mutualism drives pattern in a power function.

    Science.gov (United States)

    Vandermeer, John; Perfecto, Ivette

    2006-02-17

    Data that can be described by a power function are ubiquitous in nature. Although there is consensus that such data frequently emerge generally from nonlinear complex systems, a variety of specific mechanisms may be responsible for creating the pattern in particular cases. Here, we report on the distribution of a scale insect (Coccus viridis) that is a common agricultural pest. Its distribution in an organic coffee farm in southern Mexico generally follows a power function, but there are subtle deviations from that function. We offer a biological explanation for both adherence to the power functions and associated deviations, along with supporting evidence.

  1. Genome sequencing and annotation of Amycolatopsis vancoresmycina strain DSM 44592T

    Directory of Open Access Journals (Sweden)

    Navjot Kaur

    2014-12-01

    Full Text Available We report the 9.0-Mb draft genome of Amycolatopsis vancoresmycina strain DSM 44592T, isolated from Indian soil sample; produces antibiotic vancoresmycin. Draft genome of strain DSM44592T consists of 9,037,069 bp with a G+C content of 71.79% and 8340 predicted protein coding genes and 57 RNAs. RAST annotation indicates that strains Streptomyces sp. AA4 (score 521, Saccharomonospora viridis DSM 43017 (score 400 and Actinosynnema mirum DSM 43827 (score 372 are the closest neighbors of the strain DSM 44592T.

  2. Padrão inverso - elemento indígena toma forma urbana - o caso da ayahuasca

    OpenAIRE

    Carlos Eduardo Pacheco

    2012-01-01

    O presente projeto tem como tema principal a "circularidade cultural” que existe em torno da ayahuasca, uma bebida produzida através da mistura de duas plantas amazônicas: a bannisteriopsis caapi, chamado cipó-mariri, e a psychotria viridis, popularmente conhecida como chacrona. A pesquisa pretende compreender a relação de circularidade entre a cultura popular (indígena) e a cultura erudita (ocidental) deste patrimônio imaterial, que parece seguir um caminho contrário ao processo comum seguid...

  3. Bioactivity of Phycocolloids against the Mediterranean Protozoan Leishmania infantum: An Inceptive Study

    Directory of Open Access Journals (Sweden)

    Simona Armeli Minicante

    2016-11-01

    Full Text Available Sulfated polysaccharides from marine macroalgae have been shown to possess a variety of biological activities against fungi, bacteria, viruses, and protozoa. In this study, the in vitro activity of algal polysaccharides against Leishmania infantum (Kinetoplastida: Trypanosomatidae was investigated. The polysaccharides were extracted from different macroalgae of the Mediterranean Sea: Chaetomorpha linum, Agardhiella subulata, Gracilaria viridis, Gracilaria bursa-pastoris, Hypnea cornuta, Sargassum muticum, and Undaria pinnatifida. Preliminary results showed a good anti-leishmanial activity of the investigated species, encouraging the focus on their use as natural resources in order to match integrated management strategies for the employment of local macroalgae.

  4. A checklist of malacofauna of the Vellar Estuarine Mangroves, India

    Directory of Open Access Journals (Sweden)

    K. Kesavan

    2009-07-01

    Full Text Available A survey conducted to know the diversity of malacofauna in Vellar estuarine mangroves (southeast coast of India. In this study, 13 species of molluscs (10 species of gastropods - Melampus ceylonicus, Cerithidea cingulata, Cassidula nucleus, Pythia plicata, Neritina (Dostia violacea, Littorina scabra, Littorina melanostoma, Ellobium aurisjudae, C. obtusa T. telescopium and Assiminea nitida and 3 species of bivalves - Perna viridis, Crassostrea madrasensis and Modiolus metcalfei were recorded. M. pulchella, C. obtusa, L. scabra and N. violacea were found arboreal. T. telescopium, C. cingulata and E. aurisjudae were found crawling on the intertidal mud.

  5. Contact Dermatitis Due to Plants

    Directory of Open Access Journals (Sweden)

    A K Bajaj

    1982-01-01

    Full Text Available Forty-seven cases of suspected plant dermatitis were patch tested with extracts of various plants. Twenty-six showed positive patch tests to one or more plant antigens. Parthenium sensitivity was observed in nine cases. Trianthema monogyna, Carissa, carandus, Amaranthus viridis, Amaranthus spinosus, Euphorbia hirta, Euphorbia thymibolia, Salvia plebia, lantana camera and pennisetum typhoides were other important plants founds to be responsible for contact sensitivity. Majority of the patients were from rural areas and most of them showed exacerbation of the dermatitis during rainy season. Males and females were equally affected.

  6. [Spread of hemoparasites in reptiles and amphibians in Italy].

    Science.gov (United States)

    Ricci, M

    1999-12-01

    Hemoparasites were harvested from 993 individuals belonging to 15 reptilian and 1 amphibian species, from various Italian localities. Hemogregarins were found in 10 reptilian species while a flagellate and microfilariae were found only in Tarentola mauritanica from Lampedusa. For each host species and place of origin the frequencies of hemogregarins are reported and discussed. Longitudinal studies with periodical thin smears were carried out on 5 Tarentola mauritanica, 4 Lacerta viridis, 26 Podarcis filfolensis, 10 Podarcis muralis, 38 Podarcis sicula, 8 Chalcides ocellatus. This material, whose study has not yet been completed, is made available by the author who strongly encourages further investigations on this subject.

  7. REPRODUCTIVE FEATURES OF SEVERAL UKRAINIAN TRUE LIZARDS (LACERTIDAE

    Directory of Open Access Journals (Sweden)

    Karmishev Yu.

    2013-04-01

    Full Text Available This work presents data on reproductive features of Ukrainian fauna Lacertidae lizards in laboratory conditions and comparative data on lizards clutches in wild nature. Terms of egg incubation of these lizards in the laboratory in a stable, relatively low temperatures can significantly exceed those in nature, which allows to obtain embryonic material with a smooth, long process of development. The most prolific representatives of different majortypes - green lizard (Lacerta viridis and nimble (Lacerta agilis. Females sand lizard can be aggressive towards other females clutches, which is manifested in the destruction of nests.

  8. Фаунистический обзор ящериц Чехии

    OpenAIRE

    Кучера, Я.

    2009-01-01

    Приводятся данные о распространении, биотопическом распределении и численности 5 видов ящериц (Lacerta agilis, Lacerta viridis, Zootoca vivipara, Podarcis muralis, Anguis fragilis) в Чехии.

  9. Toxinas proteicas del veneno de serpientes del género Dendroaspis que reconocen receptores colinérgicos muscarínicos

    OpenAIRE

    Kornisiuk, Edgar E.

    1998-01-01

    Hace diez años se reportó la existencia de dos proteínas, MTx1 y MTx2, del veneno de la mamba verde oriental (Dendroaspis angusticeps) que inhibieron la unión de ligandos muscarínicos en cerebro de rata. Actualmente se han aislado más de diez toxinas muscarínicas (MTxs) de la mamba verde oriental, la mamba negra (D. polylepis) y la mamba verde occidental (D. viridis). Estas toxinas poseen 65-66 aminoácidos, con cuatro puentes disulfirro que les confieren una estructura de "tres dedos", tal co...

  10. Molecular discrimination of Perna (Mollusca: Bivalvia) species using the polymerase chain reaction and species-specific mitochondrial primers

    DEFF Research Database (Denmark)

    Blair, D.; Waycott, M.; Byrne, L.

    2006-01-01

    This work was prompted by the need to be able to identify the invasive mussel species, Perna viridis, in tropical Australian seas using techniques that do not rely solely on morphology. DNA-based molecular methods utilizing a polymerase chain reaction (PCR) approach were developed to distinguish...... designed that can act as a forward primer in PCRs for any Perna species. Four reverse primers have also been designed, based on nad4 and intergenic spacer sequences, which yield species-specific products of different lengths when paired with the conserved forward primer. A further pair of primers has been...

  11. New records of Decapod Crustaceans (Decapoda: Pontoniinae and Inachidae associated with sea anemones in Turkish waters

    Directory of Open Access Journals (Sweden)

    Z. DURIS

    2013-10-01

    Full Text Available Three anemone-associated decapod crustaceans, two shrimp species, Periclimenes amethysteus and P. aegylios (Caridea: Palaemonidae: Pontoniinae, and the crab Inachus phalangium (Brachyura: Inachidae, all collected from the Dardanelles, are reported for the first time from Turkish coasts. Another inachid crab, Macropodia czernjawskii is also reported for the first time to occur in association with the sea anemone, Anemonia viridis. Periclimenes scriptus was the fifth decapod species recorded associated with sea anemones within the present study, and while this species has already been reported from Turkish waters, this is the first time it is recorded from the Dardanelles (the Turkish Straits System.

  12. Mating opportunities in Sangalopsis veliterna females: Costs and benefits

    Science.gov (United States)

    Hernández Duran, Linda C.; Fajardo Medina, Gonzalo E.; Fuentes Quinter, Luz S.; Martin, Oliver

    2014-01-01

    Abstract In nature, females of several animal taxa exhibit considerable variation in their mating system, and this variation involves different balances of costs (e.g., energetic, reproductive) and benefits (e.g., increased net reproductive rate of the female, increased longevity). Many studies have focused on discovering the potential advantages and disadvantages that females could have when increasing their mating rate and the possible evolutionary consequences that may result. Butterflies and moths are an ideal study system because it is easy to determine and to manipulate experimentally their mating frequency. In this study, the effect of continuous availability of different numbers of males (1, 2, 4, 8) on female mating rate and fitness components was estimated by comparing the number of spermatophores in the corpus bursa (an estimate of the number of copulations, but not of the number males involved in these copulations), female longevity, lifetime number of laid eggs (fecundity), and proportion of hatching eggs (fertility) in the moth Sangalopsis veliterna Druce (Lepidoptera: Geometridae). The results showed that there were no significant differences in either fertility or fecundity when treatments were compared, but longevity and in some cases fecundity increased when females had several matings. Resumen En la naturaleza, hembras de varios taxa animal muestran una variación considerable en su sistema de apareamiento, esta variación involucra diferentes costos (energéticos, reproductivos, etc) y beneficios (aumento de la tasa reproductiva neta de la hembra, mayor longevidad, entre otros). En años recientes, muchos estudios se han enfocado en descubrir las potenciales ventajas y desventajas que las hembras podrían tener al aumentar su número de cópulas y las posibles consecuencias evolutivas que podrían resultar. Las mariposas y polillas son un sistema de estudio ideal, dada la facilidad para determinar y manipular experimentalmente su frecuencia de

  13. Parasitóides Associados a Cochonilhas e Aleirodídeos (Sternorrhyncha de Plantas Cítricas no Estado do Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    William Rodrigues

    2012-03-01

    Abstract. With the purpose of knowing parasitids of scales and whiteflies, associates to the citrus plants in Rio de Janeiro State, they were accomplished leaves collected contend fitoparasits: Aleurothrixus floccosus (Maskell, Tetraleurodes (=Aleurotrachelus cruzi (Cassino, Paraleyrodes bondari Peracchi, Coccus viridis (Green, Crysomphalus ficus (Ashmead, Orthezia praelonga (Douglas and Pinnaspis aspidistrae (Signoret, being this ones clean, it soon after proceded the organism elimination that was study object (each leaf remained with an only species of fitoparasite, so that parasitoids that had arisen had gone same associate to that species. After this procedure the leaves were incubate for a period of 25 days, when it was observed only parasitism in A. floccosus, P. aspidistrae, C. viridis and T. cruzi, and parasitoids of this the latter, not identified because the number specimens was very reduced. It was parasiting A. floccosus it observed: Arrhenophagus sp., Cales sp., Encarsia sp. (1, Eretmocerus sp., Signiphora sp. (1, Signiphora sp. (2, Signiphora sp. (3 and a species of the family Platygasteridae. Parasiting P. aspidistrae it was observed: Arrhenophagus sp., Cales sp., Encarsia sp. (2 and Pteroptrix sp. Some species are associated either to A. floccosus or to P. aspidistrae. By the results it was verified that Arrhenophagus sp. the parasitism and the species of the family Platygasteridae in A. floccosus and parasitism of Arrhenophagus sp. and Pteroptrix sp. in P. aspidistrae, they are occurrence new record for do Rio de Janeiro State

  14. Assessing the Influence of the Automobile Traffic on the Amphibians and Reptiles in the Buffer Zone of Biosphere Reserve “Srebarna” (NE Bulgaria

    Directory of Open Access Journals (Sweden)

    Ivelin A. Mollov

    2013-12-01

    Full Text Available Currently the problem of the effects of the road network and traffic on the amphibians and reptiles in Bulgaria is poorly studied. During the period March 2002 - March 2004 in the Buffer Zone of Biosphere Reserve "Srebarna" (NE Bulgaria were built two anti-fire roads from the eastern and western side of the lake in area of grasslands of semi-steppe type, typical for north-eastern Bulgaria. The aim of the constructed roads is to provide access for fire vehicles to areas in and around the reserve. The current study aims to provide data on the impact of road traffic and the newly constructed road network and another previously existing road on the amphibians and reptiles inhabiting the buffer zone of the biosphere reserve "Srebarna". For the entire period of study in the three studied road sections a total of 15 dead specimens of amphibians belonging to 4 species (Bombina bombina, Hyla arborea, Bufo bufo, Bufo viridis and 70 dead specimens of reptiles belonging to 8 species (Emys orbicularis, Ablepharus kitaibelii, Lacerta viridis, Podarcis tauricus, Podarcis muralis, Natrix natrix, Coronella austriaca and Dolichophis caspius were recorded. Several “hot spots”, where most cadavers were recorded are well described and possible conservation measures are discussed.

  15. Studies on the variations in the settlement of macrofoulants in Kalpakkam coastal waters, east coast of India

    International Nuclear Information System (INIS)

    Sahu, Gouri; Prasad, M.V.R.; Satpathy, K.K.; Biswas, S.; Selvanaygam, M.

    2008-01-01

    Biofouling studies in the coastal waters of Kalpakkam were carried out with an aim to delineate the present seasonal succession and fouling potential of macrofoulants, the dominant species and their breeding period. Three series (weekly, monthly and cumulative at 30 d interval observations) of teak wood panels were exposed to coastal waters from a jetty. A marked variation was observed in the colonization of the biofoulers on the weekly panels during the present study. The highest and lowest numbers of organisms observed were 136 and 1 per sq. cm respectively. Dominance of barnacles (12.4 - 99 %) on weekly panels was found throughout the study period. A climax community of green mussels (Perna viridis) was observed in the cumulative observations. Biofouling biomass of weekly panels varied between 1 and 11 g. (100 cm) -2 , however, a steep increase in biomass was observed in 28 d (77 g. (100 cm) -2 ), 56 d (97 g. (100 cm) -2 ), 112 d (185 g. (100 cm) -2 ) and 150 d (648 g. (100 cm) -2 ) old panels. In the present study, the biomass values found to be significantly higher than those of the earlier reported values (33 and 52 g. (100 cm) -2 in 43 d and 128 d exposure respectively). Interestingly, a visible shift in the peak settlement period of green mussels (Perna viridis) was observed in the present investigation, as compared to the earlier study. (author)

  16. Abejas englosinas de Colombia (Hymenoptera: Apidae I. Claves ilustradas Abejas englosinas de Colombia (Hymenoptera: Apidae I. Claves ilustradas

    Directory of Open Access Journals (Sweden)

    Bonilla Gómez María Argenis

    1992-09-01

    Full Text Available One hundred and eight euglossine bee species are registered for Colombia, distributed in five genera: Aglae (1, Eufriesea (30, Euglossa (60, Eulaema (13 and Exaerete (4. New records for Colombia include: Eufriesea auripes, Ef. dressleri, Ef. fragrocara, Ef. xantha, Euglossa viridis, Eg. azureoviridis, Eg. cognata, Eg. singularis, EI. boliviensis, EI. seabrai and EI mocsaryi. Keys are given for males and females of Aglae, Exaerete, Eulaema and Eufriesea and for males of Euglossa of the 108 Colombian euglossines. A key for the subgenera of Euglossa is presented by the first time. Revisando diferentes fuentes de literatura y colecciones de abejas en Colombia y el exterior se encontró para Colombia un total de 108 especies de abejas de la subfamilia Euglossinae repartidas en 5 géneros: Aglae (1 especie, Eufriesea (30 especies, Euglossa (60 especies, Eulaema (13 especies y Exaerete (4 especies. Se registran por primera vez para Colombia 11 especies de abejas euglosinas: Eufriesea auripes, Ef. fragrocara, Ef. dressleri, Ef. xantha, Euglossa viridis, Eg. cognata, Eg. singularis, Eg. azureoviridis, Eulaema boliviensis, EI. seabrai y EI. mocsaryi. Se presentan claves para las 108 especies de los 5 géneros así, machos y hembras de Eufriesea, Exaerete y Aglae y los machos de Euglossa y por primera vez una clave para los subgéneros de Euglossa.

  17. Spatial Distribution and a Retrospective Analysis of the Herpetofauna in the City of Plovdiv, Bulgaria

    Directory of Open Access Journals (Sweden)

    Ivelin A. Mollov

    2010-12-01

    Full Text Available The current study presents the contemporary status and distribution of theamphibians and reptiles in the city of Plovdiv. To track changes in the status ofamphibians and reptiles in the research area through time, a retrospective analysis wasmade based on available literary data. During the past 100 years four species ofamphibians (Triturus karelinii, Lissotriton vulgaris, Bombina bombina, B. variegata and fourspecies of reptiles (Coronella austriaca, Zamenis longissimus, Elaphe sauromates, Viperaammodytes probably have disappeared from the study area; one amphibian species (Bufobufo and one reptile (Natrix natrix have not changed their status, one amphibian(Pelobates syriacus and two reptile species (Ablepharus kitaibelii, Podarcis muralis havereduced their localities and four amphibian species (Epidalea viridis, Rana dalmatina,Pelophylax ridibundus, Hyla arborea and seven species of reptiles (Mediodactylus kotschyi,Lacerta trilineata, Lacerta viridis, Podarcis tauricus, Emys orbicularis, Dolichophis caspius,Natrix tessellata have increased their localities and frequency of occurrence. The recordsof the two tortoise species (Testudo hermanni and T. graeca in the city, and the presence ofthe Red-eared slider (Trachemys scripta elegans should be considered as accidental.Important Herpetological Areas (IHA in the study region are also identified.

  18. Molluscicidal activity of some marine substances against the snail Biomphalaria glabrata (Mollusca, Planorbidae).

    Science.gov (United States)

    Miyasato, P A; Kawano, T; Freitas, J C; Berlinck, R G S; Nakano, E; Tallarico, L F

    2012-05-01

    Freshwater snails of the genus Biomphalaria play a major role as intermediate hosts of Schistosoma mansoni, the etiologic agent of schistosomiasis. While Biomphalaria spp. control by molluscicides is one of the main strategies to reduce the snail population in infected areas, there are few effective molluscicides commercially available. Natural products may be considered as potentially useful and safe molluscicides. We have evaluated the molluscicidal activity of 12 extracts from ten marine organisms on adult and embryonic stages of Biomphalaria glabrata. Only extracts of the red algae Liagora farinosa and of the sponge Amphimedon viridis presented molluscicidal activity. Lethal concentration (LC)(50) values obtained were 120 μg/mL for L. farinosa CH(2)Cl(2) extract (apolar fraction) and 20 μg/mL for A. viridis extract and halitoxin. The polar alga fraction and halitoxin had no effect on B. glabrata embryos. The algae apolar fraction was active on B. glabrata in all embryonic development stages, with LC(50) values for blastulae at 42 μg/mL, gastrulae at 124 μg/mL, trochophore at 180 μg/mL, and veliger at 222 μg/mL. This is the first report of extracts from marine organisms which presented molluscicidal activity.

  19. Gas chromatographic analysis of dimethyltryptamine and beta-carboline alkaloids in ayahuasca, an Amazonian psychoactive plant beverage.

    Science.gov (United States)

    Pires, Ana Paula Salum; De Oliveira, Carolina Dizioli Rodrigues; Moura, Sidnei; Dörr, Felipe Augusto; Silva, Wagner Abreu E; Yonamine, Mauricio

    2009-01-01

    Ayahuasca is obtained by infusing the pounded stems of Banisteriopsis caapi in combination with the leaves of Psychotria viridis. P. viridis is rich in the psychedelic indole N,N-dimethyltryptamine, whereas B. caapi contains substantial amounts of beta-carboline alkaloids, mainly harmine, harmaline and tetrahydroharmine, which are monoamine-oxidase inhibitors. Because of differences in composition in ayahuasca preparations, a method to measure their main active constituents is needed. To develop a gas chromatographic method for the simultaneous determination of dimethyltryptamine and the main beta-carbolines found in ayahuasca preparations. The alkaloids were extracted by means of solid phase extraction (C(18)) and detected by gas chromatography with nitrogen/phosphorous detector. The lower limit of quantification (LLOQ) was 0.02 mg/mL for all analytes. The calibration curves were linear over a concentration range of 0.02-4.0 mg/mL (r(2 )> 0.99). The method was also precise (RSD ayahuasca was developed and validated. The method can be useful to estimate administered doses in animals and humans for further pharmacological and toxicological investigations of ayahuasca. Copyright (c) 2009 John Wiley & Sons, Ltd.

  20. Ayahuasca: Pharmacology, neuroscience and therapeutic potential.

    Science.gov (United States)

    Domínguez-Clavé, Elisabet; Soler, Joaquim; Elices, Matilde; Pascual, Juan C; Álvarez, Enrique; de la Fuente Revenga, Mario; Friedlander, Pablo; Feilding, Amanda; Riba, Jordi

    2016-09-01

    Ayahuasca is the Quechua name for a tea obtained from the vine Banisteriopsis caapi, and used for ritual purposes by the indigenous populations of the Amazon. The use of a variation of the tea that combines B. caapi with the leaves of the shrub Psychotria viridis has experienced unprecedented expansion worldwide for its psychotropic properties. This preparation contains the psychedelic 5-HT 2A receptor agonist N,N-dimethyltryptamine (DMT) from P. viridis, plus β-carboline alkaloids with monoamine-oxidase-inhibiting properties from B. caapi. Acute administration induces a transient modified state of consciousness characterized by introspection, visions, enhanced emotions and recollection of personal memories. A growing body of evidence suggests that ayahuasca may be useful to treat substance use disorders, anxiety and depression. Here we review the pharmacology and neuroscience of ayahuasca, and the potential psychological mechanisms underlying its therapeutic potential. We discuss recent findings indicating that ayahuasca intake increases certain mindfulness facets related to acceptance and to the ability to take a detached view of one's own thoughts and emotions. Based on the available evidence, we conclude that ayahuasca shows promise as a therapeutic tool by enhancing self-acceptance and allowing safe exposure to emotional events. We postulate that ayahuasca could be of use in the treatment of impulse-related, personality and substance use disorders and also in the handling of trauma. More research is needed to assess the full potential of ayahuasca in the treatment of these disorders. Copyright © 2016 Elsevier Inc. All rights reserved.

  1. Postharvest management affects spearmint and calamint essential oils.

    Science.gov (United States)

    Tibaldi, Giorgio; Fontana, Emanuela; Nicola, Silvana

    2013-02-01

    The objectives of this work were to evaluate the phytomass yield, essential oil (EO) content and EO yield of Mentha spicata L. var. rubra, M. spicata L. var. viridis and Calamintha nepeta Savi in Piedmont (Italy), and to study how postharvest management (hydrodistillation of EO from fresh, dehumidified or oven-dried herbs) can affect the EO content and profile of the three species. Mentha spicata L. var. rubra gave the greatest phytomass yield (1997 g m(-2)), which was statistically different from M. spicata L. var. viridis and C. nepeta. The highest EO yield was obtained from C. nepeta (3.75 g m(-2)), which was significantly different from the Mentha genus. Postharvest management significantly affected both the EO content and the EO profile of each species, with the dehumidifying process leading to a significantly higher EO content than the oven-drying process. The EO profile was different not only from species to species but also because of the postharvest management. The dehumidifying process is a relatively new postharvest technology that has shown positive results in terms of EO yield, and it can be applied to species which have a high EO value, after evaluation of the resulting EO profile. Copyright © 2012 Society of Chemical Industry.

  2. Studies on mutagenic effectiveness and efficiency of gamma rays and its effect on quantitative traits in finger millet (Eleusine coracana L. Gaertn

    Directory of Open Access Journals (Sweden)

    A.R. Ambavane

    2015-01-01

    Full Text Available Dry seeds (12% moisture of two finger millet cultivar viz., Dapoli-1 and Dapoli Safed were irradiated with four doses of gamma-rays viz., 400 Gy, 500 Gy, 600 Gy and 700 Gy at BARC, Mumbai. In laboratory test, root and shoot lengths of seedlings were decreased with increase in dose of gamma rays. Similarly, germination percentage and survival rate of seedlings were decreased with increase in dose of gamma irradiation during field study. In M1 generation, three types of chlorophyll mutations viz., albino, xantha and viridis were observed. Albino and xantha were observed in all treatments, whereas, viridis observed only in lower doses viz., 400 Gy and 500 Gy. Based on the chlorophyll mutation frequency on M1 plants, mutagenic effectiveness and efficiency were computed. In Dapoli-1 variety, two early maturing mutants and three high yielding mutants were isolated from 500 Gy dose and 600 Gy dose, respectively. In M2 generation, the mutagenic treatments were effective in inducing various types of chlorophyll and morphological macro mutants, few of those show significant change in flowering, maturity and plant height character and few of them have good breeding value.

  3. Phylogeny and revision of the bee genus Rhinocorynura Schrottky (Hymenoptera, Apidae, Augochlorini, with comments on its female cephalic polymorphism

    Directory of Open Access Journals (Sweden)

    Rodrigo B. Gonçalves

    2012-03-01

    Full Text Available Phylogeny and revision of the bee genus Rhinocorynura Schrottky (Hymenoptera, Apidae, Augochlorini, with comments on its female cephalic polymorphism. A taxonomic revision and a phylogeny for the species of Rhinocorynura are provided. Six species are recognized: R. briseis, R. crotonis, R. inflaticeps and R. vernoniae stat. nov., the latter removed from synonymy with R. inflaticeps, in addition to two newly described species, R. brunnea sp. nov. and R. viridis sp. nov. Lectotypes for Halictus crotonis Ducke, 1906 and Halictus inflaticeps Ducke, 1906 are hereby designated. Another available name included in Rhinocorynura, Corynuropsis ashmeadi Schrottky, 1909, is removed from the genus and treated as species inquerenda in Augochlorini. Rhinocorynura is monophyletic in the phylogenetic analysis and the following relationships were found among its species: (R. crotonis (R. briseis ((R. brunnea sp. nov. + R. viridis sp. nov. (R. inflaticeps + R. vernoniae. Biogeographic relationships within the genus and comparisons with related taxa are presented. Females of all species exhibit pronounced variation in body size, in two of them, R. inflaticeps and R. vernoniae, with structural modifications possibly linked to division of labor. Identification key and illustrations for the species are provided.

  4. Trace metals in different species of mollusca, water and sediments from Taiwan coastal area.

    Science.gov (United States)

    Hung, T C; Meng, P J; Han, B C; Chuang, A; Huang, C C

    2001-08-01

    Since October 1994, a long-term program of Asia/Pacific Mussel Watch: Taiwan Regional Studies has been carried out. The results indicate that trace metal contents in mollusca varied among 30 different species and the environments (water and sediments) along the Taiwan coast. The orders of bioaccumulation of trace metals in mollusca were: Cu (over 200 microg/g), Thais clavigera > Isognomon legumen > Clibanarius rivescens > Crassostrea gigas; Zn (over 700 microg/g), Moruta granulata > C. gigas > Asiatica cypraea arabica > T. clavigera; Cd (over 5 microg/g), Trochus hanleyanus > Acanthopleura japonica > Nerita albicilla > Patella flexuosa; Pb (over 2 microg/g), P. flexuosa > C. gigas > T. hanleyanus > T. clavigera > C. gigas > Capiyulum mitella; Ni (over 10 microg/g), Meretrix lusoria > Philine sp. > Littoraria scabra > Tridacna squamosa > T. hanleyanus; Cr (over 30 microg/g), Littoraria undulata > T. hanleyanus > N. albicilla > Nerita chamaelor > M. granulata; As (over 20 microg/g), Perna viridis > L. scabra; and Sn (over 5 microg/g), P. viridis > L. undulata> C. mitella> C. gigas. Their seasonal and regional variations as well as their correlation are evaluated and discussed.

  5. The effect of chlorsulfurone and MCPB-Na on the enzymatic activity of microorganisms

    Directory of Open Access Journals (Sweden)

    Filimon Marioara Nicoleta

    2014-01-01

    Full Text Available herbicides, have a broad spectrum effect on weeds, in relatively low doses and with a much reduced toxicity on livestock. In this study were used two herbicides: dacsulfuron with the active substance chlorsulfuron (0.005 - 0.035 μg/g soil and butoxone with the active substance MCPB-Na (0.005 - 0.035 mg/L/g soil. The samples were collected from a depth of 0-20 cm from chernozem soil. The effect of herbicide was estimated by measuring the activity of catalase, actual and potential dehydrogenase, urease and cellulase activities. All samples being incubated for 10 days at 27°C using Sapp medium for isolation and study of cellulosolytic bacteria. The inhibitory effect of the tested herbicides was the most intense for the urease and dehydrogenase enzymatic activities. The most resistant cellulosolytic bacteria to the effects of dacsulfuron were Cellfalcicula fusca, Cellfalcicula viridis, Cellvibrio fulvus and Fuseaux veris and for butoxone Cellfalcicula mucosa, C. viridis and C. fulvus.

  6. Identification and functional analysis of a novel bradykinin inhibitory peptide in the venoms of New World Crotalinae pit vipers

    International Nuclear Information System (INIS)

    James Graham, Robert Leslie; Graham, Ciaren; McClean, Stephen; Chen, Tianbao; O'Rourke, Martin; Hirst, David; Theakston, David; Shaw, Chris

    2005-01-01

    A novel undecapeptide has been isolated and structurally characterized from the venoms of three species of New World pit vipers from the subfamily, Crotalinae. These include the Mexican moccasin (Agkistrodon bilineatus), the prairie rattlesnake (Crotalus viridis viridis), and the South American bushmaster (Lachesis muta). The peptide was purified from all three venoms using a combination of gel permeation chromatography and reverse-phase HPLC. Automated Edman degradation sequencing and MALDI-TOF mass spectrometry established its peptide primary structure as: Thr-Pro-Pro-Ala-Gly-Pro-Asp-Val-Gly-Pro-Arg-OH, with a non-protonated molecular mass of 1063.18 Da. A synthetic replicate of the peptide was found to be an antagonist of bradykinin action at the rat vascular B2 receptor. This is the first bradykinin inhibitory peptide isolated from snake venom. Database searching revealed the peptide to be highly structurally related (10/11 residues) with a domain residing between the bradykinin-potentiating peptide and C-type natriuretic peptide domains of a recently cloned precursor from tropical rattlesnake (Crotalus durissus terrificus) venom gland. BIP thus represents a novel biological entity from snake venom

  7. Robust biological nitrogen fixation in a model grass-bacterial association.

    Science.gov (United States)

    Pankievicz, Vânia C S; do Amaral, Fernanda P; Santos, Karina F D N; Agtuca, Beverly; Xu, Youwen; Schueller, Michael J; Arisi, Ana Carolina M; Steffens, Maria B R; de Souza, Emanuel M; Pedrosa, Fábio O; Stacey, Gary; Ferrieri, Richard A

    2015-03-01

    Nitrogen-fixing rhizobacteria can promote plant growth; however, it is controversial whether biological nitrogen fixation (BNF) from associative interaction contributes to growth promotion. The roots of Setaria viridis, a model C4 grass, were effectively colonized by bacterial inoculants resulting in a significant enhancement of growth. Nitrogen-13 tracer studies provided direct evidence for tracer uptake by the host plant and incorporation into protein. Indeed, plants showed robust growth under nitrogen-limiting conditions when inoculated with an ammonium-excreting strain of Azospirillum brasilense. (11)C-labeling experiments showed that patterns in central carbon metabolism and resource allocation exhibited by nitrogen-starved plants were largely reversed by bacterial inoculation, such that they resembled plants grown under nitrogen-sufficient conditions. Adoption of S. viridis as a model should promote research into the mechanisms of associative nitrogen fixation with the ultimate goal of greater adoption of BNF for sustainable crop production. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

  8. Air-borne Contact Dermatitis in Varanasi

    Directory of Open Access Journals (Sweden)

    K K Singh

    1986-01-01

    Full Text Available Forty-six patients suspected to have air borne contact dermatitis were tested with various plant antigens. Thirteen patients turned out to be sensitive to one or more antigens. The plant antigens, used for testing, were Parthenium hysterophorus, Lantana camara, Cynodon dactylon, Bougainvaled spectabills, calotropis procera, Argimone mexicana, Acacia arabica, Azadiracha indica, Eucalyptus rostrata, Saraka indica, triticum vulgare, Triticum aestivum, Dryopteris filix, Nerium indicum, Eclipta alba, Mangifera indica, Trianthema monogyna, Euphorbia hirta, Euphorbia thimifolia, Amaranthus spinosus, Amaranthus viridis, Carissa carands, Salvia plebia, Cyperus rotandus, Cassia occidentalis, Gynandropsis gynandra, Pennisetum typhoides, chenopodium album, Nicotana tobacum, Tagetes sp, Rosa indica, Cestrum nocturnum, Helianthus annus, Jasminum samlae, Thuja orientalis, Cajanus cajan, Hibiscus rosasinensis, Echinochloa cruss-galli, Phaseolus aureus, Ricinus communis and Alternantheria sessilis. The maximum positive reactions were elicited by Parthenium hysterophorus (30.0% followed in the order of frequency by Amarnthus viridis (10.0% Gynandropsis gynandra (10.0% Pennisetum typhoides (10.0%, Nerium indicum (3.9%, Triticum vulgare (2.5% and Dryopteris filix (2.5%. Rest of the plant antigens did not show any reaction. The male to female ratio was 5.5:1.

  9. Optimization of preservation and processing of sea anemones for microbial community analysis using molecular tools.

    Science.gov (United States)

    Rocha, Joana; Coelho, Francisco J R C; Peixe, Luísa; Gomes, Newton C M; Calado, Ricardo

    2014-11-11

    For several years, knowledge on the microbiome associated with marine invertebrates was impaired by the challenges associated with the characterization of bacterial communities. With the advent of culture independent molecular tools it is possible to gain new insights on the diversity and richness of microorganisms associated with marine invertebrates. In the present study, we evaluated if different preservation and processing methodologies (prior to DNA extraction) can affect the bacterial diversity retrieved from snakelocks anemone Anemonia viridis. Denaturing gradient gel electrophoresis (DGGE) community fingerprints were used as proxy to determine the bacterial diversity retrieved (H'). Statistical analyses indicated that preservation significantly affects H'. The best approach to preserve and process A. viridis biomass for bacterial community fingerprint analysis was flash freezing in liquid nitrogen (preservation) followed by the use of a mechanical homogenizer (process), as it consistently yielded higher H'. Alternatively, biomass samples can be processed fresh followed by cell lyses using a mechanical homogenizer or mortar &pestle. The suitability of employing these two alternative procedures was further reinforced by the quantification of the 16S rRNA gene; no significant differences were recorded when comparing these two approaches and the use of liquid nitrogen followed by processing with a mechanical homogenizer.

  10. Oxygen consumption in the lizard genus Lacerta in relation to diel variation, maximum activity and body weight.

    Science.gov (United States)

    Cragg, P A

    1978-12-01

    1. Diel recordings of VO2 under a 12 h Light/12 h Dark regime, constant light or constant dark reveal a strong endogenous diurnal rhythm in L. sicula. L. vivipara show an exogeneous rhythm with activity occurring only in the light whilst L. viridis have a weak endogeneous rhythm that is modified by behavioural factors and inhibited by dark. 2. Standard (or basal) VO2 can only be attained after several hours in an 'indifferent' environment, shielded from extraneous stimuli. Measurements must be at night (light or dark) for unrestrained L. sicula and in the dark (day or night, restrained or unrestrained) for L. vivipara and L. viridis. Intrageneric std VO2 (ml h-1 STPD) = 0.328 W0.76 or 0.216 W0.77 for 1- or 3-days starvation at 30 degrees C for 0.2 to 34 g Lacerta. 3. Intrageneric maximum VO2 (determined for 30 to 60 s of provoked activity during the day) = 2.66 W0.747 at 30 degrees C for 1-days starvation. 4. Respiratory exchange ratio, R = 0.75 or 0.85 for std VO2 after 1 or 3 days starvation and 0.95 and 1.45 for mean daily and max VO2. High R values are considered a result of anaerobic metabolism and hyperventilation during activity.

  11. Temperature, but not available energy, affects the expression of a sexually selected ultraviolet (UV colour trait in male European green lizards.

    Directory of Open Access Journals (Sweden)

    Katalin Bajer

    Full Text Available BACKGROUND: Colour signals are widely used in intraspecific communication and often linked to individual fitness. The development of some pigment-based (e.g. carotenoids colours is often environment-dependent and costly for the signaller, however, for structural colours (e.g. ultraviolet [UV] this topic is poorly understood, especially in terrestrial ectothermic vertebrates. METHODOLOGY/PRINCIPAL FINDINGS: In a factorial experiment, we studied how available energy and time at elevated body temperature affects the annual expression of the nuptial throat colour patch in male European green lizards (Lacerta viridis after hibernation and before mating season. In this species, there is a female preference for males with high throat UV reflectance, and males with high UV reflectance are more likely to win fights. We found that (i while food shortage decreased lizards' body condition, it did not affect colour development, and (ii the available time for maintaining high body temperature affected the development of UV colour without affecting body condition or other colour traits. CONCLUSIONS/SIGNIFICANCE: Our results demonstrate that the expression of a sexually selected structural colour signal depends on the time at elevated body temperature affecting physiological performance but not on available energy gained from food per se in an ectothermic vertebrate. We suggest that the effect of high ambient temperature on UV colour in male L. viridis makes it an honest signal, because success in acquiring thermally favourable territories and/or effective behavioural thermoregulation can both be linked to individual quality.

  12. Temperature, but not available energy, affects the expression of a sexually selected ultraviolet (UV) colour trait in male European green lizards.

    Science.gov (United States)

    Bajer, Katalin; Molnár, Orsolya; Török, János; Herczeg, Gábor

    2012-01-01

    Colour signals are widely used in intraspecific communication and often linked to individual fitness. The development of some pigment-based (e.g. carotenoids) colours is often environment-dependent and costly for the signaller, however, for structural colours (e.g. ultraviolet [UV]) this topic is poorly understood, especially in terrestrial ectothermic vertebrates. In a factorial experiment, we studied how available energy and time at elevated body temperature affects the annual expression of the nuptial throat colour patch in male European green lizards (Lacerta viridis) after hibernation and before mating season. In this species, there is a female preference for males with high throat UV reflectance, and males with high UV reflectance are more likely to win fights. We found that (i) while food shortage decreased lizards' body condition, it did not affect colour development, and (ii) the available time for maintaining high body temperature affected the development of UV colour without affecting body condition or other colour traits. Our results demonstrate that the expression of a sexually selected structural colour signal depends on the time at elevated body temperature affecting physiological performance but not on available energy gained from food per se in an ectothermic vertebrate. We suggest that the effect of high ambient temperature on UV colour in male L. viridis makes it an honest signal, because success in acquiring thermally favourable territories and/or effective behavioural thermoregulation can both be linked to individual quality.

  13. Fatal chytridiomycosis and infection loss observed in captive toads infected in the wild

    Directory of Open Access Journals (Sweden)

    Vojtech Baláž

    2013-01-01

    Full Text Available A parasitic fungus, Batrachochytrium dendrobatidis is now recognised as an important factor in the amphibian biodiversity crisis. Toad species of the genus Bufo are among those susceptible to infection by the pathogen in Europe. The aim of this study was to observe the presence and impact of infection in adults of two toad species collected for captive breeding. The total number of animals included in the study was 162, but only subsets were used for sampling at different occasions (35 specimens in the initial sampling in summer 2011, 48 post hibernation during winter 2011, and 31 in summer 2012, after all toads in captivity were treated with itraconazole. We performed TaqMan real-time quantification PCR to detect and quantify the pathogen. We found that a large infection load was linked to mortality in a single adult green toad (Bufo viridis. However, low infection loads observed in five B. viridis and five natterjack toads (B. calamita were lost over time, with no apparent adverse effect. Intraconazole treated animals were all clear of infection. As infection in these two toad species either led to mortality or recovery, it seems unlikely they could act as permanent carriers of B. dendrobatidis and therefore persistence of the pathogen is likely maintained by different host species. This is the first study to date that has detected infection and observed its impact and persistence in wild-infected toads in Europe.

  14. Prairie rattlesnake envenomation in 27 New World camelids.

    Science.gov (United States)

    Sonis, J M; Hackett, E S; Callan, R J; Holt, T N; Hackett, T B

    2013-01-01

    Morbidity and case fatality from rattlesnake envenomation is regionally specific because of variability in relative toxicity of the species of snake encountered. A previous report of rattlesnake envenomation in New World camelids (NWC) from the western coastal United States documented high case fatality rates and guarded prognosis for survival. To describe clinical findings, treatments, and outcome of NWC with prairie rattlesnake (Crotalus viridis viridis) envenomation in the Rocky Mountain region of the United States. Twenty-seven NWC admitted to the Colorado State University Veterinary Teaching Hospital for evaluation of acute rattlesnake envenomation between 1992 and 2012. Medical records of NWC evaluated for rattlesnake envenomation as coded by the attending clinician and identified by a database search were reviewed retrospectively. Month of admission, signalment, area of bite, clinical and clinicopathologic data, treatments, and outcome were recorded. Twenty-five llamas and 2 alpacas were admitted for envenomation. Llamas were overrepresented compared to hospital caseload. The face was the most common site of envenomation, observed in 96% of recorded cases. Presenting clinical signs included fever, tachypnea, tachycardia, and respiratory distress. Nine animals required a tracheotomy. Median hospitalization time was 3 days and overall survival rate was 69%. Case fatality rate for prairie rattlesnake envenomation in NWC was lower than that reported in the Western coastal region of the United States and similar to that reported for prairie rattlesnake envenomation in horses. Copyright © 2013 by the American College of Veterinary Internal Medicine.

  15. Investigation of Nematopsis spp. oocysts in 7 species of bivalves from Chonburi province, Gulf of Thailand.

    Science.gov (United States)

    Tuntiwaranuruk, C; Chalermwat, K; Upatham, E S; Kruatrachue, M; Azevedo, C

    2004-01-28

    This is the first detailed report of Nematopsis spp. in Thai bivalves. A monthly survey was conducted on 7 species of commercial bivalves from Chonburi province, on the eastern seaboard of Thailand, from November 2000 to November 2001 to investigate the prevalence of the apicomplexan parasite Nematopsis Schneider, 1892. Nematopsis spp. sporozoites were found in the cultivated bivalves Arcuatula arcuatula, Anadara granosa and Perna viridis as well as the locally harvested Paphia undulata. They were not found in Donax faba, Meretrix meretrix or Saccostrea cucullata. Using light microscopy, we were able to identiby 4 oocyst morphotypes of the gregarine Nematopsis spp. Prevalence of Nematopsis spp. during the 13 mo sampling period was highest in A. arcuatula (91.8%; n = 110) and lowest in A. granosa (59.2%; n = 130). The morphology of the oocysts differed between hosts, with an average (x +/- SD) length/width of 16.28 +/- 0.64/12.01 +/- 0.35 microm (n = 50) for A. arcuatula, 16.90 +/- 0.71/12.69 +/- 0.33 microm (n = 50) for A. granosa, 17.61 +/- 0.69/12.72 +/- 0.36 microm (n = 50) for P. viridis, and 11.21 +/- 0.62/8.55 +/- 0.52 microm (n = 50) for P. undulata. Identification of oocysts of these apicomplexan gregarines to species was not attempted. The prevalence of infection in relation to habitat and time of sampling is discussed.

  16. Atividade residual de herbicidas aplicados ao solo em relação ao controle de quatro espécies de Amaranthus Residual activity of herbicides applied to the soil in relation to control of four Amaranthus Species

    Directory of Open Access Journals (Sweden)

    M.A. Raimondi

    2010-01-01

    Full Text Available Herbicidas aplicados em pré-emergência normalmente apresentam atividade residual no solo, controlando os primeiros fluxos germinativos das plantas daninhas e prevenindo a matocompetição inicial. O objetivo deste trabalho foi verificar o período de atividade residual proporcionado por doses de herbicidas suficientes para o controle pontual de 95% (C95 das espécies Amaranthus hybridus, A. lividus, A. spinosus e A. viridis, além de avaliar doses recomendadas desses herbicidas. O trabalho foi realizado em casa de vegetação, em solo de textura franco-argiloarenosa (20% de argila e 1,9 de matéria orgânica, e as doses dos herbicidas alachlor, diuron, oxyfluorfen, pendimethalin, prometryne, oxyfluorfen, S-metolachlor, trifluralin 450 e trifluralin 600 foram aplicadas aos 30, 20, 10 e 0 dias antes da semeadura das plantas daninhas. Avaliou-se o controle das plantas daninhas após a permanência dos herbicidas no solo por períodos de 0, 10, 20 e 30 dias depois da aplicação dos tratamentos (DAA. A atividade residual de alachlor e prometryne, na dose C95, não foi suficiente para o controle eficiente (>80% das espécies por períodos de até 30 DAA. Quanto ao alachlor, o emprego da dose recomendada não se refletiu em aumento considerável da atividade residual, exceto em relação a A. viridis. A dose recomendada de prometryne proporcionou controle eficiente das espécies até 30 DAA, exceto de A. hybridus. A dose recomendada de oxyfluorfen controlou eficientemente A. hybridus e A. spinosus até 30 DAA, espécies estas que não haviam sido eficientemente controladas pela dose C95. Trifluralin 450 promoveu controle residual eficiente de 30 DAA somente em relação a A. hybridus. Trifluralin 600 foi eficiente no controle de A. hybridus e A. viridis até os 30 DAA e até 29 e 28 DAA para A. lividus e A. spinosus, respectivamente. Clomazone não promoveu controle eficiente das espécies até 30 DAA, exceto de A. viridis. Diuron, pendimethalin e S

  17. Novos táxons de Hemilophini (Coleoptera, Cerambycidae da Região Neotropical New taxa of Hemilophini (Coleoptera, Cerambycidae from the Neotropical Region

    Directory of Open Access Journals (Sweden)

    Maria Helena M. Galileo

    2005-09-01

    Full Text Available Novos táxons descritos da Costa Rica: Erana cretaria sp. nov., Itumbiara denudata sp. nov., Hilaroleopsis coloratus sp. nov., Alampyris flavicollis sp. nov., Cotycuara viridis sp. nov., Adesmus stellatus sp. nov., A. pilatus sp. nov. (também do Panamá; do Panamá: Eulachnesia amoena sp. nov., Cotycuara crinita sp. nov.; da Venezuela: Abanycha fasciata sp. nov.; do Equador: Mariliana hovorei sp. nov., Adesmus ocellatus sp. nov.; do Peru: Susuanycha gen. nov., espécie-tipo, S. susua sp. nov., Malacoscylus elegantulus sp. nov., Adesmus guttatus sp. nov., A. calca sp. nov.; do Brasil (Minas Gerais: Sybaguasu cornutum sp. nov. Acrescenta-se chave para as espécies de Cotycuara.New taxa described from Costa Rica: Erana cretaria sp. nov., Itumbiara denudata sp. nov., Hilaroleopsis coloratus sp. nov., Alampyris flavicollis sp. nov., Cotycuara viridis sp. nov., Adesmus stellatus sp. nov., A. pilatus sp. nov. (also from Panama; from Panama: Eulachnesia amoena sp. nov., Cotycuara crinita sp. nov.; from Venezuela: Abanycha fasciata sp. nov.; from Ecuador: Mariliana hovorei sp. nov., Adesmus ocellatus sp. nov.; from Peru: Susuanycha gen. nov., type species, S. susua sp. nov., Malacoscylus elegantulus sp. nov., Adesmus guttatus sp. nov., A. calca sp. nov.; from Brazil (Minas Gerais: Sybaguasu cornutum sp. nov. A key to the species of Cotycuara is added.

  18. Controle de plantas daninhas na cultura do milho (Zea mays L. por meio de herbicidas Weed control in maize (Zea mays L. with herbicides

    Directory of Open Access Journals (Sweden)

    C. A. L. dos Santos

    1979-12-01

    Full Text Available Com o objetivo de se verificar a ação do butylate, aplicado isoladamente e em mistura com atrazine, no controle de plantas daninhas da cultura do milho, foi instalado um experimento de campo em solo fino areno-argiloso. Foram utilizados os seguintes tratamentos: butylate a 2,80; 3,60 e 4,32 kg/ha (p.p.i.; butylate + atrazine a 3,24 + 0,80; 3,24 + 1,20 e 3,60 + 0,96 kg/ha (p.p.i.; atrazine a 3,00 kg/ha e atrazine + metolachlor a 1,40 + 2,10 kg/ha, ambos aplicados em pré-emergência e empregados como herbicidas padrão para a cultura. As plantas daninhas encontradas foram: tiririca - Cyperus rotundus L., carurú comum - .:maranthus viridis L., capim de colchão - Digitaria sanguinalis (L. Scop. e capim pé-de-galinha Eleusine indica (L. Gaertn. Butylate nas três doses apresentou-se bem contra C. rotundus e E. indica; nas doses de 3,60 e 4,32 kg foram obtidos bons resultados sobre D. sanguinalis. Butylate + atrazine controlou, nas três doses, todas as espécies incidentes, o mesmo ocorrendo com a mistura atrazine + metolachlor. Atrazine foi mais eficiente para A. viridis e E. indica. Nas condições em que foi conduzido o experimento nenhum dos herbicidas foi prejudicial para a cultura.Butylate at 2.80; 3.60 and 4.32 kg/ha and butylate + atrazine at. 3.24 + 0.80; 3.24 + 1.20 and 3.60 + 0.96 kg, were applied in preplant incorporated; atrazine at 3.00 kg and atrazine + metolachlor at 1.40 + 2.10 kg were applied in preemergence on corn. The weeds were represented by Cyperus rotundus L., Amaranthus viridis L., Digitaria sanguinalis (L. Scop. and Eleusine indica (L. Gaertn. Butylate + atrazine, in all rates, atrazine + metolachlor and atrazine gave good control of the weeds in general. Butylate, in the three rates, controlled C. rotundus and E. indica; at 3.60 and 4.32 kg/ha controlled well D. sanguinalis. The herbicides did not cause injuries to the crop.

  19. The detection of hemorrhagic proteins in snake venoms using monoclonal antibodies against Virginia opossum (Didelphis virginiana) serum.

    Science.gov (United States)

    Sánchez, E E; García, C; Pérez, J C; De La Zerda, S J

    1998-10-01

    Most snakes and a few warm-blooded animals have a resistance to snake venoms because of naturally occurring antihemorrhagins found in their sera. The antihemorrhagins in serum of Virginia opossum (Didelphis virginiana) neutralize hemorrhagic activity by binding to hemorrhagins in snake venoms. The binding characteristic of antihemorrhagins in D. virginiana serum was used to develop a five-step western blot. The detection of hemorrhagic proteins were measured indirectly with antihemorrhagins in Virginia opossum serum and with DV-2LD#2, a monoclonal antibody specific for Virginia opossum antihemorrhagins. Snake venoms were separated by native-PAGE, transferred to a Millipore Immobilon-P membrane and then incubated with crude Virginia opossum serum. The hemorrhagins in snake venom bind to antihemorrhagins in Virginia opossum serum which react with DV-2LD#2 a monoclonal antibody that is specific for Virginia opossum antihemorrhagins. DV-2LD#2 monoclonal antibody inhibits antihemorrhagic activity in Virginia opossum serum when mixed in equal amounts. The inhibition of antihemorrhagins by DV-2LD#2 monoclonal antibody suggests specificity. DV-2LD#2 monoclonal antibody does not recognize antihemorrhagins in gray woodrat (Neotoma micropus) serum. The five-step western blot reveals two well-defined bands which represent hemorrhagins found in Western diamondback rattlesnake (Crotalus atrox) venom. Venoms from 15 different snake species were examined to determine the usefulness of the five-step western blot. Other hemorrhagic venoms (Great Basin rattlesnake (C. viridis lutosus), Prairie rattlesnake (C. viridis viridis), Tancitaran dusky rattlesnake (C. pusillus), Northern Mojave rattlesnake (C. scutulatus scutulatus type B) and Northern Pacific rattlesnake (C. v. oreganus)) had one single band in the five-step western blot. DV-2LD#2 did not bind to the non-hemorrhagic venoms and reacted with 50% of the hemorrhagic venoms used in this study. The monoclonal antibody, CAH

  20. Disentangling the visual cues used by a jumping spider to locate its microhabitat.

    Science.gov (United States)

    Tedore, Cynthia; Johnsen, Sönke

    2016-08-01

    Many arthropod species have evolved to thrive only on the leaves of a particular species of plant, which they must be capable of finding in order to survive accidental displacement, developmental transitions or the changing of the seasons. A number of studies have tested whether such species select leaves to land or oviposit on based on their color, shape or size. Unfortunately, many studies did not control for correlates of these characters, such as the brightness of different colors, the areas of different shapes, and the level of ambient illumination in the vicinity of different sizes of leaves. In the present study, we tested for leaf color, shape and size preferences in a leaf-dwelling jumping spider (Lyssomanes viridis) with known summer and winter host plants, while controlling for these correlates. First, color preferences were tested outdoors under the natural illumination of their forest habitat. Lyssomanes viridis did not prefer to perch on a green substrate compared with various shades of gray, but did prefer the second darkest shade of gray we presented them with. Of the green and gray substrates, this shade of gray's integrated photon flux (350-700 nm), viewed from below, i.e. the spider's perspective in the arena, was the most similar to that of real leaves. This relationship also held when we weighted the transmitted photon flux by the jumping spiders' green photopigment spectral sensitivity. Spiders did not prefer the star-like leaf shape of their summer host plant, Liquidambar styraciflua, to a green circle of the same area. When given a choice between a L. styraciflua leaf-shaped stimulus that was half the area of an otherwise identical alternative, spiders preferred the larger stimulus. However, placing a neutral density filter over the side of the experimental arena with the smaller stimulus abolished this preference, with spiders then being more likely to choose the side of the arena with the smaller stimulus. In conclusion, L. viridis

  1. New synonyms and a new name in Asteraceae: Senecioneae from the southern African winter rainfall region

    Directory of Open Access Journals (Sweden)

    J. C. Manning

    2010-07-01

    new name O. daucifolia J.C.Manning & Goldblatt is provided to replace the later homonym O. abrotanifolia (Harv. Druce.

  2. RASIO BIOMASA DAN KELIMPAHAN MAKROZOOBENTHOS SEBAGAI PENDUGA TINGKAT PENCEMARAN DI TELUK JAKARTA

    Directory of Open Access Journals (Sweden)

    Yonvitner

    2006-12-01

    Full Text Available The monitoring technic using aquatic organism as bio indicator was more advance. Monitoring of water quality conduct with biological indicator among macrobentic biomass and green mussel population were intensively used by researcher. These research was consider that water quality damage on Jakarta bay might be identity with biomass analysis approach. Benthic organism used as sample were macrozoobenthos and green mussel (Pema viridis. Water quality was analysed using Fsawb (Fish and Wild Life Method index from ott. 1979, then for biomass model was analysed by dominant cumulative curve. Result of this research showed that Fsawl index average was 64.99, that its value was unappropriate for fishes. The analysis of abundance and biomass comparison index was tend to increase the density, while the biomass was decrease. The results indicate that water body was already polluted. The si:: nificant impact for mussel of pollution was appear on water column at 2 m under of sea level.

  3. Climate change promotes hybridisation between deeply divergent species

    Directory of Open Access Journals (Sweden)

    Daniele Canestrelli

    2017-03-01

    Full Text Available Rare hybridisations between deeply divergent animal species have been reported for decades in a wide range of taxa, but have often remained unexplained, mainly considered chance events and reported as anecdotal. Here, we combine field observations with long-term data concerning natural hybridisations, climate, land-use, and field-validated species distribution models for two deeply divergent and naturally sympatric toad species in Europe (Bufo bufo and Bufotes viridis species groups. We show that climate warming and seasonal extreme temperatures are conspiring to set the scene for these maladaptive hybridisations, by differentially affecting life-history traits of both species. Our results identify and provide evidence of an ultimate cause for such events, and reveal that the potential influence of climate change on interspecific hybridisations goes far beyond closely related species. Furthermore, climate projections suggest that the chances for these events will steadily increase in the near future.

  4. Phylogeny and revision of the bee genus Rhinocorynura Schrottky (Hymenoptera, Apidae, Augochlorini, with comments on its female cephalic polymorphism

    Directory of Open Access Journals (Sweden)

    Rodrigo B. Gonçalves

    2012-03-01

    Full Text Available Phylogeny and revision of the bee genus Rhinocorynura Schrottky (Hymenoptera, Apidae, Augochlorini, with comments on its female cephalic polymorphism. A taxonomic revision and a phylogeny for the species of Rhinocorynura are provided. Six species are recognized: R. briseis, R. crotonis, R. inflaticeps and R. vernoniae stat. nov., the latter removed from synonymy with R. inflaticeps, in addition to two newly described species, R. brunnea sp. nov. and R. viridis sp. nov. Lectotypes for Halictus crotonis Ducke, 1906 and Halictus inflaticeps Ducke, 1906 are hereby designated. Another available name included in Rhinocorynura, Corynuropsis ashmeadi Schrottky, 1909, is removed from the genus and treated as species inquerenda in Augochlorini. Rhinocorynura is monophyletic in the phylogenetic analysis and the following relationships were found among its species: (R. crotonis (R. briseis ((R. brunnea sp. nov. + R. viridis sp. nov. (R. inflaticeps + R. vernoniae. Biogeographic relationships within the genus and comparisons with related taxa are presented. Females of all species exhibit pronounced variation in body size, in two of them, R. inflaticeps and R. vernoniae, with structural modifications possibly linked to division of labor. Identification key and illustrations for the species are provided.Filogenia e revisão taxonômica das abelhas do gênero Rhinocorynura Schrottky (Hymenoptera, Apidae, Augochlorini, com comentários sobre o poliformismo cefálico das fêmeas. São apresentadas uma revisão taxonômica e filogenia para as espécies de Rhinocorynura. Seis espécies são reconhecidas, duas descritas como novas, R. brunnea sp. nov. e R. viridis sp. nov., e quatro com nomes disponíveis, R. briseis, R. crotonis, R. inflaticeps e R. vernoniae stat. nov., esta última removida da sinonímia com R. inflaticeps. Designam-se aqui lectótipos para Halictus crotonis Ducke, 1906 e Halictus inflaticeps Ducke, 1906. Outro nome disponível incluído em

  5. The First Report of Mycobacterium celatum Isolation from Domestic Pig (Sus scrofa domestica and Roe Deer (Capreolus capreolus and an Overview of Human Infections in Slovenia

    Directory of Open Access Journals (Sweden)

    Mateja Pate

    2011-01-01

    Full Text Available Mycobacterium celatum, a slowly growing potentially pathogenic mycobacterium first described in humans, is regarded as an uncommon cause of human infection, though capable of inducing invasive disease in immunocompromised hosts. According to some reports, a serious disease due to M. celatum may also occur in individuals with no apparent immunodeficiency. In animals, an M. celatum-related disease has been described in three cases only: twice in a domestic ferret (Mustela putorius furo and once in a white-tailed trogon (Trogon viridis. In this paper, we report the first detection of M. celatum in a domestic pig (Sus scrofa domestica and roe deer (Capreolus capreolus. A nation-wide overview of human M. celatum infections recorded in Slovenia between 2000 and 2010 is also given. Pulmonary disease due to M. celatum was recognized in one patient with a history of a preexisting lung disease.

  6. AMPHIBIAN COMMUNITIES IN BIOGEOCOENOSIS WITH DIFFERENT STAGES OF ANTHROPOGENIC CLYMAX

    Directory of Open Access Journals (Sweden)

    Marchenkovskaya А. А.

    2013-04-01

    Full Text Available We examined the abundance of juvenile (fingerlings and yearlings and sexually mature (3-6 years of various anurans at various biotopes with different degrees of anthropogenic influence. Population analysis has revealed that the number of juveniles in all the habitats are depended on type and level of anthropogenic influence. In all the habitats the most numerous species was synanthropic bufo viridis. In biotopes with high contamination of pollutants, only one species of amphibians - the marsh frog has populations with juveniles migrating here in the early fall. The highest number of mature individuals registered for the population of Bombina bombina, pelobates fuscus and in one biotope for hyla arborea. The populations of pelophylax ridibundus could be considered as the most balanced by number of juvenile and mature individuals.

  7. Scale Insects (Hemiptera: Coccoidea) on Myrciaria dubia (Myrtaceae) in Brazil.

    Science.gov (United States)

    Wolff, V R S; Kondo, T; Peronti, A L B G; Noronha, A C S

    2016-06-01

    Commercial cultivation of the fruit tree Myrciaria dubia (Myrtaceae) is being developed in Brazil but phytophagous insects, including scale insects (Hemiptera: Coccoidea), can become pests in plantations. The coccids Ceroplastes jamaicensis White, Coccus viridis (Green), Parasaissetia nigra (Nietner), Pseudokermes vitreus (Cockerell) (Coccidae), and the diaspidid Pseudaonidia trilobitiformis (Green) were collected on M. dubia in the municipality of Belém and Tomé-Açu, state of Pará (PA), metropolitan and Northeast Pará mesoregions, Brazil. A key to species of Coccoidea recorded on M. dubia, based on adult females, is provided. Photographs for all scale insects reported on M. dubia are provided. Ceroplastes jamaicensis is recorded for the first time for Brazil and is herein reported for the first time associated with this host.

  8. Non-microcystin producing Microcystis wesenbergii (Komarek) Komarek (Cyanobacteria) representing a main waterbloom-forming species in Chinese waters

    Energy Technology Data Exchange (ETDEWEB)

    Xu Yao [Institute of Hydrobiology, Chinese Academy of Sciences, Donghu Nanlu 7, Wuhan, Hubei 430072 (China); College of Geographical Science, Nanjing Normal University, Nanjing 210097 (China); Wu Zhongxing [Institute of Hydrobiology, Chinese Academy of Sciences, Donghu Nanlu 7, Wuhan, Hubei 430072 (China); Yu Boshi [Institute of Hydrobiology, Chinese Academy of Sciences, Donghu Nanlu 7, Wuhan, Hubei 430072 (China); School of Nature Resources, Southwest Forestry University, Kunming 650224 (China); Peng Xin; Yu Gongliang [Institute of Hydrobiology, Chinese Academy of Sciences, Donghu Nanlu 7, Wuhan, Hubei 430072 (China); Wei Zhihong [Research Center of the Erhai Lake, Dali, Yunnan 671000 (China); Wang Guoxiang [College of Geographical Science, Nanjing Normal University, Nanjing 210097 (China); Li Renhui [Institute of Hydrobiology, Chinese Academy of Sciences, Donghu Nanlu 7, Wuhan, Hubei 430072 (China)], E-mail: reli@ihb.ac.cn

    2008-11-15

    It is well known that several morphospecies of Microcystis, such as Microcystis aeruginosa (Kuetzing) Lemmermann and Microcystis viridis (A. Brown) Lemmermann can produce hepatotoxic microcystins. However, previous studies gave contradictory conclusions about microcystin production of Microcystis wesenbergii (Komarek) Komarek. In the present study, ten Microcystis morphospecies were identified in waterblooms of seven Chinese waterbodies, and Microcystis wesenbergii was shown as the dominant species in these waters. More than 250 single colonies of M. wesenbergii were chosen, under morphological identification, to examine whether M. wesenbergii produce hepatotoxic microcystin by using multiplex PCR for molecular detection of a region (mcyA) of microcystin synthesis genes, and chemical analyses of microcystin content by ELISA and HPLC for 21 isolated strains of M. wesenbergii from these waters were also performed. Both molecular and chemical methods demonstrated that M. wesenbergii from Chinese waters did not produce microcystin. - Both molecular and chemical methods demonstrated that Microcystis wesenbergii was not a microcystin producer in Chinese waters.

  9. Studies on the effects on growth and antioxidant responses of two marine microalgal species to uniconazole

    Science.gov (United States)

    Mei, Xueqiao; Zheng, Kang; Wang, Lingdong; Li, Yantuan

    2014-10-01

    Uniconazole, as a plant growth retardant, can enhance stress tolerance in plants, possibly because of improved antioxidation defense mechanisms with higher activities of superoxide dismutase (SOD) and peroxidase (POD) enzymes that retard lipid peroxidation and membrane deterioration. These years much attention has been focused on the responses of antioxidant system in plants to uniconazole stress, but such studies on aquatic organism are very few. Moreover, no information is available on growth and antioxidant response in marine microalgae to uniconazole. In this paper, the growth and antioxidant responses of two marine microalgal species, Platymonas helgolandica and Pavlova viridis, at six uniconazole concentrations (0-15 mg L-1) were investigated. The results demonstrated that 3 mg L-1 uniconazole could increase significantly chlorophyll a and carbohydrate contents of P. helgolandica ( P catalase (CAT) were enhanced remarkably at low concentrations of uniconazole. However, significant reduction of SOD and CAT activities was observed at higher concentrations of uniconazole.

  10. From Macrocrystals to Microcrystals: A Strategy for Membrane Protein Serial Crystallography.

    Science.gov (United States)

    Dods, Robert; Båth, Petra; Arnlund, David; Beyerlein, Kenneth R; Nelson, Garrett; Liang, Mengling; Harimoorthy, Rajiv; Berntsen, Peter; Malmerberg, Erik; Johansson, Linda; Andersson, Rebecka; Bosman, Robert; Carbajo, Sergio; Claesson, Elin; Conrad, Chelsie E; Dahl, Peter; Hammarin, Greger; Hunter, Mark S; Li, Chufeng; Lisova, Stella; Milathianaki, Despina; Robinson, Joseph; Safari, Cecilia; Sharma, Amit; Williams, Garth; Wickstrand, Cecilia; Yefanov, Oleksandr; Davidsson, Jan; DePonte, Daniel P; Barty, Anton; Brändén, Gisela; Neutze, Richard

    2017-09-05

    Serial protein crystallography was developed at X-ray free-electron lasers (XFELs) and is now also being applied at storage ring facilities. Robust strategies for the growth and optimization of microcrystals are needed to advance the field. Here we illustrate a generic strategy for recovering high-density homogeneous samples of microcrystals starting from conditions known to yield large (macro) crystals of the photosynthetic reaction center of Blastochloris viridis (RC vir ). We first crushed these crystals prior to multiple rounds of microseeding. Each cycle of microseeding facilitated improvements in the RC vir serial femtosecond crystallography (SFX) structure from 3.3-Å to 2.4-Å resolution. This approach may allow known crystallization conditions for other proteins to be adapted to exploit novel scientific opportunities created by serial crystallography. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. The globalization of ayahuasca: harm reduction or benefit maximization?

    Science.gov (United States)

    Tupper, Kenneth W

    2008-08-01

    Ayahuasca is a tea made from two plants native to the Amazon, Banisteriopsis caapi and Psychotria viridis, which, respectively, contain the psychoactive chemicals harmala alkaloids and dimethyltryptamine. The tea has been used by indigenous peoples in countries such as Brazil, Ecuador and Peru for medicinal, spiritual and cultural purposes since pre-Columbian times. In the 20th century, ayahuasca spread beyond its native habitat and has been incorporated into syncretistic practices that are being adopted by non-indigenous peoples in modern Western contexts. Ayahuasca's globalization in the past few decades has led to a number of legal cases which pit religious freedom against national drug control laws. This paper explores some of the philosophical and policy implications of contemporary ayahuasca use. It addresses the issue of the social construction of ayahuasca as a medicine, a sacrament and a "plant teacher." Issues of harm reduction with respect to ayahuasca use are explored, but so too is the corollary notion of "benefit maximization."

  12. Identification of N,N-dimethyltryptamine and beta-carbolines in psychotropic ayahuasca beverage.

    Science.gov (United States)

    Gambelunghe, Cristiana; Aroni, Kyriaki; Rossi, Riccardo; Moretti, Luca; Bacci, Mauro

    2008-10-01

    Recently many people have shown great interest in traditional indigenous practices and popular medicine, involving the ingestion of natural psychotropic drugs. We received a request to analyze and determine the nature of a dark green liquid with a dark brown plant sediment, which the police had seized at an airport and inside the home of a person belonging to the 'Santo Daime' religious movement. Gas chromatography/mass spectrometry analysis of the extract identified N,N-dimethyltryptamine, a potent hallucinogen, and the beta-carboline alkaloids harmine and harmaline, revealing monoamine oxidase A-inhibiting properties. These substances are typical components of Ayahuasca, a South American psychotropic beverage obtained by boiling the bark of the liana Banisteriopsis caapi together with the leaves of various admixture plants, principally Psychotria viridis.

  13. Ayahuasca Alters Structural Parameters of the Rat Aorta.

    Science.gov (United States)

    Pitol, Dimitrius L; Siéssere, Selma; Dos Santos, Rafael G; Rosa, Maria L N M; Hallak, Jaime E C; Scalize, Priscilla H; Pereira, Bruno F; Iyomasa, Melina M; Semprini, Marisa; Riba, Jordi; Regalo, Simone C H

    2015-07-01

    Ayahuasca is a hallucinogenic brew traditionally used by Northwestern Amazonian indigenous groups for therapeutic purposes. It is prepared by the decoction of Banisteriopsis caapi with the leaves of Psychotria viridis. Banisteriopsis caapi contains β-carbolines that are inhibitors of monoamine oxidase and P. viris is rich in dimethyltryptamine, a 5-HT(1A/2A/2C) agonist. Acute ayahuasca administration produces moderate cardiovascular effects in healthy volunteers, but information regarding long-term use is lacking. This study investigated the effects of ayahuasca (2-4 mL/kg) in the rat aorta after acute and chronic (14 days) administration. Ayahuasca caused flattening and stretching of vascular smooth muscle cells and changes in the arrangement and distribution of collagen and elastic fibers. Chronic treatment with the higher dose significantly increased media thickness and the ratio of media thickness to lumen diameter. More research is needed on the cardiovascular function of long-term ayahuasca consumers.

  14. Genetic structure and origin of a tetraploid toad species Bufo danatensis Pisanetz, 1978 (Amphibia, Bufonidae) from central Asia: Description of biochemical polymorphism and comparison of heterozygosity levels in diploid and tetraploid species

    Energy Technology Data Exchange (ETDEWEB)

    Mezhzherin, S.V.; Pisanets, E.M. [Schmalhausen Institute of Zoology, Kiev (Ukraine)

    1995-01-01

    Comparison of individual variation at 24 biochemical loci in members of the species complex of Palearctic green toads showed that the heterozygosity of the tetraploid species Bufo danatensis (H{sub obs} = 0.45) was significantly higher than that of the diploid species B. viridis, B. sp., and B. raddei (H{sub obs} = 0.009 - 0.103). Such difference can be explained only by a hybrid origin of the tetraploid species. Individual electrophoretic variability of the polyploid toad species is associated with an allelic variation that is manifested in constantly heterozygous spectra as the gene dosage effect. At the population level, this phenomenon found in Pamir toads is caused by irregular meiosis in founders of the population or by directional changes in gene regulation. Genotypic distributions in zones of contact of the diploid and tetraploid taxons demonstrate the possibility of restricted introgressive hybridization.

  15. Amphibians of the Aurunci Mountains (Latium, Central Italy. Checklist and conservation guidelines

    Directory of Open Access Journals (Sweden)

    Antonio Romano

    2007-01-01

    Full Text Available The Aurunci Mounts are among the less investigated areas of Latium for herpetological researches. In this study we surveyed 72 potential breeding sites of amphibians within the Monti Aurunci Regional Park. Fifty-eight spawning sites, and nine amphibian species (64.3% out the 14 amphibian species living in Latium region have been found. Green toad and European tree frog were recorded for the first time for the Aurunci Mounts. Reproductive activity was recorded for Salamandrina perspicillata, Triturus carnifex, Lissotriton vulgaris, Lissotriton italicus, Bufo bufo, Pseudopidalea viridis, Hyla intermedia, Rana italica and Rana synklepton hispanica. Unexpectedly, no amphibian species has been recorded within the Monte Redentore (pSIC IT6040027, despite this site was included within the Natura 2000 network also basing on the presence of Triturus carnifex.

  16. In vitro anticancer activity of extracts of Mentha Spp. against human cancer cells.

    Science.gov (United States)

    Sharma, Vikas; Hussain, Shabir; Gupta, Moni; Saxena, Ajit Kumar

    2014-10-01

    In vitro anticancer potential of methanolic and aqueous extracts of whole plants of Mentha arvensis, M. longifolia, M. spicata and M. viridis at concentration of 100 μg/ml was evaluated against eight human cancer cell lines--A-549, COLO-205, HCT-116, MCF-7, NCI-H322, PC-3, THP-1 and U-87MG from six different origins (breast, colon, glioblastoma, lung, leukemia and prostate) using sulphorhodamine blue (SRB) assay. Methanolic extracts of above-mentioned Mentha Spp. displayed anti-proliferative effect in the range of 70-97% against four human cancer cell lines, namely COLO-205, MCF-7, NCI-H322 and THP-1; however, aqueous extracts were found to be active against HCT-116 and PC-3. The results indicate that Mentha Spp. contain certain constituents with cytotoxic properties which may find use in developing anticancer agents.

  17. Responses of selected pepper varieties to ethyl methanesulfonate

    International Nuclear Information System (INIS)

    Longid, C.S.

    1994-01-01

    Seeds of three varieties of pepper (Capsicum anuum L.) were treated with 0.3% and 0.6% EMS with a pH between 9 to 11 at 30 o C, to determine the responses of the M 1 plants and the M 2 seedlings to the mutagen. Seeds treated with 0.3% were soaked in the mutagen for 20 hours, while seeds treated with 0.6% were soaked for 10 hours. Data obtained in the M 1 showed decrease in germination percentage, shoot length, plant height, seed set and survival percentage. Somatic chimeras were obtained. Decrease in shoot length, plant height at maturity, survival percentage and seed set were significant. In the M 2 seedlings, chlorophyll-deficient mutants induced in decreasing frequency were viridis, xantha and albina. The three varieties showed varying responses to the different treatment conditions of EMS. (author). 20 refs., 9 tabs

  18. Preimaginal stages of the emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae: an invasive pest on ash trees (Fraxinus.

    Directory of Open Access Journals (Sweden)

    M Lourdes Chamorro

    Full Text Available This study provides the most detailed description of the immature stages of Agrilus planipennis Fairmaire to date and illustrates suites of larval characters useful in distinguishing among Agrilus Curtis species and instars. Immature stages of eight species of Agrilus were examined and imaged using light and scanning electron microscopy. For A. planipennis all preimaginal stages (egg, instars I-IV, prepupa and pupa were described. A combination of 14 character states were identified that serve to identify larvae of A. planipennis. Our results support the segregation of Agrilus larvae into two informal assemblages based on characters of the mouthparts, prothorax, and abdomen: the A. viridis and A. ater assemblages, with A. planipennis being more similar to the former. Additional evidence is provided in favor of excluding A. planipennis from the subgenus Uragrilus.

  19. [Effect of decimeter polarized electromagnetic radiation on germinating capacity of seeds].

    Science.gov (United States)

    Polevik, N D

    2013-01-01

    The effect of a polarization structure of electromagnetic radiation on the germinating capacity of seeds of such weeds as Green foxtail (Setaria viridis) and Green amaranth (Amaranthus retroflexus) has been studied. Seeds have been exposed to impulse electromagnetic radiation in a frequency of 896 MHz with linear, elliptical right-handed and elliptical left-handed polarizations at different power flux density levels. It is determined that the effect of the right-handed polarized electromagnetic radiation increases and the influence of the left-handed polarized one reduces the germinating capacity of seeds compared to the effect of the linearly polarized electromagnetic radiation. It is shown that the seeds have an amplitude polarization selectivity as evinced by the major effect of the right-handed polarized radiation on seeds. An electrodynamic model as the right-handed elliptically polarized antenna with the given quantity of the ellipticity of polarization is suggested to use in description of this selectivity.

  20. What hydra has to say about the role and origin of symbiotic interactions.

    Science.gov (United States)

    Bosch, Thomas C G

    2012-08-01

    The Hydra holobiont involves at least three types of organisms that all share a long coevolutionary history and appear to depend on each other. Here I review how symbiotic algae and stably associated bacteria interact with the Hydra host and where in the tissue they are located. In particular I discuss the role of Toll-like receptor (TLR) signaling in maintaining Hydra's species-specific microbiota. I also discuss studies in Hydra viridis and its symbiotic Chlorella algae which indicate that the symbiotic algae are critically involved in the control of sexual differentiation in green Hydra. Finally, I review the state of "omics" in this tripartite association and the fact that the functioning of this holobiont is also a tale of several genomes.

  1. Rediscovery of Pelobates fuscus insubricus in the Asti Province, north-western Italy

    Directory of Open Access Journals (Sweden)

    Vincenzo Mercurio

    2007-01-01

    Full Text Available The amphibians of the pond complex “Stagni di Belangero” in the Po Plain, Asti Province, have been studied. The species living in the pond are Bufo bufo, Bufo viridis, Hyla intermedia, Pelobates fuscus, Rana dalmatina, Rana synklepton esculenta, Rana cf. kurtmuelleri, Triturus carnifex and Triturus vulgaris. Species composition, migration period of P. fuscus, and biometric data are provided. Relevant importance has been given to P. fuscus, since we reconfirm its presence in one of the ponds 13 years after its first finding in the area. This toad is also one of the most threatened species of amphibians in Europe and needs particular attention in order to be protected adequately.

  2. The early phyllosoma stages of spiny lobster Panulirus echinatus Smith, 1869 (Decapoda: Palinuridae reared in the laboratory

    Directory of Open Access Journals (Sweden)

    FA. Abrunhosa

    Full Text Available The early stages of the Panulirus echinatus were hatched and reared in the laboratory. Ovigerous females were captured in their habitat and carefully transported to the laboratory. Larvae were transferred in a recirculation water tank at a density of 10 larvae.L-1. The larvae were fed on Artemia and gonads of mussel Brachydonts sp. Microalgae Dunaliella viridis was added at a concentration of 150 x 10(4 cell.mL-1. Larvae and exuviae of each zoeal stage were preserved in an alcohol 70% + glycerin (1:1 solution. The phyllosomas moulted eight times; the intermoulting period of each instar averaged about 7 to 10 days. The main morphological changes of each appendage were described in detail, illustrated and compared with previous reports.

  3. Non-microcystin producing Microcystis wesenbergii (Komarek) Komarek (Cyanobacteria) representing a main waterbloom-forming species in Chinese waters

    International Nuclear Information System (INIS)

    Xu Yao; Wu Zhongxing; Yu Boshi; Peng Xin; Yu Gongliang; Wei Zhihong; Wang Guoxiang; Li Renhui

    2008-01-01

    It is well known that several morphospecies of Microcystis, such as Microcystis aeruginosa (Kuetzing) Lemmermann and Microcystis viridis (A. Brown) Lemmermann can produce hepatotoxic microcystins. However, previous studies gave contradictory conclusions about microcystin production of Microcystis wesenbergii (Komarek) Komarek. In the present study, ten Microcystis morphospecies were identified in waterblooms of seven Chinese waterbodies, and Microcystis wesenbergii was shown as the dominant species in these waters. More than 250 single colonies of M. wesenbergii were chosen, under morphological identification, to examine whether M. wesenbergii produce hepatotoxic microcystin by using multiplex PCR for molecular detection of a region (mcyA) of microcystin synthesis genes, and chemical analyses of microcystin content by ELISA and HPLC for 21 isolated strains of M. wesenbergii from these waters were also performed. Both molecular and chemical methods demonstrated that M. wesenbergii from Chinese waters did not produce microcystin. - Both molecular and chemical methods demonstrated that Microcystis wesenbergii was not a microcystin producer in Chinese waters

  4. Lectins with Anti-HIV Activity: A Review

    Directory of Open Access Journals (Sweden)

    Ouafae Akkouh

    2015-01-01

    Full Text Available Lectins including flowering plant lectins, algal lectins, cyanobacterial lectins, actinomycete lectin, worm lectins, and the nonpeptidic lectin mimics pradimicins and benanomicins, exhibit anti-HIV activity. The anti-HIV plant lectins include Artocarpus heterophyllus (jacalin lectin, concanavalin A, Galanthus nivalis (snowdrop agglutinin-related lectins, Musa acuminata (banana lectin, Myrianthus holstii lectin, Narcissus pseudonarcissus lectin, and Urtica diocia agglutinin. The anti-HIV algal lectins comprise Boodlea coacta lectin, Griffithsin, Oscillatoria agardhii agglutinin. The anti-HIV cyanobacterial lectins are cyanovirin-N, scytovirin, Microcystis viridis lectin, and microvirin. Actinohivin is an anti-HIV actinomycete lectin. The anti-HIV worm lectins include Chaetopterus variopedatus polychaete marine worm lectin, Serpula vermicularis sea worm lectin, and C-type lectin Mermaid from nematode (Laxus oneistus. The anti-HIV nonpeptidic lectin mimics comprise pradimicins and benanomicins. Their anti-HIV mechanisms are discussed.

  5. Chemotaxonomic Evaluation of Species of Turkish Salvia: Fatty Acid Composition of Seed Oils. II

    Directory of Open Access Journals (Sweden)

    Turgut Kılıç

    2007-05-01

    Full Text Available Fatty acids composition of seed oil of Salvia viridis, S. hydrangea, S. blepharochleana, S. chianantha, S. staminea, S. hypergeia,, S. cilicica, S. caespitosa, S. sclarea, S. cadmica, S. microstegia, S. pachystachys and S. verticillata were analyzed by GC/MS. The main compound were found to be as linoleic acid (18:2; 12.8 % to 52.2 %, linolenic acid (18:3; 3.2 % to 47.7 %, oleic acid (18:1; 11.3 % to 25.6 %, palmitic acid (16:0; 0.7 % to 16.8 % and stearic acid (18:0; 1.8 % to 4.8 %. A phylogenetic tree of species of Salvia were reported and compared to 18:3/18:2 ratio of the seed oils. Fatty acid composition of Salvia seed oils could be used as a chemotaxonomical marker.

  6. Initiation of Setaria as a model plant

    Directory of Open Access Journals (Sweden)

    Xianmin DIAO,James SCHNABLE,Jeffrey L. BENNETZEN,Jiayang LI

    2014-02-01

    Full Text Available Model organisms such as Arabidopsis (Arabidopsis thaliana and rice (Oryza sativa have proven essential for efficient scientific discovery and development of new methods. With the diversity of plant lineages, some important processes such as C4 photosynthesis are not found in either Arabidopsis or rice, so new model species are needed. Due to their small diploid genomes, short life cycles, self-pollination, small adult statures and prolific seed production, domesticated foxtail millet (Setaria italica and its wild ancestor, green foxtail (S. viridis, have recently been proposed as novel model species for functional genomics of the Panicoideae, especially for study of C4 photosynthesis. This review outlines the development of these species as model organisms, and discusses current challenges and future potential of a Setaria model.

  7. Patrones de forrajeo en dos especies de peces intermareales herbívoros de las costas de Chile: Efecto de la abundancia y composición química del alimento Foraging patterns of two species of intertidal herbivorous fishes: Effect of food abundance and chemical composition

    Directory of Open Access Journals (Sweden)

    CRISTIAN W. CACERES

    2000-06-01

    Full Text Available Los peces herbívoros son organismos que deben suplir los requerimientos de su economía energética a partir de una fuente de alimento con un bajo contenido de nutrientes y energía. Dos de las interrogantes más importantes en relación con la herbivoría por peces son: i ¿cuáles son los factores que influyen en la selección o rechazo de un determinado item dietario? y ii ¿son capaces los peces herbívoros de extraer los nutrientes y energía necesarios para suplir sus requerimientos energéticos en base a una dieta de macroalgas?. En este trabajo se estudiaron en dos especies de peces herbívoros, Scartichthys viridis y Girella laevifrons, los patrones de selectividad dietaria en terreno y laboratorio, la eficiencia de asimilación y la relación entre los patrones encontrados con la composición química del alga. Los resultados obtenidos señalan que la dieta de estos organismos se compone en más del 90% de macroalgas bentónicas. En terreno ambas especies presentan una conducta trófica no selectiva en verano y selectiva en invierno, prefiriendo el consumo de algas verdes. En los experimentos de selección dietaria ambas especies presentan un patrón similar caracterizado por la preferencia de algas verdes y rojas por sobre algas pardas. Los resultados de los experimentos de asimilación, indican que Girella laevifrons presenta tasas de asimilación mayores que Scartichthys viridis, siendo en la primera las algas verde Ulva y Enteromorpha las que presentan una mayor eficiencia de asimilación. Los resultados sugieren una fuerte relación entre el patrón de selección trófica observado en estas especies y la relación entre composición del alimento y características digestivasHerbivores are organisms that must meet their energy and nutrients requirements from a food source that typically has been characterized as having low nutritional value given their low concentration of nutrients and energy. Two of the most important questions

  8. Structure of capsule around acanthocephalan Corynosoma strumosum from uncommon paratenic hosts-lizards of two species.

    Science.gov (United States)

    Skorobrechova, Ekaterina M; Nikishin, Vladimir P; Lisitsyna, Olga I

    2012-01-01

    Micromorphology and ultrastructure of capsule forming around acanthocephalan Corynosoma strumosum in uncommon paratenic hosts-lizards Lacerta agilis and Lacerta viridis-have been studied. Experimental infestation of the lizards by acanthocephalans obtained from naturally infested sea fishes showed that only small amount of parasites occurred in the intestine of the host was able to migrate into body cavity and to be encapsulated. Micromorphology of capsules of different ages from different species of lizards and micromorphology and ultrastructure of capsules at the age of 1.5 and 10 days appeared to be similar. In the capsule's structure cells of inflammatory rank were prevailing: mononuclear and multinuclear macrophages, eosinophils, and basophils. Fibroblasts were not numerous and were located only in the outer part of a capsule; exocellular collagen fibers were absent. Inflammatory character of capsule confirms the idea that lizards are unsuitable paratenic hosts for corynosomes.

  9. Herpesvirus-associated papillomatosis in a green lizard.

    Science.gov (United States)

    Literak, I; Robesova, B; Majlathova, V; Majlath, I; Kulich, P; Fabian, P; Roubalova, E

    2010-01-01

    Papillomatous skin lesions from a green lizard (Lacerta viridis) were examined histologically, using electron microscopy and DNA was isolated from the lesions for herpes-viral DNA detection. Histology confirmed the lesions to be squamous epithelial papillomas. Using electron microscopy, no virus particles were detected. The specific sequence of herpesviral DNA-directed DNA polymerase (EC 2.7.7.7) was amplified using degenerate primers in a nested format. The 235-base-pair (bp) sequence was sequenced and compared with previously published DNA-directed DNA polymerase sequences from various reptile herpesviruses. The sequence from the green lizard showed significant similarity with sequence of fibropapilloma-associated turtle herpesviruses from sea turtles.

  10. The early larval development of the tropical reef lobster Enoplometopus antillensis Lütken (Astacidea, Enoplometopidae reared in the laboratory Desenvolvimento dos estágios iniciais da lagosta de recife tropical Enoplometopus antillensis Lütken (Astacidea, Enoplometopidae cultivada em laboratório

    Directory of Open Access Journals (Sweden)

    Fernando A. Abrunhosa

    2007-06-01

    Full Text Available The early stages of the tropical reef lobster Enoplometopus antillensis Lütken, 1865 were described and illustrated in detail from specimens reared in the laboratory. Ovigerous females were captured in their habitat, at a depth of about 15 meters and transported to the laboratory. The larvae were reared in a recirculation water tank for approximately 15 days and then transferred to four 10 liters aquariums. The larvae were fed on Artemia sp. nauplii. Microalgae Dunaliella viridis was added daily to the culture. The larvae moulted seven times progressing through the zoea VIII. Megalopa stage was not achieved. The intermoulting period of each stage averaged from eight to 12 days. Morphological comparisons with previous reports are briefly discussed.Os estágios iniciais da lagosta tropical Enoplometopus antillensis Lütken, 1865 foram descritos e ilustrados a partir de espécimes cultivados em laboratório. Fêmeas ovígeras foram capturadas em seu habitat, na profundidade cerca de 15 metros e transportadas para o laboratório. As larvas foram cultivadas em tanques de água recirculante por aproximadamente 15 dias e, então transferidas para quatro aquários (capacidade 10 litros. As larvas foram alimentadas com náuplios de Artemia sp. recém eclodidos. A microalga Dunaliella viridis AUTOR foi diariamente adicionada no cultivo. As larvas mudaram sete vezes alcançando o zoea VIII. O estágio megalopa não foi obtido. O período de intermuda de cada estágio variou de cerca de oito a 12 dias. Comparações morfológicas com trabalhos anteriores são brevemente discutidas.

  11. The Snakes of Osun Grove: a World Heritage Site in Osogbo, Nigeria

    Directory of Open Access Journals (Sweden)

    Akinsola I Akinpelu

    2007-06-01

    Full Text Available The Osun Grove, Osogbo, Nigeria, is a protected area covered by riparian forest, dry high forest and derived savanna. In January and June 2000 a total of 25 of snake species were recorded with Afronatrix anoscopus and Calabaria reinhardti being prominent. The incidence of Philothamnus semivariegatus, a savanna species, may be the result of the invasive savanna produced by farming activities around the grove. Nine species, led by A. anoscopus, accounted for 69.7 % of the snake community. The dominant species are either aquatic or terrestrial, with the exception of Boiga blandingi and Dendroaspis viridis that can be both arboreal and terrestrial, and C. reinhardti that is fossorial. Arboreal species mostly preyed on tree frogs and birds including eggs and nestlings, and the aquatic forms preyed on fish and frogs. Mammals, reptiles and toads constitute the prey items of terrestrial species while fossorial species feed on annelids, molluscs, arachnids, myriapods, hexapods, amphibians, reptiles and mammals. Rev. Biol. Trop. 55 (2: 717-721. Epub 2007 June, 29.Se registró un total de 25 especies de serpientes en la arboleda de Osun en Osogbo, Nigeria, incluyendo prominentemente dos especies consideradas escasas en el sudoeste de Nigeria: Afronatrix anoscopus y Calabaria reinhardti; Philothamnus semivariegatus, una especie de la sabana, es común posiblemente debido a las actividades de cultivo fuera de la reserva. Junto con las ocho especies abundantes siguientes, A. anoscopus, representó el 69.7 % de la comunidad de serpientes. Las especies dominantes son acuáticas o terrestres, con excepción de Boiga blandingi y Dendroaspis viridis que son arborícolas y terrestres, y C. reinhardti que es fosorial. Las especies fosoriales tienen mayor diversidad trófica.

  12. UNTAGGED MUTATION IN RICE GAL4/VP16 TRANSCRIPTIONAL ACTIVATOR FACILITATED-ENHANCER TRAP LINES

    Directory of Open Access Journals (Sweden)

    Sri Koerniati

    2013-04-01

    Full Text Available An enhancer trap system is an insertional mutagenesis based upon gene expression, instead of gene knock-out, so its insertion in genome is  expected not linked to any dramatic changes in plant phenotypes. Gene  knock-out, leading to lossof- function (LoF mutation, is a dominant  approach for rice functional genomic studies. The objective of this study was to find out whether Transcriptional Activator-Facilitated Enhancer Trap (TAFET T-DNA insertion inducing mutant phenotypes in rice TAFET population. Materials used in this experiment were T1 generation of 270 rice TAFET lines. Eight plants of each were grown in the greenhouse and observed for any mutant phenotypes. Phenotypic, histochemical, Southernblot analyses were carried out to define a mutant of pSKC66.1- 8e. Result showed that about 10% of the 270 lines produced chlorophyll-deficient  leaves, ranged from yellowish green (viridis, white stripe green zebra-like stripe to completely white (albino. Albino plants died after two weeks,  whilst white stripe or viridis mutants became normal in the next generation(T2. Another mutant was pSKC66.1-8e line which had floral dramatic phenotype change with various spikelet shapes and number of organs, and had a single twisted culm. The flower of mutant also had gus gene expression. Plants with wild type did not express gus gene and had six or more straight culms. Molecular, histochemical and phenotypic analyses of this particular line for three generations indicated that mutant phenotype was not due to the T-DNA insertion. Since there was approved that Tos17 is activated during tissue culture and induced mutant phenotype, this line might relate to Tos17 insertion, but it needs further investigation to gain such conclusion.

  13. A survey of scale insects (Sternorryncha: Coccoidea) occurring on table grapes in South Africa.

    Science.gov (United States)

    Walton, Vaughn M; Krüger, Kerstin; Saccaggi, Davina L; Millar, Ian M

    2009-01-01

    Increasing international trade and tourism have led to an increase in the introduction of exotic pests that pose a considerable economic threat to the agro-ecosystems of importing countries. Scale insects (Sternorryncha: Coccoidea) may be contaminants of export consignments from the South African deciduous fruit industry to the European Union, Israel, United Kingdom and the United States, for example. Infestations of immature scale insects found on South African fruit destined for export have resulted in increasing rates of rejection of such consignments. To identify the risk posed by scale insect species listed as phytosanitary pests on table grapes to the abovementioned importing countries, a field survey was undertaken in 2004-2005 in vineyards throughout all grape-producing regions in South Africa. Coccoidea species found during the current field survey were Planococcus ficus (Signoret), Pseudococcus longispinus (Targioni Tozzetti), Coccus hesperidum L. and Nipaecoccus viridis (Newstead). With the exception of Pl. ficus, which has only been collected from Vitis vinifera (Vitaceae) and Ficus carica (Moraceae) in South Africa, these species are polyphagous and have a wide host range. None of the scale insect species found to occur in vineyards in South Africa pose a phytosanitary risk to countries where fruit are exported except for Ferrisia malvastra (McDaniel) and N. viridis that have not been recorded in the USA. All scale insects previously found in vineyards in South Africa are listed and their phytosanitary status discussed. The results of the survey show that the risk of exporting scale insect pests of phytosanitary importance on table grapes from South Africa is limited.

  14. Ayahuasca: Psychological And Physiologic Effects, Pharmacology And Potential Uses In Addiction And Mental Illness.

    Science.gov (United States)

    Hamill, Jonathan; Hallak, Jaime; Dursun, Serdar M; Baker, Glen

    2018-01-24

    Ayahuasca, a traditional Amazonian decoction with psychoactive properties, is made from bark of the Banisteriopsis caapi vine (contains beta-carboline alkaloids) and leaves of the Psychotria viridis bush (supply the hallucinogen N,N-dimethyltryptamine (DMT)). Originally used by indigenous shamans for the purposes of spirit communication, magical experiences, healing, and religious rituals, across several South American countries ayahuasca has been incorporated into folk medicine and spiritual healing, and several Brazilian churches use it routinely to foster spiritual experience. More recently it is being used in Europe and North America, not only for religious or healing reasons, but also for recreation. To review ayahuasca's behavioral effects, possible adverse effects, proposed mechanisms of action and potential clinical uses in mental illness. We searched Medline, in English, using the terms ayahuasca, dimethytryptamine, Banisteriopsis caapi, and Psychotria viridis and reviewed the relevant publications. The following aspects of ayahuasca are summarized: Political and legal factors; acute and chronic psychological effects; electrophysiological studies and imaging; physiological effects, safety and adverse effects; pharmacology; potential psychiatric uses. Many years of shamanic wisdom have indicated potential therapeutic uses for ayahuasca, and many present day studies suggest that it may be useful for treating various psychiatric disorders and addictions. The side effect profile appears to be relatively mild, but more detailed studies need to be done. Several prominent researchers feel that government regulations with regard to ayahuasca should be relaxed so that it could be provided more readily to recognized credible researchers to conduct comprehensive clinical trials. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  15. Comparative phytosociological investigation of subalpine alder thickets in southwestern Alaska and the North Pacific

    Science.gov (United States)

    Talbot, Stephen S.; Talbot, Sandra L.; Daniëls, F. J. A.

    2005-01-01

    We present the first vegetation analysis of subalpine alder (Alnus viridis) thickets in southwestern Alaska. The data are primarily from mesic, hilly and mountainous sites ranging from the westernmost tip of the Alaska Peninsula to the northern Kenai Peninsula, spanning 1,000 km on an E–W gradient and 700 km on a N–S gradient. 127 relevés from 18 sites represent the range of structural and compositional variation in the matrix of vegetation and landform diversity. Data were analyzed by multivariate and traditional Braun-Blanquet methods. One association is distinguished, Sambuco racemosi-Alnetum viridis ass. nov. with three new subassociations, oplopanacetosum horridi, typicum, and rubetosum spectabilis with the latter subdivided into four variants. These phytocoena are well-differentiated, although they form a syntaxonomical continuum. The composition and structure of these communities are described and interpreted in relation to complex environmental factors; these are analyzed using Jancey's ranking on F-values. Community composition is primarily related to elevation, longitude, soil moisture, and latitude. Phytogeographic comparison of southwestern Alaska alder communities with those elsewhere in the North Pacific suggests a close floristic relationship to those of southcentral, southeastern Alaska and coastal British Columbia, Canada. All these communities belong to the same association, while those of the eastern and southern parts of the Kamchatka Peninsula, Russia belong to a different association. Syntaxonomy of the 4 major communities is discussed. Within the Northern Hemisphere, vascular plant species of southwestern Alaska alder thickets primarily occur in East Asia and North America, 36 %; while 26 % are circumpolar, and 22 % are restricted to North America. From a latitudinal perspective, the distribution of vascular plant species within these alder thickets peaks in the high-subarctic, low-subarctic, and temperate latitudinal zones, with low

  16. Increase of the cytotoxic effect of Bothrops jararacussu venom on mouse extensor digitorum longus and soleus by potassium channel blockers and by Na(+)/K(+)-ATPase inhibition.

    Science.gov (United States)

    Tomaz, Marcelo A; Fernandes, Fabrício F A; El-Kik, Camila Z; Moraes, Raphael A M; Calil-Elias, Sabrina; Saturnino-Oliveira, Jeison; Martinez, Ana Maria B; Ownby, Charlotte L; Melo, Paulo A

    2008-09-15

    We investigated the myotoxicity of Bothrops jararacussu crude venom and other cytolytic agents on mouse isolated extensor digitorum longus (EDL) and soleus (SOL) muscles, which present distinct properties: EDL is a fast-twitch, white muscle with predominantly glycolytic fibers, while SOL is slow-twitch, red muscle with predominantly oxidative fibers. Muscles were exposed to B. jararacussu crude venom (25 microg/ml) and other crotaline venoms (Agkistrodon contortrix laticinctus; Crotalus viridis viridis; Crotalus durissus terrificus) at the same concentration. Basal creatine kinase (CK) release to bathing solution was 0.43+/-0.06 for EDL and 0.29+/-0.06 for SOL (U g(-)(1) h(-)(1), n=36 for each muscle). Sixty minutes after exposure to B. jararacussu venom, EDL presented higher increase in the rate of CK release than SOL, respectively, 13.2+/-1.5 and 2.9+/-0.7 U g(-)(1)h(-)(1), n=10-12. Muscle denervation, despite decreasing CK content, did not affect sensitivities to B. jararacussu venom. Ouabain and potassium channel blockers (TEA; clotrimazole; glibenclamide) increased the rate of CK release by B. jararacussu in EDL and SOL muscles, decreasing and almost abolishing the different sensitivity. When we exposed EDL or SOL muscles to Naja naja, Apis mellifera venoms (25 microg/ml), or Triton X-100 (0.01%), they showed similar rate of CK release. Our present data suggest that a mechanism involving intracellular calcium regulation or potassium channels may participate in the different sensitivity of EDL and SOL to B. jararacussu venom.

  17. Species delimitation in the lichenized fungal genus Vulpicida (Parmeliaceae, Ascomycota) using gene concatenation and coalescent-based species tree approaches.

    Science.gov (United States)

    Saag, Lauri; Mark, Kristiina; Saag, Andres; Randlane, Tiina

    2014-12-01

    • Species boundaries in many organism groups are still in a state of flux, and for empirical species delimitation, finding appropriate character sets and analytical tools are among the greatest challenges. In the lichenized fungal genus Vulpicida, six morphologically circumscribed species have been distinguished, but phenotypic characters partly overlap for three of these and intermediate forms occur. We used a combination of phylogenetic strategies to delimit the species in this genus.• Five DNA loci were sequenced and analyzed. Single-locus gene trees and a five-locus concatenated phylogeny were constructed to assess current Vulpicida species. Species boundaries were inferred from molecular data using two coalescent-based species delimitation methods (BP&P and Brownie) and from species trees reconstructed with three different algorithms (*BEAST, BEST, and STEM).• The two species restricted to North America, Vulpicida canadensis and V. viridis, are clearly distinct in all analyses. The four other traditionally accepted species form two strongly supported, closely related species-level lineages within the core group of the genus. On the basis of these results, we propose four instead of the current six species in the genus: V. canadensis, V. juniperinus, V. pinastri, and V. viridis, while V. tilesii and V. tubulosus are reduced to synonymy under V. juniperinus.• Coalescent species delimitation and tree inference give consistent results for fully distinct Vulpicida species but not for diverging populations. Even the inconsistent results were informative, revealing developing isolation despite a complex history of recombination and incomplete lineage sorting. © 2014 Botanical Society of America, Inc.

  18. Analysis of nutritional components of eight famine foods of the Republic of Niger.

    Science.gov (United States)

    Sena, L P; Vanderjagt, D J; Rivera, C; Tsin, A T; Muhamadu, I; Mahamadou, O; Millson, M; Pastuszyn, A; Glew, R H

    1998-01-01

    In the western Sahel, indigenous plants become important staples when cereal harvests are inadequate to support populations inhabiting that region of Africa. The purpose of this study was to assess the nutrient content of several of these edible wild plants. The leaves of the following seven plant foods were analyzed: Ziziphus mauritiana, Cerathotheca sesamoides, Moringa oleifera, Leptadenia hastata, Hibiscus sabdarifa, Amaranthus viridis, and Adansonia digitata. The fatty acid, vitamin E, carotenoid, selected mineral and amino acid contents of these plant foods were determined. These same analyses were performed on the fruit of the Adanisonia digitata. In quantitative and qualitative terms, Amaranthus viridis was found to be an excellent source of protein. Its amino acid composition compared favorably to that of a World Health Organization (WHO) protein standard. It also contained considerable amounts of the two fatty acids that are essential in humans (linoleic and alpha-linolenic) and a number of minerals including iron, magnesium. calcium and zinc. The leaves of Hibiscus sabdarifa contained an appreciable quantity of protein the composition of which was comparable to the WHO standard. The mineral content of the leaves of this plant was also exceptionally high; noteworthy was its high zinc content. H. sabdarifa also contained significant quantities of the two essential fatty acids. Ziziphus mauritiana was an excellent source of the essential fatty acid linoleic acid and several of the metals including iron, calcium, magnesium and zinc. Its content of other essential nutrients, however, was rather low. In general, Adansonia digitata leaves were nutritionally superior to the fruit of the tree; however, the fruit did contain useful quantities of potassium, phosphorus, zinc and alpha-linolenic acid. The Leptadenia hastata leaves were an especially good source of lutein and beta-carotene. These data should be useful to the people who inhabit the western Sahel in

  19. Stage-dependent responses to emergent habitat heterogeneity: consequences for a predatory insect population in a coffee agroecosystem.

    Science.gov (United States)

    Liere, Heidi; Perfecto, Ivette; Vandermeer, John

    2014-08-01

    Interactions among members of biological communities can create spatial patterns that effectively generate habitat heterogeneity for other members in the community, and this heterogeneity might be crucial for their persistence. For example, stage-dependent vulnerability of a predatory lady beetle to aggression of the ant, Azteca instabilis, creates two habitat types that are utilized differently by the immature and adult life stages of the beetle. Due to a mutualistic association between A. instabilis and the hemipteran Coccus viridis - which is A. orbigera main prey in the area - only plants around ant nests have high C. viridis populations. Here, we report on a series of surveys at three different scales aimed at detecting how the presence and clustered distribution of ant nests affect the distribution of the different life stages of this predatory lady beetle in a coffee farm in Chiapas, Mexico. Both beetle adults and larvae were more abundant in areas with ant nests, but adults were restricted to the peripheries of highest ant activity and outside the reach of coffee bushes containing the highest densities of lady beetle larvae. The abundance of adult beetles located around trees with ants increased with the size of the ant nest clusters but the relationship is not significant for larvae. Thus, we suggest that A. orbigera undergoes an ontogenetic niche shift, not through shifting prey species, but through stage-specific vulnerability differences against a competitor that renders areas of abundant prey populations inaccessible for adults but not for larvae. Together with evidence presented elsewhere, this study shows how an important predator is not only dependent on the existence of two qualitatively distinct habitat types, but also on the spatial distribution of these habitats. We suggest that this dependency arises due to the different responses that the predator's life stages have to this emergent spatial pattern.

  20. The mining of toxin-like polypeptides from EST database by single residue distribution analysis

    Science.gov (United States)

    2011-01-01

    Background Novel high throughput sequencing technologies require permanent development of bioinformatics data processing methods. Among them, rapid and reliable identification of encoded proteins plays a pivotal role. To search for particular protein families, the amino acid sequence motifs suitable for selective screening of nucleotide sequence databases may be used. In this work, we suggest a novel method for simplified representation of protein amino acid sequences named Single Residue Distribution Analysis, which is applicable both for homology search and database screening. Results Using the procedure developed, a search for amino acid sequence motifs in sea anemone polypeptides was performed, and 14 different motifs with broad and low specificity were discriminated. The adequacy of motifs for mining toxin-like sequences was confirmed by their ability to identify 100% toxin-like anemone polypeptides in the reference polypeptide database. The employment of novel motifs for the search of polypeptide toxins in Anemonia viridis EST dataset allowed us to identify 89 putative toxin precursors. The translated and modified ESTs were scanned using a special algorithm. In addition to direct comparison with the motifs developed, the putative signal peptides were predicted and homology with known structures was examined. Conclusions The suggested method may be used to retrieve structures of interest from the EST databases using simple amino acid sequence motifs as templates. The efficiency of the procedure for directed search of polypeptides is higher than that of most currently used methods. Analysis of 39939 ESTs of sea anemone Anemonia viridis resulted in identification of five protein precursors of earlier described toxins, discovery of 43 novel polypeptide toxins, and prediction of 39 putative polypeptide toxin sequences. In addition, two precursors of novel peptides presumably displaying neuronal function were disclosed. PMID:21281459

  1. Crovirin, a snake venom cysteine-rich secretory protein (CRISP with promising activity against Trypanosomes and Leishmania.

    Directory of Open Access Journals (Sweden)

    Camila M Adade

    2014-10-01

    Full Text Available The neglected human diseases caused by trypanosomatids are currently treated with toxic therapy with limited efficacy. In search for novel anti-trypanosomatid agents, we showed previously that the Crotalus viridis viridis (Cvv snake venom was active against infective forms of Trypanosoma cruzi. Here, we describe the purification of crovirin, a cysteine-rich secretory protein (CRISP from Cvv venom with promising activity against trypanosomes and Leishmania.Crude venom extract was loaded onto a reverse phase analytical (C8 column using a high performance liquid chromatographer. A linear gradient of water/acetonitrile with 0.1% trifluoroacetic acid was used. The peak containing the isolated protein (confirmed by SDS-PAGE and mass spectrometry was collected and its protein content was measured. T. cruzi trypomastigotes and amastigotes, L. amazonensis promastigotes and amastigotes and T. brucei rhodesiense procyclic and bloodstream trypomastigotes were challenged with crovirin, whose toxicity was tested against LLC-MK2 cells, peritoneal macrophages and isolated murine extensor digitorum longus muscle. We purified a single protein from Cvv venom corresponding, according to Nano-LC MS/MS sequencing, to a CRISP of 24,893.64 Da, henceforth referred to as crovirin. Human infective trypanosomatid forms, including intracellular amastigotes, were sensitive to crovirin, with low IC50 or LD50 values (1.10-2.38 µg/ml. A considerably higher concentration (20 µg/ml of crovirin was required to elicit only limited toxicity on mammalian cells.This is the first report of CRISP anti-protozoal activity, and suggests that other members of this family might have potential as drugs or drug leads for the development of novel agents against trypanosomatid-borne neglected diseases.

  2. Adaptations to endosymbiosis in a cnidarian-dinoflagellate association: differential gene expression and specific gene duplications.

    Science.gov (United States)

    Ganot, Philippe; Moya, Aurélie; Magnone, Virginie; Allemand, Denis; Furla, Paola; Sabourault, Cécile

    2011-07-01

    Trophic endosymbiosis between anthozoans and photosynthetic dinoflagellates forms the key foundation of reef ecosystems. Dysfunction and collapse of symbiosis lead to bleaching (symbiont expulsion), which is responsible for the severe worldwide decline of coral reefs. Molecular signals are central to the stability of this partnership and are therefore closely related to coral health. To decipher inter-partner signaling, we developed genomic resources (cDNA library and microarrays) from the symbiotic sea anemone Anemonia viridis. Here we describe differential expression between symbiotic (also called zooxanthellate anemones) or aposymbiotic (also called bleached) A. viridis specimens, using microarray hybridizations and qPCR experiments. We mapped, for the first time, transcript abundance separately in the epidermal cell layer and the gastrodermal cells that host photosynthetic symbionts. Transcriptomic profiles showed large inter-individual variability, indicating that aposymbiosis could be induced by different pathways. We defined a restricted subset of 39 common genes that are characteristic of the symbiotic or aposymbiotic states. We demonstrated that transcription of many genes belonging to this set is specifically enhanced in the symbiotic cells (gastroderm). A model is proposed where the aposymbiotic and therefore heterotrophic state triggers vesicular trafficking, whereas the symbiotic and therefore autotrophic state favors metabolic exchanges between host and symbiont. Several genetic pathways were investigated in more detail: i) a key vitamin K-dependant process involved in the dinoflagellate-cnidarian recognition; ii) two cnidarian tissue-specific carbonic anhydrases involved in the carbon transfer from the environment to the intracellular symbionts; iii) host collagen synthesis, mostly supported by the symbiotic tissue. Further, we identified specific gene duplications and showed that the cnidarian-specific isoform was also up-regulated both in the

  3. Adaptations to endosymbiosis in a cnidarian-dinoflagellate association: differential gene expression and specific gene duplications.

    Directory of Open Access Journals (Sweden)

    Philippe Ganot

    2011-07-01

    Full Text Available Trophic endosymbiosis between anthozoans and photosynthetic dinoflagellates forms the key foundation of reef ecosystems. Dysfunction and collapse of symbiosis lead to bleaching (symbiont expulsion, which is responsible for the severe worldwide decline of coral reefs. Molecular signals are central to the stability of this partnership and are therefore closely related to coral health. To decipher inter-partner signaling, we developed genomic resources (cDNA library and microarrays from the symbiotic sea anemone Anemonia viridis. Here we describe differential expression between symbiotic (also called zooxanthellate anemones or aposymbiotic (also called bleached A. viridis specimens, using microarray hybridizations and qPCR experiments. We mapped, for the first time, transcript abundance separately in the epidermal cell layer and the gastrodermal cells that host photosynthetic symbionts. Transcriptomic profiles showed large inter-individual variability, indicating that aposymbiosis could be induced by different pathways. We defined a restricted subset of 39 common genes that are characteristic of the symbiotic or aposymbiotic states. We demonstrated that transcription of many genes belonging to this set is specifically enhanced in the symbiotic cells (gastroderm. A model is proposed where the aposymbiotic and therefore heterotrophic state triggers vesicular trafficking, whereas the symbiotic and therefore autotrophic state favors metabolic exchanges between host and symbiont. Several genetic pathways were investigated in more detail: i a key vitamin K-dependant process involved in the dinoflagellate-cnidarian recognition; ii two cnidarian tissue-specific carbonic anhydrases involved in the carbon transfer from the environment to the intracellular symbionts; iii host collagen synthesis, mostly supported by the symbiotic tissue. Further, we identified specific gene duplications and showed that the cnidarian-specific isoform was also up-regulated both

  4. Molecular systematics and historical biogeography of the green lizards (Lacerta) in Greece: insights from mitochondrial and nuclear DNA.

    Science.gov (United States)

    Sagonas, Kostas; Poulakakis, Nikos; Lymberakis, Petros; Parmakelis, Aristeidis; Pafilis, Panayiotis; Valakos, Efstratios D

    2014-07-01

    The green lizards of the genus Lacerta (Sauria, Lacertidae) comprise nine recognized species, which in Europe are mainly restricted to the southern peninsulas. Four of them (L. trilineata, L. viridis, L. bilineata and L. agilis) occur in Greece. The uncertainty of morphological diversification renders the taxonomic assignment into species and subspecies problematic. In this study sequence data derived from two mitochondrial (cytochrome b and 16S rRNA) genes and one nuclear (NKTR) gene were used to (a) evaluate the taxonomic status of the genus Lacerta in Greece with emphasis on L. trilineata group and (b) investigate the evolutionary history of the genus through the application of phylogenetic and phylogeographic analyses, using Gallotia and Timon as outgroups. The phylogenetic analyses revealed the existence of four major clades. The first clade corresponds to L. trilineata group, the second to L. media, the third to L. agilis and the fourth to a complex of L. viridis and L. bilineata. However, the produced phylogenetic relationships are not congruent with the current taxonomy, especially in the first clade in which L. trilineata appeared to be paraphyletic in regard to L. pamphylica. Six distinct lineages were inferred within L. trilineata, despite the current recognition of nine morphological subspecies, the genetic differentiation of which exceeds that of other Lacerta species, imposing a thorough taxonomic revision of the species. Our results suggested a rapid diversification of L. trilineata group during the late Miocene. We believe that the present distribution of the genus in Greece is the result of several dispersal and vicariant events that took place during the late Miocene and early Pliocene. Copyright © 2014 Elsevier Inc. All rights reserved.

  5. Changes in weed infestations on plantations of sugar beet (Beta vulgaris L. subsp. vulgaris cultivated on black soil near Wrocław in 1989–1995 and 2006–2012

    Directory of Open Access Journals (Sweden)

    Krzysztof Domaradzki

    2016-03-01

    Full Text Available Field studies were carried out in 1989–1995 and 2006–2012 on plantations of sugar beet (Beta vulgaris L. subsp. vulgaris. During this period, 542 phytosociological relevés were made using the Braun-Blanquet method. In total, 46 weed species were found. In 1989–1995, the occurrence of 36 segetal species was reported. The highest cover indices were determined for Chenopodium album and Amaranthus retroflexus. Galium aparine, Echinochloa crus-galli, and Elymus repens were the dominant species, as well. Analysis of the frequency of occurrence revealed one constant species (Chenopodium album, two frequent species (Amaranthus retroflexus and Galium aparine, and two medium-frequent species (Echinochloa crus-galli and Matricaria maritima ssp. inodora. In 2006–2012, the occurrence of 40 weed species on the sugar beet plantations was recorded. The plantations were clearly dominated by Chenopodium album, accompanied by Polygonum persicaria and Polygonum lapathifolium ssp. lapathifolium. Other dominant species comprised Setaria viridis, Galinsoga parviflora, Brassica napus ssp. napus, and Fallopia convolvulus. The Chenopodium album was a constant component of the sugar beet plantations. In turn, no frequent species were observed and six medium-frequent species were found (Setaria viridis, Galinsoga parviflora, Brassica napus ssp. napus, Echinochloa crus-galli, Amaranthus retroflexus, and Capsella bursa-pastoris. Noteworthy, the presence of previously unreported species, e.g., Abutilon theophrasti, Hyoscyamus niger, or Artemisia vulgaris, was revealed. These species are rare components in sugar beet crops. A reverse phenomenon, i.e., the disappearance of some species such as Euphorbia helioscopia, Malva neglecta, Rumex acetosella, Sinapis arvensis, or Sisymbrium officinale, was also observed.

  6. The complete chloroplast and mitochondrial genomes of the green macroalga Ulva sp. UNA00071828 (Ulvophyceae, Chlorophyta.

    Directory of Open Access Journals (Sweden)

    James T Melton

    Full Text Available Sequencing mitochondrial and chloroplast genomes has become an integral part in understanding the genomic machinery and the phylogenetic histories of green algae. Previously, only three chloroplast genomes (Oltmannsiellopsis viridis, Pseudendoclonium akinetum, and Bryopsis hypnoides and two mitochondrial genomes (O. viridis and P. akinetum from the class Ulvophyceae have been published. Here, we present the first chloroplast and mitochondrial genomes from the ecologically and economically important marine, green algal genus Ulva. The chloroplast genome of Ulva sp. was 99,983 bp in a circular-mapping molecule that lacked inverted repeats, and thus far, was the smallest ulvophycean plastid genome. This cpDNA was a highly compact, AT-rich genome that contained a total of 102 identified genes (71 protein-coding genes, 28 tRNA genes, and three ribosomal RNA genes. Additionally, five introns were annotated in four genes: atpA (1, petB (1, psbB (2, and rrl (1. The circular-mapping mitochondrial genome of Ulva sp. was 73,493 bp and follows the expanded pattern also seen in other ulvophyceans and trebouxiophyceans. The Ulva sp. mtDNA contained 29 protein-coding genes, 25 tRNA genes, and two rRNA genes for a total of 56 identifiable genes. Ten introns were annotated in this mtDNA: cox1 (4, atp1 (1, nad3 (1, nad5 (1, and rrs (3. Double-cut-and-join (DCJ values showed that organellar genomes across Chlorophyta are highly rearranged, in contrast to the highly conserved organellar genomes of the red algae (Rhodophyta. A phylogenomic investigation of 51 plastid protein-coding genes showed that Ulvophyceae is not monophyletic, and also placed Oltmannsiellopsis (Oltmannsiellopsidales and Tetraselmis (Chlorodendrophyceae closely to Ulva (Ulvales and Pseudendoclonium (Ulothrichales.

  7. Where to Combat Shrub Encroachment in Alpine Timberline Ecosystems: Combining Remotely-Sensed Vegetation Information with Species Habitat Modelling.

    Science.gov (United States)

    Braunisch, Veronika; Patthey, Patrick; Arlettaz, Raphaël

    2016-01-01

    In many cultural landscapes, the abandonment of traditional grazing leads to encroachment of pastures by woody plants, which reduces habitat heterogeneity and impacts biodiversity typical of semi-open habitats. We developed a framework of mutually interacting spatial models to locate areas where shrub encroachment in Alpine treeline ecosystems deteriorates vulnerable species' habitat, using black grouse Tetrao tetrix (L.) in the Swiss Alps as a study model. Combining field observations and remote-sensing information we 1) identified and located the six predominant treeline vegetation types; 2) modelled current black grouse breeding habitat as a function thereof so as to derive optimal habitat profiles; 3) simulated from these profiles the theoretical spatial extension of breeding habitat when assuming optimal vegetation conditions throughout; and used the discrepancy between (2) and (3) to 4) locate major aggregations of homogeneous shrub vegetation in otherwise suitable breeding habitat as priority sites for habitat restoration. All six vegetation types (alpine pasture, coniferous forest, Alnus viridis (Chaix), Rhododendron-dominated, Juniperus-dominated and mixed heathland) were predicted with high accuracy (AUC >0.9). Breeding black grouse preferred a heterogeneous mosaic of vegetation types, with none exceeding 50% cover. While 15% of the timberline belt currently offered suitable breeding habitat, twice that fraction (29%) would potentially be suitable when assuming optimal shrub and ground vegetation conditions throughout the study area. Yet, only 10% of this difference was attributed to habitat deterioration by shrub-encroachment of dense heathland (all types 5.2%) and Alnus viridis (4.8%). The presented method provides both a general, large-scale assessment of areas covered by dense shrub vegetation as well as specific target values and priority areas for habitat restoration related to a selected target organism. This facilitates optimizing the spatial

  8. Where to Combat Shrub Encroachment in Alpine Timberline Ecosystems: Combining Remotely-Sensed Vegetation Information with Species Habitat Modelling.

    Directory of Open Access Journals (Sweden)

    Veronika Braunisch

    Full Text Available In many cultural landscapes, the abandonment of traditional grazing leads to encroachment of pastures by woody plants, which reduces habitat heterogeneity and impacts biodiversity typical of semi-open habitats. We developed a framework of mutually interacting spatial models to locate areas where shrub encroachment in Alpine treeline ecosystems deteriorates vulnerable species' habitat, using black grouse Tetrao tetrix (L. in the Swiss Alps as a study model. Combining field observations and remote-sensing information we 1 identified and located the six predominant treeline vegetation types; 2 modelled current black grouse breeding habitat as a function thereof so as to derive optimal habitat profiles; 3 simulated from these profiles the theoretical spatial extension of breeding habitat when assuming optimal vegetation conditions throughout; and used the discrepancy between (2 and (3 to 4 locate major aggregations of homogeneous shrub vegetation in otherwise suitable breeding habitat as priority sites for habitat restoration. All six vegetation types (alpine pasture, coniferous forest, Alnus viridis (Chaix, Rhododendron-dominated, Juniperus-dominated and mixed heathland were predicted with high accuracy (AUC >0.9. Breeding black grouse preferred a heterogeneous mosaic of vegetation types, with none exceeding 50% cover. While 15% of the timberline belt currently offered suitable breeding habitat, twice that fraction (29% would potentially be suitable when assuming optimal shrub and ground vegetation conditions throughout the study area. Yet, only 10% of this difference was attributed to habitat deterioration by shrub-encroachment of dense heathland (all types 5.2% and Alnus viridis (4.8%. The presented method provides both a general, large-scale assessment of areas covered by dense shrub vegetation as well as specific target values and priority areas for habitat restoration related to a selected target organism. This facilitates optimizing the

  9. Climate change impact research on arable weeds – data, methods and applications at various scale levels

    Directory of Open Access Journals (Sweden)

    Breitsameter, Laura

    2014-02-01

    Full Text Available In the past years, a large number of studies have examined various aspects of possible consequences of climate change for the biology and damage potential of arable weeds. However, there are merely a few examples that have comprehensively investigated individual weed species or arable crop systems within a clearly delimited geographical area. In the frame of the research co-operation KLIFF (Climate change impact and adaptation research for Lower Saxony, we tested an approach that combines a number of methods to span several scale levels and types of environmental factors, which was intended to provide as accurate as possible an estimate of the potential distribution and performance of individual arable weed species under the predicted future climate conditions. This approach was put to practice for the species Abutilon theophrasti, Amaranthus retroflexus, Echinochloa crus-galli, Datura stramonium, Iva xanthiifolia and Setaria viridis. We combined projections of the potential future distribution of the individual weed species based on a correlative distribution modelling approach (regional scale level with pot experiments (local scale level on the vegetative and generative performance of these species under climatic conditions predicted for the end of the current century for Lower Saxony. A synopsis revealed that the results obtained from the different approaches corresponded to a large extent. For A. retroflexus, D. stramonium, E. crus-galli, and S. viridis, both approaches indicated a neutral or positive effect of the predicted future climate on their potential distribution and performance, whereas the opposite was found for I. xanthiifolia. Merely for A. theophrasti, results of the two methods did not fully concur. Altogether, our results highlight that investigating climate change impact on weeds by combining several methods to span several scale levels allows fitting various data sets to a comprehensive picture for a delimited region. It has

  10. Actinomadura jiaoheensis sp. nov. and Actinomadura sporangiiformans sp. nov., two novel actinomycetes isolated from muddy soil and emended description of the genus Actinomadura.

    Science.gov (United States)

    Zhao, Junwei; Guo, Lifeng; Sun, Pengyu; Han, Chuanyu; Bai, Lu; Liu, Chongxi; Li, Yunxi; Xiang, Wensheng; Wang, Xiangjing

    2015-12-01

    Two novel actinomycetes, designated strains NEAU-Jh1-3(T) and NEAU-Jh2-5(T), were isolated from muddy soil collected from a riverbank in Jiaohe, Jilin Province, north China. A polyphasic study was carried out to establish the taxonomic positions of these strains. The 16S rRNA gene sequence analysis showed that the two novel isolates exhibited 99.9 % 16S rRNA gene sequence similarity with each other and that they are closely related to Actinomadura viridis IFO 15238(T) (99.6, 99.6 %) and Actinomadura vinacea IFO 14688(T) (99.3, 99.3 %). Phylogenetic analysis based on the 16S rRNA gene sequences indicated that the two cultures clustered together and formed a cluster with A. viridis IFO 15238(T), A. vinacea IFO 14688(T) and Actinomadura rugatobispora IFO 14382(T). However, the DNA-DNA hybridization value between strains NEAU-Jh1-3(T) and NEAU-Jh2-5(T) was 63.6 %, and the values between the two strains and their close phylogenetic relatives were also below 70 %. With reference to phenotypic characteristics, phylogenetic data and DNA-DNA hybridization results, the two strains can be distinguished from each other and their close phylogenetic relatives. Thus, strains NEAU-Jh1-3(T) and NEAU-Jh2-5(T) represent two novel species of the genus Actinomadura, for which the names Actinomadura jiaoheensis sp. nov. and Actinomadura sporangiiformans sp. nov. are proposed. The type strains are NEAU-Jh1-3(T) (=CGMCC 4.7197(T) = JCM 30341(T)) and NEAU-Jh2-5(T) (=CGMCC 4.7211(T) = JCM 30342(T)), respectively.

  11. The relative contribution of fruits and arthropods to the diet of three trogon species (Aves, Trogonidae in the Brazilian Atlantic Forest A contribuição relativa de frutos e artrópodes para a dieta de três espécies de surucuás (Aves, Trogonidae na Mata Atlântica

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Pizo

    2007-06-01

    Full Text Available Trogons are pan-tropical forest birds that eat a mix of fruits and arthropods. With direct observations of wild feeding birds, I assessed the relative contribution of fruits and arthropods to the diet of three trogon species (Trogonviridis, T.surrucura, and T.rufus at Parque Estadual Intervales, southeast Brazil. Fruits and arthropods made the bulk of the food items recorded, with a tendency of frugivory increasing with body mass. The Trogon species differed in the proportion of fruits and arthropods taken, with T.viridis being the most frugivorous species (66% of feeding bouts, n = 47. The relative contribution of fruits and arthropods did not differ between the wet and dry seasons for any species. In the omnivorous gradient, T.viridis is close to the frugivorous extreme, whereas T.surrucura and T.rufus is next to the insectivorous end. Such a distinction may have important consequences for the territoriality and social behavior of these birds.Os surucuás são aves florestais pantropicais que se alimentam de frutos e artrópodes. Com observações diretas de aves forrageando na natureza, estudei a contribuição relativa de frutos e artrópodes para a dieta de três espécies de surucuás (Trogonviridis, T.surrucura, and T.rufus no Parque Estadual Intervales, sudeste do Brasil. Frutos e artrópodes foram os itens mais registrados, com uma tendência do grau de frugivoria aumentar com o aumento da massa corporal da ave. As três espécies diferiram em relação à proporção de frutos e artrópodes de que se alimentam; T.viridisfoi a espécie mais frugívora (66% dos registros, n = 47. As contribuições relativas de frutos e artrópodes para a dieta não diferiram entre as estações seca e úmida para nenhuma das três espécies. A diferença no grau de frugivoria aqui revelada pode ter conseqüências importantes para a territorialidade e organização social dos surucuás.

  12. Amaranto BRS Alegria: alternativa para diversificar os sistemas de produção Amaranth BRS Alegria: alternative for diversification of cropping systems

    Directory of Open Access Journals (Sweden)

    Carlos Roberto Spehar

    2003-05-01

    Full Text Available A diversificação do sistema produtivo depende de espécies com rápido crescimento, tolerância ao déficit hídrico, produção de biomassa, ciclagem de nutrientes e utilização humana e animal. As espécies Amaranthus caudatus, A. cruentus e A. hypochondriacus apresentam essas características e sementes claras, sem dormência. Distinguem-se das invasoras A. spinosus, A. hybridus, A. blitum e A. viridis, com sementes escuras e dormentes. Os grãos, com excelente qualidade protéica, atendem à demanda por dietas especiais, livres de glúten e podem ser usados na alimentação animal. O A. cruentus BRS Alegria, primeira recomendação ao cultivo granífero no Brasil, originou-se da variedade AM 5189, dos Estados Unidos, na qual realizou-se seleção massal. Em sucessão à soja, apresentou produção média de 2.359 kg ha-1 de grãos e 5.650 kg ha-1 de biomassa total em apenas 90 dias de ciclo.Diversification of production systems depends on rapid growth, tolerance to hydric stress, biomass production, nutrient cycling and human and animal utilization. The grain amaranth species Amaranthus caudatus, A. cruentus and A. hypochondriacus, with light seed colour and no dormancy, present these characteristics. They are distinguishable from the weeds A. spinosus, A. hybridus, A. blitum and A. viridis, with dark and dormant seeds. Their grains, with excellent protein quality, can be used in gluten-free special diets and livestock feed. The A. cruentus BRS Alegria, the first recommendation for grain production systems in Brazil, originated from mass selection in the variety AM 5189 of the United States. In double-cropping, after soybeans, it showed average yield of 2,359 kg ha-1 for grain and of 5,650 kg ha-1 for total biomass, in 90 days from emergence to maturity.

  13. Distribuição mensal da emergência de seis ervas daninhas em solos com e sem cultivos Monthly emergence of six weeds in cultived and undisturbed soil

    Directory of Open Access Journals (Sweden)

    Hélio G. Blanco

    1994-01-01

    Full Text Available Foram realizados no período de 14 meses, com início em outubro de 1988, levantamentos demográficos mensais para registro da dinâmica de emergência de seis espécies de ervas daninhas anuais, submetidas mensalmente a um dos seguintes sistemas de manejo da população: grade de disco, grade de disco seguida de rolo compactador do solo, enxada rotativa, e herbicida de contato. Os resultados mostraram que a distribuição mensal da emergência de Digitaria horizontalis Willd. (capim-colchão, Brachiaria plantaginea (Link Hitch. (capim-marmelada, Bidens pilosa L. (picão-preto, e Amaranthus viridis L. (caruru-de-mancha, se configurou com um pico de emergência muito alto em outubro (acima de 80% do total emergido no período, com reinfestações pouco significativas nos meses seguintes, e que o manejo através do cultivo do solo favoreceu a emergência dessas espécies. O modelo de emergência de Eleusine indica (L. Gaertn. (capim-pé-de-galinha, e Eragrostis pilosa (L. Beauv. (capim-barba-de-alemão, por outro lado, apresentou um grau de emergência baixo em outubro, elevando-se até janeiro quando ocorreu o fluxo de maior pico. O manejo sem revolvimento do solo dessas duas espécies incrementou a geminação dos propágulos do banco de sementes. De um modo geral, quando não se permitiu a multiplicação sexuada, a taxa de população foi extremamente reduzida no ciclo seguinte.In lhe period of October/l988 to December/1989 a research was carried out to study lhe emergence dynamics of six weeds through monthly samplings under four weed managements: destruction of lhe former flora by cultivation with harrow, harrow following compaction by soil roller, rotary harrow and use of a contact herbicide without soil disturbance. The results showed that lhe initial emergence in October is very high for Digitaria horizontalis, Brachiaria plantaginea, Bidens pilosa and Amaranthus viridis compared with lhe emergence in lhe following months and that

  14. Las infracomunidades de parásitos de dos especies de Scartichthys (Pisces: Blenniidae en localidades cercanas del norte de Chile Parasite infracommunities of two blennid species, Scartichthys (Pisces: Blenniidae, at nearby localities off northern Chile

    Directory of Open Access Journals (Sweden)

    KAREN FLORES

    2009-03-01

    Full Text Available Se comparan las infracomunidades de parásitos de dos especies congenéricas y simpátridas de peces marinos: Scartichthys viridis (Valenciennes 1836 y Scartichthys gigas (Steindachner 1876 (Pisces: Blenniidae, en tres localidades del intermareal rocoso de Iquique (20°32' S, 70°11' O, norte de Chile, separadas por no más de 6 km, con muestras recolectadas entre agosto y septiembre de 2005. El objetivo fue evaluar la variabilidad de la riqueza, abundancia, diversidad, dominancia y composición en una escala espacial y temporal reducida. En total, se recolectaron 2.110 individuos parásitos en los 134 hospedadores examinados, los que pertenecían a 14 taxa. Se encontró una gran similitud en la composición y en las propiedades agregadas de las infracomunidades, tanto entre especies de hospedadores como entre sitios de estudio. Se interpreta que las condiciones ambientales, los factores ecológicos como el uso del habitat y de los recursos alimentarios, y los factores evolutivos como el alto grado de parentesco de estas especies de Scartichthys, son las principales influencias en la alta similitud parasitaria encontrada.The infracommunities of metazoan parasites in two congeneric and sympatric marine fish species, Scartichthys viridis (Valenciennes 1836 and Scartichthys gigas (Steindachner 1876, were studied and compared between three localities of the intertidal rocky shore off the coast of northern Chile, near Iquique (20°32' S, 70°11' W, which were separated by no more than 6 km. Samples were collected between August and September 2005. The goal of this study was to assess the variability in richness, abundance, diversity, dominance and parasite composition between close localities sampled within a short period. In all, 2,110 parasite individuals were collected from the 134 hosts examined, and 14 parasite taxa were identified. There was great similarity in the aggregated and compositional properties of the infracommunities, both between

  15. Health risk assessments of heavy metal exposure via consumption of marine mussels collected from anthropogenic sites

    International Nuclear Information System (INIS)

    Yap, Chee Kong; Cheng, Wan Hee; Karami, Ali; Ismail, Ahmad

    2016-01-01

    A total of 40 marine mussel Perna viridis populations collected (2002–2009) from 20 geographical sites located in two busy shipping lanes namely the Straits of Malacca (10 sites; 16 populations) and the Straits of Johore (8 sites; 21 populations) and three populations (2 sites) on the east coast of Peninsular Malaysia, was determined for Cd, Cu, Fe, Ni, Pb and Zn concentrations. In comparison with the maximum permissible limits (MPLs) set by existing food safety guidelines, all metal concentrations found in all the mussel populations were lower than the prescribed MPLs. In terms of the provisional tolerable weekly intake prescribed by the Joint FAO/WHO Expert Committee on Food Additives (JECFA) and oral reference doses (ORDs) by the USEPA, all the studied metals (except for Pb) were unlikely to become the limiting factors or unlikely to pose a risk for the consumption of the mussel populations. The estimated daily intake (EDI) for average level mussel (ALM) and high level mussel (HLM) consumers of mussels was found to be lower than the ORD guidelines for Cd, Cu, Fe, Ni and Zn. Furthermore, the target hazard quotient (THQ) was found to be less than 1 for ALM consumers but higher than 1 for HLM consumers in some sites. Therefore, there were no potential human health risks to the ALM consumers of the mussels. However, for Pb THQ values, the Pb levels in some mussel populations could create a health risk problem. Present results indicate that the consumption amounts of mussels should be limited for minimizing potential health risks of heavy metals to the HLM consumers. - Highlights: • Human health risk assessments of heavy metals in Perna viridis were investigated. • All metals in the mussels were below the established seafood safety guidelines. • Pb in mussels could easily reach the percentage of prescribed PTWI value of Pb. • Potential health risk with Pb exposure was found for the mussel consumers. • Consumption rate of mussels should be limited to

  16. Ayahuasca Exposure: Descriptive Analysis of Calls to US Poison Control Centers from 2005 to 2015.

    Science.gov (United States)

    Heise, C William; Brooks, Daniel E

    2017-09-01

    Ayahuasca is a hallucinogenic plant preparation which usually contains the vine Banisteriopsis caapi and the shrub Psychotria viridis. This tea originates from the Amazon Basin where it is used in religious ceremonies. Because interest in these religious groups spreading as well as awareness of use of ayahuasca for therapeutic and recreational purposes, its use is increasing. Banisteriopsis caapi is rich in β-carbolines, especially harmine, tetrahydroharmine and harmaline, which have monoamine oxidase inhibiting (MAOI) activity. Psychotria viridis contains the 5HT2A/2C/1A receptor agonist hallucinogen N,N-dimethyltryptamine (DMT). Usual desired effects include hallucination, dissociation, mood alteration and perception change. Undesired findings previously reported are nausea, vomiting, hypertension, and tachycardia. All human exposure calls reported to the American Association of Poison Controls Centers' (AAPCC) National Poison Data System (NPDS) between September 1, 2005 and September 1, 2015 were reviewed. Cases were filtered for specific plant derived ayahuasca-related product codes. Abstracted data included the following: case age and gender, exposure reason, exposure route, clinical manifestations, treatments given, medical outcomes and fatality. Five hundred and thirty-eight exposures to ayahuasca botanical products were reported. The majority of the calls to poison control centers came from healthcare facilities (83%). The most common route of exposure was ingestion. Most cases were men (437, 81%, 95% CI 77.7% - 84.3%). The median age was 21 (IQR 18-29). Most exposures were acute. Three hundred thirty-seven (63%) were reported to have a major or moderate clinical effect. The most common clinical manifestations reported were hallucinations (35%), tachycardia (34%), agitation (34%), hypertension (16%), mydriasis (13%) and vomiting (6%). Benzodiazepines were commonly given (30%). There were 28 cases in the series who required endotracheal intubation (5

  17. Ayahuasca: uma abordagem toxicológica do uso ritualístico Ayahuasca: a toxicological approach of the ritualistic use

    Directory of Open Access Journals (Sweden)

    Maria Carolina Meres Costa

    2005-12-01

    Full Text Available O chá da Ayahuasca vem sendo utilizado milenarmente por índios da América do Sul,como instrumento espiritual e ritual, com extrema religiosidade. No século passado surgiram seitas não-indígenas, que passaram a fazer uso do chá. Essa utilização vem aumentando desde a liberação do uso da Ayahuasca para fins religiosos no Brasil. A ação do chá deve-se à presença de alcalóides nas plantas utilizadas na sua preparação: o cipó Banisteriopsis caapi e as folhas do arbusto Psycotria viridis. Os efeitos observados são: alucinações, hipertensão, taquicardia, náuseas, vômitos e diarréia. Estas ações podem causar efeitos mais sérios ao organismo e, portanto, merecem maior atenção dos profissionais da saúde, no sentido de que se promovam estudos que possam permitir a utilização religiosa do chá sem maiores danos biológicos e para a conscientização dos usuários sobre os possíveis efeitos tóxicos destas substâncias.The Ayahuasca tea has been used for more than a thousand years by the Indians of South America, as a spiritual and ritualistic instrument, for religious purposes. Non-Indians sects have arose in the last century, and started to use the tea. This utilization is increasing since the legalization of the Ayahuasca for religious use in Brazil. The effect of the tea is caused by the presence of alkaloids in the plants used in its preparation: the Banisteriopsis caapi liana, and the leaves of Psycotria viridis shrub. The effects observed are: hallucination, hypertension, tachycardia, nausea, vomiting and diarrhea. These actions may cause more serious damage to the organism, and therefore deserve more attention from the health professionals, because even for strickly religious use the tea may cause higher biological damage and therefore, the users should be made aware of the possible toxic effects of these substances.

  18. Post-Messinian evolutionary relationships across the Sicilian channel: Mitochondrial and nuclear markers link a new green toad from Sicily to African relatives

    Directory of Open Access Journals (Sweden)

    Lo Brutto Sabrina

    2008-02-01

    Full Text Available Abstract Background Little attention has been paid to the consequences of the last landbridge between Africa and Sicily on Mediterranean biogeography. Previous paleontological and scarce molecular data suggest possible faunal exchange later than the well-documented landbridge in the Messinian (5.3 My; however, a possible African origin of recent terrestrial Sicilian fauna has not been thoroughly tested with molecular methods. To gain insight into the phylogeography of the region, we examine two mitochondrial and two nuclear markers (one is a newly adapted intron marker in green toads (Bufo viridis subgroup across that sea barrier, the Strait of Sicily. Results Extensive sampling throughout the western Mediterranean and North Africa revealed a deep sister relationship between Sicilian (Bufo siculus n.sp. and African green toads (B. boulengeri on the mitochondrial and nuclear level. Divergence times estimated under a Bayesian-coalescence framework (mtDNA control region and 16S rRNA range from the Middle Pliocene (3.6 My to Pleistocene (0.16 My with an average (1.83 to 2.0 My around the Pliocene/Pleistocene boundary, suggesting possible land connections younger than the Messinian (5.3 My. We describe green toads from Sicily and some surrounding islands as a new endemic species (Bufo siculus. Bufo balearicus occurs on some western Mediterranean islands (Corsica, Sardinia, Mallorca, and Menorca and the Apennine Peninsula, and is well differentiated on the mitochondrial and nuclear level from B. siculus as well as from B. viridis (Laurenti, whose haplotype group reaches northeastern Italy, north of the Po River. Detection of Calabrian B. balearicus haplotypes in northeastern Sicily suggests recent invasion. Our data agree with paleogeographic and fossil data, which suggest long Plio-Pleistocene isolation of Sicily and episodic Pleistocene faunal exchange across the Strait of Messina. It remains unknown whether both species (B. balearicus, B. siculus

  19. Testing the apparent resistance of three dominant plants to chronic drought on the Colorado Plateau

    Science.gov (United States)

    Hoover, David L.; Duniway, Michael C.; Belnap, Jayne

    2016-01-01

    Many drylands, including the south-western United States, are projected to become more water-limited as these regions become warmer and drier with climate change. Such chronic drought may push individual species or plant functional types beyond key thresholds leading to reduced growth or even mortality. Indeed, recent observational and experimental evidence from the Colorado Plateau suggests that C3 grasses are the most vulnerable to chronic drought, while C4 grasses and C3 shrubs appear to have greater resistance.The effects of chronic, or press-drought are predicted to begin at the physiological level and translate up to higher hierarchical levels. To date, the drought resistance of C4grasses and C3 shrubs in this region has been only evaluated at the community level and thus we lack information on whether there are sensitivities to drought at lower hierarchical levels. In this study, we tested the apparent drought resistance of three dominant species (Pleuraphis jamesii, a C4 rhizomatous grass; Coleogyne ramosissima, a C3 drought-deciduous shrub; and Ephedra viridis, a C3 evergreen shrub) to an ongoing experimental press-drought (-35% precipitation) by comparing individual-level responses (ecophysiology and growth dynamics) to community-level responses (plant cover).For all three species, we observed consistent responses across all hierarchical levels:P. jamesii was sensitive to drought across all measured variables, while the shrubsC. ramosissima and E. viridis had little to no responses to the experimental press-drought at any given level.Synthesis. Our findings suggest that the apparent drought resistance at higher hierarchical levels, such as cover, may serve as good proxies for lower-level responses. Furthermore, it appears the shrubs are avoiding drought, possibly by utilizing moisture at deeper soil layers, while the grasses are limited to shallower layers and must endure the drought conditions. Give this differential sensitivity to drought, a future

  20. Calosota Curtis (Hymenoptera, Chalcidoidea, Eupelmidae – review of the New World and European fauna including revision of species from the West Indies and Central and North America

    Directory of Open Access Journals (Sweden)

    Gary Gibson

    2010-09-01

    Full Text Available Two of three species previously classified in Calosota Curtis (Hymenoptera: Eupelmidae from the Neotropical region are transferred to Eupelminae. Calosota eneubulus (Walker from Galapagos Islands is transferred to Eupelmus Dalman as Eupelmus (Eupelmus eneubulus (Walker, comb. n., and Calosota silvai (Brèthes from Chile is transferred to Brasema Cameron as Brasema silvai comb. n. Calosota cecidobius (Kieffer from Argentina is retained in Calosota, with reservation, as an unrecognized species. The species of Calosota from the New World excluding South America are revised. Eleven species are recognized, including the seven newly described species Calosota albipalpus sp. n. (Costa Rica, Mexico, USA, Venezuela, Calosota bicolorata sp. n. (USA, Calosota elongata sp. n. (USA, Calosota longivena sp. n. (USA, Calosota panamaensis sp. n. (Panama, Calosota setosa sp. n. (Bahamas, Dominican Republic, USA, and Calosota speculifrons sp. n. (Costa Rica, USA. The 11 regional species and the Palaearctic species Calosota vernalis Curtis are keyed and illustrated. Calosota vernalis is not known to occur in the New World but is included in the key and diagnosed because it has been intercepted in quarantine in Canada. Calosota pseudotsugae Burks is placed in synonymy under Calosota acron (Walker, syn. n., and Calosota kentra Burks, Calosota montana Burks and Calosota septentrionalis Hedqvist are placed in synonymy under Calosota aestivalis Curtis syn. n. Calosota modesta Bolívar y Pieltain is removed from synonymy under Calosota viridis Masi, stat. rev., and Calosota viridis, Calosota matritensis Bolívar y Pieltain, and Calosota coerulea Nikol’skaya are placed in synonymy under Calosota metallica (Gahan, syn. n. Calosota grylli Erdös is confirmed as a separate species from Calosota metallica based on features of both sexes. It is suggested that Calosota ariasi Bolívar y Pieltain may be a synonym of Calosota aestivalis, Calosota bolivari Askew may be a synonym

  1. Health risk assessments of heavy metal exposure via consumption of marine mussels collected from anthropogenic sites

    Energy Technology Data Exchange (ETDEWEB)

    Yap, Chee Kong, E-mail: yapckong@hotmail.com [Department of Biology, Faculty of Science, Universiti Putra Malaysia (UPM), 43400 Serdang, Selangor (Malaysia); Cheng, Wan Hee [Inti International University, Persiaran Perdana BBN, 71800 Nilai, Negeri Sembilan (Malaysia); Karami, Ali [Laboratory of Aquatic Toxicology, Faculty of Medicine and Health Sciences, Universiti Putra Malaysia (UPM), 43400 Serdang, Selangor (Malaysia); Ismail, Ahmad [Department of Biology, Faculty of Science, Universiti Putra Malaysia (UPM), 43400 Serdang, Selangor (Malaysia)

    2016-05-15

    A total of 40 marine mussel Perna viridis populations collected (2002–2009) from 20 geographical sites located in two busy shipping lanes namely the Straits of Malacca (10 sites; 16 populations) and the Straits of Johore (8 sites; 21 populations) and three populations (2 sites) on the east coast of Peninsular Malaysia, was determined for Cd, Cu, Fe, Ni, Pb and Zn concentrations. In comparison with the maximum permissible limits (MPLs) set by existing food safety guidelines, all metal concentrations found in all the mussel populations were lower than the prescribed MPLs. In terms of the provisional tolerable weekly intake prescribed by the Joint FAO/WHO Expert Committee on Food Additives (JECFA) and oral reference doses (ORDs) by the USEPA, all the studied metals (except for Pb) were unlikely to become the limiting factors or unlikely to pose a risk for the consumption of the mussel populations. The estimated daily intake (EDI) for average level mussel (ALM) and high level mussel (HLM) consumers of mussels was found to be lower than the ORD guidelines for Cd, Cu, Fe, Ni and Zn. Furthermore, the target hazard quotient (THQ) was found to be less than 1 for ALM consumers but higher than 1 for HLM consumers in some sites. Therefore, there were no potential human health risks to the ALM consumers of the mussels. However, for Pb THQ values, the Pb levels in some mussel populations could create a health risk problem. Present results indicate that the consumption amounts of mussels should be limited for minimizing potential health risks of heavy metals to the HLM consumers. - Highlights: • Human health risk assessments of heavy metals in Perna viridis were investigated. • All metals in the mussels were below the established seafood safety guidelines. • Pb in mussels could easily reach the percentage of prescribed PTWI value of Pb. • Potential health risk with Pb exposure was found for the mussel consumers. • Consumption rate of mussels should be limited to

  2. Paleoclimatic and paleoenvironmental context of the Early Pleistocene hominins from Dmanisi (Georgia, Lesser Caucasus) inferred from the herpetofaunal assemblage

    Science.gov (United States)

    Blain, Hugues-Alexandre; Agustí, Jordi; Lordkipanidze, David; Rook, Lorenzo; Delfino, Massimo

    2014-12-01

    Dmanisi is currently the oldest Early Palaeolithic site discovered out of Africa. It has produced over 40 hominin remains, including a set of very informative skulls, in direct association with faunal remains and numerous lithic artifacts. Given the relevance of this locality, every effort is being made to reconstruct the landscapes where these hominins once lived. Amphibian and reptile remains from Dmanisi are here described for the first time and used as paleoclimatic and paleoenvironmental proxies. They comprise at least six taxa: a green toad (Bufo gr. Bufo viridis), the Greek tortoise (Testudo graeca), a green lizard (Lacerta gr. Lacerta viridis), a four-lined snake (Elaphe gr. Elaphe quatuorlineata), an indeterminate colubrid and a water snake (Natrix sp.). As these taxa are not extinct and their ecology can be directly studied, they can contribute to the reconstruction of the landscape and climate. The application of the Mutual Climatic Range method provides quantitative data indicating that during the hominin presence at Dmanisi climate was warm and dry, similar to the present-day Mediterranean climate. In comparison with today climate of Dmanisi, estimated mean annual temperature was 3.1 °C higher, with a greater increase of temperature in summer (+7.1 °C) than in winter (+4.7 °C). The mean annual precipitation was slightly lower (-65 mm) than the current level, with precipitation higher than current one during winter (+104 mm) but strongly lower during the other seasons, suggesting a stronger contrast in the rainfall regime during the year. From a paleoenvironmental point of view, fossil amphibians and reptiles all suggest the predominance of arid environments, from steppe or semi-desert to open Mediterranean forest, with stony or rocky substrate and bushy areas. The presence of permanent aquatic environments is also documented. These results mainly agree with those for large mammals, small mammals and the archaeobotanical analysis that indicate an

  3. Plantas daninhas como hospedeiras alternativas para Pratylenchus brachyurus

    Directory of Open Access Journals (Sweden)

    Guilherme Braga Pereira Braz

    Full Text Available RESUMO Uma das ações indiretas exercidas pelas plantas daninhas na interferência sob espécies cultivadas é o potencial de hospedar agentes causadores de enfermidades. O nematoide das lesões radiculares (Pratylenchus brachyurus vem causando uma série de danos em diversas culturas no Brasil. Para o manejo deste fitoparasita, o cultivo de diferentes espécies de crotalárias tem sido empregado. O objetivo deste trabalho foi avaliar a hospedabilidade de plantas daninhas para P. brachyurus, bem como o efeito de supressão de diferentes espécies de crotalária. Para isso, foi instalado um experimento em casa de vegetação no delineamento inteiramente casualizado em arranjo fatorial (2x17, com seis repetições. O primeiro fator consistiu na presença ou ausência da inoculação do nematoide. O segundo correspondeu a dezessete espécies vegetais, sendo onze plantas daninhas, quatro crotalárias (C. breviflora, C. juncea, C. ochroleuca e C spectabilis e duas variedades de soja, as quais serviram como testemunha sendo hospedeiras de P. brachyurus. A inoculação do nematoide das lesões radiculares não influenciou a altura de plantas e massa seca de parte aérea das diferentes espécies avaliadas. Portulaca oleracea, Amaranthus viridis e Sida rhombifolia foram as espécies com maior número de nematoides por sistema radicular, e apenas a S. rhombifolia apresentou comportamento semelhante a testemunha (variedade de soja BMX Potência RR®. Com relação ao número de nematoides por grama de raiz, os maiores valores foram observados para A. viridis, seguido por P. oleracea. Excluindo-se a C. juncea, todas as demais espécies de crotalária apresentaram-se como boas opções para o manejo em áreas infestadas com P. brachyurus.

  4. Do selenium and glutathione inhibit the toxic effects of mercury in marine lamellibranchs?

    Science.gov (United States)

    Patel, B; Chandy, J P; Patel, S

    1988-10-15

    The effect of selenium (SeO2) and glutathione (GSH) on the bioaccumulation of mercury (HgCl2) and on the activities of lysosomal enzymes in four species of tropical estuarine lamellibranchs is reported. A definite correlation between mercury levels in the external medium and tissue uptake and physiological behaviour--opening and closing of shell valves, response to mechanical stimulus, mucus secretion, and incidence of bleeding--was evident. In the clams exposed to Hg (range 0.1-5.0 mg l-1), bioaccumulation was dependent on the ambient concentration of Hg. The highest bioaccumulation of Hg occurred during the initial 24 h exposure period. Further exposure of up to 7 days did not increase the body burden of Hg. Of the four bivalve species exposed to 0.1 mg Hg l-1, Perna viridis showed the highest levels of Hg (approximately 47 ppm) followed by Anadara granosa, A. rhombea (approximately 25 ppm) and Meretrix casta (approximately 9 ppm). The uptake of Hg by A. granosa was greatly reduced by GSH, whereas Se enhanced it by 50% when administered in combination with Hg. However, the presence of Hg did not influence the uptake of Se. Exposure to combined GSH and Hg resulted in almost complete inhibition of Hg uptake in all four bivalve species. Prior exposure to GSH, however, did not have the same influence on their uptake of Hg. Nevertheless, exposure of clams to GSH following initial exposure to Hg resulted in complete depuration of accumulated Hg. The activities of lysosomal enzymes--arylsulfatase, acid phosphatase, beta-galactosidase and beta-glucuronidase--varied considerably. Treatment with Hg and GSH, separately and in combination, significantly enhanced the levels of beta-galactosidase (P less than 0.05) and beta-glucuronidase (P less than 0.001) in the digestive gland after 96 h exposure. Although Se increased beta-glucuronidase activity (P less than 0.001), it had no effect on beta-galactosidase. On exposure to Hg + Se the activity of both enzymes decreased

  5. Remarkable difference in paralytic shellfish poisoning toxin distribution in tissues of pen shell atrina pectinata exposed to toxic red tide bloom

    International Nuclear Information System (INIS)

    Narceda, Ronald Jefferson A.; Montojo, Ulysses M.; Cayme, Mirriam F.; Borja, Valeriano M.

    2011-01-01

    Pen shell atrina pectinata is one of the commercially important bivalves in Western Pacific region. In the Philippines, it is marketed as a whole meat or processed by shellfish harvesters to separate the abductor muscle as an export commodity. During blooms of toxic dinoflagellate pyrodinium bahamense var. compressum (Pbc), A. pectinata accumulates paralytic shellfish poisoning (PSP) toxins sometimes exceeding Philippine regulatory limit of 60μgSTXeq/100g tissue and international regulatory limit of 80μgSTXeq/100g tissue for safe human consumption, based on whole tissue analysis. Toxic blooms directly affect the shellfish industry which includes A. pectinata, and this causes not only significant economical losses on shellfish gatherers but also serious public health concerns. In this study, samples of A. pectinata exposed to toxic bloom of Pbc were collected in Sorsogon Bay, Philippines. Bioaccumulation and distribution of PSP toxins were determined in different tissues namely, abductor muscle, mantle, gills, gonads, siphon, stomach and intestine using High Performance Liquid Chromatography post column derivatization method with fluorescence detection. Likewise, green mussels Perna viridis being the sentinel species for PSP monitoring in the Philippines were also collected in the same area and served as control. Interestingly, results showed that the abductor muscle accumulates minimal level of PSP toxins and is several folds lower than the Philippine and international regulatory limits in contrast with the results obtained from P. viridis. Mantle parts showed toxicity values exceeding local regulatory limit and near to go beyond the international regulatory limit. Conversely, the remaining parts showed high toxicity values surpassing both regulation limits. Standard mouse bioassay regulatory used in PSP monitoring in the Philippines was also performed and revealed that the abductor muscle had non-detectable level of toxins. Also, toxicity values from different

  6. Metazoan parasite infection in the swordfish, Xiphias gladius, from the Mediterranean Sea and comparison with Atlantic populations: implications for its stock characterization

    Directory of Open Access Journals (Sweden)

    Mattiucci Simonetta

    2014-01-01

    Full Text Available Thirteen parasite taxa were identified in the Mediterranean swordfish by morphological and genetic/molecular methods. The comparison of the identified parasite taxa and parasitic infection values observed in the Mediterranean swordfish showed statistically significant differences with respect to those reported for its Atlantic populations. A stepwise Linear Discriminant Analysis of the individual fish examined showed a separation among three groups: one including fish from the Mediterranean Sea (CTS, STS, and IOS; one consisting of fish from the Central South (CS, Eastern Tropical (ET, and Equatorial (TEQ Atlantic; and a third comprising the fish sampled from the North-West Atlantic (NW; the CN Atlantic sample was more similar to the first group rather than to the other Atlantic ones. The nematodes Hysterothylacium petteri and Anisakis pegreffii were the species that contributed most to the characterization of the Mediterranean swordfish samples with respect to these Atlantic ones. Anisakis brevispiculata, A. physeteris, A. paggiae, Anisakis sp. 2, Hysterothylacium incurvum, Hepatoxylon trichiuri, Sphyriocephalus viridis, and their high infection levels were associated with the swordfish from the Central and the Southern Atlantic areas. Finally, H. corrugatum, A. simplex (s.s., Rhadinorhynchus pristis, and Bolbosoma vasculosum were related to the fish from the North-West (NW Atlantic area. These results indicate that some parasites, particularly Anisakis spp. larvae identified by genetic markers, could be used as “biological tags” and support the existence of a Mediterranean swordfish stock.

  7. Metazoan parasite infection in the swordfish, Xiphias gladius, from the Mediterranean Sea and comparison with Atlantic populations: implications for its stock characterization.

    Science.gov (United States)

    Mattiucci, Simonetta; Garcia, Alexandra; Cipriani, Paolo; Santos, Miguel Neves; Nascetti, Giuseppe; Cimmaruta, Roberta

    2014-01-01

    Thirteen parasite taxa were identified in the Mediterranean swordfish by morphological and genetic/molecular methods. The comparison of the identified parasite taxa and parasitic infection values observed in the Mediterranean swordfish showed statistically significant differences with respect to those reported for its Atlantic populations. A stepwise Linear Discriminant Analysis of the individual fish examined showed a separation among three groups: one including fish from the Mediterranean Sea (CTS, STS, and IOS); one consisting of fish from the Central South (CS), Eastern Tropical (ET), and Equatorial (TEQ) Atlantic; and a third comprising the fish sampled from the North-West Atlantic (NW); the CN Atlantic sample was more similar to the first group rather than to the other Atlantic ones. The nematodes Hysterothylacium petteri and Anisakis pegreffii were the species that contributed most to the characterization of the Mediterranean swordfish samples with respect to these Atlantic ones. Anisakis brevispiculata, A. physeteris, A. paggiae, Anisakis sp. 2, Hysterothylacium incurvum, Hepatoxylon trichiuri, Sphyriocephalus viridis, and their high infection levels were associated with the swordfish from the Central and the Southern Atlantic areas. Finally, H. corrugatum, A. simplex (s.s.), Rhadinorhynchus pristis, and Bolbosoma vasculosum were related to the fish from the North-West (NW) Atlantic area. These results indicate that some parasites, particularly Anisakis spp. larvae identified by genetic markers, could be used as "biological tags" and support the existence of a Mediterranean swordfish stock. © S. Mattiucci et al., published by EDP Sciences, 2014.

  8. Evaluation of the inhibitive effect of some plant extracts on the acid corrosion of mild steel

    International Nuclear Information System (INIS)

    Oguzie, Emeka E.

    2008-01-01

    Corrosion inhibition of mild steel in 2 M HCl and 1 M H 2 SO 4 by extracts of selected plants was investigated using a gasometric technique at temperatures of 30 and 60 deg. C. The studied plants materials include leaf extracts Occimum viridis (OV), Telferia occidentalis (TO), Azadirachta indica (AI) and Hibiscus sabdariffa (HS) as well as extracts from the seeds of Garcinia kola (GK). The results indicate that all the extracts inhibited the corrosion process in both acid media by virtue of adsorption and inhibition efficiency improved with concentration. Synergistic effects increased the inhibition efficiency in the presence of halide additives. Inhibition mechanisms were deduced from the temperature dependence of the inhibition efficiency as well as from assessment of kinetic and activation parameters that govern the processes. Comparative analysis of the inhibitor adsorption behaviour in 2 M HCl and 1 M H 2 SO 4 as well as the effects of temperature and halide additives suggest that both protonated and molecular species could be responsible for the inhibiting action of the extracts

  9. Origin and genome evolution of polyploid green toads in Central Asia: evidence from microsatellite markers.

    Science.gov (United States)

    Betto-Colliard, C; Sermier, R; Litvinchuk, S; Perrin, N; Stöck, M

    2015-03-01

    Polyploidization, which is expected to trigger major genomic reorganizations, occurs much less commonly in animals than in plants, possibly because of constraints imposed by sex-determination systems. We investigated the origins and consequences of allopolyploidization in Palearctic green toads (Bufo viridis subgroup) from Central Asia, with three ploidy levels and different modes of genome transmission (sexual versus clonal), to (i) establish a topology for the reticulate phylogeny in a species-rich radiation involving several closely related lineages and (ii) explore processes of genomic reorganization that may follow polyploidization. Sibship analyses based on 30 cross-amplifying microsatellite markers substantiated the maternal origins and revealed the paternal origins and relationships of subgenomes in allopolyploids. Analyses of the synteny of linkage groups identified three markers affected by translocation events, which occurred only within the paternally inherited subgenomes of allopolyploid toads and exclusively affected the linkage group that determines sex in several diploid species of the green toad radiation. Recombination rates did not differ between diploid and polyploid toad species, and were overall much reduced in males, independent of linkage group and ploidy levels. Clonally transmitted subgenomes in allotriploid toads provided support for strong genetic drift, presumably resulting from recombination arrest. The Palearctic green toad radiation seems to offer unique opportunities to investigate the consequences of polyploidization and clonal transmission on the dynamics of genomes in vertebrates.

  10. Predation of amphibians by carabid beetles of the genus Epomis found in the central coastal plain of Israel

    Directory of Open Access Journals (Sweden)

    Gil Wizen

    2011-05-01

    Full Text Available The genus Epomis is represented in Israel by two species: E. dejeani and E. circumscriptus. In the central coastal plain these species are sympatric but do not occur in the same sites. The objective of this study was to record and describe trophic interactions between the adult beetles and amphibian species occurring in the central coastal plain of Israel. Day and night surveys at three sites, as well as controlled laboratory experiments were conducted for studying beetle-amphibian trophic interaction. In the field we recorded three cases of E. dejeani preying upon amphibian metamorphs and also found that Epomis adults share shelters with amphibians. Laboratory experiments supported the observations that both Epomis species can prey on amphibians. Predation of the three anuran species (Bufo viridis, Hyla savignyi and Rana bedriagae and two urodele species (Triturus vittatus and Salamandra salamandra infraimmaculata is described. Only E. dejeani consumed T. vittatus. Therefore, we conclude that the two species display a partial overlap in food habit.

  11. Predation of amphibians by carabid beetles of the genus Epomis found in the central coastal plain of Israel

    Science.gov (United States)

    Wizen, Gil; Gasith, Avital

    2011-01-01

    Abstract The genus Epomis is represented in Israel by two species: Epomis dejeani and Epomis circumscriptus. In the central coastal plain these species are sympatric but do not occur in the same sites. The objective of this study was to record and describe trophic interactions between the adult beetles and amphibian species occurring in the central coastal plain of Israel. Day and night surveys at three sites, as well as controlled laboratory experiments were conducted for studying beetle-amphibian trophic interaction. In the field we recorded three cases of Epomis dejeani preying upon amphibian metamorphs and also found that Epomis adults share shelters with amphibians. Laboratory experiments supported the observations that both Epomis species can prey on amphibians. Predation of the three anuran species (Bufo viridis, Hyla savignyi and Rana bedriagae) and two urodele species (Triturus vittatus and Salamandra salamandra infraimmaculata) is described. Only Epomis dejeani consumed Triturus vittatus. Therefore, we conclude that the two species display a partial overlap in food habit. PMID:21738411

  12. Effects of solar PAR and UV radiation on tropical biofouling communities

    KAUST Repository

    Dobretsov, SV

    2010-03-08

    We investigated the effect of solar ultraviolet radiation (UVR) and photosynthetically active radiation (PAR) on the development of tropical micro- and macrofouling communities for 30 d. The experimental design involved 3 treatments: full spectrum (PAR+UVR), PAR only, and minimal light (reduced PAR and UVR). Terminal restriction fragment length polymorphism analysis demonstrated that different light conditions resulted in the formation of highly different microbial communities. The lowest densities of bacteria were found under the full spectrum treatment, while the lowest densities of diatoms were found in the minimal light treatment. Macrofouling communities consisted of 13 species and differed among light treatments. In the presence of UVR, communities had low species diversity, evenness, and richness, while in minimal light and PAR treatments, communities had high species diversity, evenness, and richness. Similarity percentage (SIMPER) analysis revealed that the tubeworm Hydroides elegans, the alga Ulva (Enteromorpha) sp., and the bivalve Perna viridis were the species responsible for most of the dissimilarities in macrofouling communities among treatments. While densities of H. elegans were similar in the PAR and minimal light treatments, this polychaete had higher growth rates under minimal light conditions. We conclude that UVR and PAR directly control the development of shallow micro- and macrofouling communities by inhibiting the recruitment and growth of sensitive species and promoting the growth of resistant species, but also that these forms of solar radiation influence the surface cues available to competent larvae by altering the development of the microbial community.

  13. Cenoses of phototrophic algae of ultrasaline lakes in the Kulunda steppe (Altai krai, Russian Federation)

    Science.gov (United States)

    Sapozhnikov, Ph. V.; Kalinina, O. Yu.; Nikitin, M. A.; Samylina, O. S.

    2016-01-01

    In 2012, expeditions of the Institute of Microbiology, Russian Academy of Sciences, delivered samples of algo-bacterial mats from Kulunda steppe alkaline lakes (Petukhovskoe alkaline lake, Tanatar VI, and Gorchina III). The filamentous alga Ctenocladus circinnatus (Chlorophyta) acted as an edificator of the mats. The composition of cenoses algocomponents also included chlorophytes Dunaliella viridis and Picocystis salinarum as well as diatoms Anomeoneis sphaerophora, Brachysira brebissonii, B. zellensis, Mastogloia pusilla var. subcapitata, Nitzschia amphibia, N. cf. communis, and Nitzschia sp. 1. The composition and structure of phototrophic algae cenoses (including diatom taxocenes) were described for the investigated lakes for the first time. For the period from 2011 to 2012, the total mineralization significantly increased in lakes. This involved sensible alterations of cenoses. B. zellensis was the most permanent component of diatom taxocenes in both seasons. In the summer of 2011, it was often accompanied by A. sphaerophora and B. brebissonii. In the summer of 2012, A. sphaerophora was found only singularly in Lake Gorchina III, and some biotopes of Lake Tanatar VI were massively inhabited by N. cf. communis, including colonies that had not been previously described for the species. The genetic analysis of three diatoms, which are markedly different from each other in their appearance and were sampled from different lakes but were all determined as Nitzschia cf. communis, showed their complete similarity to each other with the 18S rRNA gene fragment and the highest similarity of all the three diatoms with the species Nitzschia communis.

  14. An appraisal of eighteen commonly consumed edible plants as functional food based on their antioxidant and starch hydrolase inhibitory activities.

    Science.gov (United States)

    Lee, Yian Hoon; Choo, Candy; Watawana, Mindani I; Jayawardena, Nilakshi; Waisundara, Viduranga Y

    2015-11-01

    Eighteen edible plants were assessed for their antioxidant potential based on oxygen radical absorbance capacity (ORAC), 2,2-diphenyl-1-picrylhydrazyl (DPPH) radical scavenging activity, total phenolics, vitamin C content and various lipophilic antioxidants. The inhibitory activities of the plant extracts against the enzymatic activities of α-amylase and α-glucosidase were also evaluated. The antioxidant and starch hydrolase activities of the plants varied widely across a single batch of analysis. The ORAC and DPPH radical scavenging EC50 values varied between 298 and 1984 Trolox equivalents g(-1) fresh weight and between 91 and 533 mg kg(-1) fresh weight, respectively. The total phenolics and vitamin C contents varied between 32 and 125 mg gallic acid equivalents g(-1) fresh weight and between 96 and 285 µg g(-1) fresh weight, respectively. All the plants contained neoxanthin, violaxanthin, and α- and β-carotene in varying amounts. Coccinia grandis, Asparagus racemosus, Costus speciosus, Amaranthus viridis and Annona muricata displayed the highest inhibitory activities against starch hydrolases. They were the most efficient against the breakdown of seven starches exposed to the two enzymes as well. Overall, the edible plants were observed to display a high antioxidant potential with starch hydrolase inhibitory properties, which were beneficial in their being recognized as functional food. © 2014 Society of Chemical Industry.

  15. Performance of ectomycorrhizal alders exposed to specific Canadian oil sands tailing stressors under in vivo bipartite symbiotic conditions.

    Science.gov (United States)

    Beaudoin-Nadeau, Martin; Gagné, André; Bissonnette, Cyntia; Bélanger, Pier-Anne; Fortin, J André; Roy, Sébastien; Greer, Charles W; Khasa, Damase P

    2016-07-01

    Canadian oil sands tailings are predominately sodic residues contaminated by hydrocarbons such as naphthenic acids. These conditions are harsh for plant development. In this study, we evaluated the effect of inoculating roots of Alnus viridis ssp. crispa and Alnus incana ssp. rugosa with ectomycorrhizal fungi in the presence of tailings compounds. Seedlings were inoculated with 7 different strains of Paxillus involutus and Alpova diplophloeus and were grown under different treatments of NaCl, Na2SO4, and naphthenic acids in a growth chamber. Afterwards, seedling survival, height, dry biomass, leaf necrosis, and root mycorrhization rate were measured. Paxillus involutus Mai was the most successful strain in enhancing alder survival, health, and growth. Seedlings inoculated with this strain displayed a 25% increase in survival rate, 2-fold greater biomass, and 2-fold less leaf necrosis compared with controls. Contrary to our expectations, A. diplophloeus was not as effective as P. involutus in improving seedling fitness, likely because it did not form ectomycorrhizae on roots of either alder species. High intraspecific variation characterized strains of P. involutus in their ability to stimulate alder height and growth and to minimize leaf necrosis. We conclude that in vivo selection under bipartite symbiotic conditions is essential to select effective strains that will be of use for the revegetation and reclamation of derelict lands.

  16. Avaliações qualitativas e quantitativas de plantas daninhas na cultura da soja submetida aos sistemas de plantio direto e convencional Quantitative and qualitative weed evaluation of soybean crop in no-tillage and conventional tillage systems

    Directory of Open Access Journals (Sweden)

    Eduardo de Sá Pereira

    2000-08-01

    Full Text Available Com o objetivo de avaliar os efeitos do método de preparo do solo e do controle de plantas daninhas em resteva de aveia preta (Avena strigosa, na cultura da soja (Glycine max cv. 'IAC 14', foi conduzido um experimento de campo na Fazenda Experimental Lageado - UNESP Botucatu - SP, em 1993/94. Os tratamentos de manejo do solo foram Plantio Direto e Plantio Convencional (preparado com uma aração e três gradagens. As formas de controle de plantas daninhas estudadas corresponderam a uma testemunha sem controle do mato; controle com uso exclusivo de herbicidas aplicados em préemergência (0,28 kg/ha de metribuzim + 1,29 kg/ha de orizalin; controle com uso exclusivo de herbicidas aplicados em pósemergência (0,25 kg/ha de fluazifop-p-butil + 0,25 kg/ha de fomesafen; controle com o uso conjunto dos tratamentos em pré e pós-emergência mencionados. Tanto no plantio direto quanto no convencional, utilizou-se glyphosate para a eliminação da aveia preta e das plantas daninhas antes da implantação da cultura. O delineamento experimental adotado foi de blocos ao acaso em parcelas subdivididas, com quatro repetições. Os tipos de manejo do solo foram aplicados às parcelas e os métodos de controle das plantas daninhas às sub-parcelas. Deve ser ressaltado que durante a fase inicial do ensaio, as chuvas foram escassas, limitando tanto o crescimento da cultura quanto a atuação dos herbicidas de pré-emergência e pósemergência. As avaliações baseadas na contagem do número de plantas/m2, realizadas aos 14, 28 e 35 dias após a emergência da cultura da soja, indicaram diferenças entre os métodos de preparo do solo e os métodos de controle. Entre as espécies daninhas mais freqüentes, Brachiaria plantaginea e Amaranthus viridis foram as predominantes no sistema de plantio convencional; estas espécies apresentaram pequena importância no plantio direto, no qual predominou Euphorbia heterophylla. No plantio convencional, os herbicidas de

  17. Inhibitory Effects of Several Essential Oils towards Salmonella typhimurium, Salmonella paratyphi A and Salmonella paratyphi B

    Directory of Open Access Journals (Sweden)

    S.F. Mazhar

    2014-09-01

    Full Text Available Plant essential oils are natural products extracted from plants and because of their antimicrobial properties can be used as natural additives in foods. They are also useful for decontamination of food-borne pathogens and can be a safe additive in foods. The antimicrobial activities of essential oils belonging to Saturiea hortensis, Thymus vulgaris, Mentha polegium, Cuminum cyminum, Lavandula officinalis and Mentha viridis L. (spearmint were investigated at different concentrations (0.1, 0.3, 0.5, 1, 2, 5 and 10%v/v against Salmonella typhimurium, Salmonella paratyphi A and Salmonella paratyphi B by using the agar well diffusion method. Essential oils showed inhibitory effect on Salmonella spp. in the agar well diffusion assay. In addition, the capability of essential oils for decontamination of minced row beef, ground beef, minced raw chicken and minced raw fish inoculated with Salmonella spp. at 0.1 and 0.5%v/v were assessed. Reduction of the Salmonella spp. population was observed following the inoculation of the cultures with 0.1 and 0.5%v/v essential oils.

  18. Taxonomic notes on some Polyglyptini: descriptions of new genus and new species (Homoptera, Membracidae, Smiliinae

    Directory of Open Access Journals (Sweden)

    Albino M. Sakakibara

    1996-01-01

    Full Text Available Taxonomic notes on some Polyglyptini; descriptions of new genus and new species (Homoptera, Membracidae, Smiliinae. The genera Hemiptycha Germar, Metheisa Fowler, Maturnaria Metcalf, Aphetea Fowler, Dioclophara Kirkaldy, and Phormophora Stål, are redescribed; Creonus, gen.n. (type species: Maturna lloydi Funkhouser, 1914, and Aphetea robustula, sp.n. (from Bolivia, are described. Some nomenclatural changes are introduced, as follow: - Hemiptycha Germar, 1833 = Polyrhyssa Stål, 1869, syn.n.: - Hemiptycha cultrata (Coquebert, 1801, comb.n., = Polyglyptodes flavocostatus Haviland, 1925, syn.n., = Polyrhyssa cultrata maculata Fonseca, 1942, syn.n. - Hemiptycha obtecta (Fabricius, 1803 = Hille herbicola Haviland, 1925, syn.n. - Maturnaria ephippigera (Fairmaire, 1846 = Publilia tumulata Buckton, 1903, syn.n., = Metheisa fowleri Funkhouser, 1927, syn.n. - Creonus lloydi (Funkhouser, 1914, comb.n. - Aphetea parvula (Fabricius, 1803, comb.n., = Aphetea affinis Haviland, 1925, syn.n. - Dioclophara Kirkaldy, 1904 = lncolea Goding, 1926, syn.n. - Dioclophara viridula (Fairmaire, 1846 = Maturna multilineata Fonseca, 1942, syn.n. - Dioclophara variegata (Goding, 1926, comb.n. = lncolea viridis Goding, 1926, syn.n. - Phormophora maura (Fabricius, 1803 = Darnis dorsata Fabricius, 1803, syn.n.

  19. Antifouling activity of twelve demosponges from Brazil

    Directory of Open Access Journals (Sweden)

    SM. Ribeiro

    Full Text Available Benthic marine organisms are constantly exposed to fouling, which is harmful to most host species. Thus, the production of secondary metabolites containing antifouling properties is an important ecological advantage for sessile organisms and may also provide leading compounds for the development of antifouling paints. High antifouling potential of sponges has been demonstrated in the Indian and Pacific oceans and in the Caribbean and Mediterranean seas. Brazilian sponges remain understudied concerning antifouling activities. Only two scientific articles reported this activity in sponges of Brazil. The objective of this study was to test crude extracts of twelve species of sponges from Brazil against the attachment of the mussel Perna perna through laboratorial assays, and highlight promising species for future studies. The species Petromica citrina, Amphimedon viridis, Desmapsamma anchorata, Chondrosia sp., Polymastia janeirensis, Tedania ignis, Aplysina fulva, Mycale angulosa, Hymeniacidon heliophila, Dysidea etheria, Tethya rubra, and Tethya maza were frozen and freeze-dried before extraction with acetone or dichloromethane. The crude extract of four species significantly inhibited the attachment of byssus: Tethya rubra (p = 0.0009, Tethya maza (p = 0.0039, Petromica citrina (p = 0.0277, and Hymeniacidon heliophila (p = 0.00003. These species, specially, should be the target of future studies to detail the substances involved in the ability antifouling well as to define its amplitude of action.

  20. Chemical Composition and Quality Characteristics of Wheat Bread Supplemented with Leafy Vegetable Powders

    Directory of Open Access Journals (Sweden)

    T. V. Odunlade

    2017-01-01

    Full Text Available The study investigated the effect of supplementation of the leaf powders of Telfairia occidentalis, Amaranthus viridis, and Solanum macrocarpon on the chemical composition and the quality characteristics of wheat bread. The bread samples were supplemented with each of the vegetable leaf powders at 1%, 2%, and 3% during preparation. The bread samples were assayed for proximate composition, mineral composition, physical, sensory, and antioxidant properties using standard methods. The addition of vegetable powders significantly increased the protein (9.50 to 13.93%, fibre (1.81 to 4.00%, ash (1.05 to 2.38%, and fat (1.27 to 2.00%. Supplementation with vegetable powder however significantly decreased (p<0.05 the carbohydrate and moisture contents. Significant (p<0.05 increases were recorded for all evaluated minerals as the level of vegetable powder increased. Supplementation with vegetable powder caused significant decrease in total phenolic content, percentage DPPH inhibition, metal chelating ability, ferric reducing antioxidant power, and total antioxidant capacity. Sensory results showed that there was significant decrease in sensory qualities with increasing supplementation. This therefore suggests that bread supplemented with vegetable powder could have more market penetration if awareness is highly created.

  1. The curious case of Neotroglocarcinus dawydoffi (Decapoda, Cryptochiridae): unforeseen biogeographic patterns resulting from isolation

    KAUST Repository

    Van Der Meij, Sancia E.T.

    2014-09-09

    © 2014 The Trustees of the Natural History Museum, London. Coral gall crabs form a commonly overlooked component of the associated fauna of shallow-water reef corals and therefore little is known about their ecology and biogeography. This study investigated the biogeography and phylogenetic position of the informal Detocarcini species group within the Cryptochiridae. We used molecular data for two mitochondrial markers (COI and 16S) obtained from gall crabs covering (part of) a wide geographic range: the Red Sea, Malaysia, Indonesia and New Caledonia. Our phylogeny reconstructions portrayed the Detocarcini as paraphyletic within the monophyletic Cryptochiridae. A phylogeographic clustering was noticed in Neotroglocarcinus dawydoffi that was absent in its sister species, N. hongkongensis, and the closely related species Pseudocryptochirus viridis. A Neighbour Network was estimated for the N. dawydoffi dataset to visualize the similarity between sequences from different biogeographic areas, resulting in three groupings: (1) New Caledonia with Lembeh/Ternate (eastern Indonesia), (2) Semporna/Kudat (eastern Malaysia), and (3) Red Sea (Saudi Arabia). Cryptic speciation rather than isolation is discussed and rejected as an alternative explanation for the observed biogeographic pattern.

  2. On the influence of different host plants and of insecticide treatments on the population development of the western corn rootworm Diabrotica virgifera virgifera LeConte (Coleoptera: Chrysomelidae

    Directory of Open Access Journals (Sweden)

    Fora, Ciprian George

    2014-02-01

    Full Text Available D. virgifera virgifera is classified as a quarantine pest in Germany, therefore the trials, presented in this paper, were performed in the western part of Romania, where the pest is well established since more than ten years. The field tests were carried out in close collaboration with Banat’s University of Agricultural Sciences and Veterinary Medicine, Timişoara. On sites highly infested by D. virgifera virgifera, 1 m² plots in four replications per variable were planted with maize for the chemical treatments and alternative crops (cereals and weeds. Gauze covered hatch cages were used for weekly counts of the emerged adult Diabrotica during the hatch period from mid of June to mid of August. It could be asserted that matured cereals are no host-plants for the western corn rootworm. In four years of trials not even one adult beetle hatched in the related cages. Setaria viridis and Digitaria sanguinalis reduced the number of hatched imagines significantly, nevertheless some individuals survived. Therefore an effective herbicide management against grass weeds in maize is recommended to limit the chance of survival of the pest. Clothianidin and Tefluthrin are effective against D. virgifera virgifera. 20% to 100% efficiency was assessed in the trials, strongly depending on precipitation and soil moisture in time of application. The insecticides decreased the maize root injury caused by larvae of the western corn rootworm significantly.

  3. Assessment of heavy metal contents of green leafy vegetables

    Directory of Open Access Journals (Sweden)

    V. Jena

    2013-01-01

    Full Text Available Vegetables are rich sources of vitamins, minerals, and fibers, and have beneficial antioxidative effects. Ingestion of vegetables containing heavy metals is one of the main routes through which these elements enter the human body. Slowly released into the body, however, heavy metals can cause an array of diseases. In this study we investigated the concentrations of copper, chromium, zinc, and lead in the most frequently consumed vegetables including Pimpinella anisum, Spinacia oleracea, Amaranthus viridis, Coriandrum sativum, and Trigonella foenum graecum in various sites in Raipur city, India. Atomic absorption spectrophotometry was used to estimate the levels of these metals in vegetables. The mean concentration for each heavy metal in the samples was calculated and compared with the permissible levels set by the Food and Agriculture Organization and World Health Organization. The intake of heavy metals in the human diet was also calculated to estimate the risk to human health. Our findings indicated the presence of heavy metals in vegetables in the order of Cr > Zn > Cu > Pb. Based on these findings, we conclude that the vegetables grown in this region are a health hazard for human consumption.

  4. Contamination of butyltin compounds in Malaysian marine environments

    International Nuclear Information System (INIS)

    Sudaryanto, Agus; Takahashi, Shin; Iwata, Hisato; Tanabe, Shinsuke; Ismail, Ahmad

    2004-01-01

    Concentration of butyltin compounds (BTs), including tributyltin (TBT), dibutyltin (DBT) and monobutyltin (MBT) and total tin (ΣSn) were determined in green mussel (Perna viridis), 10 species of muscle fish and sediment from coastal waters of Malaysia. BTs were detected in all these samples ranging from 3.6 to 900 ng/g wet wt., 3.6 to 210 ng/g wet wt., and 18 to 1400 ng/g dry wt. for mussels, fish and sediments, respectively. The concentrations of BTs in several locations of this study were comparable with the reported values from some developed countries and highest among Asian developing nations. Considerable concentration of BTs in several locations might have ecotoxicological consequences and may cause concern to human health. The parent compound TBT was found to be highest than those of its degradation compounds, DBT and MBT, suggesting recent input of TBT to the Malaysian marine environment. Significant positive correlation (Spearman rank correlation: r 2 =0.82, P<0.0001) was found between BTs and ΣSn, implying considerable anthropogenic input of butyltin compounds to total tin contamination levels. Enormous boating activities may be a major source of BTs in this country, although aquaculture activities may not be ignored. - Lack of any regulation of TBT clearly resulted in a heavy contamination of BTs in Malaysia

  5. Direct injection of tissue extracts in liquid chromatography/tandem mass spectrometry for the determination of pharmaceuticals and other contaminants of emerging concern in mollusks.

    Science.gov (United States)

    Bayen, Stéphane; Estrada, Elvagris Segovia; Juhel, Guillaume; Kelly, Barry C

    2015-07-01

    In the present study, a straightforward approach was validated for the analysis of pharmaceutically active compounds and endocrine-disrupting chemicals in the mollusk tissues, with a focus on two species commonly consumed in Southeast Asia (green mussels: Perna viridis; lokan clams: Polymesoda expansa). This approach relied on a simple solvent extraction (shaker table) followed by direct injection in liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS). This "cleanup-free" approach was made possible by the use of isotopically labeled surrogates (to correct for matrix effects) and a post-column switch on the LC-MS/MS system (to remove potential interfering material). Altogether, relative recoveries were satisfactory for 36 out of 44 compounds (26-163% range) and excellent for 27 out of 44 compounds (79-107% range). Method detection limits (MDLs) were usually expressed in the nanogram per gram wet weight (ww) range and below. The method was successfully applied to 16 batches of green mussel samples collected in Singapore coastal waters. Trace levels of six compounds were detected in mussel tissues: caffeine (0.22-1.55 ng g(-1) ww), carbamazepine (

  6. Fasciola hepatica in snails collected from water-dropwort fields using PCR.

    Science.gov (United States)

    Kim, Hwang-Yong; Choi, In-Wook; Kim, Yeon-Rok; Quan, Juan-Hua; Ismail, Hassan Ahmed Hassan Ahmed; Cha, Guang-Ho; Hong, Sung-Jong; Lee, Young-Ha

    2014-12-01

    Fasciola hepatica is a trematode that causes zoonosis mainly in cattle and sheep and occasionally in humans. Fascioliasis has been reported in Korea; however, determining F. hepatica infection in snails has not been done recently. Thus, using PCR, we evaluated the prevalence of F. hepatica infection in snails at 4 large water-dropwort fields. Among 349 examined snails, F. hepatica-specific internal transcribed space 1 (ITS-1) and/or ITS-2 markers were detected in 12 snails and confirmed using sequence analysis. Morphologically, 213 of 349 collected snails were dextral shelled, which is the same aperture as the lymnaeid snail, the vectorial host for F. hepatica. Among the 12 F. hepatica-infected snails, 6 were known first intermediate hosts in Korea (Lymnaea viridis and L. ollula) and the remaining 6 (Lymnaea sp.) were potentially a new first intermediate host in Korea. It has been shown that the overall prevalence of the snails contaminated with F. hepatica in water-dropwort fields was 3.4%; however, the prevalence varied among the fields. This is the first study to estimate the prevalence of F. hepatica infection using the vectorial capacity of the snails in Korea.

  7. Decontamination of tomato, red cabbage, carrot, fresh parsley and fresh green onion inoculated with Shigella sonnei and Shigella flexneri by some Essential oils (in vitro condition

    Directory of Open Access Journals (Sweden)

    Farhang Aliakbari

    2014-06-01

    Full Text Available Background: Essential oils and their major constituents are useful sources of antimicrobial compounds. There are a few reports on the decontamination and antimicrobial activity of essential oils towards Shigella spp.Materials and Methods: In this study, the antimicrobial and decontamination potentials of essential oils at different concentrations, belonging to plants such as Thymus vulgaris, Saturiea hortensis, Mentha polegium, Cuminum cyminum, Lavandula officinalis and Mentha viridis L. (spearmint, towards Shigella sonnei and Shigella  flexneri were investigated. The disk diffusion method demonstrated the antimicrobial potential of the essential oils.Results: The ability of essential oils to decontaminate vegetables such as, tomato, red cabbage, carrot, fresh parsley and fresh green onion that were previously inoculated with Shigella spp. was determined. Inhibitory effects of essential oils towards Shigella spp. were noted in the disk diffusion method. There was a reduction in Shigella population following inoculation of cultures with 0.5% and 0.1% (v/v essential oils.Conclusion: This study confirmed that essential oils have the potential to be used for decontamination of vegetables.

  8. A Foxtail mosaic virus Vector for Virus-Induced Gene Silencing in Maize1[OPEN

    Science.gov (United States)

    Mei, Yu; Kernodle, Bliss M.; Hill, John H.

    2016-01-01

    Plant viruses have been widely used as vectors for foreign gene expression and virus-induced gene silencing (VIGS). A limited number of viruses have been developed into viral vectors for the purposes of gene expression or VIGS in monocotyledonous plants, and among these, the tripartite viruses Brome mosaic virus and Cucumber mosaic virus have been shown to induce VIGS in maize (Zea mays). We describe here a new DNA-based VIGS system derived from Foxtail mosaic virus (FoMV), a monopartite virus that is able to establish systemic infection and silencing of endogenous maize genes homologous to gene fragments inserted into the FoMV genome. To demonstrate VIGS applications of this FoMV vector system, four genes, phytoene desaturase (functions in carotenoid biosynthesis), lesion mimic22 (encodes a key enzyme of the porphyrin pathway), iojap (functions in plastid development), and brown midrib3 (caffeic acid O-methyltransferase), were silenced and characterized in the sweet corn line Golden × Bantam. Furthermore, we demonstrate that the FoMV infectious clone establishes systemic infection in maize inbred lines, sorghum (Sorghum bicolor), and green foxtail (Setaria viridis), indicating the potential wide applications of this viral vector system for functional genomics studies in maize and other monocots. PMID:27208311

  9. A Foxtail mosaic virus Vector for Virus-Induced Gene Silencing in Maize.

    Science.gov (United States)

    Mei, Yu; Zhang, Chunquan; Kernodle, Bliss M; Hill, John H; Whitham, Steven A

    2016-06-01

    Plant viruses have been widely used as vectors for foreign gene expression and virus-induced gene silencing (VIGS). A limited number of viruses have been developed into viral vectors for the purposes of gene expression or VIGS in monocotyledonous plants, and among these, the tripartite viruses Brome mosaic virus and Cucumber mosaic virus have been shown to induce VIGS in maize (Zea mays). We describe here a new DNA-based VIGS system derived from Foxtail mosaic virus (FoMV), a monopartite virus that is able to establish systemic infection and silencing of endogenous maize genes homologous to gene fragments inserted into the FoMV genome. To demonstrate VIGS applications of this FoMV vector system, four genes, phytoene desaturase (functions in carotenoid biosynthesis), lesion mimic22 (encodes a key enzyme of the porphyrin pathway), iojap (functions in plastid development), and brown midrib3 (caffeic acid O-methyltransferase), were silenced and characterized in the sweet corn line Golden × Bantam. Furthermore, we demonstrate that the FoMV infectious clone establishes systemic infection in maize inbred lines, sorghum (Sorghum bicolor), and green foxtail (Setaria viridis), indicating the potential wide applications of this viral vector system for functional genomics studies in maize and other monocots. © 2016 American Society of Plant Biologists. All Rights Reserved.

  10. ECOMOD - An ecological approach to radioecological modelling

    International Nuclear Information System (INIS)

    Sazykina, Tatiana G.

    2000-01-01

    A unified methodology is proposed to simulate the dynamic processes of radionuclide migration in aquatic food chains in parallel with their stable analogue elements. The distinguishing feature of the unified radioecological/ecological approach is the description of radionuclide migration along with dynamic equations for the ecosystem. The ability of the methodology to predict the results of radioecological experiments is demonstrated by an example of radionuclide (iron group) accumulation by a laboratory culture of the algae Platymonas viridis. Based on the unified methodology, the 'ECOMOD' radioecological model was developed to simulate dynamic radioecological processes in aquatic ecosystems. It comprises three basic modules, which are operated as a set of inter-related programs. The 'ECOSYSTEM' module solves non-linear ecological equations, describing the biomass dynamics of essential ecosystem components. The 'RADIONUCLIDE DISTRIBUTION' module calculates the radionuclide distribution in abiotic and biotic components of the aquatic ecosystem. The 'DOSE ASSESSMENT' module calculates doses to aquatic biota and doses to man from aquatic food chains. The application of the ECOMOD model to reconstruct the radionuclide distribution in the Chernobyl Cooling Pond ecosystem in the early period after the accident shows good agreement with observations

  11. Occurence, spread and possibilities of invasive weeds control in sugar beet

    Directory of Open Access Journals (Sweden)

    Konstantinović Branko I.

    2006-01-01

    Full Text Available Floristically rich and diverse weed comunity of sugar beet is in our country represented by 150 weed species. They are not all equaly significant in weediness of this crop. Only a limited number of them participate in weed comunity composition. These are: Abuthilon theophrasti Medic., Ambrosia artemisiifolia L., Amaranthus retroflexus L., Chenopodium album L., Cirsium arvense (L Scop., Convolvulus arvensis L., Cynodon dactylon (L Pers. Digitaria sanguinalis (L Scop., Hibiscus trionum L., Rubus caesius L. Echinochloa crus-gall L., Polygonum aviculare L., P. lapathifolium L., P. persicaria L., Setaria glauca (L P. B., S. viridis (L P. B., Solanum nigrum L. and Sorghum halepense (L Pers. In shooting period up to 4-8 weeks upon emergence, sugar beet is under the haviest harmfull inluence of weeds, especially invasive ones such as: Abuthilon theophrasti Medic. Ambrosia artemisiifolia L., Cirsium arvense (L Scop., Iva xanthifolia L. Sorghum halepense (L Pers. and Xanthium strumarium L. Sugar beet growing requires intensive cultural practices, i.e. basic and additional tillage and cultivation. Due to the widening of weed problems, frequent herbicide use in several applications is needed in the longer time period.

  12. Importance of visual cues of conspecifics and predators during the habitat selection of coral reef fish larvae.

    Science.gov (United States)

    Lecchini, David; Peyrusse, Kevin; Lanyon, Rynae Greta; Lecellier, Gaël

    2014-05-01

    The study investigated visual recognition of conspecifics and predators by settlement-stage coral reef fish larvae in a set of three experiments using a dual-choice aquarium (Moorea Island). Experiments 1 and 2 were conducted under artificial light conditions. Experiment 3 was conducted under natural light during new and full moon nights. In experiment 1, five out of six species preferred conspecifics rather than heterospecifics (Acanthurus triostegus, Chromis viridis, Ostorhinchus angustatus, Stegastes fasciolatus, Valenciaenna strigata). In experiment 2, three out of six species were repulsed by predators (Mulloidichtys flavolineatus, O. angustatus, V. strigata). In experiment 3 (conducted on one species), A. triostegus was attracted to conspecifics during bright nights, but did not show such behavior during dark nights. Our study raises the question of trade-off for fish larvae to settle during the night with high light intensities to favor the visual recognition of conspecifics and predators, or during darker nights to reduce reef predation. Copyright © 2014 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  13. Phytoplankton diversity in the bioremediation pool in PTAPB-BATAN Yogyakarta

    International Nuclear Information System (INIS)

    Wijiyono; Artiningsih, Sri

    2013-01-01

    Research has been done on Phytoplankton Diversity in Bioremediation Pool in PTAPB-BATAN Yogyakarta. This study aims to determine the diversity of phytoplankton and phytoplankton species are numerous in the bioremediation pool in PTAPB BATAN. This study is an observational study conducted from September to November 2012. The population in this study is all kinds of phytoplankton that live in the bioremediation pool. The sample was filtered with all phytoplankton plankton net at each sampling point. This study was conducted to determine the point of sampling as much as 3 points, namely at the inlet, the center of the pond, and exit channel, with each point done 3 times repetition. Sampling was done by taking as much as 50 liters of water at each sample point, the water sample is filtered directly into the plankton net. Filtered water put into flakon bottles. Observation and identification of plankton were done in the laboratory. The research found as many as 21 species of phytoplankton consisting of Scenedesmus acuminatus, Scenedesmus quadricauda, Closterium moniiferum, Pleurosigma sp., Rivularia bullata, Chroococcus sp., Cocconeis sp., Pinnularia viridis, Navicula sp., Spirogyra sp., Thiopedia rosea, Cyclotella sp., Minidiscus sp., Achnantes sp., ChIorella sp., Oscillatoria sp., Hemiaulus sp., Surirella sp., Chattonella sp., Thalasiossira mala, Leuvenia sp. Phytoplankton density value of 5.330 ind / I. Phytoplankton diversity index value was 2.6062, included in the medium category. (author)

  14. The role of carbonic anhydrase in C4 photosynthesis

    Energy Technology Data Exchange (ETDEWEB)

    Studer, Anthony [Life Sciences Research Foundation, Baltimore, MD (United States)

    2015-10-01

    Current pressures on the global food supply have accelerated the urgency for a second green revolution using novel and sustainable approaches to increase crop yield and efficiency. This proposal outlines experiments to address fundamental questions regarding the biology of C4 photosynthesis, the method of carbon fixation utilized by the most productive food, feed and bioenergy crops. Carbonic anhydrase (CA) has been implicated in multiple cellular functions including nitrogen metabolism, water use efficiency, and photosynthesis. CA catalyzes the first dedicated step in C4 photosynthesis, the hydration of CO2 into bicarbonate, and is potentially rate limiting in C4 grasses. Using insertional mutagenesis, we have generated CA mutants in maize, and propose the characterization of these mutants using phenotypic, physiological, and transcriptomic profiling to assay the plant’s response to altered CA activity. In addition, florescent protein tagging experiments will be employed to study the subcellular localization of CA paralogs, providing critical data for modeling carbon fixation in C4 plants. Finally, I propose parallel experiments in Setaria viridis to explore its relevance as model C4 grass. Using a multifaceted approach, this proposal addresses important questions in basic biology, as well as the need for translation research in response to looming global food challenges.

  15. Plant communities of cultivated fields of the Podlaski Przełom Bugu mesoregion. Part 5. Root crop communities of light soils

    Directory of Open Access Journals (Sweden)

    Zofia Rzymowska

    2012-12-01

    Full Text Available This present paper, focused on root crop communities of light soils, is a part of the wide range characteristics of segetal communities of the Podlaski Przełom Bugu (Podlasie Bug River Gorge mesoregion. On the basis of 160 phytosociological relevés made according to the Braun-Blanquet method, phytocenoses representing the Panico-Setarion alliance were distinguished. Most often, patches of the association Echinochloo-Setarietum were recorded in the study area. Heterogeneous habitat conditions affect its floristic diversity. Two subassociations of the phytocenosis, divided according to the species composition into 9 lower syntaxa, were identified on light soils. The following subassociations were distinguished: Echinochloo-Setarietum setarietosum glaucae in a typical variant and a variant with Juncus bufonius, both with subvariants with Digitaria ischaemum, as well as a typical variant of Echinochloo-Setarietum typicum, a variant with Juncus bufonius and a subvariant with Oxalis stricta in the typical and wet variant. Another association found in root crops on light soils of the Podlaski Przełom Bugu mesoregion is Digitarietum ischaemi. Its patches were observed in cultivations on light, acidic, poor soils. The characteristic feature of this community is the occurrence of numerous acidophilous species. In habitat conditions typical for the Podlaski Przełom Bugu mesoregion, Digitarietum ischaemi is differentiated into the typical and wet variant. Quite frequent patches of the Setaria pumila-Setaria viridis community were noted in intermediate habitat conditions, between those characteristic for Digitarietum ischaemi and Echinochloo-Setarietum.

  16. The life cycle of Prosorhynchoides carvajali (Trematoda: Bucephalidae) involving species of bivalve and fish hosts in the intertidal zone of central Chile.

    Science.gov (United States)

    Muñoz, G; Valdivia, I; López, Z

    2015-09-01

    We describe the life cycle of the bucephalid Prosorhynchoides carvajali from the intertidal rocky zone of central Chile. To elucidate the life cycle of this digenean, two mytilid bivalves, Semimytilus algosus and Perumytilus purpuratus, and ten intertidal fish species belonging to the families Blenniidae, Tripterygiidae, Labrisomidae, Kyphosidae and Gobiesocidae were analysed for natural infections. In addition, experimental infections of fish were undertaken and molecular analyses were performed of several developmental stages of the digeneans in various host species. Experimental infections of fish were made from infected mytilids to determine which fish species were suitable for the metacercarial stage of Prosorhynchoides. We also determined the abundance and prevalence of metacercariae in natural infections in fish and found that they were lower than in the experimental infections. A molecular analysis showed that sporocysts from S. algosus were identical to metacercariae from five fish species and P. carvajali adults. Sporocysts isolated from P. purpuratus were similar to metacercaria found in one fish species only (G. laevifrons) but were different from P. carvajali, with 1.9-2.0% genetic divergence. Therefore, the complete life cycle of P. carvajali consists of the mytilid species S. algosus as the first intermediate host, at least five intertidal fish species as second intermediate hosts (Scartichthys viridis, Auchenionchus microcirrhis, Hypsoblennius sordidus, Helcogrammoides chilensis and Gobiesox marmoratus), two carnivorous fish as definitive hosts (Auchenionchus microcirrhis and A. variolosus) and one occasional definitive host (Syciases sanguineus). This is the second description of a life cycle of a marine digenean from Chile.

  17. Asymmetry in serial femtosecond crystallography data.

    Science.gov (United States)

    Sharma, Amit; Johansson, Linda; Dunevall, Elin; Wahlgren, Weixiao Y; Neutze, Richard; Katona, Gergely

    2017-03-01

    Serial crystallography is an increasingly important approach to protein crystallography that exploits both X-ray free-electron laser (XFEL) and synchrotron radiation. Serial crystallography recovers complete X-ray diffraction data by processing and merging diffraction images from thousands of randomly oriented non-uniform microcrystals, of which all observations are partial Bragg reflections. Random fluctuations in the XFEL pulse energy spectrum, variations in the size and shape of microcrystals, integrating over millions of weak partial observations and instabilities in the XFEL beam position lead to new types of experimental errors. The quality of Bragg intensity estimates deriving from serial crystallography is therefore contingent upon assumptions made while modeling these data. Here it is observed that serial femtosecond crystallography (SFX) Bragg reflections do not follow a unimodal Gaussian distribution and it is recommended that an idealized assumption of single Gaussian peak profiles be relaxed to incorporate apparent asymmetries when processing SFX data. The phenomenon is illustrated by re-analyzing data collected from microcrystals of the Blastochloris viridis photosynthetic reaction center and comparing these intensity observations with conventional synchrotron data. The results show that skewness in the SFX observations captures the essence of the Wilson plot and an empirical treatment is suggested that can help to separate the diffraction Bragg intensity from the background.

  18. EVALUATION OF FISH FAUNA STOCKS IN DAMS IN SOSSEGO MIME IN CANAÃ OF CARAJÁS (EASTERN AMAZON, CAPTURED WITH THE USE OF CAST NET BEFORE THE DEPOSIT OF TAILINGS

    Directory of Open Access Journals (Sweden)

    Ivan Furtado Junior

    2016-12-01

    Full Text Available This study aims to estimate the biomass of fish stocks in the area of the dam formed by tailings of Sossego mine in Canaã dos Carajás, captured with the use of cast nets for fish. The prospecting work was carried out during the period from 29 February to 6 March 2004, 6 months after closing the dam and immediately before the disposal of waste. The average values estimated for the capture per unit area covered by cast nets (CPUA and biomass were 8.4 g m-² and 16,922.7 kg, respectively. The most representative groups of fish were minnows, with 67.7% and discus with 24.8% of the total estimated biomass. The species caught were: Moenkhausia cf. sanctaefilomenae (redeye tetra fish, Tetragonopterus cf. argenteus (white tetra fish, Tetragonopterus chalceus (red tetra fish, Aequidens viridis (cichlasoma bimaculatum Crenicichla cincta (jacunda Hoplerythrinus unitaeniatus (jeju Curimata inornata (branquinha and Hoplias malabaricus (trahira. Keywords: fishing survey; yield per unit area; biomass; tailings dam.

  19. Mutagenic effectiveness and efficiency of gamma rays in mungbean

    International Nuclear Information System (INIS)

    Yadav, R.D.S.; Singh, P.D.

    1988-01-01

    Dry seeds (moisture, 9 per cent) of mungbean (Vigna radiata (L.) Wilczek) variety PS 16 were treated with ten doses of gamma rays ( 60 Co) ranging from 10 to 100 kR. Plant survival and pollen fertility in X 1 , and, chlorophyll mutation frequency and mutagenic effectiveness and efficiency were studied in X 2 generation. The plant survival and pollen fertility were reduced gradually with increasing dose. The chlorophyll mutation frequency increased in a linear fashion upto medium doses and was erratic at higher doses. The chlorophyll mutation spectrum included albina xantha, chlorina, virescence, viridis and maculata. Mutagenic effectiveness decreased with increase dose except at 60 kR. Mutagenic efficiency increased upto to 30 kR and thereafter it decreased. The decreasing trend of mutagenic effectiveness and efficiency at increased dose of gamma rays revealed that the biological damage (survival and pollen fertility) increased with increase dose at the faster rate than increase in rate of mutations induced. (author). 8 refs., 4 tabs

  20. Behavioral Changes Over Time Following Ayahuasca Exposure in Zebrafish

    Directory of Open Access Journals (Sweden)

    Robson Savoldi

    2017-07-01

    Full Text Available The combined infusion of Banisteriopsis caapi stem and Psychotria viridis leaves, known as ayahuasca, has been used for centuries by indigenous tribes. The infusion is rich in N, N-dimethyltryptamine (DMT and monoamine oxidase inhibitors, with properties similar to those of serotonin. Despite substantial progress in the development of new drugs to treat anxiety and depression, current treatments have several limitations. Alternative drugs, such as ayahuasca, may shed light on these disorders. Here, we present time-course behavioral changes induced by ayahuasca in zebrafish, as first step toward establishing an ideal concentration for pre-clinical evaluations. We exposed adult zebrafish to five concentrations of the ayahuasca infusion: 0 (control, 0.1, 0.5, 1, and 3 ml/L (n = 14 each group, and behavior was recorded for 60 min. We evaluated swimming speed, distance traveled, freezing and bottom dwelling every min for 60 min. Swimming speed and distance traveled decreased with an increase in ayahuasca concentration while freezing increased with 1 and 3 ml/L. Bottom dwelling increased with 1 and 3 ml/L, but declined with 0.1 ml/L. Our data suggest that small amounts of ayahuasca do not affect locomotion and reduce anxiety-like behavior in zebrafish, while increased doses of the drug lead to crescent anxiogenic effects. We conclude that the temporal analysis of zebrafish behavior is a sensitive method for the study of ayahuasca-induced functional changes in the vertebrate brain.