WorldWideScience

Sample records for ant paraponera clavata

  1. The effect of water on the ground nesting habits of the giant tropical ant, Paraponera clavata

    OpenAIRE

    Elahi, Robin

    2005-01-01

    The large predatory ant, Paraponera clavata, exerts measurable top-down effects in wet and moist Neotropical forests, and therefore its distribution has potential ecological implications. To determine how water affects the presence of this important predator, the ground nesting ecology of P. clavata was examined with respect to various habitat characteristics. Four hectares of disturbed Costa Rican lowland rain forest were surveyed for ant colonies to determine nest distribution patterns in w...

  2. The effect of water on the ground nesting habits of the giant tropical ant, Paraponera clavata.

    Science.gov (United States)

    Elahi, Robin

    2005-11-18

    The large predatory ant, Paraponera clavata, exerts measurable top-down effects in wet and moist Neotropical forests, and therefore its distribution has potential ecological implications. To determine how water affects the presence of this important predator, the ground nesting ecology of P. clavata was examined with respect to various habitat characteristics. Four hectares of disturbed Costa Rican lowland rain forest were surveyed for ant colonies to determine nest distribution patterns in wet and dry habitat; significantly more colonies were found in dry habitat. Seventeen of 19 nests built on slopes of > 5 degrees inclination were positioned on the downward side of the tree, possibly using the trunk as a shield against runoff during rain showers. Moisture and pH inside nests were significantly different from adjacent soil. These results suggest that water influences the ground nesting habits of P. clavata, thus ecological differences between comparatively wet and dry portions of tropical forests may arise from the relative abundance of this ant species.

  3. To drink or grasp? How bullet ants ( Paraponera clavata) differentiate between sugars and proteins in liquids

    Science.gov (United States)

    Jandt, Jennifer; Larson, Hannah K.; Tellez, Peter; McGlynn, Terrence P.

    2013-12-01

    Flexibility in behavior can increase the likelihood that a forager may respond optimally in a fluctuating environment. Nevertheless, physiological or neuronal constraints may result in suboptimal responses to stimuli. We observed foraging workers of the giant tropical ant (also referred to as the "bullet ant"), Paraponera clavata, as they reacted to liquid solutions with varying concentrations of sugar and protein. We show that when protein/sucrose concentration is high, many bullet ants will often try to grasp at the droplet, rather than gather it by drinking. Because P. clavata actively hunt for prey, fixed action patterns and rapid responses to protein may be adaptively important, regardless of the medium in which it is presented. We conclude that, in P. clavata, food-handling decisions are made in response to the nutrient content of the food rather than the texture of the food. Further, we suggest that colonies that maintain a mixture of individuals with consistent fixed or flexible behavioral responses to food-handling decisions may be better adapted to fluctuating environmental conditions, and we propose future studies that could address this.

  4. A quantification of predation rates, indirect positive effects on plants, and foraging variation of the giant tropical ant, Paraponera clavata

    Directory of Open Access Journals (Sweden)

    Lee A. Dyer

    2002-09-01

    Full Text Available While a clear consensus is emerging that predators can play a major role in shaping terrestrial communities, basic natural history observations and simple quantifications of predation rates in complex terrestrial systems are lacking. The potential indirect effect of a large predatory ant, Paraponera clavata Fabricius (Formicidae: Ponerinae, on herbivores was determined on rainforest trees at La Selva Biological Station in Costa Rica and Barro Colorado Island in Panama. Prey and other food brought back to nests by 75 colonies of P. clavata were quantified, taking into account temporal, seasonal, and microhabitat variation for both foraging activity and composition of foraging booty. The dispersion and density of ant colonies and combined density with the mean amounts of prey retrieval were used to calculate rates of predation per hectare in the two forests. In addition, herbivory was measured on trees containing P. clavata and on trees where the ants were not foraging. Colonies at La Selva brought back significantly more nectar plus prey than those at Barro Colorado Island, but foraging patterns were similar in the two forests. At both forests, the ants were more active at night, and there was no significant seasonal or colonial variation in consumption of nectar, composition of foraging booty, and overall activity of the colonies. At La Selva, trees containing P. clavata colonies had the same levels of folivory as nearest neighbor trees without P. clavata but had significantly lower folivory than randomly selected trees. Predation by this ant was high in both forests, despite its omnivorous diet. This insect predator is part of potentially important top-down controls in these wet and moist forests.

  5. Distribución, mortalidad y asociación con plantas, de nidos de Paraponera clavata (Hymenoptera: Formicidae en la isla de Barro Colorado, Panamá

    Directory of Open Access Journals (Sweden)

    Rolando Pérez

    1999-12-01

    Full Text Available Se estudió la distribución, mortalidad, reclutamiento y asociación con plantas, de 308 nidos de la hormiga neotropical Paraponera clavata en una parcela de cincuenta hectáreas de bosque viejo en la isla de Barro Colorado entre septiembre de 1993 y febrero de 1995. Los nidos estaban distribuidos uniformemente a través de toda la parcela, y se asociaban de manera significativa con el tipo de hábitat, existían más nidos de los esperados en las planicies altas y en la sección de bosque más joven de la parcela. La densidad promedio era de 6.2 nidos por hectárea. Los nidos con un mayor número de vecinos entre 0 y 20 m de distancia, tenían una mayor probabilidad de morir, si se comparaban con aquéllos que se encontraban separados por distancias mayores. La mortalidad era entre 13.36 y 69.64% dependiendo del intervalo de censo, y el reclutamiento fue del 22.63 y 31.72%. Los nidos se encontraron en las bases de 84 especies de plantas, en 34 familias con cuatro categorías de forma de vida: 76 especies eran árboles, 5 especies eran arbustos, 2 especies eran palmas y 1 era liana. Ocho especies de plantas se asociaban positivamente con los nidos de la hormiga. Plantas medianas entre 8 y 63.9 cm de DAP eran las más utilizadas. Arboles y arbustos pequeños presentan muy poca asociación con los nidos. La hormiga no se asocia con árboles que tienen nectarios extraflorales. El 53% de los nidos tenían a Phrynus gervaisii (Amblypygi: Phrynidae habitando en el interior. Estos nidos presentaron menores tasas de mortalidad en comparación con el resto.We studied the distribution, mortality and association with plants, of 308 nests of the neotropical ant Paraponera clavata, in a permanent 50 hectare plot in old-growth forest on Barro Colorado island between September 1993 and February 1995. Ant nests were uniformly dispersed throughout the plot, and significantly associated with the high plateau and patch of young forest in the plot. The average

  6. Hormigas cazadoras en sistemas productivos del piedemonte amazónico colombiano: diversidad y especies indicadoras Hunter ants in productive systems of Colombian amazon foothills: diversity and indicator species

    Directory of Open Access Journals (Sweden)

    Maria Catalina Sanabria-Blandón

    2011-01-01

    Full Text Available Para conocer la abundancia, riqueza y composición de hormigas cazadoras y su variación en los sistemas productivos del departamento de Caquetá, se seleccionaron 27 fincas representativas de tres ventanas (agroforestal, silvopastoril y tradicional, en las cuales se identificaron hasta nueve clases de usos del suelo. Las proporciones dedicadas a pastos limpios, agroforestales y rastrojos viejos, fueron las que más contribuyeron a diferenciar las ventanas. Se muestrearon cinco puntos por finca mediante cuatro métodos para captura de hormigas (TSBF, lavado de suelo con formol, escrutinio de hojarasca y búsqueda directa. De un total de 280 individuos se determinaron nueve géneros y 35 especies de las subfamilias Ectatomminae, Paraponerinae y Ponerinae; el género más diverso fue Pachycondyla con 13 especies. La abundancia de hormigas se correlacionó directamente con la riqueza de especies y con el número de especies exclusivas. La riqueza fue mayor en la ventana agroforestal (24 especies, seguida de la silvopastoril (19 y de la tradicional (8. Cinco especies fueron comunes a las tres ventanas y siete especies (Ectatomma ruidum, Hypoponera sp.1 y sp.4, Odontomachus haematodus, O. brunneus y Pachycondyla constricta marcaron las diferencias en composición. Odontomachus brunneus resultó indicadora para la ventana tradicional y Paraponera clavata para la ventana silvopastoril. La búsqueda directa fue el método más eficiente para muestrear hormigas cazadoras en el piedemonte amazónico.We studied the abundance, richness and composition of hunting ants and their variation in production systems in department of Caquetá-Colombia, 27 farms were selected in three productive systems (agroforestry, silvopastoral and traditional, in this nine kinds of soil uses were identified. The proportions of clean pasture, agroforestry and old stubble contributed most to differentiating the systems. Five points were sampled per farm using four different

  7. Rediscovery of Bugulella clavata Hincks 1887 (Ectoprocta)

    Digital Repository Service at National Institute of Oceanography (India)

    Menon, N.R; Nair, N.B.

    The species Bugulella clavata collected from the Krusadai island, Gulf of Mannar is redescribed Description is based on the three fragments of a colony at a depth of 5 m Redescription has helped to important features such as nature and shape...

  8. Synergistic interaction of CLAVATA1, CLAVATA2, and RECEPTOR-LIKE PROTEIN KINASE 2 in cyst nematode parasitism of Arabidopsis

    Science.gov (United States)

    Plant-parasitic cyst nematodes secrete CLAVATA3 (CLV3)/ENDOSPERM SURROUNDING REGION (ESR) (CLE)-like effector proteins. These proteins act as ligand mimics of plant CLE peptides and are required for successful nematode infection. Previously, we showed that CLV2 and CORYNE (CRN), a heterodimer recept...

  9. Distribución espacial de Cordyceps spp. (Ascomycotina: Clavicipitaceae y su impacto sobre las hormigas en selvas del piedemonte amazónico de Colombia

    Directory of Open Access Journals (Sweden)

    Sanjuán Tatiana

    2001-12-01

    hormiga influenciando sus códigos feromonalesEntomopathogenic fungi of the genus Cordyceps were sampled in the foothills of the Colombian Amazon region (450 - 600 msnm altitude, January and May, 1998, i.e. dry and wet seasons, respectively. Healthy and Cordyceps-parasitized ants from a nearly pristine, a naturally disturbed and a human-disturbed forests were collected on 100 quadrants (1 m² per forest. Litter, shrubs and trunks were explored as substrates, and samples were gathered in vertical strata from 50 cm to 2 m high. Aztec was the predominant ant genus in near pristine forest whereas Camponotus, Pheidole and Crematogaster were dominant in disturbed forests. In the naturally disturbed forest we found 759 individuals of Cordyceps unilateralis and 69 of C. lloydii var. binata parasitizing Camponotus spp (Formicidae: Formicinae, whereas C. kniphofioides var. ponerinarum and C. australis were found only in six cases infecting the ants Paraponera clavata and Pachycondila crassinoda (Formicidae: Ponerinae. In the human disturbed forest it were found 34 individuals of C. unilateralis on Camponotus. In the near pristine forest we did not find parasitized ants. The Camponotus spp ants parasitized by C. unilateralis and C. lloydii var binata were found predominantly in the substratum foliage up to 1 m. It was concluded that the incidence of Cordyceps-ant interactions is not influenced by the conservation status of the forest. Instead, relative humidity and presence/absence of host ants appear to be key factors. Also, the micro-spatial distribution of the interactions seems to follow a definite pattern. This work observations support the hypothesis on coevolution of dispersion mechanisms in Cordyceps and ant feromonal codes

  10. Nematode CLE signaling in Arabidopsis requires CLAVATA2 and CORYNE

    Science.gov (United States)

    Plant-parasitic cyst nematodes secrete CLAVATA3 (CLV3)/ESR(CLE)-like effector proteins. These proteins have been shown to act as ligand mimics of plant CLE peptides and are required for successful nematode infection; however, the receptors for nematode CLE-like peptides have not been identified. Her...

  11. Characterization and isolation of DNA microsatellite primers in Raja clavata L. (thornback ray, Rajidae)

    NARCIS (Netherlands)

    Chevolot, M; Reusch, TBH; Boele-Bos, S; Stam, WT; Olsen, JL

    The thornback ray, Raja clavata, is an elasmobranch (cartilaginous fish). Since the 1950s, its stock has severely declined. In order to investigate the genetic population structure of the species, we developed microsatellite loci. The five loci reported here have eight to 48 alleles per locus and

  12. Life history and viability of a long-lived marine invertebrate: the octocoral Paramuricea clavata.

    Science.gov (United States)

    Linares, Cristina; Doak, Daniel F; Coma, Rafel; Díaz, David; Zabala, Mikel

    2007-04-01

    The red gorgonian Paramuricea clavata is a long-lived, slow-growing sessile invertebrate of ecological and conservation importance in the northwestern Mediterranean Sea. We develop a series of size-based matrix models for two Paramuricea clavata populations. These models were used to estimate basic life history traits for this species and to evaluate the viability of the red gorgonian populations we studied. As for many other slow-growing species, sensitivity and elasticity analysis demonstrate that gorgonian population growth is far more sensitive to changes in survival rates than to growth, shrinkage, or reproductive rates. The slow growth and low mortality of red gorgonians results in low damping ratios, indicating slow convergence to stable size structures (at least 50 years). The stable distributions predicted by the model did not differ from the observed ones. However, our simulations point out the fragility of this species, showing both populations in decline and high risk of extinction over moderate time horizons. These declines appear to be related to a recent increase in anthropogenic disturbances. Relative to their life span, the values of recruitment elasticity for Paramuricea clavata are lower than those reported for other marine organisms but are similar to those reported for some long-lived plants. These values and the delayed age of sexual maturity, in combination with the longevity of the species, show a clear fecundity/mortality trade-off. Full demographic studies of sessile marine species are quite scarce but can provide insight into population dynamics and life history patterns for these difficult and under-studied species. While our work shows clear results for the red gorgonian, the variability in some of our estimates suggest that future work should include data collection over longer temporal and spatial scales to better understand the long-term effects of natural and anthropogenic disturbances on red gorgonian populations.

  13. Relationship between radiocesium contamination and the contents of various elements in the web spider Nephila clavata (Nephilidae: Arachnida)

    International Nuclear Information System (INIS)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato

    2015-01-01

    The accident at the Fukushima Dai-ichi nuclear power plant seriously contaminated a large area in northeast Japan with a large amount of radioactive material. Consequently, various organisms, including arthropods, in the ecosystem have been contaminated with radiocesium ("1"3"7Cs) through the food chain. We previously showed that the web spider Nephila clavata was contaminated with "1"3"7Cs and that the level of contamination, which varied among spider individuals, was independent of the amount of prey consumed. The present study aimed to clarify the mechanisms that could determine the level of "1"3"7Cs contamination in N. clavata. We first demonstrated the patterns of contents of over 30 elements in N. clavata that were collected at two forest sites (PS and ES) in Fukushima and then focused on the relationships between the contents of the alkali metals Li, Na, K, and Rb and the accumulation of "1"3"7Cs in the spiders; Cs is an alkali metal and is expected to act similarly to Li, Na, K, and Rb. We also focused on the content of the non-alkali element, Cu, which is an essential element for oxygen transport in spiders. We found that Na content correlated positively with "1"3"7Cs accumulation at both sites, which suggested that "1"3"7Cs accumulation in N. clavata was related with the dynamics of Na. The K–, Rb–, and Cu–"1"3"7Cs relationships were site specific; the relationships were significant at site PS, but not significant at site ES. Factors causing the site specific relationships and the probable pathway for "1"3"7Cs transfer from soil to plants and then to higher trophic levels are discussed in terms of the transfer processes of the alkali metals. - Highlights: • Accumulation of "1"3"7Cs and various elements in web spiders was investigated. • "1"3"7Cs accumulation positively correlated with that of K, Rb, Na, and Cu. • Accumulation of alkali metals determined the level of "1"3"7Cs contamination. • K–, Rb–, Cu–"1"3"7Cs relationships were

  14. Nephila clavata L Koch, the Joro Spider of East Asia, newly recorded from North America (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    E. Richard Hoebeke

    2015-02-01

    Full Text Available Nephila clavata L Koch, known as the Joro spider and native to East Asia (Japan, China, Korea, and Taiwan, is newly reported from North America. Specimens from several locations in northeast Georgia were collected from around residential properties in Barrow, Jackson, and Madison counties in late October and early November 2014. These are the first confirmed records of the species in the New World. Our collections, along with confirmed images provided by private citizens, suggest that the Joro spider is established in northeast Georgia. Genomic sequence data for the COI gene obtained from two specimens conforms to published sequences for N. clavata, providing additional confirmation of species identity. Known collection records are listed and mapped using geocoding. Our observations are summarized along with published background information on biology in Asia and we hypothesize on the invasion history and mode of introduction into North America. Recognition features are given and photographic images of the male and female are provided to aid in their differentiation from the one native species of the genus (Nephila clavipes in North America.

  15. Solid-phase synthesis and biological evaluation of Joro spider toxin-4 from Nephila clavata

    DEFF Research Database (Denmark)

    Barslund, Anne Fuglsang; Poulsen, Mette Homann; Bach, Tinna Brøbech

    2011-01-01

    Polyamine toxins from orb weaver spiders are attractive pharmacological tools particularly for studies of ionotropic glutamate (iGlu) receptors in the brain. These polyamine toxins are biosynthesized in a combinatorial manner, providing a plethora of related, but structurally complex toxins...... to be exploited in biological studies. Here, we have used solid-phase synthetic methodology for the efficient synthesis of Joro spider toxin-4 (JSTX-4) (1) from Nephila clavata, providing sufficient amounts of the toxin for biological evaluation at iGlu receptor subtypes using electrophysiology. Biological...

  16. In planta processing and glycosylation of a nematode CLAVATA3/ENDOSPERM SURROUNDING REGION-like effector and its interaction with a host CLAVATA2-like receptor to promote parasitism.

    Science.gov (United States)

    Chen, Shiyan; Lang, Ping; Chronis, Demosthenis; Zhang, Sheng; De Jong, Walter S; Mitchum, Melissa G; Wang, Xiaohong

    2015-01-01

    Like other biotrophic plant pathogens, plant-parasitic nematodes secrete effector proteins into host cells to facilitate infection. Effector proteins that mimic plant CLAVATA3/ENDOSPERM SURROUNDING REGION-related (CLE) proteins have been identified in several cyst nematodes, including the potato cyst nematode (PCN); however, the mechanistic details of this cross-kingdom mimicry are poorly understood. Plant CLEs are posttranslationally modified and proteolytically processed to function as bioactive ligands critical to various aspects of plant development. Using ectopic expression coupled with nanoliquid chromatography-tandem mass spectrometry analysis, we show that the in planta mature form of proGrCLE1, a multidomain CLE effector secreted by PCN during infection, is a 12-amino acid arabinosylated glycopeptide (named GrCLE1-1Hyp4,7g) with striking structural similarity to mature plant CLE peptides. This glycopeptide is more resistant to hydrolytic degradation and binds with higher affinity to a CLAVATA2-like receptor (StCLV2) from potato (Solanum tuberosum) than its nonglycosylated forms. We further show that StCLV2 is highly up-regulated at nematode infection sites and that transgenic potatoes with reduced StCLV2 expression are less susceptible to PCN infection, indicating that interference of the CLV2-mediated signaling pathway confers nematode resistance in crop plants. These results strongly suggest that phytonematodes have evolved to utilize host cellular posttranslational modification and processing machinery for the activation of CLE effectors following secretion into plant cells and highlight the significance of arabinosylation in regulating nematode CLE effector activity. Our finding also provides evidence that multidomain CLEs are modified and processed similarly to single-domain CLEs, adding new insight into CLE maturation in plants. © 2015 American Society of Plant Biologists. All Rights Reserved.

  17. Ammolagena clavata (Jones and Parker, 1860), an agglutinated benthic foraminiferal species - first report from the Recent sediments, Arabian Sea, Indian Ocean region

    Digital Repository Service at National Institute of Oceanography (India)

    Nigam, R.; Mazumder, A.; Saraswat, R.

    The rare presence of the agglutinated foraminiferal species Ammolagena clavata is presented for the first time from the Recent sediments of the Indian Ocean region. This species has previously been reported in Recent sediments from all other oceans...

  18. Bioaccumulation of metals and PCBs in Raja clavata.

    Science.gov (United States)

    Torres, Paulo; Tristão da Cunha, Regina; Micaelo, Cristina; Rodrigues, Armindo Dos Santos

    2016-12-15

    The goal of this study was to assess stable isotopes profiles, metals concentration and PCBs in Raja clavata muscle and liver, according to sex and size, and to elucidate its suitability as a Mid-Atlantic biomonitor. The results reflected bioaccumulation and suggested biomagnification processes for As and Hg in muscle tissue. Cd, Cu and Zn were detected in high amounts in liver, Cr, Mn and Rb were relatively stable and low, Pb was not detected and Sr was present in muscle at high levels, decreasing with length. Hg and Se were strongly correlated, suggesting a mitigation role. Both tissues presented low concentrations of PCBs, especially the dioxin-like congeners, although always higher in liver and not correlated with size. None of these contaminants exceed EU legislated limits. However, they need to be monitored given study area's location, volcanic nature and the expected increase of anthropogenic activity related to future prospective mining activities and the establishment of the Transatlantic Trade and Investment Partnership (TTIP) between Europe and the USA. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  20. In Planta Processing and Glycosylation of a Nematode CLAVATA3/ENDOSPERM SURROUNDING REGION-Like Effector and Its Interaction with a Host CLAVATA2-Like Receptor to Promote Parasitism1[OPEN

    Science.gov (United States)

    Chen, Shiyan; Lang, Ping; Chronis, Demosthenis; Zhang, Sheng; De Jong, Walter S.; Mitchum, Melissa G.

    2015-01-01

    Like other biotrophic plant pathogens, plant-parasitic nematodes secrete effector proteins into host cells to facilitate infection. Effector proteins that mimic plant CLAVATA3/ENDOSPERM SURROUNDING REGION-related (CLE) proteins have been identified in several cyst nematodes, including the potato cyst nematode (PCN); however, the mechanistic details of this cross-kingdom mimicry are poorly understood. Plant CLEs are posttranslationally modified and proteolytically processed to function as bioactive ligands critical to various aspects of plant development. Using ectopic expression coupled with nanoliquid chromatography-tandem mass spectrometry analysis, we show that the in planta mature form of proGrCLE1, a multidomain CLE effector secreted by PCN during infection, is a 12-amino acid arabinosylated glycopeptide (named GrCLE1-1Hyp4,7g) with striking structural similarity to mature plant CLE peptides. This glycopeptide is more resistant to hydrolytic degradation and binds with higher affinity to a CLAVATA2-like receptor (StCLV2) from potato (Solanum tuberosum) than its nonglycosylated forms. We further show that StCLV2 is highly up-regulated at nematode infection sites and that transgenic potatoes with reduced StCLV2 expression are less susceptible to PCN infection, indicating that interference of the CLV2-mediated signaling pathway confers nematode resistance in crop plants. These results strongly suggest that phytonematodes have evolved to utilize host cellular posttranslational modification and processing machinery for the activation of CLE effectors following secretion into plant cells and highlight the significance of arabinosylation in regulating nematode CLE effector activity. Our finding also provides evidence that multidomain CLEs are modified and processed similarly to single-domain CLEs, adding new insight into CLE maturation in plants. PMID:25416475

  1. Reproductive biology of Raja clavata (Elasmobranchii: Rajidae) from Southern Black Sea coast around Turkey

    Science.gov (United States)

    Saglam, Hacer; Ak, Orhan

    2012-06-01

    Specimens of Raja clavata were monthly collected at the coast of Havaalanı (Trabzon/Turkey) from January 2009 to December 2009 at depths between 20 and 40 m. A total of 230 individuals of thornback ray (131 females and 99 males) were collected by bottom trawls during research cruises. Using logistic regression, it was determined that TL at 50% maturity of males was 718 mm TL and of females 746 mm TL. The ovarian fecundity ranged from 27 to 60 yellow follicles in both ovaries. Females carrying egg cases were found in July and October. Variations in the gonadosomatic and hepatosomatic indices indicated a continuous reproductive cycle during the year.

  2. Ant- and Ant-Colony-Inspired ALife Visual Art.

    Science.gov (United States)

    Greenfield, Gary; Machado, Penousal

    2015-01-01

    Ant- and ant-colony-inspired ALife art is characterized by the artistic exploration of the emerging collective behavior of computational agents, developed using ants as a metaphor. We present a chronology that documents the emergence and history of such visual art, contextualize ant- and ant-colony-inspired art within generative art practices, and consider how it relates to other ALife art. We survey many of the algorithms that artists have used in this genre, address some of their aims, and explore the relationships between ant- and ant-colony-inspired art and research on ant and ant colony behavior.

  3. ANT

    DEFF Research Database (Denmark)

    van der Duim, René; Ren, Carina Bregnholm; Jóhannesson, Gunnar Thór

    2017-01-01

    Ten years ago actor-network theory (ANT) entered this journal. To illustrate how the relational ontology and sensibilities of ANT lend themselves to particular kinds of research, we first interrogate the main controversies as a way to open up and discuss the main premises of ANT. These debates...... concern the status and agency of objects and non-humans, ANT’s denial of the explanatory power of social structures, and the political implications of ANT. Second we present ANT’s relevance for tourism studies and discuss what ANT ‘does’ in practice. After summarizing a decade of relations between ANT...... and tourism, we conclude by tracing three future trajectories of how we have ‘moved away with’ ANT into new areas of discovery....

  4. Transient shifts in bacterial communities associated with the temperate gorgonian Paramuricea clavata in the Northwestern Mediterranean Sea.

    Directory of Open Access Journals (Sweden)

    Marie La Rivière

    Full Text Available BACKGROUND: Bacterial communities that are associated with tropical reef-forming corals are being increasingly recognized for their role in host physiology and health. However, little is known about the microbial diversity of the communities associated with temperate gorgonian corals, even though these communities are key structural components of the ecosystem. In the Northwestern Mediterranean Sea, gorgonians undergo recurrent mass mortalities, but the potential relationship between these events and the structure of the associated bacterial communities remains unexplored. Because microbial assemblages may contribute to the overall health and disease resistance of their host, a detailed baseline of the associated bacterial diversity is required to better understand the functioning of the gorgonian holobiont. METHODOLOGY/PRINCIPAL FINDINGS: The bacterial diversity associated with the gorgonian Paramuricea clavata was determined using denaturing gradient gel electrophoresis, terminal-restriction fragment length polymorphism and the construction of clone libraries of the bacterial 16S ribosomal DNA. Three study sites were monitored for 4 years to assess the variability of communities associated with healthy colonies. Bacterial assemblages were highly dominated by one Hahellaceae-related ribotype and exhibited low diversity. While this pattern was mostly conserved through space and time, in summer 2007, a deep shift in microbiota structure toward increased bacterial diversity and the transient disappearance of Hahellaceae was observed. CONCLUSION/SIGNIFICANCE: This is the first spatiotemporal study to investigate the bacterial diversity associated with a temperate shallow gorgonian. Our data revealed an established relationship between P. clavata and a specific bacterial group within the Oceanospirillales. These results suggest a potential symbiotic role of Hahellaceae in the host-microbe association, as recently suggested for tropical corals

  5. Recovery of Proteolytic and Collagenolytic Activities from Viscera By-products of Rayfish (Raja clavata

    Directory of Open Access Journals (Sweden)

    José Antonio Vázquez

    2009-12-01

    Full Text Available The aim of this work was to study the recovery of proteolytic and collagenolytic activities from rayfish (Raja clavata viscera wastes. Initially, different parts of the gastrointestinal tract by-products (stomach, duodenum section including pancreas, final intestine were evaluated. The extracts from proximal intestine yielded the highest values of both enzymatic activities. Optimal conditions for protease activity quantification were established at pH = 6, T = 40 °C and incubation time ≤20 min. The mathematical equation used to model the joint effect of pH and temperature led to maximum activity at pH = 8.66 and 59.4 °C, respectively. Overcooled acetone was found to be best option for recovery of enzymatic activities in comparison with ethanol, PEG-4000, ammonium sulphate and ultrafiltration system. Finally, a simple and systematic protocol of partial purification and total recovery of proteases and collagenases was defined.

  6. CLE-CLAVATA1 peptide-receptor signaling module regulates the expansion of plant root systems in a nitrogen-dependent manner.

    Science.gov (United States)

    Araya, Takao; Miyamoto, Mayu; Wibowo, Juliarni; Suzuki, Akinori; Kojima, Soichi; Tsuchiya, Yumiko N; Sawa, Shinichiro; Fukuda, Hiroo; von Wirén, Nicolaus; Takahashi, Hideki

    2014-02-04

    Morphological plasticity of root systems is critically important for plant survival because it allows plants to optimize their capacity to take up water and nutrients from the soil environment. Here we show that a signaling module composed of nitrogen (N)-responsive CLE (CLAVATA3/ESR-related) peptides and the CLAVATA1 (CLV1) leucine-rich repeat receptor-like kinase is expressed in the root vasculature in Arabidopsis thaliana and plays a crucial role in regulating the expansion of the root system under N-deficient conditions. CLE1, -3, -4, and -7 were induced by N deficiency in roots, predominantly expressed in root pericycle cells, and their overexpression repressed the growth of lateral root primordia and their emergence from the primary root. In contrast, clv1 mutants showed progressive outgrowth of lateral root primordia into lateral roots under N-deficient conditions. The clv1 phenotype was reverted by introducing a CLV1 promoter-driven CLV1:GFP construct producing CLV1:GFP fusion proteins in phloem companion cells of roots. The overaccumulation of CLE2, -3, -4, and -7 in clv1 mutants suggested the amplitude of the CLE peptide signals being feedback-regulated by CLV1. When CLE3 was overexpressed under its own promoter in wild-type plants, the length of lateral roots was negatively correlated with increasing CLE3 mRNA levels; however, this inhibitory action of CLE3 was abrogated in the clv1 mutant background. Our findings identify the N-responsive CLE-CLV1 signaling module as an essential mechanism restrictively controlling the expansion of the lateral root system in N-deficient environments.

  7. Ant-plant mutualism: a dietary by-product of a tropical ant's macronutrient requirements.

    Science.gov (United States)

    Arcila Hernández, Lina M; Sanders, Jon G; Miller, Gabriel A; Ravenscraft, Alison; Frederickson, Megan E

    2017-12-01

    Many arboreal ants depend on myrmecophytic plants for both food and shelter; in return, these ants defend their host plants against herbivores, which are often insects. Ant-plant and other mutualisms do not necessarily involve the exchange of costly rewards or services; they may instead result from by-product benefits, or positive outcomes that do not entail a cost for one or both partners. Here, we examined whether the plant-ant Allomerus octoarticulatus pays a short-term cost to defend their host plants against herbivores, or whether plant defense is a by-product benefit of ant foraging for insect prey. Because the food offered by ant-plants is usually nitrogen-poor, arboreal ants may balance their diets by consuming insect prey or associating with microbial symbionts to acquire nitrogen, potentially shifting the costs and benefits of plant defense for the ant partner. To determine the effect of ant diet on an ant-plant mutualism, we compared the behavior, morphology, fitness, stable isotope signatures, and gaster microbiomes of A. octoarticulatus ants nesting in Cordia nodosa trees maintained for nearly a year with or without insect herbivores. At the end of the experiment, ants from herbivore exclosures preferred protein-rich baits more than ants in the control (i.e., herbivores present) treatment. Furthermore, workers in the control treatment were heavier than in the herbivore-exclusion treatment, and worker mass predicted reproductive output, suggesting that foraging for insect prey directly increased ant colony fitness. The gaster microbiome of ants was not significantly affected by the herbivore exclusion treatment. We conclude that the defensive behavior of some phytoecious ants is a by-product of their need for external protein sources; thus, the consumption of insect herbivores by ants benefits both the ant colony and the host plant. © 2017 by the Ecological Society of America.

  8. Ant Larval Demand Reduces Aphid Colony Growth Rates in an Ant-Aphid Interaction

    Directory of Open Access Journals (Sweden)

    James M. Cook

    2012-02-01

    Full Text Available Ants often form mutualistic interactions with aphids, soliciting honeydew in return for protective services. Under certain circumstances, however, ants will prey upon aphids. In addition, in the presence of ants aphids may increase the quantity or quality of honeydew produced, which is costly. Through these mechanisms, ant attendance can reduce aphid colony growth rates. However, it is unknown whether demand from within the ant colony can affect the ant-aphid interaction. In a factorial experiment, we tested whether the presence of larvae in Lasius niger ant colonies affected the growth rate of Aphis fabae colonies. Other explanatory variables tested were the origin of ant colonies (two separate colonies were used and previous diet (sugar only or sugar and protein. We found that the presence of larvae in the ant colony significantly reduced the growth rate of aphid colonies. Previous diet and colony origin did not affect aphid colony growth rates. Our results suggest that ant colonies balance the flow of two separate resources from aphid colonies- renewable sugars or a protein-rich meal, depending on demand from ant larvae within the nest. Aphid payoffs from the ant-aphid interaction may change on a seasonal basis, as the demand from larvae within the ant colony waxes and wanes.

  9. Fire Ant Bites

    Science.gov (United States)

    ... Favorite Name: Category: Share: Yes No, Keep Private Fire Ant Bites Share | Fire ants are aggressive, venomous insects that have pinching ... across the United States, even into Puerto Rico. Fire ant stings usually occur on the feet or ...

  10. Ant aggression and evolutionary stability in plant-ant and plant-pollinator mutualistic interactions.

    Science.gov (United States)

    Oña, L; Lachmann, M

    2011-03-01

    Mutualistic partners derive a benefit from their interaction, but this benefit can come at a cost. This is the case for plant-ant and plant-pollinator mutualistic associations. In exchange for protection from herbivores provided by the resident ants, plants supply various kinds of resources or nests to the ants. Most ant-myrmecophyte mutualisms are horizontally transmitted, and therefore, partners share an interest in growth but not in reproduction. This lack of alignment in fitness interests between plants and ants drives a conflict between them: ants can attack pollinators that cross-fertilize the host plants. Using a mathematical model, we define a threshold in ant aggressiveness determining pollinator survival or elimination on the host plant. In our model we observed that, all else being equal, facultative interactions result in pollinator extinction for lower levels of ant aggressiveness than obligatory interactions. We propose that the capacity to discriminate pollinators from herbivores should not often evolve in ants, and when it does it will be when the plants exhibit limited dispersal in an environment that is not seed saturated so that each seed produced can effectively generate a new offspring or if ants acquire an extra benefit from pollination (e.g. if ants eat fruit). We suggest specific mutualism examples where these hypotheses can be tested empirically. © 2010 The Authors. Journal of Evolutionary Biology © 2010 European Society For Evolutionary Biology.

  11. CLAVATA3-like genes are differentially expressed in grape vine (Vitis vinifera) tissues.

    Science.gov (United States)

    Tominaga-Wada, Rumi; Nukumizu, Yuka; Wada, Takuji; Sawa, Shinichiro; Tetsumura, Takuya

    2013-10-15

    The CLAVATA3 (CLV3)/endosperm surrounding region [(ESR) CLE] peptides function as intercellular signaling molecules that regulate various physiological and developmental processes in diverse plant species. We identified five CLV3-like genes from grape vine (Vitis vinifera var. Pinot Noir): VvCLE 6, VvCLE 25-1, VvCLE 25-2, VvCLE 43 and VvCLE TDIF. These CLV3-like genes encode short proteins containing 43-128 amino acids. Except VvCLE TDIF, grape vine CLV3-like proteins possess a consensus amino acid sequence known as the CLE domain. Phylogenic analysis suggests that the VvCLE 6, VvCLE25-1, VvCLE25-2 and VvCLE43 genes have evolved from a single common ancestor to the Arabidopsis CLV3 gene. Expression analyses showed that the five grape CLV3-like genes are expressed in leaves, stems, roots and axillary buds with significant differences in their levels of expression. For example, while all of them were strongly expressed in axillary buds, VvCLE6 and VvCLE43 expression prevailed in roots, and VvCLE25-1, VvCLE25-2 and VvCLE TDIF expression in stems. The differential expression of the five grape CLV3-like peptides suggests that they play different roles in different organs and developmental stages. Copyright © 2013 Elsevier GmbH. All rights reserved.

  12. AntStar: Enhancing Optimization Problems by Integrating an Ant System and A⁎ Algorithm

    Directory of Open Access Journals (Sweden)

    Mohammed Faisal

    2016-01-01

    Full Text Available Recently, nature-inspired techniques have become valuable to many intelligent systems in different fields of technology and science. Among these techniques, Ant Systems (AS have become a valuable technique for intelligent systems in different fields. AS is a computational system inspired by the foraging behavior of ants and intended to solve practical optimization problems. In this paper, we introduce the AntStar algorithm, which is swarm intelligence based. AntStar enhances the optimization and performance of an AS by integrating the AS and A⁎ algorithm. Applying the AntStar algorithm to the single-source shortest-path problem has been done to ensure the efficiency of the proposed AntStar algorithm. The experimental result of the proposed algorithm illustrated the robustness and accuracy of the AntStar algorithm.

  13. Runtime analysis of the 1-ANT ant colony optimizer

    DEFF Research Database (Denmark)

    Doerr, Benjamin; Neumann, Frank; Sudholt, Dirk

    2011-01-01

    The runtime analysis of randomized search heuristics is a growing field where, in the last two decades, many rigorous results have been obtained. First runtime analyses of ant colony optimization (ACO) have been conducted only recently. In these studies simple ACO algorithms such as the 1-ANT...... that give us a more detailed impression of the 1-ANT’s performance. Furthermore, the experiments also deal with the question whether using many ant solutions in one iteration can decrease the total runtime....

  14. Microorganisms transported by ants induce changes in floral nectar composition of an ant-pollinated plant.

    Science.gov (United States)

    de Vega, Clara; Herrera, Carlos M

    2013-04-01

    Interactions between plants and ants abound in nature and have significant consequences for ecosystem functioning. Recently, it has been suggested that nectar-foraging ants transport microorganisms to flowers; more specifically, they transport yeasts, which can potentially consume sugars and alter nectar composition. Therefore, ants could indirectly change nectar sugar profile, an important floral feature involved in the plant-pollinator mutualism. But this novel role for ants has never been tested. We here investigate the effects of nectarivorous ants and their associated yeasts on the floral nectar sugar composition of an ant-pollinated plant. Differences in the nectar sugar composition of ant-excluded and ant-visited flowers were examined in 278 samples by using high-performance liquid-chromatography. The importance of the genetic identity and density of ant-transported basidiomycetous and ascomycetous yeasts on the variation of nectar traits was also evaluated. Ant visitation had significant effects on nectar sugar composition. The nectar of ant-visited flowers contained significantly more fructose, more glucose, and less sucrose than the nectar of ant-excluded flowers, but these effects were context dependent. Nectar changes were correlated with the density of yeast cells in nectar. The magnitude of the effects of ant-transported ascomycetes was much higher than that of basiodiomycetes. Ants and their associated yeasts induce changes in nectar sugar traits, reducing the chemical control of the plant over this important floral trait. The potential relevance of this new role for ants as indirect nectar modifiers is a rich topic for future research into the ecology of ant-flower interactions.

  15. Formigas (Hymenoptera: Formicidae Bioindicadoras de Degradação Ambiental em Poxoréu, Mato Grosso, Brasil

    Directory of Open Access Journals (Sweden)

    Wilian de Oliveira Rocha

    Full Text Available Este trabalho teve por objetivo avaliar as espécies de formigas que ocorrem em áreas degradadas pela mineração de diamantes, definindo as espécies bioindicadoras desta degradação. O estudo realizado entre junho de 2010 e abril de 2011, bimestralmente, em Poxoréu - MT, amostrou quatro ambientes: A1 – área degradada pela mineração; A2 – área com vegetação de cerrado antropizado recentemente; A3 – vegetação antropizada há cerca de 30 anos; A4 – área de cerrado preservado. Em cada ambiente, foram instaladas 11 armadilhas pitfall, equidistantes 15 metros, para a coleta de formigas durante 24 horas. Os indivíduos coletados foram levados ao Laboratório de Proteção Florestal/FENF/UFMT e triados para posterior identificação. As espécies bioindicadoras foram indicadas por meio de análises faunísticas. As espécies Camponotus (Myrmaphaenus sp.1 e Forelius brasiliensis podem ser consideradas bioindicadoras de degradação ambiental na área de garimpo de diamantes e antropização, enquanto Camponotus atriceps, Pachycondyla crassinoda e Paraponera clavata podem ser consideradas bioindicadoras de cerrado preservado.

  16. Harnessing ant defence at fruits reduces bruchid seed predation in a symbiotic ant-plant mutualism.

    Science.gov (United States)

    Pringle, Elizabeth G

    2014-06-22

    In horizontally transmitted mutualisms, mutualists disperse separately and reassemble in each generation with partners genetically unrelated to those in the previous generation. Because of this, there should be no selection on either partner to enhance the other's reproductive output directly. In symbiotic ant-plant mutualisms, myrmecophytic plants host defensive ant colonies, and ants defend the plants from herbivores. Plants and ants disperse separately, and, although ant defence can indirectly increase plant reproduction by reducing folivory, it is unclear whether ants can also directly increase plant reproduction by defending seeds. The neotropical tree Cordia alliodora hosts colonies of Azteca pittieri ants. The trees produce domatia where ants nest at stem nodes and also at the node between the peduncle and the rachides of the infloresence. Unlike the stem domatia, these reproductive domatia senesce after the tree fruits each year. In this study, I show that the tree's resident ant colony moves into these ephemeral reproductive domatia, where they tend honeydew-producing scale insects and patrol the nearby developing fruits. The presence of ants significantly reduced pre-dispersal seed predation by Amblycerus bruchid beetles, thereby directly increasing plant reproductive output.

  17. "Ant-egg" cataract revisited

    DEFF Research Database (Denmark)

    Clemmensen, Kåre; Enghild, Jan J; Ivarsen, Anders

    2017-01-01

    -ray scans and electron microscopy. The purpose of this study was to further characterize "ant-egg" cataract using modern technology and display the history of the "ant-eggs" after cataract extraction. METHODS: "Ant-eggs" were examined using Heidelberg SPECTRALIS Optical Coherence Tomography (OCT...

  18. How ants drop out: ant abundance on tropical mountains.

    Science.gov (United States)

    Longino, John T; Branstetter, Michael G; Colwell, Robert K

    2014-01-01

    In tropical wet forests, ants are a large proportion of the animal biomass, but the factors determining abundance are not well understood. We characterized ant abundance in the litter layer of 41 mature wet forest sites spread throughout Central America (Chiapas, Guatemala, Honduras, Nicaragua, and Costa Rica) and examined the impact of elevation (as a proxy for temperature) and community species richness. Sites were intentionally chosen to minimize variation in precipitation and seasonality. From sea level to 1500 m ant abundance very gradually declined, community richness declined more rapidly than abundance, and the local frequency of the locally most common species increased. These results suggest that within this elevational zone, density compensation is acting, maintaining high ant abundance as richness declines. In contrast, in sites above 1500 m, ant abundance dropped abruptly to much lower levels. Among these high montane sites, community richness explained much more of the variation in abundance than elevation, and there was no evidence of density compensation. The relative stability of abundance below 1500 m may be caused by opposing effects of temperature on productivity and metabolism. Lower temperatures may decrease productivity and thus the amount of food available for consumers, but slower metabolisms of consumers may allow maintenance of higher biomass at lower resource supply rates. Ant communities at these lower elevations may be highly interactive, the result of continuous habitat presence over geological time. High montane sites may be ephemeral in geological time, resulting in non-interactive communities dominated by historical and stochastic processes. Abundance in these sites may be determined by the number of species that manage to colonize and/or avoid extinction on mountaintops.

  19. How ants drop out: ant abundance on tropical mountains.

    Directory of Open Access Journals (Sweden)

    John T Longino

    Full Text Available In tropical wet forests, ants are a large proportion of the animal biomass, but the factors determining abundance are not well understood. We characterized ant abundance in the litter layer of 41 mature wet forest sites spread throughout Central America (Chiapas, Guatemala, Honduras, Nicaragua, and Costa Rica and examined the impact of elevation (as a proxy for temperature and community species richness. Sites were intentionally chosen to minimize variation in precipitation and seasonality. From sea level to 1500 m ant abundance very gradually declined, community richness declined more rapidly than abundance, and the local frequency of the locally most common species increased. These results suggest that within this elevational zone, density compensation is acting, maintaining high ant abundance as richness declines. In contrast, in sites above 1500 m, ant abundance dropped abruptly to much lower levels. Among these high montane sites, community richness explained much more of the variation in abundance than elevation, and there was no evidence of density compensation. The relative stability of abundance below 1500 m may be caused by opposing effects of temperature on productivity and metabolism. Lower temperatures may decrease productivity and thus the amount of food available for consumers, but slower metabolisms of consumers may allow maintenance of higher biomass at lower resource supply rates. Ant communities at these lower elevations may be highly interactive, the result of continuous habitat presence over geological time. High montane sites may be ephemeral in geological time, resulting in non-interactive communities dominated by historical and stochastic processes. Abundance in these sites may be determined by the number of species that manage to colonize and/or avoid extinction on mountaintops.

  20. Pest repelling properties of ant pheromones

    DEFF Research Database (Denmark)

    Offenberg, Joachim

    2014-01-01

    Ants control pests via predation and physical deterrence; however, ant communication is based on chemical cues which may serve as warning signals to potential prey and other intruders. The presence of ant pheromones may, thus, be sufficient to repel pests from ant territories. This mini-review sh......-review shows that four out of five tested ant species deposit pheromones that repel herbivorous prey from their host plants.......Ants control pests via predation and physical deterrence; however, ant communication is based on chemical cues which may serve as warning signals to potential prey and other intruders. The presence of ant pheromones may, thus, be sufficient to repel pests from ant territories. This mini...

  1. Nectar Theft and Floral Ant-Repellence: A Link between Nectar Volume and Ant-Repellent Traits?

    Science.gov (United States)

    Ballantyne, Gavin; Willmer, Pat

    2012-01-01

    As flower visitors, ants rarely benefit a plant. They are poor pollinators, and can also disrupt pollination by deterring other flower visitors, or by stealing nectar. Some plant species therefore possess floral ant-repelling traits. But why do particular species have such traits when others do not? In a dry forest in Costa Rica, of 49 plant species around a third were ant-repellent at very close proximity to a common generalist ant species, usually via repellent pollen. Repellence was positively correlated with the presence of large nectar volumes. Repellent traits affected ant species differently, some influencing the behaviour of just a few species and others producing more generalised ant-repellence. Our results suggest that ant-repellent floral traits may often not be pleiotropic, but instead could have been selected for as a defence against ant thieves in plant species that invest in large volumes of nectar. This conclusion highlights to the importance of research into the cost of nectar production in future studies into ant-flower interactions. PMID:22952793

  2. Pest repellent properties of ant pheromones

    DEFF Research Database (Denmark)

    Offenberg, Joachim

    2012-01-01

    of ant pheromones may be sufficient to repel pest insects from ant territories. The study of ant semiochemicals is in its infancy, yet, evidence for their potential use in pest management is starting to build up. Pheromones from four of five tested ant species have been shown to deter herbivorous insect...... prey and competing ant species are also deterred by ant deposits, whereas ant symbionts may be attracted to them. Based on these promising initial findings, it seems advisable to further elucidate the signaling properties of ant pheromones and to test and develop their use in future pest management....

  3. Plant lock and ant key: pairwise coevolution of an exclusion filter in an ant-plant mutualism.

    Science.gov (United States)

    Brouat, C; Garcia, N; Andary, C; McKey, D

    2001-10-22

    Although observations suggest pairwise coevolution in specific ant-plant symbioses, coevolutionary processes have rarely been demonstrated. We report on, what is to the authors' knowledge, the strongest evidence yet for reciprocal adaptation of morphological characters in a species-specific ant-plant mutualism. The plant character is the prostoma, which is a small unlignified organ at the apex of the domatia in which symbiotic ants excavate an entrance hole. Each myrmecophyte in the genus Leonardoxa has evolved a prostoma with a different shape. By performing precise measurements on the prostomata of three related myrmecophytes, on their specific associated ants and on the entrance holes excavated by symbiotic ants at the prostomata, we showed that correspondence of the plant and ant traits forms a morphological and behavioural filter. We have strong evidence for coevolution between the dimensions and shape of the symbiotic ants and the prostoma in one of the three ant-Leonardoxa associations.

  4. Beyond ANT

    DEFF Research Database (Denmark)

    Jansen, Till

    2017-01-01

    Actor-Network-Theory (ANT) offers an ‘infra-language’ of the social that allows one to trace social relations very dynamically, while at the same time dissolving human agency, thus providing a flat and de-centred way into sociology. However, ANT struggles with its theoretical design that may lead...... us to reduce agency to causation and to conceptualize actor-networks as homogeneous ontologies of force. This article proposes to regard ANT’s inability to conceptualize reflexivity and the interrelatedness of different ontologies as the fundamental problem of the theory. Drawing on Günther......, it offers an ‘infra-language’ of reflexive relations while maintaining ANT’s de-centred approach. This would enable us to conceptualize actor-networks as non-homogeneous, dynamic and connecting different societal rationales while maintaining the main strengths of ANT....

  5. Dynamics of an ant-plant-pollinator model

    Science.gov (United States)

    Wang, Yuanshi; DeAngelis, Donald L.; Nathaniel Holland, J.

    2015-03-01

    In this paper, we consider plant-pollinator-ant systems in which plant-pollinator interaction and plant-ant interaction are both mutualistic, but there also exists interference of pollinators by ants. The plant-pollinator interaction can be described by a Beddington-DeAngelis formula, so we extend the formula to characterize plant-pollinator mutualisms, including the interference by ants, and form a plant-pollinator-ant model. Using dynamical systems theory, we show uniform persistence of the model. Moreover, we demonstrate conditions under which boundary equilibria are globally asymptotically stable. The dynamics exhibit mechanisms by which the three species could coexist when ants interfere with pollinators. We define a threshold in ant interference. When ant interference is strong, it can drive plant-pollinator mutualisms to extinction. Furthermore, if the ants depend on pollination mutualism for their persistence, then sufficiently strong ant interference could lead to their own extinction as well. Yet, when ant interference is weak, plant-ant and plant-pollinator mutualisms can promote the persistence of one another.

  6. Using Ants as bioindicators: Multiscale Issues in Ant Community Ecology

    Directory of Open Access Journals (Sweden)

    Alan Andersen

    1997-06-01

    Full Text Available Ecological patterns and processes are characteristically scale dependent, and research findings often cannot be translated easily from one scale to another. Conservation biology is challenged by a lack of congruence between the spatial scales of ecological research (typically involving small plots and land management (typically involving whole landscapes. Here, I discuss spatial scaling issues as they relate to an understanding of ant communities and, consequently, their use as bioindicators in land management. Our perceptions of fundamental patterns and processes in ant communities depend on scale: taxa that are behaviorally dominant at one scale are not necessarily so at others, functional groups recognized at one scale are often inappropriate for others, and the role of competition in community structure depends on the scale of analysis. Patterns of species richness and composition, and the ability of total richness to be estimated by surrogates, are all also scale dependent. Ant community ecology has a tradition of detailed studies in small plots, but the use of ants as bioindicators requires a predictive understanding of community structure and dynamics at a range of spatial scales. Such an appreciation of ant communities and their most effective use as bioindicators is best served by studies integrating results from plot-scale research with the broad-scale paradigms of biogeography, systematics, and evolutionary biology.

  7. Ecosystem services delivered by weaver ants

    DEFF Research Database (Denmark)

    Offenberg, Joachim

    Weaver ants (Oecopgylla spp.) are increasingly being utilized as efficient biocontrol agents in a number of tropical tree crops, as they prey on pest insects and increase yields. However, recent studies and a review of the literature reveal that a number of other services may derive from the pres......Weaver ants (Oecopgylla spp.) are increasingly being utilized as efficient biocontrol agents in a number of tropical tree crops, as they prey on pest insects and increase yields. However, recent studies and a review of the literature reveal that a number of other services may derive from...... the presence of these ants. First of all, the chemical footprint left by the high density of ants in managed host trees may results in additional benefits. (i) Ant deposits may lead to improved fruit quality, e.g. increased sugar content, (ii) ant deposits may deter important pests (chemical deterrence) from...... crops, and lastly, (iii) ant waste products deposited ias anal spots contain urea that may be taken up by plant leaves and in this way fertilize ant-plants. On top of chemical services, weaver ants have been shown to reduce plant disease incidence via competitive exclusion of other ant species because...

  8. Ant-lepidopteran associations along African forest edges

    Science.gov (United States)

    Dejean, Alain; Azémar, Frédéric; Libert, Michel; Compin, Arthur; Hérault, Bruno; Orivel, Jérôme; Bouyer, Thierry; Corbara, Bruno

    2017-02-01

    Working along forest edges, we aimed to determine how some caterpillars can co-exist with territorially dominant arboreal ants (TDAAs) in tropical Africa. We recorded caterpillars from 22 lepidopteran species living in the presence of five TDAA species. Among the defoliator and/or nectarivorous caterpillars that live on tree foliage, the Pyralidae and Nymphalidae use their silk to protect themselves from ant attacks. The Notodontidae and lycaenid Polyommatinae and Theclinae live in direct contact with ants; the Theclinae even reward ants with abundant secretions from their Newcomer gland. Lichen feeders (lycaenid; Poritiinae), protected by long bristles, also live among ants. Some lycaenid Miletinae caterpillars feed on ant-attended membracids, including in the shelters where the ants attend them; Lachnocnema caterpillars use their forelegs to obtain trophallaxis from their host ants. Caterpillars from other species live inside weaver ant nests. Those of the genus Euliphyra (Miletinae) feed on ant prey and brood and can obtain trophallaxis, while those from an Eberidae species only prey on host ant eggs. Eublemma albifascia (Erebidae) caterpillars use their thoracic legs to obtain trophallaxis and trophic eggs from ants. Through transfer bioassays of last instars, we noted that herbivorous caterpillars living in contact with ants were always accepted by alien conspecific ants; this is likely due to an intrinsic appeasing odor. Yet, caterpillars living in ant shelters or ant nests probably acquire cues from their host colonies because they were considered aliens and killed. We conclude that co-evolution with ants occurred similarly in the Heterocera and Rhopalocera.

  9. The metapleural gland of ants

    DEFF Research Database (Denmark)

    Yek, Sze Huei; Mueller, Ulrich G

    2011-01-01

    The metapleural gland (MG) is a complex glandular structure unique to ants, suggesting a critical role in their origin and ecological success. We synthesize the current understanding of the adaptive function, morphology, evolutionary history, and chemical properties of the MG. Two functions......-compressible invagination of the integument and the secretion is thought to ooze out passively through the non-closable opening of the MG or is groomed off by the legs and applied to target surfaces. MG loss has occurred repeatedly among the ants, particularly in the subfamilies Formicinae and Myrmicinae, and the MG...... is more commonly absent in males than in workers. MG chemistry has been characterized mostly in derived ant lineages with unique biologies (e.g. leafcutter ants, fire ants), currently precluding any inferences about MG chemistry at the origin of the ants. A synthetic approach integrating functional...

  10. Foliar uptake of nitrogen from ant fecal droplets: an overlooked service to ant plants

    DEFF Research Database (Denmark)

    Pinkalski, Christian Alexander Stidsen; Jensen, Karl-Martin Vagn; Damgaard, Christian Frølund

    2018-01-01

    and subsequently deposited fecal droplets on the seedlings, coffee leaves showed increased levels of 15N and total N compared to control plants without ants. This was evident for both exposed leaves and leaves covered in plastic bags (i.e. not directly exposed to ants). Thus, N from ant excretions was absorbed...

  11. Especies de hormigas del suelo en el Parque Nacional Natural Gorgona, Pacífico Colombiano

    Directory of Open Access Journals (Sweden)

    Stephany Valdés-Rodríguez

    2014-02-01

    Full Text Available Este trabajo compila registros publicados (1991 y no publicados (2006 sobre las especies de hormigas del PNN Gorgona y aporta nuevos registros de especies recolectadas en 2010. Se recopiló información de 15 diferentes sitios de isla Gorgona (13.82km², incluyendo la pequeña isla de Gorgonilla (0.4899km². Los métodos de recolecta incluyeron trampas de caída, cebos de atún, sacos Winkler, trampas Malaise, red entomológica y captura directa. El inventario de hormigas de suelo y sotobosque resultó en 107 especies y morfoespecies, 46 géneros y 12 subfamilias. Myrmicinae reunió la mayor riqueza (37 especies seguida de Ponerinae (27 y Formicinae (12. Los géneros más ricos fueron Pachycondyla (15 especies, Camponotus (nueve y Pheidole (ocho, mientras que 30 géneros solo presentaron una especie. Doce especies fueron muy comunes: Azteca sp., Atta cephalotes, Camponotus sericeiventris, Eciton vagans, Ectatomma goninion, Gnamptogenys annulata, Odontomachus bauri, Pachycondyla bugabensis, P. harpax, P. verenae, Paraponera clavata y Wasmannia auropunctata. En comparación con otras islas neotropicales, Gorgona tiene un número sorprendentemente elevado de especies de hormigas, ninguna de ellas invasivas. Por tanto, estos resultados sugieren que, mecanismos ecológicos y procesos de recuperación natural en el ecosistema han generado disponibilidad de microhábitats permitiendo la coexistencia una gran riqueza de especies.

  12. Odorous house ants (Tapinoma sessile as back-seat drivers of localized ant decline in urban habitats.

    Directory of Open Access Journals (Sweden)

    Adam Salyer

    Full Text Available Invasive species and habitat disturbance threaten biodiversity worldwide by modifying ecosystem performance and displacing native organisms. Similar homogenization impacts manifest locally when urbanization forces native species to relocate or reinvade perpetually altered habitat. This study investigated correlations between ant richness and abundance in response to urbanization and the nearby presence of invasive ant species, odorous house ants (Tapinoma sessile, within its native region. Surveying localized ant composition within natural, semi-natural, and urban habitat supported efforts to determine whether T. sessile appear to be primary (drivers threats as instigators or secondary (passengers threats as inheritors of indigenous ant decline. Sampling 180 sites, evenly split between all habitats with and without T. sessile present, yielded 45 total species. Although urbanization and T. sessile presence factors were significantly linked to ant decline, their interaction correlated to the greatest reduction of total ant richness (74% and abundance (81%. Total richness appeared to decrease from 27 species to 18 when natural habitat is urbanized and from 18 species to 7 with T. sessile present in urban plots. Odorous house ant presence minimally influenced ant communities within natural and semi-natural habitat, highlighting the importance of habitat alteration and T. sessile presence interactions. Results suggest urbanization releases T. sessile from unknown constraints by decreasing ant richness and competition. Within urban environment, T. sessile are pre-adapted to quickly exploit new resources and grow to supercolony strength wherein T. sessile drive adjacent biodiversity loss. Odorous house ants act as passengers and drivers of ecological change throughout different phases of urban 'invasion'. This progression through surviving habitat alteration, exploiting new resources, thriving, and further reducing interspecific competition supports a

  13. Microsatellite primers for fungus-growing ants

    DEFF Research Database (Denmark)

    Villesen, Palle; Gertsch, P J; Boomsma, JJ

    2002-01-01

    We isolated five polymorphic microsatellite loci from a library of two thousand recombinant clones of two fungus-growing ant species, Cyphomyrmex longiscapus and Trachymyrmex cf. zeteki. Amplification and heterozygosity were tested in five species of higher attine ants using both the newly...... developed primers and earlier published primers that were developed for fungus-growing ants. A total of 20 variable microsatellite loci, developed for six different species of fungus-growing ants, are now available for studying the population genetics and colony kin-structure of these ants....

  14. Microsatellite Primers for Fungus-Growing Ants

    DEFF Research Database (Denmark)

    Villesen Fredsted, Palle; Gertsch, Pia J.; Boomsma, Jacobus Jan (Koos)

    2002-01-01

    We isolated five polymorphic microsatellite loci from a library of two thousand recombinant clones of two fungus-growing ant species, Cyphomyrmex longiscapus and Trachymyrmex cf. zeteki. Amplification and heterozygosity were tested in five species of higher attine ants using both the newly...... developed primers and earlier published primers that were developed for fungus-growing ants. A total of 20 variable microsatellite loci, developed for six different species of fungus-growing ants, are now available for studying the population genetics and colony kin-structure of these ants....

  15. Ant Colony Optimization for Control

    NARCIS (Netherlands)

    Van Ast, J.M.

    2010-01-01

    The very basis of this thesis is the collective behavior of ants in colonies. Ants are an excellent example of how rather simple behavior on a local level can lead to complex behavior on a global level that is beneficial for the individuals. The key in the self-organization of ants is communication

  16. Partial incompatibility between ants and symbiotic fungi in two sympatric species of Acromyrmex leaf-cutting ants.

    Science.gov (United States)

    Bot, A N; Rehner, S A; Boomsma, J J

    2001-10-01

    We investigate the nature and duration of incompatibility between certain combinations of Acromyrmex leaf-cutting ants and symbiotic fungi, taken from sympatric colonies of the same or a related species. Ant-fungus incompatibility appeared to be largely independent of the ant species involved, but could be explained partly by genetic differences among the fungus cultivars. Following current theoretical considerations, we develop a hypothesis, originally proposed by S. A. Frank, that the observed incompatibilities are ultimately due to competitive interactions between genetically different fungal lineages, and we predict that the ants should have evolved mechanisms to prevent such competition between cultivars within a single garden. This requires that the ants are able to recognize unfamiliar fungi, and we show that this is indeed the case. Amplified fragment length polymorphism genotyping further shows that the two sympatric Acromyrmex species share each other's major lineages of cultivar, confirming that horizontal transfer does occasionally take place. We argue and provide some evidence that chemical substances produced by the fungus garden may mediate recognition of alien fungi by the ants. We show that incompatibility between ants and transplanted, genetically different cultivars is indeed due to active killing of the novel cultivar by the ants. This incompatibility disappears when ants are force-fed the novel cultivar for about a week, a result that is consistent with our hypothesis of recognition induced by the resident fungus and eventual replacement of incompatibility compounds during force-feeding.

  17. Sick ants become unsociable

    DEFF Research Database (Denmark)

    Bos, Nicky Peter Maria; Lefevre, T.; Jensen, A.B.

    2012-01-01

    Parasites represent a severe threat to social insects, which form high-density colonies of related individuals, and selection should favour host traits that reduce infection risk. Here, using a carpenter ant (Camponotus aethiops) and a generalist insect pathogenic fungus (Metarhizium brunneum), we...... show that infected ants radically change their behaviour over time to reduce the risk of colony infection. Infected individuals (i) performed less social interactions than their uninfected counterparts, (ii) did not interact with brood anymore and (iii) spent most of their time outside the nest from...... day 3 post-infection until death. Furthermore, infected ants displayed an increased aggressiveness towards non-nestmates. Finally, infected ants did not alter their cuticular chemical profile, suggesting that infected individuals do not signal their physiological status to nestmates. Our results...

  18. Interactive effects of soil-dwelling ants, ant mounds and simulated grazing on local plant community composition

    NARCIS (Netherlands)

    Veen, G.F.; Olff, H.

    2011-01-01

    Interactions between aboveground vertebrate herbivores and subterranean yellow meadow ants (Lasius flavus) can drive plant community patterns in grassland ecosystems. Here, we study the relative importance of the presence of ants (L. flavus) and ant mounds under different simulated grazing regimes

  19. Roadside Survey of Ants on Oahu, Hawaii

    Science.gov (United States)

    Tong, Reina L.; Grace, J. Kenneth; Krushelnycky, Paul D.

    2018-01-01

    Hawaii is home to over 60 ant species, including five of the six most damaging invasive ants. Although there have been many surveys of ants in Hawaii, the last island-wide hand-collection survey of ants on Oahu was conducted in 1988–1994. In 2012, a timed hand-collection of ants was made at 44 sites in a systematic, roadside survey throughout Oahu. Ants were identified and species distribution in relation to elevation, precipitation and soil type was analyzed. To assess possible convenience sampling bias, 15 additional sites were sampled further from roads to compare with the samples near roads. Twenty-four species of ants were found and mapped; Pheidole megacephala (F.), Ochetellus glaber (Mayr), and Technomyrmex difficilis Forel were the most frequently encountered ants. For six ant species, a logistic regression was performed with elevation, average annual precipitation, and soil order as explanatory variables. O. glaber was found in areas with lower precipitation around Oahu. Paratrechina longicornis (Latrielle) and Tetramorium simillimum (Smith, F.) were found more often in lower elevations and in areas with the Mollisol soil order. Elevation, precipitation, and soil type were not significant sources of variation for P. megacephala, Plagiolepis alluaudi Emery, and T. difficilis. P. megacephala was associated with fewer mean numbers of ants where it occurred. Ant assemblages near and far from roads did not significantly differ. Many species of ants remain established on Oahu, and recent invaders are spreading throughout the island. Mapping ant distributions contributes to continued documentation and understanding of these pests. PMID:29439503

  20. Dealing with water deficit in Atta ant colonies: large ants scout for water while small ants transport it

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Da-Silva

    2012-07-01

    Leafcutter ants (Atta sexdens rubropilosa (Forel 1908 have an elaborate social organization, complete with caste divisions. Activities carried out by specialist groups contribute to the overall success and survival of the colony when it is confronted with environmental challenges such as dehydration. Ants detect variations in humidity inside the nest and react by activating several types of behavior that enhance water uptake and decrease water loss, but it is not clear whether or not a single caste collects water regardless of the cost of bringing this resource back to the colony. Accordingly, we investigated water collection activities in three colonies of Atta sexdens rubropilosa experimentally exposed to water stress. Specifically, we analyzed whether or not the same ant caste foraged for water, regardless of the absolute energetic cost (distance of transporting this resource back to the colony. Our experimental design offered water sources at 0 m, 1 m and 10 m from the nest. We studied the body size of ants near the water sources from the initial offer of water (time  =  0 to 120 min, and tested for specialization. We observed a reduction in the average size and variance of ants that corroborated the specialization hypothesis. Although the temporal course of specialization changed with distance, the final outcome was similar among distances. Thus, we conclude that, for this species, a specialist (our use of the word “specialist” does not mean exclusive task force is responsible for collecting water, regardless of the cost of transporting water back to the colony.

  1. The evolution of genome size in ants

    Directory of Open Access Journals (Sweden)

    Spagna Joseph C

    2008-02-01

    Full Text Available Abstract Background Despite the economic and ecological importance of ants, genomic tools for this family (Formicidae remain woefully scarce. Knowledge of genome size, for example, is a useful and necessary prerequisite for the development of many genomic resources, yet it has been reported for only one ant species (Solenopsis invicta, and the two published estimates for this species differ by 146.7 Mb (0.15 pg. Results Here, we report the genome size for 40 species of ants distributed across 10 of the 20 currently recognized subfamilies, thus making Formicidae the 4th most surveyed insect family and elevating the Hymenoptera to the 5th most surveyed insect order. Our analysis spans much of the ant phylogeny, from the less derived Amblyoponinae and Ponerinae to the more derived Myrmicinae, Formicinae and Dolichoderinae. We include a number of interesting and important taxa, including the invasive Argentine ant (Linepithema humile, Neotropical army ants (genera Eciton and Labidus, trapjaw ants (Odontomachus, fungus-growing ants (Apterostigma, Atta and Sericomyrmex, harvester ants (Messor, Pheidole and Pogonomyrmex, carpenter ants (Camponotus, a fire ant (Solenopsis, and a bulldog ant (Myrmecia. Our results show that ants possess small genomes relative to most other insects, yet genome size varies three-fold across this insect family. Moreover, our data suggest that two whole-genome duplications may have occurred in the ancestors of the modern Ectatomma and Apterostigma. Although some previous studies of other taxa have revealed a relationship between genome size and body size, our phylogenetically-controlled analysis of this correlation did not reveal a significant relationship. Conclusion This is the first analysis of genome size in ants (Formicidae and the first across multiple species of social insects. We show that genome size is a variable trait that can evolve gradually over long time spans, as well as rapidly, through processes that may

  2. Are ant feces nutrients for plants? A metabolomics approach to elucidate the nutritional effects on plants hosting weaver ants

    DEFF Research Database (Denmark)

    Vidkjær, Nanna Hjort; Wollenweber, Bernd; Gislum, René

    2015-01-01

    Weaver ants (genus Oecophylla) are tropical carnivorous ant species living in high numbers in the canopies of trees. The ants excrete copious amounts of fecal matter on leaf surfaces, and these feces may provide nutrients to host trees. This hypothesis is supported by studies of ant......-plant interactions involving other ant species that have demonstrated the transfer of nutrients from ants to plants. In this 7-months study, a GC–MS-based metabolomics approach along with an analysis of total nitrogen and carbon levels was used to study metabolic changes in ant-hosting Coffea arabica plants compared...... with control plants. The results showed elevated levels of total nitrogen, amino acids, fatty acids, caffeine, and secondary metabolites of the phenylpropanoid pathway in leaves from ant-hosting plants. Minor effects were observed for sugars, whereas little or no effect was observed for organic acids, despite...

  3. The interactions of ants with their biotic environment.

    Science.gov (United States)

    Chomicki, Guillaume; Renner, Susanne S

    2017-03-15

    This s pecial feature results from the symposium 'Ants 2016: ant interactions with their biotic environments' held in Munich in May 2016 and deals with the interactions between ants and other insects, plants, microbes and fungi, studied at micro- and macroevolutionary levels with a wide range of approaches, from field ecology to next-generation sequencing, chemical ecology and molecular genetics. In this paper, we review key aspects of these biotic interactions to provide background information for the papers of this s pecial feature After listing the major types of biotic interactions that ants engage in, we present a brief overview of ant/ant communication, ant/plant interactions, ant/fungus symbioses, and recent insights about ants and their endosymbionts. Using a large molecular clock-dated Formicidae phylogeny, we map the evolutionary origins of different ant clades' interactions with plants, fungi and hemiptera. Ants' biotic interactions provide ideal systems to address fundamental ecological and evolutionary questions about mutualism, coevolution, adaptation and animal communication. © 2017 The Author(s).

  4. Chemically armed mercenary ants protect fungus-farming societies

    DEFF Research Database (Denmark)

    Adams, Rachelle Martha Marie; Liberti, Joanito; Illum, Anders A.

    2013-01-01

    guest ants are sufficient to kill raiders that invariably exterminate host nests without a cohabiting guest ant colony. We also show that the odor of guest ants discourages raider scouts from recruiting nestmates to host colonies. Our results imply that Sericomyrmex fungus-growers obtain a net benefit......The ants are extraordinary in having evolved many lineages that exploit closely related ant societies as social parasites, but social parasitism by distantly related ants is rare. Here we document the interaction dynamics among a Sericomyrmex fungus-growing ant host, a permanently associated...... parasitic guest ant of the genus Megalomyrmex, and a raiding agro-predator of the genus Gnamptogenys. We show experimentally that the guest ants protect their host colonies against agro-predator raids using alkaloid venom that is much more potent than the biting defenses of the host ants. Relatively few...

  5. A cellular automata model for ant trails

    Indian Academy of Sciences (India)

    In this study, the unidirectional ant traffic flow with U-turn in an ant trail was inves- tigated using ... the literature, it was considered in the model that (i) ant colony consists of two kinds of ants, good- ... ponents without a central controller [8].

  6. Using pleometrosis (multiple queens) and pupae transplantation to boost weaver ant (Oecophylla smaragdina) colony growth in ant nurseries

    DEFF Research Database (Denmark)

    Offenberg, Hans Joachim; Nielsen, Mogens Gissel; Peng, Renkang

    2011-01-01

    Weaver ants (Oecophylla spp.) are increasingly being used for biocontrol and are targeted for future production of insect protein in ant farms. An efficient production of live ant colonies may facilitate the utilization of these ants but the production of mature colonies is hampered by the long...... and no transplantation. Thus, in ant nurseries the use of multiple queens during nest founding as well as transplantation of pupae from foreign colonies may be utilised to decrease the time it takes to produce a colony ready for implementation....

  7. Ant-plants and fungi: a new threeway symbiosis.

    Science.gov (United States)

    Defossez, Emmanuel; Selosse, Marc-André; Dubois, Marie-Pierre; Mondolot, Laurence; Faccio, Antonella; Djieto-Lordon, Champlain; McKey, Doyle; Blatrix, Rumsaïs

    2009-06-01

    Symbioses between plants and fungi, fungi and ants, and ants and plants all play important roles in ecosystems. Symbioses involving all three partners appear to be rare. Here, we describe a novel tripartite symbiosis in which ants and a fungus inhabit domatia of an ant-plant, and present evidence that such interactions are widespread. We investigated 139 individuals of the African ant-plant Leonardoxa africana for occurrence of fungus. Behaviour of mutualist ants toward the fungus within domatia was observed using a video camera fitted with an endoscope. Fungi were identified by sequencing a fragment of their ribosomal DNA. Fungi were always present in domatia occupied by mutualist ants but never in domatia occupied by opportunistic or parasitic ants. Ants appear to favour the propagation, removal and maintenance of the fungus. Similar fungi were associated with other ant-plants in Cameroon. All belong to the ascomycete order Chaetothyriales; those from L. africana formed a monophyletic clade. These new plant-ant-fungus associations seem to be specific, as demonstrated within Leonardoxa and as suggested by fungal phyletic identities. Such tripartite associations are widespread in African ant-plants but have long been overlooked. Taking fungal partners into account will greatly enhance our understanding of symbiotic ant-plant mutualisms.

  8. Food source quality and ant dominance hierarchy influence the outcomes of ant-plant interactions in an arid environment

    Science.gov (United States)

    Flores-Flores, Rocío Vianey; Aguirre, Armando; Anjos, Diego V.; Neves, Frederico S.; Campos, Ricardo I.; Dáttilo, Wesley

    2018-02-01

    In this study, we conducted a series of experiments in a population of Vachellia constricta (Fabaceae) in the arid Tehuacan-Cuicatláan valley, Mexico, in order to evaluate if the food source quality and ant dominance hierarchy influence the outcomes of ant-plant interactions. Using an experiment with artificial nectaries, we observed that ants foraging on food sources with higher concentration of sugar are quicker in finding and attacking potential herbivorous insects. More specifically, we found that the same ant species may increase their defence effectiveness according to the quality of food available. These findings indicate that ant effectiveness in plant protection is context-dependent and may vary according to specific individual characteristics of plants. In addition, we showed that competitively superior ant species tend to dominate plants in periods with high nectar activity, emphasizing the role of the dominance hierarchy structuring ant-plant interactions. However, when high sugar food sources were experimentally available ad libitum, the nocturnal and competitively superior ant species, Camponotus atriceps, did not dominate the artificial nectaries during the day possibly due to limitation of its thermal tolerance. Therefore, temporal niche partitioning may be allowing the coexistence of two dominant ant species (Camponotus rubritorax during the day and C. atriceps at night) on V. constricta. Our findings indicate that the quality of the food source, and temporal shifts in ant dominance are key factors which structure the biotic plant defences in an arid environment.

  9. Persistence of pollination mutualisms in the presence of ants.

    Science.gov (United States)

    Wang, Yuanshi; Wang, Shikun

    2015-01-01

    This paper considers plant-pollinator-ant systems in which the plant-pollinator interaction is mutualistic but ants have both positive and negative effects on plants. The ants also interfere with pollinators by preventing them from accessing plants. While a Beddington-DeAngelis (BD) formula can describe the plant-pollinator interaction, the formula is extended in this paper to characterize the pollination mutualism under the ant interference. Then, a plant-pollinator-ant system with the extended BD functional response is discussed, and global dynamics of the model demonstrate the mechanisms by which pollination mutualism can persist in the presence of ants. When the ant interference is strong, it can result in extinction of pollinators. Moreover, if the ants depend on pollination mutualism for survival, the strong interference could drive pollinators into extinction, which consequently lead to extinction of the ants themselves. When the ant interference is weak, a cooperation between plant-ant and plant-pollinator mutualisms could occur, which promotes survival of both ants and pollinators, especially in the case that ants (respectively, pollinators) cannot survive in the absence of pollinators (respectively, ants). Even when the level of ant interference remains invariant, varying ants' negative effect on plants can result in survival/extinction of both ants and pollinators. Therefore, our results provide an explanation for the persistence of pollination mutualism when there exist ants.

  10. Riding with the ants

    NARCIS (Netherlands)

    Duarte, A. P. M.; Attili-Angelis, D.; Baron, N. C.; Groenewald, Johannes Z.; Crous, Pedro W.; Pagnocca, F. C.

    Isolates of Teratosphaeriaceae have frequently been found in the integument of attine ants, proving to be common and diverse in this microenvironment. The LSU phylogeny of the ant-isolated strains studied revealed that they cluster in two main lineages. The first was associated with the genus

  11. The importance of ants in cave ecology, with new records and behavioral observations of ants in Arizona caves

    Directory of Open Access Journals (Sweden)

    Robert B. Pape

    2016-09-01

    Full Text Available The importance of ants as elements in cave ecology has been mostly unrecognized. A global list of ant species recorded from caves, compiled from a review of existing literature, is presented. This paper also reviews what is currently known about ants occurring in Arizona (USA caves. The diversity and distribution represented in these records suggests ants are relatively common cave visitors (trogloxenes. A general utilization of caves by ants within both temperate and tropical latitudes may be inferred from this combined evidence. Observations of ant behavior in Arizona caves demonstrate a low level and sporadic, but persistent, use of these habitats and their contained resources by individual ant colonies. Documentation of Neivamyrmex sp. preying on cave-inhabiting arthropods is reported here for the first time. Observations of hypogeic army ants in caves suggests they may not penetrate to great vertical depth in search of prey, but can be persistent occupants in relatively shallow, horizontal sections of caves where they may prey on endemic cave animals. First cave records for ten ant species are reported from Arizona caves. These include two species of Neivamyrmex (N. nigrescens Cresson and Neivamyrmex sp.; Formicidae: Dorylinae, four myrmicines (Pheidole portalensis Wilson, Pheidole cf. porcula Wheeler, Solenopsis aurea Wheeler and Stenamma sp. Westwood, one dolichoderine (Forelius keiferi Wheeler and three formicines (Lasius arizonicus Wheeler, L. sitiens Wilson, and Camponotus sp. Mayr.

  12. Ant-plant-homopteran mutualism: how the third partner affects the interaction between a plant-specialist ant and its myrmecophyte host

    Science.gov (United States)

    Gaume, L.; McKey, D.; Terrin, S.

    1998-01-01

    By estimating relative costs and benefits, we explored the role of the homopteran partner in the protection mutualism between the myrmecophyte Leonardoxa africana T3, the ant Aphomomyrmex afer, and sap-sucking homopterans tended by ants in the tree's swollen hollow twigs. The ants obtain nest sites and food from their host-plant (food is obtained either directly by extrafloral nectar or indirectly via homopterans). Aphomomyrmex workers patrol the young leaves of L. africana T3 and protect them against phytophagous insects. Because ants tended, either solely or primarily, coccids in some trees and pseudococcids in others, we were able to study whether the nature of the interaction was dependent on the identity of the third partner. First, the type of homopteran affects the benefits to the tree of maintaining a large ant colony. Larger colony size (relative to tree size) confers greater protection against herbivory; this relationship is more pronounced for trees whose ants tend pseudococcids than for those in which ants tend coccids. Second, for trees (and associated ant colonies) of comparable size, homopteran biomass was much larger in trees harbouring coccids than in trees with pseudococcids. Thus, the cost to the tree of maintaining ants may be greater when ants are associated with coccids. The net benefits to the plant of maintaining ants appear to be much greater with pseudococcids as the third partner. To explore how the type of homopteran affects functioning of the system, we attempted to determine which of the resources (nest sites, extrafloral nectar, and homopterans) is likely to limit ant colony size. In trees where ants tended coccids, ant-colony biomass was strongly dependent on the number of extrafloral nectaries. In contrast, in trees whose ants tended only pseudococcids, colony biomass was not related to the number of nectaries and was most strongly determined by the volume of available nest sites. We present hypotheses to explain how the type of

  13. The distribution of weaver ant pheromones on host trees

    DEFF Research Database (Denmark)

    Offenberg, Joachim

    2007-01-01

    The visible anal spots deposited by Oecophylla smaragdina ants have been suggested to deter ant prey, affect interspecific competition and facilitate mutualists and parasites in tracking down Oecophylla ants. I measured the density of anal spots on host trees with and without ants and tested for ...... to leaves. Also there was a positive correlation between spot density and the likelihood of being detected by ants. Anal spots may thus function as reliable cues to interacting species and be an important factor in shaping the community around Oecophylla colonies.......The visible anal spots deposited by Oecophylla smaragdina ants have been suggested to deter ant prey, affect interspecific competition and facilitate mutualists and parasites in tracking down Oecophylla ants. I measured the density of anal spots on host trees with and without ants and tested...... for correlations between spot density, ant activity and the likelihood of being detected by an ant. Spots were only found on trees with ants. On ant-trees, spots were distributed throughout the trees but with higher densities in areas with high ant activity and pheromone densities were higher on twigs compared...

  14. Relative effects of disturbance on red imported fire ants and native ant species in a longleaf pine ecosystem

    DEFF Research Database (Denmark)

    Stuble, Katharine L.; Kirkman, L. Katherine; Carroll, C. Ronald

    2011-01-01

    and cases in which non-native species become established in intact (lacking extensive anthropogenic soil disturbance) communities and subsequently diminish the abundance and richness of native species is challenging on the basis of observation alone. The red imported fire ant (Solenopsis invicta......), an invasive species that occurs throughout much of the southeastern United States, is such an example. Rather than competitively displacing native species, fire ants may become established only in disturbed areas in which native species richness and abundance are already reduced. We used insecticide to reduce......, the abundance of native ants increased to levels comparable to those in control plots after 1 year. Our findings suggest that factors other than large reductions in ant abundance and species density (number of species per unit area) may affect the establishment of fire ants and that the response of native ants...

  15. Chemically armed mercenary ants protect fungus-farming societies

    Science.gov (United States)

    Adams, Rachelle M. M.; Liberti, Joanito; Illum, Anders A.; Jones, Tappey H.; Nash, David R.; Boomsma, Jacobus J.

    2013-01-01

    The ants are extraordinary in having evolved many lineages that exploit closely related ant societies as social parasites, but social parasitism by distantly related ants is rare. Here we document the interaction dynamics among a Sericomyrmex fungus-growing ant host, a permanently associated parasitic guest ant of the genus Megalomyrmex, and a raiding agro-predator of the genus Gnamptogenys. We show experimentally that the guest ants protect their host colonies against agro-predator raids using alkaloid venom that is much more potent than the biting defenses of the host ants. Relatively few guest ants are sufficient to kill raiders that invariably exterminate host nests without a cohabiting guest ant colony. We also show that the odor of guest ants discourages raider scouts from recruiting nestmates to host colonies. Our results imply that Sericomyrmex fungus-growers obtain a net benefit from their costly guest ants behaving as a functional soldier caste to meet lethal threats from agro-predator raiders. The fundamentally different life histories of the agro-predators and guest ants appear to facilitate their coexistence in a negative frequency-dependent manner. Because a guest ant colony is committed for life to a single host colony, the guests would harm their own interests by not defending the host that they continue to exploit. This conditional mutualism is analogous to chronic sickle cell anemia enhancing the resistance to malaria and to episodes in human history when mercenary city defenders offered either net benefits or imposed net costs, depending on the level of threat from invading armies. PMID:24019482

  16. Chemically armed mercenary ants protect fungus-farming societies.

    Science.gov (United States)

    Adams, Rachelle M M; Liberti, Joanito; Illum, Anders A; Jones, Tappey H; Nash, David R; Boomsma, Jacobus J

    2013-09-24

    The ants are extraordinary in having evolved many lineages that exploit closely related ant societies as social parasites, but social parasitism by distantly related ants is rare. Here we document the interaction dynamics among a Sericomyrmex fungus-growing ant host, a permanently associated parasitic guest ant of the genus Megalomyrmex, and a raiding agro-predator of the genus Gnamptogenys. We show experimentally that the guest ants protect their host colonies against agro-predator raids using alkaloid venom that is much more potent than the biting defenses of the host ants. Relatively few guest ants are sufficient to kill raiders that invariably exterminate host nests without a cohabiting guest ant colony. We also show that the odor of guest ants discourages raider scouts from recruiting nestmates to host colonies. Our results imply that Sericomyrmex fungus-growers obtain a net benefit from their costly guest ants behaving as a functional soldier caste to meet lethal threats from agro-predator raiders. The fundamentally different life histories of the agro-predators and guest ants appear to facilitate their coexistence in a negative frequency-dependent manner. Because a guest ant colony is committed for life to a single host colony, the guests would harm their own interests by not defending the host that they continue to exploit. This conditional mutualism is analogous to chronic sickle cell anemia enhancing the resistance to malaria and to episodes in human history when mercenary city defenders offered either net benefits or imposed net costs, depending on the level of threat from invading armies.

  17. Monoculture of leafcutter ant gardens.

    Directory of Open Access Journals (Sweden)

    Ulrich G Mueller

    2010-09-01

    Full Text Available Leafcutter ants depend on the cultivation of symbiotic Attamyces fungi for food, which are thought to be grown by the ants in single-strain, clonal monoculture throughout the hundreds to thousands of gardens within a leafcutter nest. Monoculture eliminates cultivar-cultivar competition that would select for competitive fungal traits that are detrimental to the ants, whereas polyculture of several fungi could increase nutritional diversity and disease resistance of genetically variable gardens.Using three experimental approaches, we assessed cultivar diversity within nests of Atta leafcutter ants, which are most likely among all fungus-growing ants to cultivate distinct cultivar genotypes per nest because of the nests' enormous sizes (up to 5000 gardens and extended lifespans (10-20 years. In Atta texana and in A. cephalotes, we resampled nests over a 5-year period to test for persistence of resident cultivar genotypes within each nest, and we tested for genetic differences between fungi from different nest sectors accessed through excavation. In A. texana, we also determined the number of Attamyces cells carried as a starter inoculum by a dispersing queens (minimally several thousand Attamyces cells, and we tested for genetic differences between Attamyces carried by sister queens dispersing from the same nest. Except for mutational variation arising during clonal Attamyces propagation, DNA fingerprinting revealed no evidence for fungal polyculture and no genotype turnover during the 5-year surveys.Atta leafcutter ants can achieve stable, fungal monoculture over many years. Mutational variation emerging within an Attamyces monoculture could provide genetic diversity for symbiont choice (gardening biases of the ants favoring specific mutational variants, an analog of artificial selection.

  18. The distribution and diversity of insular ants

    DEFF Research Database (Denmark)

    Roura-Pascual, Núria; Sanders, Nate; Hui, Cang

    2016-01-01

    Aim: To examine the relationship between island characteristics (area, distance to the nearest continent, climate and human population size) and ant species richness, as well as the factors underlying global geographical clustering of native and exotic ant composition on islands. Location: One...... hundred and two islands from 20 island groups around the world. Methods: We used spatial linear models that consider the spatial structure of islands to examine patterns of ant species richness. We also performed modularity analyses to identify clusters of islands hosting a similar suite of species...... and constructed conditional inference trees to assess the characteristics of islands that explain the formation of these island-ant groups. Results: Island area was the best predictor of ant species richness. However, distance to the nearest continent was an important predictor of native ant species richness...

  19. Antígona y la muerte

    OpenAIRE

    Pérez Alcolea, Simona Micaela

    2012-01-01

    La ponencia analiza la muerte de Antígona en la obra de Sófocles. Se propone que su suicidio es un acto consciente de voluntad preanunciado a lo largo de toda la obra y no una medida desesperada. Con ese fin se exploran las posibles motivaciones de Antígona para poner fin a su vida. En el análisis se proponen tres respuestas (no necesariamente excluyentes): -Antígona responde a la ética homérica. Está en lucha con Creón, y su suicidio es su golpe de gracia al poder del rey. -Antígona...

  20. From Ant Trails to Pedestrian Dynamics

    Directory of Open Access Journals (Sweden)

    Andreas Schadschneider

    2003-01-01

    Full Text Available This paper presents a model for the simulation of pedestrian dynamics inspired by the behaviour of ants in ant trails. Ants communicate by producing a pheromone that can be smelled by other ants. In this model, pedestrians produce a virtual pheromone that influences the motion of others. In this way all interactions are strictly local, and so even large crowds can be simulated very efficiently. Nevertheless, the model is able to reproduce the collective effects observed empirically, eg the formation of lanes in counterflow. As an application, we reproduce a surprising result found in experiments of evacuation from an aircraft.

  1. Ants defend aphids against lethal disease

    Science.gov (United States)

    Nielsen, Charlotte; Agrawal, Anurag A.; Hajek, Ann E.

    2010-01-01

    Social insects defend their own colonies and some species also protect their mutualist partners. In mutualisms with aphids, ants typically feed on honeydew produced by aphids and, in turn guard and shelter aphid colonies from insect natural enemies. Here we report that Formica podzolica ants tending milkweed aphids, Aphis asclepiadis, protect aphid colonies from lethal fungal infections caused by an obligate aphid pathogen, Pandora neoaphidis. In field experiments, bodies of fungal-killed aphids were quickly removed from ant-tended aphid colonies. Ant workers were also able to detect infective conidia on the cuticle of living aphids and responded by either removing or grooming these aphids. Our results extend the long-standing view of ants as mutualists and protectors of aphids by demonstrating focused sanitizing and quarantining behaviour that may lead to reduced disease transmission in aphid colonies. PMID:19923138

  2. Collective search by ants in microgravity

    Directory of Open Access Journals (Sweden)

    Stefanie M. Countryman

    2015-03-01

    Full Text Available The problem of collective search is a tradeoff between searching thoroughly and covering as much area as possible. This tradeoff depends on the density of searchers. Solutions to the problem of collective search are currently of much interest in robotics and in the study of distributed algorithms, for example to design ways that without central control robots can use local information to perform search and rescue operations. Ant colonies operate without central control. Because they can perceive only local, mostly chemical and tactile cues, they must search collectively to find resources and to monitor the colony's environment. Examining how ants in diverse environments solve the problem of collective search can elucidate how evolution has led to diverse forms of collective behavior. An experiment on the International Space Station in January 2014 examined how ants (Tetramorium caespitum perform collective search in microgravity. In the ISS experiment, the ants explored a small arena in which a barrier was lowered to increase the area and thus lower ant density. In microgravity, relative to ground controls, ants explored the area less thoroughly and took more convoluted paths. It appears that the difficulty of holding on to the surface interfered with the ants’ ability to search collectively. Ants frequently lost contact with the surface, but showed a remarkable ability to regain contact with the surface.

  3. Pericarpial nectary-visiting ants do not provide fruit protection against pre-dispersal seed predators regardless of ant species composition and resource availability.

    Directory of Open Access Journals (Sweden)

    Priscila Andre Sanz-Veiga

    Full Text Available Extrafloral nectaries can occur in both vegetative and reproductive plant structures. In many Rubiaceae species in the Brazilian Cerrado, after corolla abscission, the floral nectary continues to secret nectar throughout fruit development originating post-floral pericarpial nectaries which commonly attract many ant species. The occurrence of such nectar secreting structures might be strategic for fruit protection against seed predators, as plants are expected to invest higher on more valuable and vulnerable parts. Here, we performed ant exclusion experiments to investigate whether the interaction with ants mediated by the pericarpial nectaries of Tocoyena formosa affects plant reproductive success by reducing the number of pre-dispersal seed predators. We also assessed whether ant protection was dependent on ant species composition and resource availability. Although most of the plants were visited by large and aggressive ant species, such as Ectatomma tuberculatum and species of the genus Camponotus, ants did not protect fruits against seed predators. Furthermore, the result of the interaction was neither related to ant species composition nor to the availability of resources. We suggest that these results may be related to the nature and behavior of the most important seed predators, like Hemicolpus abdominalis weevil which the exoskeleton toughness prevent it from being predated by most ant species. On the other hand, not explored factors, such as reward quality, local ant abundance, ant colony characteristics and/or the presence of alternative energetic sources could also account for variations in ant frequency, composition, and finally ant protective effects, highlighting the conditionality of facultative plant-ant mutualisms.

  4. The Biochemical Toxin Arsenal from Ant Venoms

    Directory of Open Access Journals (Sweden)

    Axel Touchard

    2016-01-01

    Full Text Available Ants (Formicidae represent a taxonomically diverse group of hymenopterans with over 13,000 extant species, the majority of which inject or spray secretions from a venom gland. The evolutionary success of ants is mostly due to their unique eusociality that has permitted them to develop complex collaborative strategies, partly involving their venom secretions, to defend their nest against predators, microbial pathogens, ant competitors, and to hunt prey. Activities of ant venom include paralytic, cytolytic, haemolytic, allergenic, pro-inflammatory, insecticidal, antimicrobial, and pain-producing pharmacologic activities, while non-toxic functions include roles in chemical communication involving trail and sex pheromones, deterrents, and aggregators. While these diverse activities in ant venoms have until now been largely understudied due to the small venom yield from ants, modern analytical and venomic techniques are beginning to reveal the diversity of toxin structure and function. As such, ant venoms are distinct from other venomous animals, not only rich in linear, dimeric and disulfide-bonded peptides and bioactive proteins, but also other volatile and non-volatile compounds such as alkaloids and hydrocarbons. The present review details the unique structures and pharmacologies of known ant venom proteinaceous and alkaloidal toxins and their potential as a source of novel bioinsecticides and therapeutic agents.

  5. The Biochemical Toxin Arsenal from Ant Venoms

    Science.gov (United States)

    Touchard, Axel; Aili, Samira R.; Fox, Eduardo Gonçalves Paterson; Escoubas, Pierre; Orivel, Jérôme; Nicholson, Graham M.; Dejean, Alain

    2016-01-01

    Ants (Formicidae) represent a taxonomically diverse group of hymenopterans with over 13,000 extant species, the majority of which inject or spray secretions from a venom gland. The evolutionary success of ants is mostly due to their unique eusociality that has permitted them to develop complex collaborative strategies, partly involving their venom secretions, to defend their nest against predators, microbial pathogens, ant competitors, and to hunt prey. Activities of ant venom include paralytic, cytolytic, haemolytic, allergenic, pro-inflammatory, insecticidal, antimicrobial, and pain-producing pharmacologic activities, while non-toxic functions include roles in chemical communication involving trail and sex pheromones, deterrents, and aggregators. While these diverse activities in ant venoms have until now been largely understudied due to the small venom yield from ants, modern analytical and venomic techniques are beginning to reveal the diversity of toxin structure and function. As such, ant venoms are distinct from other venomous animals, not only rich in linear, dimeric and disulfide-bonded peptides and bioactive proteins, but also other volatile and non-volatile compounds such as alkaloids and hydrocarbons. The present review details the unique structures and pharmacologies of known ant venom proteinaceous and alkaloidal toxins and their potential as a source of novel bioinsecticides and therapeutic agents. PMID:26805882

  6. Aphid egg protection by ants: a novel aspect of the mutualism between the tree-feeding aphid Stomaphis hirukawai and its attendant ant Lasius productus

    Science.gov (United States)

    Matsuura, Kenji; Yashiro, Toshihisa

    2006-10-01

    Aphids often form mutualistic associations with ants, in which the aphids provide the ants with honeydew and the ants defend the aphids from predators. In this paper, we report aphid egg protection by ants as a novel aspect of the deeply interdependent relationship between a tree-feeding aphid and its attendant ant. The ant Lasius productus harbours oviparous females, males, and eggs of the hinoki cypress-feeding aphid Stomaphis hirukawai in its nests in winter. We investigated the behaviour of ants kept with aphid eggs in petri dishes to examine whether the ants recognise the aphid eggs and tend them or only provide a refuge for the aphids. Workers carried almost all of the aphid eggs into the nest within 24 h. The ants indiscriminately tended aphid eggs collected from their own colonies and those from other ant colonies. The ants cleaned the eggs and piled them up in the nest, and egg tending by ants dramatically increased aphid egg survival rates. Starving the ants showed no significant effect on aphid egg survivorship. Without ants, aphid eggs were rapidly killed by fungi. These results suggested that grooming by the ants protected the aphid eggs, at least, against pathogenic fungi. This hygienic service afforded by the ants seems indispensable for egg survival of these aphids in an environment rich in potentially pathogenic microorganisms.

  7. Fire ants perpetually rebuild sinking towers

    Science.gov (United States)

    Phonekeo, Sulisay; Mlot, Nathan; Monaenkova, Daria; Hu, David L.; Tovey, Craig

    2017-07-01

    In the aftermath of a flood, fire ants, Solenopsis invicta, cluster into temporary encampments. The encampments can contain hundreds of thousands of ants and reach over 30 ants high. How do ants build such tall structures without being crushed? In this combined experimental and theoretical study, we investigate the shape and rate of construction of ant towers around a central support. The towers are bell shaped, consistent with towers of constant strength such as the Eiffel tower, where each element bears an equal load. However, unlike the Eiffel tower, the ant tower is built through a process of trial and error, whereby failed portions avalanche until the final shape emerges. High-speed and novel X-ray videography reveal that the tower constantly sinks and is rebuilt, reminiscent of large multicellular systems such as human skin. We combine the behavioural rules that produce rafts on water with measurements of adhesion and attachment strength to model the rate of growth of the tower. The model correctly predicts that the growth rate decreases as the support diameter increases. This work may inspire the design of synthetic swarms capable of building in vertical layers.

  8. Ants Orase kultuurisõnum

    Index Scriptorium Estoniae

    2007-01-01

    26. jaanuaril toimub Tallinna Ülikooli Akadeemilises Raamatukogus seminar silmapaistvast Eesti teadlasest ja tõlkijast Ants Orasest. Esinevad kirjandusteadlased Tallinna Ülikoolist, Tartu Ülikoolist ja Eesti Kirjandusmuuseumist. Avaettekandeks on sõna Oklahoma Ülikooli professoril Vincent B. Leitchil, kes oli Ants Orase viimaseks juhendatavaks doktorandiks. Seminari korraldavad Tallinna Ülikool ja Eesti Kirjandusmuuseum. Vt ka Postimees, 26, jaan., lk. 18

  9. Ant-plant symbioses: Stalking the chuyachaqui.

    Science.gov (United States)

    Davidson, D W; McKey, D

    1993-09-01

    According to Quechua-speaking peoples, orchard-like stands ('Supay Chacras') of two Amazonian ant-plant species are cultivated by the devil, or 'Chuyachaqui'. These "devil gardens" offer extreme examples of specializations that have evolved repeatedly in ant-plant associations. Numerous investigations are beginning to disclose the identity of the Chuyachaqui - the forces behind evolutionary specialization in ant-plant symbioses. These developments have important implications for our understanding of modes of coevolution in symbiotic mutualism, remarkable convergent similarities in the form of ant-plant symbioses on different continents, and pronounced intercontinental differences in the diversity and taxonomic composition of associates. Copyright © 1993. Published by Elsevier Ltd.

  10. Pollination and facultative ant-association in the African leopard ...

    African Journals Online (AJOL)

    The role of extra-floral nectar appears to be recruitment of foraging ants to tend the flowers resulting in a facultative ant-association between the orchid and gregarious ants. Four different ant species were found to forage on A. africana's inflorescences. Ant-tended inflorescences suffered significantly less damage by insects.

  11. ANT, tourism and situated globality

    DEFF Research Database (Denmark)

    Jóhannesson, Gunnar Thór; Ren, Carina Bregnholm; van der Duim, René

    2015-01-01

    viable descriptions of the collective condition of humans and more-than-humans in the Anthropocene. Also and moving past a merely descriptive approach, it discusses it as a useful tool to engage with the situated globalities which come into being through the socio-spatial coupling of tourism......In recent years Actor-network theory (ANT) has increasingly been felt in the field of tourism studies (Van der Duim, Ren, & Jóhannesson, 2012). An important implication of the meeting between ANT and tourism studies is the notion of tourism being described as a heterogeneous assemblage of what we...... are used to define as the separate spheres of nature and culture. This paper explores and relates the central tenets of ANT in tourism with regard to the concept of the Anthropocene. It presents the ANT approach as a flat and object-oriented ontology and methodology and explores its potentials to carve out...

  12. Recurrence analysis of ant activity patterns.

    Directory of Open Access Journals (Sweden)

    Felipe Marcel Neves

    Full Text Available In this study, we used recurrence quantification analysis (RQA and recurrence plots (RPs to compare the movement activity of individual workers of three ant species, as well as a gregarious beetle species. RQA and RPs quantify the number and duration of recurrences of a dynamical system, including a detailed quantification of signals that could be stochastic, deterministic, or both. First, we found substantial differences between the activity dynamics of beetles and ants, with the results suggesting that the beetles have quasi-periodic dynamics and the ants do not. Second, workers from different ant species varied with respect to their dynamics, presenting degrees of predictability as well as stochastic signals. Finally, differences were found among minor and major caste of the same (dimorphic ant species. Our results underscore the potential of RQA and RPs in the analysis of complex behavioral patterns, as well as in general inferences on animal behavior and other biological phenomena.

  13. Symbiotic mutualism with a community of opportunistic ants: protection, competition, and ant occupancy of the myrmecophyte Barteria nigritana (Passifloraceae)

    Science.gov (United States)

    Djiéto-Lordon, Champlain; Dejean, Alain; Gibernau, Marc; Hossaert-McKey, Martine; McKey, Doyle

    2004-10-01

    Barteria nigritana is a myrmecophyte tree of Lower Guinea coastal vegetation. Unlike the more specialised B. fistulosa, which harbours a single host-specific mutualistic ant, B. nigritana is associated with several opportunistic ants. Such symbiotic, yet opportunistic, ant-plant associations have been little studied. On 113 clumps of B. nigritana, we censused ant associates and herbivores and compared herbivory on plants occupied by different ants. In addition to these correlative data, protection conferred by different ant species was compared by herbivore-placement experiments. Identity of ant associate changed predictably over plant ontogeny. Pheidole megacephala was restricted to very small plants; saplings were occupied by either Oecophylla longinoda or Crematogaster sp., and the latter species was the sole occupant of larger trees. Damage by caterpillars of the nymphalid butterfly Acraea zetes accounted for much of the herbivory to leaves. Ant species differed in the protection provided to hosts. While P. megacephala provided no significant protection, plants occupied by O. longinoda and Crematogaster sp. suffered less damage than did unoccupied plants or those occupied by P. megacephala. Furthermore, O. longinoda provided more effective protection than did Crematogaster sp. Herbivore-placement experiments confirmed these results. Workers of O. longinoda killed or removed all larval instars of A. zetes. Crematogaster preyed on only the two first larval instars, and P. megacephala preyed mainly on eggs, only rarely attacking the two first larval instars. Opportunistic ants provided significant protection to this relatively unspecialised myrmecophyte. The usual associate of mature trees was not the species that provided most protection.

  14. Structural and functional diversity of CLAVATA3/ESR (CLE)-like genes from the potato cyst nematode Globodera rostochiensis.

    Science.gov (United States)

    Lu, Shun-Wen; Chen, Shiyan; Wang, Jianying; Yu, Hang; Chronis, Demosthenis; Mitchum, Melissa G; Wang, Xiaohong

    2009-09-01

    Plant CLAVATA3/ESR-related (CLE) peptides have diverse roles in plant growth and development. Here, we report the isolation and functional characterization of five new CLE genes from the potato cyst nematode Globodera rostochiensis. Unlike typical plant CLE peptides that contain a single CLE motif, four of the five Gr-CLE genes encode CLE proteins with multiple CLE motifs. These Gr-CLE genes were found to be specifically expressed within the dorsal esophageal gland cell of nematode parasitic stages, suggesting a role for their encoded proteins in plant parasitism. Overexpression phenotypes of Gr-CLE genes in Arabidopsis mimicked those of plant CLE genes, and Gr-CLE proteins could rescue the Arabidopsis clv3-2 mutant phenotype when expressed within meristems. A short root phenotype was observed when synthetic GrCLE peptides were exogenously applied to roots of Arabidopsis or potato similar to the overexpression of Gr-CLE genes in Arabidopsis and potato hairy roots. These results reveal that G. rostochiensis CLE proteins with either single or multiple CLE motifs function similarly to plant CLE proteins and that CLE signaling components are conserved in both Arabidopsis and potato roots. Furthermore, our results provide evidence to suggest that the evolution of multiple CLE motifs may be an important mechanism for generating functional diversity in nematode CLE proteins to facilitate parasitism.

  15. Plant-ants use symbiotic fungi as a food source: new insight into the nutritional ecology of ant-plant interactions.

    Science.gov (United States)

    Blatrix, Rumsaïs; Djiéto-Lordon, Champlain; Mondolot, Laurence; La Fisca, Philippe; Voglmayr, Hermann; McKey, Doyle

    2012-10-07

    Usually studied as pairwise interactions, mutualisms often involve networks of interacting species. Numerous tropical arboreal ants are specialist inhabitants of myrmecophytes (plants bearing domatia, i.e. hollow structures specialized to host ants) and are thought to rely almost exclusively on resources derived from the host plant. Recent studies, following up on century-old reports, have shown that fungi of the ascomycete order Chaetothyriales live in symbiosis with plant-ants within domatia. We tested the hypothesis that ants use domatia-inhabiting fungi as food in three ant-plant symbioses: Petalomyrmex phylax/Leonardoxa africana, Tetraponera aethiops/Barteria fistulosa and Pseudomyrmex penetrator/Tachigali sp. Labelling domatia fungal patches in the field with either a fluorescent dye or (15)N showed that larvae ingested domatia fungi. Furthermore, when the natural fungal patch was replaced with a piece of a (15)N-labelled pure culture of either of two Chaetothyriales strains isolated from T. aethiops colonies, these fungi were also consumed. These two fungi often co-occur in the same ant colony. Interestingly, T. aethiops workers and larvae ingested preferentially one of the two strains. Our results add a new piece in the puzzle of the nutritional ecology of plant-ants.

  16. Pheromone disruption of Argentine ant trail integrity

    Science.gov (United States)

    Suckling, D.M.; Peck, R.W.; Manning, L.M.; Stringer, L.D.; Cappadonna, J.; El-Sayed, A. M.

    2008-01-01

    Disruption of Argentine ant trail following and reduced ability to forage (measured by bait location success) was achieved after presentation of an oversupply of trail pheromone, (Z)-9-hexadecenal. Experiments tested single pheromone point sources and dispersion of a formulation in small field plots. Ant walking behavior was recorded and digitized by using video tracking, before and after presentation of trail pheromone. Ants showed changes in three parameters within seconds of treatment: (1) Ants on trails normally showed a unimodal frequency distribution of walking track angles, but this pattern disappeared after presentation of the trail pheromone; (2) ants showed initial high trail integrity on a range of untreated substrates from painted walls to wooden or concrete floors, but this was significantly reduced following presentation of a point source of pheromone; (3) the number of ants in the pheromone-treated area increased over time, as recruitment apparently exceeded departures. To test trail disruption in small outdoor plots, the trail pheromone was formulated with carnuba wax-coated quartz laboratory sand (1 g quartz sand/0.2 g wax/1 mg pheromone). The pheromone formulation, with a half-life of 30 h, was applied by rotary spreader at four rates (0, 2.5, 7.5, and 25 mg pheromone/m2) to 1- and 4-m2 plots in Volcanoes National Park, Hawaii. Ant counts at bait cards in treated plots were significantly reduced compared to controls on the day of treatment, and there was a significant reduction in ant foraging for 2 days. These results show that trail pheromone disruption of Argentine ants is possible, but a much more durable formulation is needed before nest-level impacts can be expected. ?? 2008 Springer Science+Business Media, LLC.

  17. Congestion and communication in confined ant traffic

    Science.gov (United States)

    Gravish, Nick; Gold, Gregory; Zangwill, Andrew; Goodisman, Michael A. D.; Goldman, Daniel I.

    2014-03-01

    Many social animals move and communicate within confined spaces. In subterranean fire ants Solenopsis invicta, mobility within crowded nest tunnels is important for resource and information transport. Within confined tunnels, communication and traffic flow are at odds: trafficking ants communicate through tactile interactions while stopped, yet ants that stop to communicate impose physical obstacles on the traffic. We monitor the bi-directional flow of fire ant workers in laboratory tunnels of varied diameter D. The persistence time of communicating ant aggregations, τ, increases approximately linearly with the number of participating ants, n. The sensitivity of traffic flow increases as D decreases and diverges at a minimum diameter, Dc. A cellular automata model incorporating minimal traffic features--excluded volume and communication duration--reproduces features of the experiment. From the model we identify a competition between information transfer and the need to maintain jam-free traffic flow. We show that by balancing information transfer and traffic flow demands, an optimum group strategy exists which maximizes information throughput. We acknowledge funding from NSF PoLS #0957659 and #PHY-1205878.

  18. Selenium exposure results in reduced reproduction in an invasive ant species and altered competitive behavior for a native ant species

    International Nuclear Information System (INIS)

    De La Riva, Deborah G.; Trumble, John T.

    2016-01-01

    Competitive ability and numerical dominance are important factors contributing to the ability of invasive ant species to establish and expand their ranges in new habitats. However, few studies have investigated the impact of environmental contamination on competitive behavior in ants as a potential factor influencing dynamics between invasive and native ant species. Here we investigated the widespread contaminant selenium to investigate its potential influence on invasion by the exotic Argentine ant, Linepithema humile, through effects on reproduction and competitive behavior. For the fecundity experiment, treatments were provided to Argentine ant colonies via to sugar water solutions containing one of three concentrations of selenium (0, 5 and 10 μg Se mL −1 ) that fall within the range found in soil and plants growing in contaminated areas. Competition experiments included both the Argentine ant and the native Dorymyrmex bicolor to determine the impact of selenium exposure (0 or 15 μg Se mL −1 ) on exploitation- and interference-competition between ant species. The results of the fecundity experiment revealed that selenium negatively impacted queen survival and brood production of Argentine ants. Viability of the developing brood was also affected in that offspring reached adulthood only in colonies that were not given selenium, whereas those in treated colonies died in their larval stages. Selenium exposure did not alter direct competitive behaviors for either species, but selenium exposure contributed to an increased bait discovery time for D. bicolor. Our results suggest that environmental toxins may not only pose problems for native ant species, but may also serve as a potential obstacle for establishment among exotic species. - Highlights: • Argentine ant colonies exposed to selenium had reduced fecundity compared to unexposed colonies. • Viability of offspring was negatively impacted by selenium. • Queen survival was reduced in colonies

  19. Improved Ant Colony Clustering Algorithm and Its Performance Study

    Science.gov (United States)

    Gao, Wei

    2016-01-01

    Clustering analysis is used in many disciplines and applications; it is an important tool that descriptively identifies homogeneous groups of objects based on attribute values. The ant colony clustering algorithm is a swarm-intelligent method used for clustering problems that is inspired by the behavior of ant colonies that cluster their corpses and sort their larvae. A new abstraction ant colony clustering algorithm using a data combination mechanism is proposed to improve the computational efficiency and accuracy of the ant colony clustering algorithm. The abstraction ant colony clustering algorithm is used to cluster benchmark problems, and its performance is compared with the ant colony clustering algorithm and other methods used in existing literature. Based on similar computational difficulties and complexities, the results show that the abstraction ant colony clustering algorithm produces results that are not only more accurate but also more efficiently determined than the ant colony clustering algorithm and the other methods. Thus, the abstraction ant colony clustering algorithm can be used for efficient multivariate data clustering. PMID:26839533

  20. Current and potential ant impacts in the Pacific region

    Science.gov (United States)

    Loope, Lloyd L.; Krushelnycky, Paul D.

    2007-01-01

    Worldwide, ants are a powerful ecological force, and they appear to be dominant components of animal communities of many tropical and temperate ecosystems in terms of biomass and numbers of individuals (Bluthgen et al. 2000). For example, ants comprise up to 94% of arthropod individuals in fogging samples taken from diverse lowland tropical rainforest canopies, and 86% of the biomass (Davidson et al. 2003). The majority of these ant species and individuals obtain carbohydrates either from extrafloral nectaries or from sap-feeding Hemiptera that pass carbohydrate-rich “honeydew” to attending ants while concentrating nitrogen (N) from N-poor plant sap (Davidson et al. 2003). Honeydew and nectar represent key resources for arboreal ant species, although most ant species are at least partly carnivorous or scavengers (Bluthgen et al. 2004). In contrast to most of the terrestrial world, the biotas of many Pacific islands evolved without ants. Whereas endemic ant species are found in New Zealand (ca. 10 spp.), Tonga (ca. 10 spp.), and Samoa (ca. 12 spp.), other islands of Polynesia and parts of Micronesia likely lack native ants (Wilson and Taylor 1967, Wetterer 2002, Wetterer and Vargo 2003). About 20 Indo-Australian and western Pacific ant species range to the east and north of Samoa, but it is unclear how many of these were transported there by humans at some time (Wilson and Taylor 1967). Most of the remainder of the ant species currently found on Pacific islands are widespread species that fall in the category of “tramp species,” dispersed by recent human commerce and generally closely tied to human activity and urban areas (Wilson and Taylor 1967, McGlynn 1999). In Pacific island situations, some of these tramp ant species are able to thrive beyond areas of human activity. Relatively few ant species have been successful invaders of native communities on continents, and these include most of the species that pose the greatest problems for Pacific islands

  1. Oecophylla smaragdina food conversion efficiency: prospects for ant farming

    DEFF Research Database (Denmark)

    Offenberg, Hans Joachim

    2011-01-01

    can be combined with the use of the ants in biological control programmes in tropical plantations where pest insects are converted into ant biomass. To assess the cost-benefits of ant farming based on artificial feeding, food consumption and food conversion efficiency (ECI) of Oecophylla smaragdina......Oecophylla ants are sold at high prices on several commercial markets as a human delicacy, as pet food or as traditional medicine. Currently markets are supplied by ants collected from the wild; however, an increasing interest in ant farming exists as all harvest is easily sold and as ant farming...... selling prices these efficiencies led to rates of return from 1.52 to 4.56, respectively, if: (i) protein is supplied from commercial products; or (ii) alternatively supplied from free sources such as insects and kitchen waste. These results suggest that Oecophylla ant farming may become highly profitable...

  2. A cellular automata model for ant trails

    Indian Academy of Sciences (India)

    In this study, the unidirectional ant traffic flow with U-turn in an ant trail was investigated using one-dimensional cellular automata model. It is known that ants communicate with each other by dropping a chemical, called pheromone, on the substrate. Apart from the studies in the literature, it was considered in the model that ...

  3. Ant-Related Oviposition and Larval Performance in a Myrmecophilous Lycaenid

    Directory of Open Access Journals (Sweden)

    Matthew D. Trager

    2013-01-01

    Full Text Available We experimentally assessed ant-related oviposition and larval performance in the Miami blue butterfly (Cyclargus thomasi bethunebakeri. Ant tending had sex-dependent effects on most measures of larval growth: female larvae generally benefitted from increased tending frequency whereas male larvae were usually unaffected. The larger size of female larvae tended by ants resulted in a substantial predicted increase in lifetime egg production. Oviposition by adult females that were tended by C. floridanus ants as larvae was similar between host plants with or without ants. However, they laid relatively more eggs on plants with ants than did females raised without ants, which laid less than a third of their eggs on plants with ants present. In summary, we found conditional benefits for larvae tended by ants that were not accompanied by oviposition preference for plants with ants present, which is a reasonable result for a system in which ant presence at the time of oviposition is not a reliable indicator of future ant presence. More broadly, our results emphasize the importance of considering the consequences of variation in interspecific interactions, life history traits, and multiple measures of performance when evaluating the costs and benefits of mutualistic relationships.

  4. Ants as tools in sustainable agriculture

    DEFF Research Database (Denmark)

    Offenberg, Joachim

    2015-01-01

    1. With an expanding human population placing increasing pressure on the environment, agriculture needs sustainable production that can match conventional methods. Integrated pest management (IPM) is more sustainable, but not necessarily as efficient as conventional non-sustainable measures. 2...... in multiple crops. Their efficiency is comparable to chemical pesticides or higher, while at lower costs. They provide a rare example of documented efficient conservation biological control. 3. Weaver ants share beneficial traits with almost 13 000 other ant species and are unlikely to be unique...... of agricultural systems, this review emphasizes the potential of managing ants to achieve sustainable pest management solutions. The synthesis suggests future directions and may catalyse a research agenda on the utilization of ants, not only against arthropod pests, but also against weeds and plant diseases...

  5. ADAPTIVE ANT COLONY OPTIMIZATION BASED GRADIENT FOR EDGE DETECTION

    Directory of Open Access Journals (Sweden)

    Febri Liantoni

    2014-08-01

    Full Text Available Ant Colony Optimization (ACO is a nature-inspired optimization algorithm which is motivated by ants foraging behavior. Due to its favorable advantages, ACO has been widely used to solve several NP-hard problems, including edge detection. Since ACO initially distributes ants at random, it may cause imbalance ant distribution which later affects path discovery process. In this paper an adaptive ACO is proposed to optimize edge detection by adaptively distributing ant according to gradient analysis. Ants are adaptively distributed according to gradient ratio of each image regions. Region which has bigger gradient ratio, will have bigger number of ant distribution. Experiments are conducted using images from various datasets. Precision and recall are used to quantitatively evaluate performance of the proposed algorithm. Precision and recall of adaptive ACO reaches 76.98 % and 96.8 %. Whereas highest precision and recall for standard ACO are 69.74 % and 74.85 %. Experimental results show that the adaptive ACO outperforms standard ACO which randomly distributes ants.

  6. Fungal Adaptations to Mutualistic Life with Ants

    DEFF Research Database (Denmark)

    Kooij, Pepijn Wilhelmus

    Fungus-growing ants (Attini) feed off a fungus they cultivate in a mutualistic symbiosis in underground chambers by providing it substrate they collect outside the colony. The tribe of Attine ants ranges from small colonies of the paleo- and basal Attine species with a few hundred workers that fo...... that the fungus evolved some incredible adaptations to a mutualistic life with the ants....

  7. Fast and flexible: argentine ants recruit from nearby trails.

    Science.gov (United States)

    Flanagan, Tatiana P; Pinter-Wollman, Noa M; Moses, Melanie E; Gordon, Deborah M

    2013-01-01

    Argentine ants (Linepithema humile) live in groups of nests connected by trails to each other and to stable food sources. In a field study, we investigated whether some ants recruit directly from established, persistent trails to food sources, thus accelerating food collection. Our results indicate that Argentine ants recruit nestmates to food directly from persistent trails, and that the exponential increase in the arrival rate of ants at baits is faster than would be possible if recruited ants traveled from distant nests. Once ants find a new food source, they walk back and forth between the bait and sometimes share food by trophallaxis with nestmates on the trail. Recruiting ants from nearby persistent trails creates a dynamic circuit, like those found in other distributed systems, which facilitates a quick response to changes in available resources.

  8. Hey! A Fire Ant Stung Me!

    Science.gov (United States)

    ... Videos for Educators Search English Español Hey! A Fire Ant Stung Me! KidsHealth / For Kids / Hey! A ... Me picó una roja o colorada! What's a Fire Ant? There are many different types of fire ...

  9. Fast and flexible: argentine ants recruit from nearby trails.

    Directory of Open Access Journals (Sweden)

    Tatiana P Flanagan

    Full Text Available Argentine ants (Linepithema humile live in groups of nests connected by trails to each other and to stable food sources. In a field study, we investigated whether some ants recruit directly from established, persistent trails to food sources, thus accelerating food collection. Our results indicate that Argentine ants recruit nestmates to food directly from persistent trails, and that the exponential increase in the arrival rate of ants at baits is faster than would be possible if recruited ants traveled from distant nests. Once ants find a new food source, they walk back and forth between the bait and sometimes share food by trophallaxis with nestmates on the trail. Recruiting ants from nearby persistent trails creates a dynamic circuit, like those found in other distributed systems, which facilitates a quick response to changes in available resources.

  10. Cryptococcus neoformans carried by Odontomachus bauri ants

    Directory of Open Access Journals (Sweden)

    Mariana Santos de Jesus

    2012-06-01

    Full Text Available Cryptococcus neoformans is the most common causative agent of cryptococcosis worldwide. Although this fungus has been isolated from a variety of organic substrates, several studies suggest that hollow trees constitute an important natural niche for C. neoformans. A previously surveyed hollow of a living pink shower tree (Cassia grandis positive for C. neoformans in the city of Rio de Janeiro, Brazil, was chosen for further investigation. Odontomachus bauri ants (trap-jaw ants found inside the hollow were collected for evaluation as possible carriers of Cryptococcus spp. Two out of 10 ants were found to carry phenoloxidase-positive colonies identified as C. neoformans molecular types VNI and VNII. The ants may have acted as a mechanical vector of C. neoformans and possibly contributed to the dispersal of the fungi from one substrate to another. To the best of our knowledge, this is the first report on the association of C. neoformans with ants of the genus Odontomachus.

  11. [Ants as carriers of microorganisms in hospital environments].

    Science.gov (United States)

    Pereira, Rogério Dos Santos; Ueno, Mariko

    2008-01-01

    Concern exists regarding the real possibility of public health threats caused by pathogenic agents that are carried by urban ants. The present study had the objective of isolating and identifying the microorganisms that are associated with ants in hospital environments. One hundred and twenty-five ants of the same species were collected from different units of a university hospital. Each ant was collected using a swab soaked with physiological solution and was transferred to a tube containing brain heart infusion broth and incubated at 35 degrees C for 24 hours. From each tube, with growth, inoculations were made into specific culturing media, to isolate any microorganisms. The ants presented a high capacity for carrying microorganism groups: spore-producing Gram-positive bacilli 63.5%, Gram-negative bacilli 6.3%, Gram-positive cocci 23.1%, filamentous fungi 6.7% and yeast 0.5%. Thus, it can be inferred that ants may be one of the agents responsible for disseminating microorganisms in hospital environments.

  12. Cuando dialogan dos Antígonas: La tumba de Antígona de María Zambrano y Antígona furiosa de Griselda Gambaro

    Directory of Open Access Journals (Sweden)

    Rose Duroux

    2012-08-01

    Full Text Available Antígona ha sido un tópico por más de 2.000 años, participando de una historia que siempre puede ser reconocida. Tanto la Guerra Civil española como la dictadura argentina vieron surgir Antígonas en busca de justicia. A partir de los trabajos de María Zambrano y Griselda Gambaro, este artículo busca rehabilitar discursivamente estas versiones. Por un lado, la filósofa española nunca regresó del exilio iniciado en 1939 y defendió hasta el final los valores republicanos. Cuando asumió que su expatriación era irreversible, ingresó en un exilio profundo del cual Antígona revela lo esencial, pasando de la "privación" a la "revelación" tanto en un modo filosófico como en el poético, tanto en sus ensayos como en su única pieza teatral, La Tumba de Antígona [1967], una significativa metáfora de la guerra fratricida y del exilio. Por otro, Antígona furiosa [1986] de Gambaro, reescribe la tragedia de Sófocles cuando denuncia el terrorismo de estado argentino en una furiosa Antígona. Gambaro, hermana y madre de desaparecidos de la guerra sucia eleva su grito por justicia en nombre de la fraternidad humanaAntigone has been a topical figure for more than 2,000 years. She plays a part in a story that one can always identify. Spanish Civil War and Argentine dictatorship saw the birth of many Antigones seeking justice. Starting from the M. Zambrano and G. Gambaro's creations, this work rehabilitates the speech and the incarnations of the Iberian and Ibero-american Antigone. On the one hand, Spanish philosopher María Zambrano never came out of the exodus which began in 1939, and she defended the values of the Republic all the way. Once she acknowledged that expatriation was irreversible, she entered a profound exile of which Antigone reveals the essence, going from "deprivation" to "revelation" in a philosophical as well as a poetical manner, both in her essays and in her unique play, La Tumba de Antígona [1967], a striking metaphor

  13. Predaceous ants, beach replenishment, and nest placement by sea turtles.

    Science.gov (United States)

    Wetterer, James K; Wood, Lawrence D; Johnson, Chris; Krahe, Holly; Fitchett, Stephanie

    2007-10-01

    Ants known for attacking and killing hatchling birds and reptiles include the red imported fire ant (Solenopsis invicta Buren), tropical fire ant [Solenopsis geminata (Fabr.)], and little fire ant [Wasmannia auropunctata (Roger)]. We tested whether sea turtle nest placement influenced exposure to predaceous ants. In 2000 and 2001, we surveyed ants along a Florida beach where green turtles (Chelonia mydas L.), leatherbacks (Dermochelys coriacea Vandelli), and loggerheads (Caretta caretta L.) nest. Part of the beach was artificially replenished between our two surveys. As a result, mean beach width experienced by nesting turtles differed greatly between the two nesting seasons. We surveyed 1,548 sea turtle nests (2000: 909 nests; 2001: 639 nests) and found 22 ant species. S. invicta was by far the most common species (on 431 nests); S. geminata and W. auropunctata were uncommon (on 3 and 16 nests, respectively). In 2000, 62.5% of nests had ants present (35.9% with S. invicta), but in 2001, only 30.5% of the nests had ants present (16.4% with S. invicta). Turtle nests closer to dune vegetation had significantly greater exposure to ants. Differences in ant presence on turtle nests between years and among turtle species were closely related to differences in nest placement relative to dune vegetation. Beach replenishment significantly lowered exposure of nests to ants because on the wider beaches turtles nested farther from the dune vegetation. Selective pressures on nesting sea turtles are altered both by the presence of predaceous ants and the practice of beach replenishment.

  14. Studies on the environmental implications of ants (Hymenoptera ...

    African Journals Online (AJOL)

    A study of ants associated wh two synanthropcenvironments in Awka was carried out in 2008 using pitfall and bait traps. The study yelded a total of 561 ants wth 409 obtaned from the hemisynanthrophic environment while 192 ants were collected from the endophilic environment. The percentage occurrence, total dstribution ...

  15. Tracing the rise of ants - out of the ground.

    Directory of Open Access Journals (Sweden)

    Andrea Lucky

    Full Text Available The evolution of ants (Hymenoptera: Formicidae is increasingly well-understood due to recent phylogenetic analyses, along with estimates of divergence times and diversification rates. Yet, leading hypotheses regarding the ancestral habitat of ants conflict with new findings that early ant lineages are cryptic and subterranean. Where the ants evolved, in respect to habitat, and how habitat shifts took place over time have not been formally tested. Here, we reconstruct the habitat transitions of crown-group ants through time, focusing on where they nest and forage (in the canopy, litter, or soil. Based on ancestral character reconstructions, we show that in contrast to the current consensus based on verbal arguments that ants evolved in tropical leaf litter, the soil is supported as the ancestral stratum of all ants. We also find subsequent movements up into the litter and, in some cases, into the canopy. Given the global importance of ants, because of their diversity, ecological influence and status as the most successful eusocial lineage on Earth, understanding the early evolution of this lineage provides insight into the factors that made this group so successful today.

  16. Insecticide transfer efficiency and lethal load in Argentine ants

    Energy Technology Data Exchange (ETDEWEB)

    Hooper-Bui, L.M. [Department of Environmental Science, Louisiana State University, Baton Rouge, LA 70803 (United States); Department of Entomology, University of California, Riverside, CA 92521 (United States); Kwok, E.S.C. [Department of Cell Biology and Neuroscience, University of California, Riverside, CA 92521 (United States); Buchholz, B.A., E-mail: buchholz2@llnl.gov [Center for Accelerator Mass Spectrometry, Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Department of Environmental Toxicology, University of California, Davis, CA 95616 (United States); Rust, M.K. [Department of Entomology, University of California, Riverside, CA 92521 (United States); Eastmond, D.A. [Department of Cell Biology and Neuroscience, University of California, Riverside, CA 92521 (United States); Vogel, J.S. [Center for Accelerator Mass Spectrometry, Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States)

    2015-10-15

    Trophallaxis between individual worker ants and the toxicant load in dead and live Argentine ants (Linepithema humile) in colonies exposed to fipronil and hydramethylnon experimental baits were examined using accelerator mass spectrometry (AMS). About 50% of the content of the crop containing trace levels of {sup 14}C-sucrose, {sup 14}C-hydramethylnon, and {sup 14}C-fipronil was shared between single donor and recipient ants. Dead workers and queens contained significantly more hydramethylnon (122.7 and 22.4 amol/μg ant, respectively) than did live workers and queens (96.3 and 10.4 amol/μg ant, respectively). Dead workers had significantly more fipronil (420.3 amol/μg ant) than did live workers (208.5 amol/μg ant), but dead and live queens had equal fipronil levels (59.5 and 54.3 amol/μg ant, respectively). The distribution of fipronil differed within the bodies of dead and live queens; the highest amounts of fipronil were recovered in the thorax of dead queens whereas live queens had the highest levels in the head. Resurgence of polygynous ant colonies treated with hydramethylnon baits may be explained by queen survival resulting from sublethal doses due to a slowing of trophallaxis throughout the colony. Bait strategies and dose levels for controlling insect pests need to be based on the specific toxicant properties and trophic strategies for targeting the entire colony.

  17. Insecticide transfer efficiency and lethal load in Argentine ants

    International Nuclear Information System (INIS)

    Hooper-Bui, L.M.; Kwok, E.S.C.; Buchholz, B.A.; Rust, M.K.; Eastmond, D.A.; Vogel, J.S.

    2015-01-01

    Trophallaxis between individual worker ants and the toxicant load in dead and live Argentine ants (Linepithema humile) in colonies exposed to fipronil and hydramethylnon experimental baits were examined using accelerator mass spectrometry (AMS). About 50% of the content of the crop containing trace levels of 14 C-sucrose, 14 C-hydramethylnon, and 14 C-fipronil was shared between single donor and recipient ants. Dead workers and queens contained significantly more hydramethylnon (122.7 and 22.4 amol/μg ant, respectively) than did live workers and queens (96.3 and 10.4 amol/μg ant, respectively). Dead workers had significantly more fipronil (420.3 amol/μg ant) than did live workers (208.5 amol/μg ant), but dead and live queens had equal fipronil levels (59.5 and 54.3 amol/μg ant, respectively). The distribution of fipronil differed within the bodies of dead and live queens; the highest amounts of fipronil were recovered in the thorax of dead queens whereas live queens had the highest levels in the head. Resurgence of polygynous ant colonies treated with hydramethylnon baits may be explained by queen survival resulting from sublethal doses due to a slowing of trophallaxis throughout the colony. Bait strategies and dose levels for controlling insect pests need to be based on the specific toxicant properties and trophic strategies for targeting the entire colony.

  18. The Pied Piper: A Parasitic Beetle's Melodies Modulate Ant Behaviours.

    Directory of Open Access Journals (Sweden)

    Andrea Di Giulio

    Full Text Available Ants use various communication channels to regulate their social organisation. The main channel that drives almost all the ants' activities and behaviours is the chemical one, but it is long acknowledged that the acoustic channel also plays an important role. However, very little is known regarding exploitation of the acoustical channel by myrmecophile parasites to infiltrate the ant society. Among social parasites, the ant nest beetles (Paussus are obligate myrmecophiles able to move throughout the colony at will and prey on the ants, surprisingly never eliciting aggression from the colonies. It has been recently postulated that stridulatory organs in Paussus might be evolved as an acoustic mechanism to interact with ants. Here, we survey the role of acoustic signals employed in the Paussus beetle-Pheidole ant system. Ants parasitised by Paussus beetles produce caste-specific stridulations. We found that Paussus can "speak" three different "languages", each similar to sounds produced by different ant castes (workers, soldiers, queen. Playback experiments were used to test how host ants respond to the sounds emitted by Paussus. Our data suggest that, by mimicking the stridulations of the queen, Paussus is able to dupe the workers of its host and to be treated as royalty. This is the first report of acoustic mimicry in a beetle parasite of ants.

  19. Ant species confer different partner benefits on two neotropical myrmecophytes.

    Science.gov (United States)

    Frederickson, Megan E

    2005-04-01

    The dynamics of mutualistic interactions involving more than a single pair of species depend on the relative costs and benefits of interaction among alternative partners. The neotropical myrmecophytes Cordia nodosa and Duroia hirsuta associate with several species of obligately symbiotic ants. I compared the ant partners of Cordia and Duroia with respect to two benefits known to be important in ant-myrmecophyte interactions: protection against herbivores provided by ants, and protection against encroaching vegetation provided by ants. Azteca spp., Myrmelachista schumanni, and Allomerus octoarticulatus demerarae ants all provide the leaves of Cordia and Duroia some protection against herbivores. However, Azteca and Allomerus provide more protection than does Myrmelachista to the leaves of their host plants. Although Allomerus protects the leaves of its hosts, plants occupied by Allomerus suffer more attacks by herbivores to their stems than do plants occupied by other ants. Relative to Azteca or Allomerus, Myrmelachista ants provide better protection against encroaching vegetation, increasing canopy openness over their host plants. These differences in benefits among the ant partners of Cordia and Duroia are reflected in the effect of each ant species on host plant size, growth rate, and reproduction. The results of this study show how mutualistic ant partners can differ with respect to both the magnitude and type of benefits they provide to the same species of myrmecophytic host.

  20. Life-Histories of Sub-Arctic Ants

    OpenAIRE

    Heinze, Jürgen

    1993-01-01

    Ant species belonging to seven genera occur in habitats near the tree line in the Northern Hemisphere. An analysis of colony founding strategies suggests that in addition to physiological cold resistance, behavioral and sociometric adaptations might be important for survival and propagation of ants in subarctic biomes.

  1. Edge detection in digital images using Ant Colony Optimization

    Directory of Open Access Journals (Sweden)

    Marjan Kuchaki Rafsanjani

    2015-11-01

    Full Text Available Ant Colony Optimization (ACO is an optimization algorithm inspired by the behavior of real ant colonies to approximate the solutions of difficult optimization problems. In this paper, ACO is introduced to tackle the image edge detection problem. The proposed approach is based on the distribution of ants on an image; ants try to find possible edges by using a state transition function. Experimental results show that the proposed method compared to standard edge detectors is less sensitive to Gaussian noise and gives finer details and thinner edges when compared to earlier ant-based approaches.

  2. Stealthy invaders: the biology of Cardiocondyla tramp ants

    DEFF Research Database (Denmark)

    Heinze, J.; Cremer, Sylvia; Eckl, N.

    2006-01-01

    Many invasive ant species, such as the Argentine ant or the red imported fire ant, have huge colonies with thousands of mass-foraging workers, which quickly monopolise resources and therefore represent a considerable threat to the native ant fauna. Cardiocondyla obscurior and several other specie...

  3. The AINTEGUMENTA genes, MdANT1 and MdANT2, are associated with the regulation of cell production during fruit growth in apple (Malus × domestica Borkh.).

    Science.gov (United States)

    Dash, Madhumita; Malladi, Anish

    2012-06-25

    Fruit growth in apple (Malus × domestica Borkh.) is mediated by cell production and expansion. Genes involved in regulating these processes and thereby fruit growth, are not well characterized. We hypothesized that the apple homolog(s) of AINTEGUMENTA (ANT), an APETALA2-repeat containing transcription factor, regulates cell production during fruit growth in apple. Two ANT genes, MdANT1 and MdANT2, were isolated from apple and their expression was studied during multiple stages of fruit development. MdANT1 and MdANT2 expression was high during early fruit growth coincident with the period of cell production, rapidly declined during exit from cell production, and remained low during the rest of fruit development. The effects of increase in carbohydrate availability during fruit growth were characterized. Increase in carbohydrate availability enhanced fruit growth largely through an increase in cell production. Expression of MdANT1 and MdANT2 increased sharply by up to around 5-fold in response to an increase in carbohydrate availability. Expression of the ANT genes was compared across two apple genotypes, 'Gala' and 'Golden Delicious Smoothee' (GS), which differ in the extent of fruit growth, largely due to differences in cell production. In comparison to 'Gala', the larger fruit-size genotype, GS, displayed higher levels and a longer duration of MdANT1 and MdANT2 expression. Expression of the ANTs and cell cycle genes in the fruit core and cortex tissues isolated using laser capture microdissection was studied. During early fruit growth, expression of the MdANTs was higher within the cortex, the tissue that constitutes the majority of the fruit. Additionally, MdANT1 and MdANT2 expression was positively correlated with that of A- and B-type CYCLINS, B-type CYCLIN-DEPENDENT-KINASES (CDKBs) and MdDEL1. Multiple lines of evidence from this study suggest that MdANT1 and MdANT2 regulate cell production during fruit growth in apple. ANTs may coordinate the expression of

  4. Current issues in the evolutionary ecology of ant-plant symbioses.

    Science.gov (United States)

    Mayer, Veronika E; Frederickson, Megan E; McKey, Doyle; Blatrix, Rumsaïs

    2014-05-01

    Ant-plant symbioses involve plants that provide hollow structures specialized for housing ants and often food to ants. In return, the inhabiting ants protect plants against herbivores and sometimes provide them with nutrients. Here, we review recent advances in ant-plant symbioses, focusing on three areas. First, the nutritional ecology of plant-ants, which is based not only on plant-derived food rewards, but also on inputs from other symbiotic partners, in particular fungi and possibly bacteria. Food and protection are the most important 'currencies' exchanged between partners and they drive the nature and evolution of the relationships. Secondly, studies of conflict and cooperation in ant-plant symbioses have contributed key insights into the evolution and maintenance of mutualism, particularly how partner-mediated feedbacks affect the specificity and stability of mutualisms. There is little evidence that mutualistic ants or plants are under selection to cheat, but the costs and benefits of ant-plant interactions do vary with environmental factors, making them vulnerable to natural or anthropogenic environmental change. Thus, thirdly, ant-plant symbioses should be considered good models for investigating the effects of global change on the outcome of mutualistic interactions. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.

  5. The use of weaver ants (Oecophylla spp.) in tropical agriculture

    DEFF Research Database (Denmark)

    Offenberg, Hans Joachim

    2011-01-01

    by the consumed pest insects, can be harvested and utilised for nutrition as they are tasty and high in proteins, vitamins and minerals. Thus, plantations may function as ant farms and in addition to plant production also hosts the production of edible animal protein. In this setup harmful pest insects are turned...... farming as a way forward to solve an increasing future demand for protein. Weaver ant farming may build on natural food collected by the ants or alternatively be boosted by feeding the ant colonies actively with protein and sugar. In both cases, when ant biocontrol is combined with ant farming......, the environmental cost of protein production may fall even lower than for other insects as the ants feed on pests that would otherwise reduce the plant yield and since the farming area is simultaneously in use for plant production. In this presentation I provide data showing (i) how the harvest of ants can...

  6. Toxic industrial deposit remediation by ant activity

    Science.gov (United States)

    Jilkova, Veronika; Frouz, Jan

    2016-04-01

    Toxic industrial deposits are often contaminated by heavy metals and the substrates have low pH values. In such systems, soil development is thus slowed down by high toxicity and acidic conditions which are unfavourable to soil fauna. Ants (Hymenoptera, Formicidae) are considered tolerant to heavy metal pollution and are known to increase organic matter content and microbial activity in their nests. Here, we focused on soil remediation caused by three ant species (Formica sanguinea, Lasius niger, and Tetramorium sp.) in an ore-washery sedimentation basin near Chvaletice (Czech Republic). Soil samples were taken from the centre of ant nests and from the nest surroundings (>3 m from nests). Samples were then analyzed for microbial activity and biomass and contents of organic matter and nutrients. As a result, ant species that most influenced soil properties was F. sanguinea as there were higher microbial activity and total nitrogen and ammonia contents in ant nests than in the surrounding soil. We expected such a result because F. sanguinea builds conspicuous large nests and is a carnivorous species that brings substantial amounts of nitrogen in insect prey to their nests. Effects of the other two ant species might be lower because of smaller nests and different feeding habits as they rely mainly on honeydew from aphids or on plant seeds that do not contain much nutrients.

  7. Heat-induced symmetry breaking in ant (Hymenoptera: Formicidae escape behavior.

    Directory of Open Access Journals (Sweden)

    Yuan-Kai Chung

    Full Text Available The collective egress of social insects is important in dangerous situations such as natural disasters or enemy attacks. Some studies have described the phenomenon of symmetry breaking in ants, with two exits induced by a repellent. However, whether symmetry breaking occurs under high temperature conditions, which are a common abiotic stress, remains unknown. In our study, we deposited a group of Polyrhachis dives ants on a heated platform and counted the number of escaping ants with two identical exits. We discovered that ants asymmetrically escaped through two exits when the temperature of the heated platform was >32.75°C. The degree of asymmetry increased linearly with the temperature of the platform. Furthermore, the higher the temperature of heated platform was, the more ants escaped from the heated platform. However, the number of escaping ants decreased for 3 min when the temperature was higher than the critical thermal limit (39.46°C, which is the threshold for ants to endure high temperature without a loss of performance. Moreover, the ants tended to form small groups to escape from the thermal stress. A preparatory formation of ant grouping was observed before they reached the exit, indicating that the ants actively clustered rather than accidentally gathered at the exits to escape. We suggest that a combination of individual and grouping ants may help to optimize the likelihood of survival during evacuation.

  8. Ants Orasest ja Anne Lange monograafiast / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    2005-01-01

    Arvustus: Oras, Ants. Luulekool. I, Apoloogia / koostajad Hando Runnel ja Jaak Rähesoo. Tartu : Ilmamaa, 2003 ; Oras, Ants. Luulekool II, Meistriklass. Tartu : Ilmamaa, 2004 ; Lange, Anne. Ants Oras : [kirjandusteadlane, -kriitik ja tõlkija (1900-1982)]. Tartu : Ilmamaa, 2004

  9. Ant tending influences soldier production in a social aphid.

    Science.gov (United States)

    Shingleton, A W; Foster, W A

    2000-09-22

    The aphid Pseudoregma sundanica (Van der Goot) (Homoptera: Aphididae) has two defence strategies. It is obligatorily tended by various species of ant and also produces sterile soldiers. We investigated how they allocate their investment in these two strategies. We measured the size, number of soldiers, number and species of tending ant, and number and species of predators in P. sundanica populations. We found that the level of ant tending correlated negatively with soldier investment in P. sundanica. The species of tending ant also influenced soldier investment. We excluded ants from aphid populations and recorded changes in population size and structure over four weeks. Ant exclusion led to population decline and extinction. At the same time, surviving populations showed a significant increase in soldier investment. The data demonstrate that social aphids can adjust their investment in soldiers in direct response to environmental change.

  10. Do herbivores eavesdrop on ant chemical communication to avoid predation?

    Directory of Open Access Journals (Sweden)

    David J Gonthier

    Full Text Available Strong effects of predator chemical cues on prey are common in aquatic and marine ecosystems, but are thought to be rare in terrestrial systems and specifically for arthropods. For ants, herbivores are hypothesized to eavesdrop on ant chemical communication and thereby avoid predation or confrontation. Here I tested the effect of ant chemical cues on herbivore choice and herbivory. Using Margaridisa sp. flea beetles and leaves from the host tree (Conostegia xalapensis, I performed paired-leaf choice feeding experiments. Coating leaves with crushed ant liquids (Azteca instabilis, exposing leaves to ant patrolling prior to choice tests (A. instabilis and Camponotus textor and comparing leaves from trees with and without A. instabilis nests resulted in more herbivores and herbivory on control (no ant-treatment relative to ant-treatment leaves. In contrast to A. instabilis and C. textor, leaves previously patrolled by Solenopsis geminata had no difference in beetle number and damage compared to control leaves. Altering the time A. instabilis patrolled treatment leaves prior to choice tests (0-, 5-, 30-, 90-, 180-min. revealed treatment effects were only statistically significant after 90- and 180-min. of prior leaf exposure. This study suggests, for two ecologically important and taxonomically diverse genera (Azteca and Camponotus, ant chemical cues have important effects on herbivores and that these effects may be widespread across the ant family. It suggests that the effect of chemical cues on herbivores may only appear after substantial previous ant activity has occurred on plant tissues. Furthermore, it supports the hypothesis that herbivores use ant chemical communication to avoid predation or confrontation with ants.

  11. Consuming fire ants reduces northern bobwhite survival and weight gain

    Science.gov (United States)

    Myers, P.E.; Allen, Craig R.; Birge, Hannah E.

    2014-01-01

    Northern bobwhite quail, Colinus virginianus (L.) (Galliformes: Odontophoridae), population declines are well documented, but pinpointing the reasons for these decreases has proven elusive. Bobwhite population declines are attributed primarily to loss of habitat and land use changes. This, however, does not entirely explain population declines in areas intensively managed for bobwhites. Although previous research demonstrates the negative impact of red imported fire ant (Solenopsis invicta Buren) (Hymenoptera: Formicidae) on northern bobwhites, the mechanisms underlying this effect are largely unknown. To meet the protein demands of early growth and development, bobwhite chicks predominantly consume small insects, of which ants are a substantial proportion. Fire ants alter ant community dynamics by often reducing native ant diversity and abundance while concurrently increasing the abundance of individuals. Fire ants have negative effects on chicks, but they are also a large potential protein source, making it difficult to disentangle their net effect on bobwhite chicks. To help investigate these effects, we conducted a laboratory experiment to understand (1) whether or not bobwhites consume fire ants, and (2) how the benefits of this consumption compare to the deleterious impacts of bobwhite chick exposure to fire ants. Sixty bobwhite chicks were separated into two groups of 30; one group was provided with starter feed only and the second group was provided with feed and fire ants. Bobwhite chicks were observed feeding on fire ants. Chicks that fed on fire ants had reduced survival and weight gain. Our results show that, while fire ants increase potential food sources for northern bobwhite, their net effect on bobwhite chicks is deleterious. This information will help inform land managers and commercial bobwhite rearing operations.

  12. Extended phenotype: nematodes turn ants into bird-dispersed fruits

    DEFF Research Database (Denmark)

    Hughes, D P; Kronauer, D J C; Boomsma, J J

    2008-01-01

    A recent study has discovered a novel extended phenotype of a nematode which alters its ant host to resemble ripe fruit. The infected ants are in turn eaten by frugivorous birds that disperse the nematode's eggs.......A recent study has discovered a novel extended phenotype of a nematode which alters its ant host to resemble ripe fruit. The infected ants are in turn eaten by frugivorous birds that disperse the nematode's eggs....

  13. Fungal enzymes in the attine ant symbiosis

    DEFF Research Database (Denmark)

    de Fine Licht, Henrik Hjarvard; Schiøtt, Morten; Boomsma, Jacobus Jan

    the more basal attine genera use substrates such as flowers, plant debris, small twigs, insect feces and insect carcasses. This diverse array of fungal substrates across the attine lineage implies that the symbiotic fungus needs different enzymes to break down the plant material that the ants provide...... or different efficiencies of enzyme function. Fungal enzymes that degrade plant cell walls may have functionally co-evolved with the ants in this scenario. We explore this hypothesis with direct measurements of enzyme activity in fungus gardens in 12 species across 8 genera spanning the entire phylogeny...... and diversity of life-styles within the attine clade. We find significant differences in enzyme activity between different genera and life-styles of the ants. How these findings relate to attine ant coevolution and crop optimization are discussed....

  14. The invasive ant, Solenopsis invicta, reduces herpetofauna richness and abundance

    Science.gov (United States)

    Allen, Craig R.; Birge, Hannah E.; Slater, J.; Wiggers, E.

    2017-01-01

    Amphibians and reptiles are declining globally. One potential cause of this decline includes impacts resulting from co-occurrence with non-native red imported fire ant, Solenopsis invicta. Although a growing body of anecdotal and observational evidence from laboratory experiments supports this hypothesis, there remains a lack of field scale manipulations testing the effect of fire ants on reptile and amphibian communities. We addressed this gap by measuring reptile and amphibian (“herpetofauna”) community response to successful fire ant reductions over the course of 2 years following hydramethylnon application to five 100–200 ha plots in southeastern coastal South Carolina. By assessing changes in relative abundance and species richness of herpetofauna in response to fire ant reductions, we were able to assess whether some species were particularly vulnerable to fire ant presence, and whether this sensitivity manifested at the community level. We found that herpetofauna abundance and species richness responded positively to fire ant reductions. Our results document that even moderate populations of red imported fire ants decrease both the abundance and diversity of herpetofauna. Given global herpetofauna population declines and continued spread of fire ants, there is urgency to understand the impacts of fire ants beyond anecdotal and singles species studies. Our results provides the first community level investigation addressing these dynamics, by manipulating fire ant abundance to reveal a response in herpetofauna species abundance and richness.

  15. Red imported fire ant impacts on upland arthropods in Southern Mississippi

    Science.gov (United States)

    Epperson, D.M.; Allen, Craig R.

    2010-01-01

    Red imported fire ants (Solenopsis invicta) have negative impacts on a broad array of invertebrate species. We investigated the impacts of fire ants on the upland arthropod community on 20???40 ha study sites in southern Mississippi. Study sites were sampled from 19972000 before, during, and after fire ant bait treatments to reduce fire ant populations. Fire ant abundance was assessed with bait transects on all sites, and fire ant population indices were estimated on a subset of study sites. Species richness and diversity of other ant species was also assessed from bait transects. Insect biomass and diversity was determined from light trap samples. Following treatments, fire ant abundance and population indices were significantly reduced, and ant species diversity and richness were greater on treated sites. Arthropod biomass, species diversity and species richness estimated from light trap samples were negatively correlated with fire ant abundance, but there were no observable treatment effects. Solenopsis invicta has the potential to negatively impact native arthropod communities resulting in a potential loss of both species and function.

  16. Host ant independent oviposition in the parasitic butterfly Maculinea alcon

    DEFF Research Database (Denmark)

    Fürst, Matthias A; Nash, David Richard

    2010-01-01

    to host-ant nests and non-host-ant nests, and the number and position of eggs attached were assessed. Our results show no evidence for host-ant-based oviposition in M. alcon, but support an oviposition strategy based on plant characteristics. This suggests that careful management of host-ant distribution......Parasitic Maculinea alcon butterflies can only develop in nests of a subset of available Myrmica ant species, so female butterflies have been hypothesized to preferentially lay eggs on plants close to colonies of the correct host ants. Previous correlational investigations of host......-ant-dependent oviposition in this and other Maculinea species have, however, shown equivocal results, leading to a long-term controversy over support for this hypothesis. We therefore conducted a controlled field experiment to study the egg-laying behaviour of M. alcon. Matched potted Gentiana plants were set out close...

  17. What do myrmecophagous geckos eat when ants are not available ...

    African Journals Online (AJOL)

    Like other Pristurus species, P. samhaensis on Samha and P. sokotranus on Socotra were highly myrmecophagous (76.7% and 38.6% ants, respectively). However, ants were absent from the diet of P. samhaensis on Darsa. In contrast to the rich native ant fauna of the other islands, only one ant species was reported for ...

  18. Signals can trump rewards in attracting seed-dispersing ants.

    Directory of Open Access Journals (Sweden)

    Kyle M Turner

    Full Text Available Both rewards and signals are important in mutualisms. In myrmecochory, or seed dispersal by ants, the benefits to plants are relatively well studied, but less is known about why ants pick up and move seeds. We examined seed dispersal by the ant Aphaenogaster rudis of four co-occurring species of plants, and tested whether morphology, chemical signaling, or the nutritional quality of fatty seed appendages called elaiosomes influenced dispersal rates. In removal trials, ants quickly collected diaspores (seeds plus elaiosomes of Asarum canadense, Trillium grandiflorum, and Sanguinaria canadensis, but largely neglected those of T. erectum. This discrepancy was not explained by differences in the bulk cost-benefit ratio, as assessed by the ratio of seed to elaiosome mass. We also provisioned colonies with diaspores from one of these four plant species or no diaspores as a control. Colonies performed best when fed S. canadensis diaspores, worst when fed T. grandiflorum, and intermediately when fed A. canadense, T. erectum, or no diaspores. Thus, the nutritional rewards in elaiosomes affected colony performance, but did not completely predict seed removal. Instead, high levels of oleic acid in T. grandiflorum elaiosomes may explain why ants disperse these diaspores even though they reduce ant colony performance. We show for the first time that different elaiosome-bearing plants provide rewards of different quality to ant colonies, but also that ants appear unable to accurately assess reward quality when encountering seeds. Instead, we suggest that signals can trump rewards as attractants of ants to seeds.

  19. Fuzzy Rules for Ant Based Clustering Algorithm

    Directory of Open Access Journals (Sweden)

    Amira Hamdi

    2016-01-01

    Full Text Available This paper provides a new intelligent technique for semisupervised data clustering problem that combines the Ant System (AS algorithm with the fuzzy c-means (FCM clustering algorithm. Our proposed approach, called F-ASClass algorithm, is a distributed algorithm inspired by foraging behavior observed in ant colonyT. The ability of ants to find the shortest path forms the basis of our proposed approach. In the first step, several colonies of cooperating entities, called artificial ants, are used to find shortest paths in a complete graph that we called graph-data. The number of colonies used in F-ASClass is equal to the number of clusters in dataset. Hence, the partition matrix of dataset founded by artificial ants is given in the second step, to the fuzzy c-means technique in order to assign unclassified objects generated in the first step. The proposed approach is tested on artificial and real datasets, and its performance is compared with those of K-means, K-medoid, and FCM algorithms. Experimental section shows that F-ASClass performs better according to the error rate classification, accuracy, and separation index.

  20. The direct and ecological costs of an ant-plant symbiosis.

    Science.gov (United States)

    Frederickson, Megan E; Ravenscraft, Alison; Miller, Gabriel A; Arcila Hernández, Lina M; Booth, Gregory; Pierce, Naomi E

    2012-06-01

    How strong is selection for cheating in mutualisms? The answer depends on the type and magnitude of the costs of the mutualism. Here we investigated the direct and ecological costs of plant defense by ants in the association between Cordia nodosa, a myrmecophytic plant, and Allomerus octoarticulatus, a phytoecious ant. Cordia nodosa trees produce food and housing to reward ants that protect them against herbivores. For nearly 1 year, we manipulated the presence of A. octoarticulatus ants and most insect herbivores on C. nodosa in a full-factorial experiment. Ants increased plant growth when herbivores were present but decreased plant growth when herbivores were absent, indicating that hosting ants can be costly to plants. However, we did not detect a cost to ant colonies of defending host plants against herbivores. Although this asymmetry in costs suggests that the plants may be under stronger selection than the ants to cheat by withholding investment in their partner, the costs to C. nodosa are probably at least partly ecological, arising because ants tend scale insects on their host plants. We argue that ecological costs should favor resistance or traits other than cheating and thus that neither partner may face much temptation to cheat.

  1. Competitive assembly of South Pacific invasive ant communities

    Directory of Open Access Journals (Sweden)

    Sarty Megan

    2009-01-01

    Full Text Available Abstract Background The relative importance of chance and determinism in structuring ecological communities has been debated for nearly a century. Evidence for determinism or assembly rules is often evaluated with null models that randomize the occurrence of species in particular locales. However, analyses of the presence or absence of species ignores the potential influence of species abundances, which have long been considered of major importance on community structure. Here, we test for community assembly rules in ant communities on small islands of the Tokelau archipelago using both presence-absence and abundance data. We conducted three sets of analyses on two spatial scales using three years of sampling data from 39 plots on 11 islands. Results First, traditional null model tests showed support for negative species co-occurrence patterns among plots within islands, but not among islands. A plausible explanation for this result is that analyses at larger spatial scales merge heterogeneous habitats that have considerable effects on species occurrences. Second, analyses of ant abundances showed that samples with high ant abundances had fewer species than expected by chance, both within and among islands. One ant species, the invasive yellow crazy ant Anoplolepis gracilipes, appeared to have a particularly strong effect on community structure correlated with its abundance. Third, abundances of most ant species were inversely correlated with the abundances of all other ants at both spatial scales. This result is consistent with competition theory, which predicts species distributions are affected by diffuse competition with suites of co-occurring species. Conclusion Our results support a pluralistic explanation for ant species abundances and assembly. Both stochastic and deterministic processes interact to determine ant community assembly, though abundance patterns clearly drive the deterministic patterns in this community. These deterministic

  2. Exploring with PAM: Prospecting ANTS Missions for Solar System Surveys

    Science.gov (United States)

    Clark, P. E.; Rilee, M. L.; Curtis, S. A.

    2003-01-01

    ANTS (Autonomous Nano-Technology Swarm), a large (1000 member) swarm of nano to picoclass (10 to 1 kg) totally autonomous spacecraft, are being developed as a NASA advanced mission concept. ANTS, based on a hierarchical insect social order, use an evolvable, self-similar, hierarchical neural system in which individual spacecraft represent the highest level nodes. ANTS uses swarm intelligence attained through collective, cooperative interactions of the nodes at all levels of the system. At the highest levels this can take the form of cooperative, collective behavior among the individual spacecraft in a very large constellation. The ANTS neural architecture is designed for totally autonomous operation of complex systems including spacecraft constellations. The ANTS (Autonomous Nano Technology Swarm) concept has a number of possible applications. A version of ANTS designed for surveying and determining the resource potential of the asteroid belt, called PAM (Prospecting ANTS Mission), is examined here.

  3. Species diversity and distribution patterns of the ants of Amazonian Ecuador.

    Directory of Open Access Journals (Sweden)

    Kari T Ryder Wilkie

    2010-10-01

    Full Text Available Ants are among the most diverse, abundant and ecologically significant organisms on earth. Although their species richness appears to be greatest in the New World tropics, global patterns of ant diversity and distribution are not well understood. We comprehensively surveyed ant diversity in a lowland primary rainforest in Western Amazonia, Ecuador using canopy fogging, pitfall traps, baits, hand collecting, mini-Winkler devices and subterranean probes to sample ants. A total of 489 ant species comprising 64 genera in nine subfamilies were identified from samples collected in only 0.16 square kilometers. The most species-rich genera were Camponotus, Pheidole, Pseudomyrmex, Pachycondyla, Brachymyrmex, and Crematogaster. Camponotus and Pseudomyrmex were most diverse in the canopy, while Pheidole was most diverse on the ground. The three most abundant ground-dwelling ant genera were Pheidole, Solenopsis and Pyramica. Crematogaster carinata was the most abundant ant species in the canopy; Wasmannia auropunctata was most abundant on the ground, and the army ant Labidus coecus was the most abundant subterranean species. Ant species composition among strata was significantly different: 80% of species were found in only one stratum, 17% in two strata, and 3% in all three strata. Elevation and the number of logs and twigs available as nest sites were significant predictors of ground-dwelling ant species richness. Canopy species richness was not correlated with any ecological variable measured. Subterranean species richness was negatively correlated with depth in the soil. When ant species were categorized using a functional group matrix based on diet, nest-site preference and foraging ecology, the greatest diversity was found in Omnivorous Canopy Nesters. Our study indicates ant species richness is exceptionally high at Tiputini. We project 647-736 ant species in this global hotspot of biodiversity. Considering the relatively small area surveyed, this

  4. Egg-laying butterflies distinguish predaceous ants by sight.

    Science.gov (United States)

    Sendoya, Sebastián F; Freitas, André V L; Oliveira, Paulo S

    2009-07-01

    Information about predation risks is critical for herbivorous insects, and natural selection favors their ability to detect predators before oviposition and to select enemy-free foliage when offspring mortality risk is high. Food plants are selected by ovipositing butterflies, and offspring survival frequently varies among plants because of variation in the presence of predators. Eunica bechina butterflies oviposit on Caryocar brasiliense, an ant-defended plant. Experiments with dried Camponotus and Cephalotes ants pinned to leaves revealed that butterflies use ant size and form as visual cues to avoid ovipositing on plant parts occupied by ants more likely to kill larval offspring. Presence of sap-sucking bugs did not affect butterfly oviposition. This is the first demonstration that visual recognition of predators can mediate egg-laying decisions by an insect herbivore and that an insect will discriminate among different species of potential predators. This unusual behavioral capability permits specialization on a risky, ant-defended food plant.

  5. Protection of Vochysia elliptica (Vochysiaceae by a nectar-thieving ant

    Directory of Open Access Journals (Sweden)

    G. Q. ROMERO

    Full Text Available Vochysia elliptica (Vochysiaceae is a shrubby plant, which does not have EFNs. Camponotus ants thieve nectar, and can decrease plant fitness by making flowers less attractive to pollinators. However, ants remove herbivores, wich can be beneficial. Results show that plants from which ants were excluded had lower rates of termite (simulated herbivore removal than did plants visited by ants. Plants accessible to ants showed higher rates of termite removal in the base of leaves and in the inflorescence, than in the tip of leaves. This occurs because ants must pass through the principal axis to reach the inflorescence. Conclusive results of this cost/benefit analysis of the Camponotus sp. presence for V. elliptica can be obtained, with experimental manipulations.

  6. Benefits conferred by "timid" ants: active anti-herbivore protection of the rainforest tree Leonardoxa africana by the minute ant Petalomyrmex phylax.

    Science.gov (United States)

    Gaume, Laurence; McKey, Doyle; Anstett, Marie-Charlotte

    1997-10-01

    In this study, we demonstrate that an important benefit provided by the small host-specific ant Petalomyrmex phylax to its host plant Leonardoxa africana is efficient protection against herbivores. We estimate that in the absence of ants, insect herbivory would reduce the leaf area by about one-third. This contributes considerably to the fitness of the plant. Our estimates take into account not only direct damage, such as removal of leaf surface by chewing insects, but also the effects of sucking insects on leaf growth and expansion. Sucking insects are numerically predominant in this system, and the hitherto cryptic effects of ant protection against the growth-reducing effects of sucking insects accounted for half of the total estimated benefit of ant protection. We propose that the small size of workers confers a distinct advantage in this system. Assuming that resource limitation implies a trade off between size and number of ants, and given the small size of phytophagous insects that attack Leonardoxa, we conclude that fine-grained patrolling by a large number of small workers maximises protection of young leaves of this plant. Since herbivores are small and must complete their development on the young leaves of Leonardoxa, and since a high patrolling density is required for a fine-grained search for these enemies, numerous small ants should provide the most effective protection of young leaves of Leonardoxa. We also discuss other factors that may have influenced worker size in this ant.

  7. Competence of Litter Ants for Rapid Biodiversity Assessments

    Directory of Open Access Journals (Sweden)

    T. H. Saumya E. Silva

    2017-01-01

    Full Text Available Rapid Biodiversity Assessment approaches associated with focusing taxa have overcome many of the problems related to large scale surveys. This study examined the suitability of litter ants as a focusing taxon by checking whether diversity and species assemblages of litter ants reflect the overall picture of arthropod diversity and assemblages in leaf litter in two vegetation types: secondary forest and pine plantation in Upper Hanthana forest reserve, Sri Lanka. In each vegetation type, arthropods were sampled using three sampling methods (Winkler extraction, hand collection, and pitfall traps along three 100 m line transects. From the two sites, 1887 litter ants (34 species and 3488 litter arthropods (52 species were collected. Species assemblages composition of both ants and other arthropods differed significantly between the two sites (ANOSIM, p=0.001 with both groups generating distinct clusters for the two sites (SIMPROF, p=0.001. But there was no significant correlation (p>0.05 between abundance and richness of litter ants and those of other arthropods in both vegetation types. The overall finding suggests that the litter ants do not reflect the holistic picture of arthropod diversity and assemblages in leaf litter, but the quality of the habitat for the survival of all litter arthropods.

  8. Asymmetric dispersal and colonization success of Amazonian plant-ants queens.

    Directory of Open Access Journals (Sweden)

    Emilio M Bruna

    Full Text Available The dispersal ability of queens is central to understanding ant life-history evolution, and plays a fundamental role in ant population and community dynamics, the maintenance of genetic diversity, and the spread of invasive ants. In tropical ecosystems, species from over 40 genera of ants establish colonies in the stems, hollow thorns, or leaf pouches of specialized plants. However, little is known about the relative dispersal ability of queens competing for access to the same host plants.We used empirical data and inverse modeling--a technique developed by plant ecologists to model seed dispersal--to quantify and compare the dispersal kernels of queens from three Amazonian ant species that compete for access to host-plants. We found that the modal colonization distance of queens varied 8-fold, with the generalist ant species (Crematogaster laevis having a greater modal distance than two specialists (Pheidole minutula, Azteca sp. that use the same host-plants. However, our results also suggest that queens of Azteca sp. have maximal distances that are four-sixteen times greater than those of its competitors.We found large differences between ant species in both the modal and maximal distance ant queens disperse to find vacant seedlings used to found new colonies. These differences could result from interspecific differences in queen body size, and hence wing musculature, or because queens differ in their ability to identify potential host plants while in flight. Our results provide support for one of the necessary conditions underlying several of the hypothesized mechanisms promoting coexistence in tropical plant-ants. They also suggest that for some ant species limited dispersal capability could pose a significant barrier to the rescue of populations in isolated forest fragments. Finally, we demonstrate that inverse models parameterized with field data are an excellent means of quantifying the dispersal of ant queens.

  9. Disease dynamics in a specialized parasite of ant societies

    DEFF Research Database (Denmark)

    Andersen, Sandra Breum; Ferrari, Matthew; Evans, Harry C.

    2012-01-01

    Coevolution between ant colonies and their rare specialized parasites are intriguing, because lethal infections of workers may correspond to tolerable chronic diseases of colonies, but the parasite adaptations that allow stable coexistence with ants are virtually unknown. We explore the trade......-offs experienced by Ophiocordyceps parasites manipulating ants into dying in nearby graveyards. We used field data from Brazil and Thailand to parameterize and fit a model for the growth rate of graveyards. We show that parasite pressure is much lower than the abundance of ant cadavers suggests...

  10. Density-dependent benefits in ant-hemipteran mutualism? The case of the ghost ant Tapinoma melanocephalum (Hymenoptera: Formicidae and the invasive mealybug Phenacoccus solenopsis (Hemiptera: Pseudococcidae.

    Directory of Open Access Journals (Sweden)

    Aiming Zhou

    Full Text Available Although density-dependent benefits to hemipterans from ant tending have been measured many times, few studies have focused on integrated effects such as interactions between ant tending, natural enemy density, and hemipteran density. In this study, we tested whether the invasive mealybug Phenacoccus solenopsis is affected by tending by ghost ants (Tapinoma melanocephalum, the presence of parasitoids, mealybug density, parasitoid density and interactions among these factors. Our results showed that mealybug colony growth rate and percentage parasitism were significantly affected by ant tending, parasitoid presence, and initial mealybug density separately. However, there were no interactions among the independent factors. There were also no significant interactions between ant tending and parasitoid density on either mealybug colony growth rate or percentage parasitism. Mealybug colony growth rate showed a negative linear relationship with initial mealybug density but a positive linear relationship with the level of ant tending. These results suggest that benefits to mealybugs are density-independent and are affected by ant tending level.

  11. Ant exclusion in citrus over an 8-year period reveals a pervasive yet changing effect of ants on a Mediterranean spider assemblage.

    Science.gov (United States)

    Mestre, L; Piñol, J; Barrientos, J A; Espadaler, X

    2013-09-01

    Ants and spiders are ubiquitous generalist predators that exert top-down control on herbivore populations. Research shows that intraguild interactions between ants and spiders can negatively affect spider populations, but there is a lack of long-term research documenting the strength of such interactions and the potentially different effects of ants on the diverse array of species in a spider assemblage. Similarly, the suitability of family-level surrogates for finding patterns revealed by species-level data (taxonomic sufficiency) has almost never been tested in spider assemblages. We present a long-term study in which we tested the impact of ants on the spider assemblage of a Mediterranean citrus grove by performing sequential 1-year experimental exclusions on tree canopies for 8 years. We found that ants had a widespread influence on the spider assemblage, although the effect was only evident in the last 5 years of the study. During those years, ants negatively affected many spiders, and effects were especially strong for sedentary spiders. Analyses at the family level also detected assemblage differences between treatments, but they concealed the different responses to ant exclusion shown by some related spider species. Our findings show that the effects of experimental manipulations in ecology can vary greatly over time and highlight the need for long-term studies to document species interactions.

  12. Just follow your nose: homing by olfactory cues in ants.

    Science.gov (United States)

    Steck, Kathrin

    2012-04-01

    How is an ant-equipped with a brain that barely exceeds the size of a pinhead-capable of achieving navigational marvels? Even though evidences suggest that navigation is a multimodal process, ants heavily depend on olfactory cues-of pheromonal and non-pheromonal nature-for foraging and orientation. Recent studies have directed their attention to the efficiency of pheromone trail networks. Advances in neurophysiological techniques make it possible to investigate trail pheromone processing in the ant's brain. In addition to relying on pheromone odours, ants also make use of volatiles emanating from the nest surroundings. Deposited in the vicinity of the nest, these home-range markings help the ants to home after a foraging run. Furthermore, olfactory landmarks associated with the nest enhance ants' homing abilities. Copyright © 2011 Elsevier Ltd. All rights reserved.

  13. Behind every great ant, there is a great gut

    DEFF Research Database (Denmark)

    Poulsen, Michael; Sapountzis, Panagiotis

    2012-01-01

    on the potential contribution of the ants’ gut symbionts. This issue of Molecular Ecology contains a study by Anderson et al. (2012), who take a comparative approach to explore the link between trophic levels and ant microbiomes, specifically, to address three main questions: (i) Do closely related herbivorous...... conserved gut microbiomes, suggesting symbiont functions that directly relate to dietary preference of the ant host. These findings suggest an ecological role of gut symbionts in ants, for example, in metabolism and/or protection, and the comparative approach taken supports a model of co-evolution between...... ant species and specific core symbiont microbiomes. This study, thereby, highlights the omnipresence and importance of gut symbioses—also in the Hymenoptera—and suggests that these hitherto overlooked microbes likely have contributed to the ecological success of the ants....

  14. Arboreal ant colonies as 'hot-points' of cryptic diversity for myrmecophiles: the weaver ant Camponotus sp. aff. textor and its interaction network with its associates.

    Science.gov (United States)

    Pérez-Lachaud, Gabriela; Lachaud, Jean-Paul

    2014-01-01

    Systematic surveys of macrofaunal diversity within ant colonies are lacking, particularly for ants nesting in microhabitats that are difficult to sample. Species associated with ants are generally small and rarely collected organisms, which makes them more likely to be unnoticed. We assumed that this tendency is greater for arthropod communities in microhabitats with low accessibility, such as those found in the nests of arboreal ants that may constitute a source of cryptic biodiversity. We investigated the invertebrate diversity associated with an undescribed, but already threatened, Neotropical Camponotus weaver ant. As most of the common sampling methods used in studies of ant diversity are not suited for evaluating myrmecophile diversity within ant nests, we evaluated the macrofauna within ant nests through exhaustive colony sampling of three nests and examination of more than 80,000 individuals. We identified invertebrates from three classes belonging to 18 taxa, some of which were new to science, and recorded the first instance of the co-occurrence of two brood parasitoid wasp families attacking the same ant host colony. This diversity of ant associates corresponded to a highly complex interaction network. Agonistic interactions prevailed, but the prevalence of myrmecophiles was remarkably low. Our data support the hypothesis of the evolution of low virulence in a variety of symbionts associated with large insect societies. Because most myrmecophiles found in this work are rare, strictly specific, and exhibit highly specialized biology, the risk of extinction for these hitherto unknown invertebrates and their natural enemies is high. The cryptic, far unappreciated diversity within arboreal ant nests in areas at high risk of habitat loss qualifies these nests as 'hot-points' of biodiversity that urgently require special attention as a component of conservation and management programs.

  15. Arboreal ant colonies as 'hot-points' of cryptic diversity for myrmecophiles: the weaver ant Camponotus sp. aff. textor and its interaction network with its associates.

    Directory of Open Access Journals (Sweden)

    Gabriela Pérez-Lachaud

    Full Text Available INTRODUCTION: Systematic surveys of macrofaunal diversity within ant colonies are lacking, particularly for ants nesting in microhabitats that are difficult to sample. Species associated with ants are generally small and rarely collected organisms, which makes them more likely to be unnoticed. We assumed that this tendency is greater for arthropod communities in microhabitats with low accessibility, such as those found in the nests of arboreal ants that may constitute a source of cryptic biodiversity. MATERIALS AND METHODS: We investigated the invertebrate diversity associated with an undescribed, but already threatened, Neotropical Camponotus weaver ant. As most of the common sampling methods used in studies of ant diversity are not suited for evaluating myrmecophile diversity within ant nests, we evaluated the macrofauna within ant nests through exhaustive colony sampling of three nests and examination of more than 80,000 individuals. RESULTS: We identified invertebrates from three classes belonging to 18 taxa, some of which were new to science, and recorded the first instance of the co-occurrence of two brood parasitoid wasp families attacking the same ant host colony. This diversity of ant associates corresponded to a highly complex interaction network. Agonistic interactions prevailed, but the prevalence of myrmecophiles was remarkably low. CONCLUSIONS: Our data support the hypothesis of the evolution of low virulence in a variety of symbionts associated with large insect societies. Because most myrmecophiles found in this work are rare, strictly specific, and exhibit highly specialized biology, the risk of extinction for these hitherto unknown invertebrates and their natural enemies is high. The cryptic, far unappreciated diversity within arboreal ant nests in areas at high risk of habitat loss qualifies these nests as 'hot-points' of biodiversity that urgently require special attention as a component of conservation and management

  16. Histrionicotoxin alkaloids finally detected in an ant

    DEFF Research Database (Denmark)

    Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.

    2012-01-01

    Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...... only an m/z 204 base peak. Found also for the first time in skin extracts from the comparison frog Oophaga granulifera of Costa Rica is a trace DHQ of MW 273. It is coded as 273F in the frog; a different isomer is found in the ant....

  17. Neuromodulation of Nestmate Recognition Decisions by Pavement Ants.

    Science.gov (United States)

    Bubak, Andrew N; Yaeger, Jazmine D W; Renner, Kenneth J; Swallow, John G; Greene, Michael J

    2016-01-01

    Ant colonies are distributed systems that are regulated in a non-hierarchical manner. Without a central authority, individuals inform their decisions by comparing information in local cues to a set of inherent behavioral rules. Individual behavioral decisions collectively change colony behavior and lead to self-organization capable of solving complex problems such as the decision to engage in aggressive societal conflicts with neighbors. Despite the relevance to colony fitness, the mechanisms that drive individual decisions leading to cooperative behavior are not well understood. Here we show how sensory information, both tactile and chemical, and social context-isolation, nestmate interaction, or fighting non-nestmates-affects brain monoamine levels in pavement ants (Tetramorium caespitum). Our results provide evidence that changes in octopamine and serotonin in the brains of individuals are sufficient to alter the decision by pavement ants to be aggressive towards non-nestmate ants whereas increased brain levels of dopamine correlate to physical fighting. We propose a model in which the changes in brain states of many workers collectively lead to the self-organization of societal aggression between neighboring colonies of pavement ants.

  18. Antílope

    Directory of Open Access Journals (Sweden)

    Pedro Anderson Martinho Moçambique

    2015-10-01

    Full Text Available Essa espécie de antílope só é encontrada em território angolano, sendo assim um símbolo nacional. Segundo a mitologia africana é símbolo de vivacidade, velocidade e beleza - Angola.

  19. Antílope

    Directory of Open Access Journals (Sweden)

    Pedro Anderson Martinho Moçambique

    2011-04-01

    Full Text Available Essa espécie de antílope só é encontrada em território angolano, sendo assim um símbolo nacional. Segundo a mitologia africana é símbolo de vivacidade, velocidade e beleza - Angola.

  20. Application of an Image Tracking Algorithm in Fire Ant Motion Experiment

    Directory of Open Access Journals (Sweden)

    Lichuan Gui

    2009-04-01

    Full Text Available An image tracking algorithm, which was originally used with the particle image velocimetry (PIV to determine velocities of buoyant solid particles in water, is modified and applied in the presented work to detect motion of fire ant on a planar surface. A group of fire ant workers are put to the bottom of a tub and excited with vibration of selected frequency and intensity. The moving fire ants are captured with an image system that successively acquires image frames of high digital resolution. The background noise in the imaging recordings is extracted by averaging hundreds of frames and removed from each frame. The individual fire ant images are identified with a recursive digital filter, and then they are tracked between frames according to the size, brightness, shape, and orientation angle of the ant image. The speed of an individual ant is determined with the displacement of its images and the time interval between frames. The trail of the individual fire ant is determined with the image tracking results, and a statistical analysis is conducted for all the fire ants in the group. The purpose of the experiment is to investigate the response of fire ants to the substrate vibration. Test results indicate that the fire ants move faster after being excited, but the number of active ones are not increased even after a strong excitation.

  1. Interactions Increase Forager Availability and Activity in Harvester Ants.

    Directory of Open Access Journals (Sweden)

    Evlyn Pless

    Full Text Available Social insect colonies use interactions among workers to regulate collective behavior. Harvester ant foragers interact in a chamber just inside the nest entrance, here called the 'entrance chamber'. Previous studies of the activation of foragers in red harvester ants show that an outgoing forager inside the nest experiences an increase in brief antennal contacts before it leaves the nest to forage. Here we compare the interaction rate experienced by foragers that left the nest and ants that did not. We found that ants in the entrance chamber that leave the nest to forage experienced more interactions than ants that descend to the deeper nest without foraging. Additionally, we found that the availability of foragers in the entrance chamber is associated with the rate of forager return. An increase in the rate of forager return leads to an increase in the rate at which ants descend to the deeper nest, which then stimulates more ants to ascend into the entrance chamber. Thus a higher rate of forager return leads to more available foragers in the entrance chamber. The highest density of interactions occurs near the nest entrance and the entrances of the tunnels from the entrance chamber to the deeper nest. Local interactions with returning foragers regulate both the activation of waiting foragers and the number of foragers available to be activated.

  2. Fluid intake rates in ants correlate with their feeding habits.

    Science.gov (United States)

    Paul, J; Roces, F

    2003-04-01

    This study investigates the techniques of nectar feeding in 11 different ant species, and quantitatively compares fluid intake rates over a wide range of nectar concentrations in four species that largely differ in their feeding habits. Ants were observed to employ two different techniques for liquid food intake, in which the glossa works either as a passive duct-like structure (sucking), or as an up- and downwards moving shovel (licking). The technique employed for collecting fluids at ad libitum food sources was observed to be species-specific and to correlate with the presence or absence of a well-developed crop in the species under scrutiny. Workers of ponerine ants licked fluid food during foraging and transported it as a droplet between their mandibles, whereas workers of species belonging to phylogenetically more advanced subfamilies, with a crop capable of storing liquids, sucked the fluid food, such as formicine ants of the genus Camponotus. In order to evaluate the performance of fluid collection during foraging, intake rates for sucrose solutions of different concentrations were measured in four ant species that differ in their foraging ecology. Scaling functions between fluid intake rates and ant size were first established for the polymorphic species, so as to compare ants of different size across species. Results showed that fluid intake rate depended, as expected and previously reported in the literature, on sugar concentration and the associated fluid viscosity. It also depended on both the species-specific feeding technique and the extent of specialization on foraging on liquid food. For similarly-sized ants, workers of two nectar-feeding ant species, Camponotus rufipes (Formicinae) and Pachycondyla villosa (Ponerinae), collected fluids with the highest intake rates, while workers of the leaf-cutting ant Atta sexdens (Myrmicinae) and a predatory ant from the Rhytidoponera impressa-complex (Ponerinae) did so with the lowest rate. Calculating the

  3. The regulation of ant colony foraging activity without spatial information.

    Directory of Open Access Journals (Sweden)

    Balaji Prabhakar

    Full Text Available Many dynamical networks, such as the ones that produce the collective behavior of social insects, operate without any central control, instead arising from local interactions among individuals. A well-studied example is the formation of recruitment trails in ant colonies, but many ant species do not use pheromone trails. We present a model of the regulation of foraging by harvester ant (Pogonomyrmex barbatus colonies. This species forages for scattered seeds that one ant can retrieve on its own, so there is no need for spatial information such as pheromone trails that lead ants to specific locations. Previous work shows that colony foraging activity, the rate at which ants go out to search individually for seeds, is regulated in response to current food availability throughout the colony's foraging area. Ants use the rate of brief antennal contacts inside the nest between foragers returning with food and outgoing foragers available to leave the nest on the next foraging trip. Here we present a feedback-based algorithm that captures the main features of data from field experiments in which the rate of returning foragers was manipulated. The algorithm draws on our finding that the distribution of intervals between successive ants returning to the nest is a Poisson process. We fitted the parameter that estimates the effect of each returning forager on the rate at which outgoing foragers leave the nest. We found that correlations between observed rates of returning foragers and simulated rates of outgoing foragers, using our model, were similar to those in the data. Our simple stochastic model shows how the regulation of ant colony foraging can operate without spatial information, describing a process at the level of individual ants that predicts the overall foraging activity of the colony.

  4. Arboreal Ant Colonies as ‘Hot-Points’ of Cryptic Diversity for Myrmecophiles: The Weaver Ant Camponotus sp. aff. textor and Its Interaction Network with Its Associates

    Science.gov (United States)

    Pérez-Lachaud, Gabriela; Lachaud, Jean-Paul

    2014-01-01

    Introduction Systematic surveys of macrofaunal diversity within ant colonies are lacking, particularly for ants nesting in microhabitats that are difficult to sample. Species associated with ants are generally small and rarely collected organisms, which makes them more likely to be unnoticed. We assumed that this tendency is greater for arthropod communities in microhabitats with low accessibility, such as those found in the nests of arboreal ants that may constitute a source of cryptic biodiversity. Materials and Methods We investigated the invertebrate diversity associated with an undescribed, but already threatened, Neotropical Camponotus weaver ant. As most of the common sampling methods used in studies of ant diversity are not suited for evaluating myrmecophile diversity within ant nests, we evaluated the macrofauna within ant nests through exhaustive colony sampling of three nests and examination of more than 80,000 individuals. Results We identified invertebrates from three classes belonging to 18 taxa, some of which were new to science, and recorded the first instance of the co-occurrence of two brood parasitoid wasp families attacking the same ant host colony. This diversity of ant associates corresponded to a highly complex interaction network. Agonistic interactions prevailed, but the prevalence of myrmecophiles was remarkably low. Conclusions Our data support the hypothesis of the evolution of low virulence in a variety of symbionts associated with large insect societies. Because most myrmecophiles found in this work are rare, strictly specific, and exhibit highly specialized biology, the risk of extinction for these hitherto unknown invertebrates and their natural enemies is high. The cryptic, far unappreciated diversity within arboreal ant nests in areas at high risk of habitat loss qualifies these nests as ‘hot-points’ of biodiversity that urgently require special attention as a component of conservation and management programs. PMID:24941047

  5. Endophytic fungi reduce leaf-cutting ant damage to seedlings

    Science.gov (United States)

    Bittleston, L. S.; Brockmann, F.; Wcislo, W.; Van Bael, S. A.

    2011-01-01

    Our study examines how the mutualism between Atta colombica leaf-cutting ants and their cultivated fungus is influenced by the presence of diverse foliar endophytic fungi (endophytes) at high densities in tropical leaf tissues. We conducted laboratory choice trials in which ant colonies chose between Cordia alliodora seedlings with high (Ehigh) or low (Elow) densities of endophytes. The Ehigh seedlings contained 5.5 times higher endophyte content and a greater diversity of fungal morphospecies than the Elow treatment, and endophyte content was not correlated with leaf toughness or thickness. Leaf-cutting ants cut over 2.5 times the leaf area from Elow relative to Ehigh seedlings and had a tendency to recruit more ants to Elow plants. Our findings suggest that leaf-cutting ants may incur costs from cutting and processing leaves with high endophyte loads, which could impact Neotropical forests by causing variable damage rates within plant communities. PMID:20610420

  6. Diversity of Species and Behavior of Hymenopteran Parasitoids of Ants: A Review

    Directory of Open Access Journals (Sweden)

    Jean-Paul Lachaud

    2012-01-01

    Full Text Available Reports of hymenopterans associated with ants involve more than 500 species, but only a fraction unambiguously pertain to actual parasitoids. In this paper, we attempt to provide an overview of both the diversity of these parasitoid wasps and the diversity of the types of interactions they have formed with their ant hosts. The reliable list of parasitoid wasps using ants as primary hosts includes at least 138 species, reported between 1852 and 2011, distributed among 9 families from 3 superfamilies. These parasitoids exhibit a wide array of biologies and developmental strategies: ecto- or endoparasitism, solitary or gregarious, and idio- or koinobiosis. All castes of ants and all developmental stages, excepting eggs, are possible targets. Some species parasitize adult worker ants while foraging or performing other activities outside the nest; however, in most cases, parasitoids attack ant larvae either inside or outside their nests. Based on their abundance and success in attacking ants, some parasitoid wasps like diapriids and eucharitids seem excellent potential models to explore how parasitoids impact ant colony demography, population biology, and ant community structure. Despite a significant increase in our knowledge of hymenopteran parasitoids of ants, most of them remain to be discovered.

  7. Entomopathogens Isolated from Invasive Ants and Tests of Their Pathogenicity

    Directory of Open Access Journals (Sweden)

    Maria Fernanda Miori de Zarzuela

    2012-01-01

    Full Text Available Some ant species cause severe ecological and health impact in urban areas. Many attempts have been tested to control such species, although they do not always succeed. Biological control is an alternative to chemical control and has gained great prominence in research, and fungi and nematodes are among the successful organisms controlling insects. This study aimed to clarify some questions regarding the biological control of ants. Invasive ant species in Brazil had their nests evaluated for the presence of entomopathogens. Isolated entomopathogens were later applied in colonies of Monomorium floricola under laboratory conditions to evaluate their effectiveness and the behavior of the ant colonies after treatment. The entomopathogenic nematodes Heterorhabditis sp. and Steinernema sp. and the fungi Beauveria bassiana, Metarhizium anisopliae, and Paecilomyces sp. were isolated from the invasive ant nests. M. floricola colonies treated with Steinernema sp. and Heterorhabditis sp. showed a higher mortality of workers than control. The fungus Beauveria bassiana caused higher mortality of M. floricola workers. However, no colony reduction or elimination was observed in any treatment. The defensive behaviors of ants, such as grooming behavior and colony budding, must be considered when using fungi and nematodes for biological control of ants.

  8. Kin-informative recognition cues in ants

    DEFF Research Database (Denmark)

    Nehring, Volker; Evison, Sophie E F; Santorelli, Lorenzo A

    2011-01-01

    behaviour is thought to be rare in one of the classic examples of cooperation--social insect colonies--because the colony-level costs of individual selfishness select against cues that would allow workers to recognize their closest relatives. In accord with this, previous studies of wasps and ants have...... found little or no kin information in recognition cues. Here, we test the hypothesis that social insects do not have kin-informative recognition cues by investigating the recognition cues and relatedness of workers from four colonies of the ant Acromyrmex octospinosus. Contrary to the theoretical...... prediction, we show that the cuticular hydrocarbons of ant workers in all four colonies are informative enough to allow full-sisters to be distinguished from half-sisters with a high accuracy. These results contradict the hypothesis of non-heritable recognition cues and suggest that there is more potential...

  9. Regulation and specificity of antifungal metapleural gland secretion in leaf-cutting ants

    DEFF Research Database (Denmark)

    Yek, Sze Huei; Nash, David Richard; Jensen, Annette Bruun

    2012-01-01

    significantly larger for ants challenged with virulent and mild pathogens/weeds than for controls and Escovopsis-challenged ants. We conclude that the MG defence system of leaf-cutting ants has characteristics reminiscent of an additional cuticular immune system, with specific and non-specific components......Ants have paired metapleural glands (MGs) to produce secretions for prophylactic hygiene. These exocrine glands are particularly well developed in leaf-cutting ants, but whether the ants can actively regulate MG secretion is unknown. In a set of controlled experiments using conidia of five fungi...

  10. Hidden diversity behind the zombie-ant fungus Ophiocordyceps unilateralis: four new species described from carpenter ants in Minas Gerais, Brazil.

    Directory of Open Access Journals (Sweden)

    Harry C Evans

    Full Text Available BACKGROUND: Ophiocordyceps unilateralis (Clavicipitaceae: Hypocreales is a fungal pathogen specific to ants of the tribe Camponotini (Formicinae: Formicidae with a pantropical distribution. This so-called zombie or brain-manipulating fungus alters the behaviour of the ant host, causing it to die in an exposed position, typically clinging onto and biting into the adaxial surface of shrub leaves. We (HCE and DPH are currently undertaking a worldwide survey to assess the taxonomy and ecology of this highly variable species. METHODS: We formally describe and name four new species belonging to the O. unilateralis species complex collected from remnant Atlantic rainforest in the south-eastern region (Zona da Mata of the State of Minas Gerais, Brazil. Fully illustrated descriptions of both the asexual (anamorph and sexual (teleomorph stages are provided for each species. The new names are registered in Index Fungorum (registration.indexfungorum.org and have received IF numbers. This paper is also a test case for the electronic publication of new names in mycology. CONCLUSIONS: We are only just beginning to understand the taxonomy and ecology of the Ophiocordyceps unilateralis species complex associated with carpenter ants; macroscopically characterised by a single stalk arising from the dorsal neck region of the ant host on which the anamorph occupies the terminal region and the teleomorph occurs as lateral cushions or plates. Each of the four ant species collected--Camponotus rufipes, C. balzani, C. melanoticus and C. novogranadensis--is attacked by a distinct species of Ophiocordyceps readily separated using traditional micromorphology. The new taxa are named according to their ant host.

  11. Aversive learning of odor-heat associations in ants.

    Science.gov (United States)

    Desmedt, Lucie; Baracchi, David; Devaud, Jean-Marc; Giurfa, Martin; d'Ettorre, Patrizia

    2017-12-15

    Ants have recently emerged as useful models for the study of olfactory learning. In this framework, the development of a protocol for the appetitive conditioning of the maxilla-labium extension response (MaLER) provided the possibility of studying Pavlovian odor-food learning in a controlled environment. Here we extend these studies by introducing the first Pavlovian aversive learning protocol for harnessed ants in the laboratory. We worked with carpenter ants Camponotus aethiops and first determined the capacity of different temperatures applied to the body surface to elicit the typical aversive mandible opening response (MOR). We determined that 75°C is the optimal temperature to induce MOR and chose the hind legs as the stimulated body region because of their high sensitivity. We then studied the ability of ants to learn and remember odor-heat associations using 75°C as the unconditioned stimulus. We studied learning and short-term retention after absolute (one odor paired with heat) and differential conditioning (a punished odor versus an unpunished odor). Our results show that ants successfully learn the odor-heat association under a differential-conditioning regime and thus exhibit a conditioned MOR to the punished odor. Yet, their performance under an absolute-conditioning regime is poor. These results demonstrate that ants are capable of aversive learning and confirm previous findings about the different attentional resources solicited by differential and absolute conditioning in general. © 2017. Published by The Company of Biologists Ltd.

  12. Neuromodulation of Nestmate Recognition Decisions by Pavement Ants.

    Directory of Open Access Journals (Sweden)

    Andrew N Bubak

    Full Text Available Ant colonies are distributed systems that are regulated in a non-hierarchical manner. Without a central authority, individuals inform their decisions by comparing information in local cues to a set of inherent behavioral rules. Individual behavioral decisions collectively change colony behavior and lead to self-organization capable of solving complex problems such as the decision to engage in aggressive societal conflicts with neighbors. Despite the relevance to colony fitness, the mechanisms that drive individual decisions leading to cooperative behavior are not well understood. Here we show how sensory information, both tactile and chemical, and social context-isolation, nestmate interaction, or fighting non-nestmates-affects brain monoamine levels in pavement ants (Tetramorium caespitum. Our results provide evidence that changes in octopamine and serotonin in the brains of individuals are sufficient to alter the decision by pavement ants to be aggressive towards non-nestmate ants whereas increased brain levels of dopamine correlate to physical fighting. We propose a model in which the changes in brain states of many workers collectively lead to the self-organization of societal aggression between neighboring colonies of pavement ants.

  13. Sperm length evolution in the fungus-growing ants

    DEFF Research Database (Denmark)

    Baer, B.; Dijkstra, M. B.; Mueller, U. G.

    2009-01-01

    -growing ants, representing 9 of the 12 recognized genera, and mapped these onto the ant phylogeny. We show that average sperm length across species is highly variable and decreases with mature colony size in basal genera with singly mated queens, suggesting that sperm production or storage constraints affect...... the evolution of sperm length. Sperm length does not decrease further in multiply mating leaf-cutting ants, despite substantial further increases in colony size. In a combined analysis, sexual dimorphism explained 63.1% of the variance in sperm length between species. As colony size was not a significant...... predictor in this analysis, we conclude that sperm production trade-offs in males have been the major selective force affecting sperm length across the fungus-growing ants, rather than storage constraints in females. The relationship between sperm length and sexual dimorphism remained robust...

  14. The invasion biology and sociogenetics of pharaoh ants

    DEFF Research Database (Denmark)

    Schmidt, Anna Mosegaard

    Social insect colonies perform a number of tasks affecting the environments they live in. Some unintentionally introduced species have attracted the attention of scientists and general public alike when causing a number of changes to the composition and functioning of ecosystems. Such ?invaders...... laboratory lineages, thus building the foundation for future research on the species. In addition, I have started a selection experiment (still ongoing in collaboration with Dr. T. Linksvayer) using pharaoh ants, which is the first time artificial selection is attempted in an ant species. Pharaoh ants have...

  15. Desert ants learn vibration and magnetic landmarks.

    Directory of Open Access Journals (Sweden)

    Cornelia Buehlmann

    Full Text Available The desert ants Cataglyphis navigate not only by path integration but also by using visual and olfactory landmarks to pinpoint the nest entrance. Here we show that Cataglyphis noda can additionally use magnetic and vibrational landmarks as nest-defining cues. The magnetic field may typically provide directional rather than positional information, and vibrational signals so far have been shown to be involved in social behavior. Thus it remains questionable if magnetic and vibration landmarks are usually provided by the ants' habitat as nest-defining cues. However, our results point to the flexibility of the ants' navigational system, which even makes use of cues that are probably most often sensed in a different context.

  16. Population Development of Several Species of Ants on the Cocoa Trees in South Sulawesi

    Directory of Open Access Journals (Sweden)

    Fatahuddin Fatahuddin

    2010-08-01

    Full Text Available Several species of ants with different behavior have been found in cocoa plantations and their behavior is important to be considered because it might be correlated with the degree of protection of cocoa plant from cocoa pests. The aim of this research is to manipulate and to develop ants population in environment, so they are able to establish permanently in cocoa trees. This research was conducted in Papakaju Regions Luwu Regency in Juli to November 2009. In this study, 10 cocoa trees with ants were sampled (each species of ant in 10 cocoa trees. A control of 10 tree samples without ant was also taken. In order to assess the abundance of ant population, it was grouped based on scoring, which score 1 for less than 20 ants, score 2 for 21–50 ants, score 3 for 51–200 ants, score 4 for 201–1000 ants, and score 5 for more than 1000 per tree. The results indicated that average of population score of the three ants species reached the highest population for the Oecophylla. smaragdina with average score 4.85 (>1000 ants, Dolichoderus thoracicus, with average score 3.90 (> 200 ants and Crematogaster. difformis with average score 3.10 (>200 ants. This research indicated that three species of ants, Oecophylla smaragdina (weaver ant, Dolichoderus thoracicus (cocoa black ant and Crematogaster difformis (cracking ant. in farmer cocoa plantations in South Sulawesi giving better performance against major pests of cocoa in particular cocoa pod borer (CPB. Key words: Ant Population, Oecophylla smaragdina, Dolichoderus thoracicus, Crematogaster difformis, artificial nest, cocoa.

  17. When invasive ants meet: effects of outbreeding on queen performance in the tramp ant Cardiocondyla itsukii.

    Science.gov (United States)

    Heinze, Jürgen; Frohschammer, Sabine; Bernadou, Abel

    2017-08-18

    Most disturbed habitats in the tropics and subtropics harbor numerous species of invasive ants, and occasionally the same species has been introduced repeatedly from multiple geographical sources. We examined how experimental crossbreeding between sexuals from different populations affects the fitness of queens of the tramp ant Cardiocondyla itsukii, which is widely distributed in Asia and the Pacific Islands. Eggs laid by queens that mated with nestmate males had a higher hatching rate than eggs laid by queens mated to males from neighboring (Hawaii × Kauai) or distant introduced populations (Hawaii/Kauai × Okinawa). Furthermore, inbreeding queens had a longer lifespan and produced a less female-biased offspring sex ratio than queens from allopatric mating. This suggests that the genetic divergence between different source populations may already be so large that in case of multiple invasions eventual crossbreeding might negatively affect the fitness of tramp ants. © 2017 Institute of Zoology, Chinese Academy of Sciences.

  18. Conflict over reproduction in an ant-plant symbiosis: why Allomerus octoarticulatus ants sterilize Cordia nodosa trees.

    Science.gov (United States)

    Frederickson, Megan E

    2009-05-01

    The evolutionary stability of mutualism is thought to depend on how well the fitness interests of partners are aligned. Because most ant-myrmecophyte mutualisms are persistent and horizontally transmitted, partners share an interest in growth but not in reproduction. Resources invested in reproduction are unavailable for growth, giving rise to a conflict of interest between partners. I investigated whether this explains why Allomerus octoarticulatus ants sterilize Cordia nodosa trees. Allomerus octoarticulatus nests in the hollow stem domatia of C. nodosa. Workers protect C. nodosa leaves against herbivores but destroy inflorescences. Using C. nodosa trees with Azteca ants, which do not sterilize their hosts, I cut inflorescences off trees to simulate sterilization by A. octoarticulatus. Sterilized C. nodosa grew faster than control trees, providing evidence for a trade-off between growth and reproduction. Allomerus octoarticulatus manipulates this trade-off to its advantage; sterilized trees produce more domatia and can house larger, more fecund colonies.

  19. Fire Ant Allergy

    Science.gov (United States)

    ... venom in a fire ant sting will kill bacteria and some of your skin cells. This results in the formation of a blister that fills with a cloudy white material in about 24 hours. While this looks like a pus-filled lesion that should be drained, ...

  20. Adaptive Radiation in Socially Advanced Stem-Group Ants from the Cretaceous.

    Science.gov (United States)

    Barden, Phillip; Grimaldi, David A

    2016-02-22

    Across terrestrial ecosystems, modern ants are ubiquitous. As many as 94 out of every 100 individual arthropods in rainforests are ants, and they constitute up to 15% of animal biomass in the Amazon. Moreover, ants are pervasive agents of natural selection as over 10,000 arthropod species are specialized inquilines or myrmecomorphs living among ants or defending themselves through mimicry. Such impact is traditionally explained by sociality: ants are the first major group of ground-dwelling predatory insects to become eusocial, increasing efficiency of tasks and establishing competitive superiority over solitary species. A wealth of specimens from rich deposits of 99 million-year-old Burmese amber resolves ambiguity regarding sociality and diversity in the earliest ants. The stem-group genus Gerontoformica maintained distinct reproductive castes including morphotypes unknown in solitary aculeate (stinging) wasps, providing insight into early behavior. We present rare aggregations of workers, indicating group recruitment as well as an instance of interspecific combat; such aggression is a social feature of modern ants. Two species and an unusual new genus are described, further expanding the remarkable diversity of early ants. Stem-group ants are recovered as a paraphyletic assemblage at the base of modern lineages varying greatly in size, form, and mouthpart structure, interpreted here as an adaptive radiation. Though Cretaceous stem-group ants were eusocial and adaptively diverse, we hypothesize that their extinction resulted from the rise of competitively superior crown-group taxa that today form massive colonies, consistent with Wilson and Hölldobler's concept of "dynastic succession." Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. The genome of the fire ant Solenopsis invicta

    DEFF Research Database (Denmark)

    Wurm, Yannick; Wang, John; Riba-Grognuz, Oksana

    2011-01-01

    Ants have evolved very complex societies and are key ecosystem members. Some ants, such as the fire ant Solenopsis invicta, are also major pests. Here, we present a draft genome of S. invicta, assembled from Roche 454 and Illumina sequencing reads obtained from a focal haploid male and his brothe...

  2. Ant colony search algorithm for optimal reactive power optimization

    Directory of Open Access Journals (Sweden)

    Lenin K.

    2006-01-01

    Full Text Available The paper presents an (ACSA Ant colony search Algorithm for Optimal Reactive Power Optimization and voltage control of power systems. ACSA is a new co-operative agents’ approach, which is inspired by the observation of the behavior of real ant colonies on the topic of ant trial formation and foraging methods. Hence, in the ACSA a set of co-operative agents called "Ants" co-operates to find good solution for Reactive Power Optimization problem. The ACSA is applied for optimal reactive power optimization is evaluated on standard IEEE, 30, 57, 191 (practical test bus system. The proposed approach is tested and compared to genetic algorithm (GA, Adaptive Genetic Algorithm (AGA.

  3. Individual-based ant-plant networks: diurnal-nocturnal structure and species-area relationship.

    Directory of Open Access Journals (Sweden)

    Wesley Dáttilo

    Full Text Available Despite the importance and increasing knowledge of ecological networks, sampling effort and intrapopulation variation has been widely overlooked. Using continuous daily sampling of ants visiting three plant species in the Brazilian Neotropical savanna, we evaluated for the first time the topological structure over 24 h and species-area relationships (based on the number of extrafloral nectaries available in individual-based ant-plant networks. We observed that diurnal and nocturnal ant-plant networks exhibited the same pattern of interactions: a nested and non-modular pattern and an average level of network specialization. Despite the high similarity in the ants' composition between the two collection periods, ant species found in the central core of highly interacting species totally changed between diurnal and nocturnal sampling for all plant species. In other words, this "night-turnover" suggests that the ecological dynamics of these ant-plant interactions can be temporally partitioned (day and night at a small spatial scale. Thus, it is possible that in some cases processes shaping mutualistic networks formed by protective ants and plants may be underestimated by diurnal sampling alone. Moreover, we did not observe any effect of the number of extrafloral nectaries on ant richness and their foraging on such plants in any of the studied ant-plant networks. We hypothesize that competitively superior ants could monopolize individual plants and allow the coexistence of only a few other ant species, however, other alternative hypotheses are also discussed. Thus, sampling period and species-area relationship produces basic information that increases our confidence in how individual-based ant-plant networks are structured, and the need to consider nocturnal records in ant-plant network sampling design so as to decrease inappropriate inferences.

  4. No sex in fungus-farming ants or their crops.

    Science.gov (United States)

    Himler, Anna G; Caldera, Eric J; Baer, Boris C; Fernández-Marín, Hermógenes; Mueller, Ulrich G

    2009-07-22

    Asexual reproduction imposes evolutionary handicaps on asexual species, rendering them prone to extinction, because asexual reproduction generates novel genotypes and purges deleterious mutations at lower rates than sexual reproduction. Here, we report the first case of complete asexuality in ants, the fungus-growing ant Mycocepurus smithii, where queens reproduce asexually but workers are sterile, which is doubly enigmatic because the clonal colonies of M. smithii also depend on clonal fungi for food. Degenerate female mating anatomy, extensive field and laboratory surveys, and DNA fingerprinting implicate complete asexuality in this widespread ant species. Maternally inherited bacteria (e.g. Wolbachia, Cardinium) and the fungal cultivars can be ruled out as agents inducing asexuality. M. smithii societies of clonal females provide a unique system to test theories of parent-offspring conflict and reproductive policing in social insects. Asexuality of both ant farmer and fungal crop challenges traditional views proposing that sexual farmer ants outpace coevolving sexual crop pathogens, and thus compensate for vulnerabilities of their asexual crops. Either the double asexuality of both farmer and crop may permit the host to fully exploit advantages of asexuality for unknown reasons or frequent switching between crops (symbiont reassociation) generates novel ant-fungus combinations, which may compensate for any evolutionary handicaps of asexuality in M. smithii.

  5. A Theoretic Basis for IS? The Contribution of ANT

    Directory of Open Access Journals (Sweden)

    Jim Underwood

    2002-11-01

    Full Text Available Representation is a key issue of IS design and operation that is often ignored. Actor-network theory (ANT, a semiotic theory of stakeholders, provides a way of dealing with representation. Combining aspects of ANT and Foucault's discourse theory allows us to include concepts as actors and promises a flexible and durable foundation for IS practice, but ANT itself indicates that the search for a purely theoretical foundation for IS is misguided.

  6. The diversity of microorganisms associated with Acromyrmex leafcutter ants

    Directory of Open Access Journals (Sweden)

    Boomsma Jacobus J

    2002-05-01

    Full Text Available Abstract Background Molecular biological techniques are dramatically changing our view of microbial diversity in almost any environment that has so far been investigated. This study presents a systematic survey of the microbial diversity associated with a population of Acromyrmex leafcutter ants. In contrast to previous studies on social insects, which targeted specific groups of symbionts occurring in the gut (termites, Tetraponera ants or in specialised cells (Camponotus ants the objective of our present study was to do a total screening of all possible micro-organisms that can be found inside the bodies of these leafcutter ants. Results We amplified, cloned and sequenced SSU rRNA encoding gene fragments from 9 microbial groups known to have insect-associated representatives, and show that: (1 representatives of 5 out of 9 tested groups are present, (2 mostly several strains per group are present, adding up to a total of 33 different taxa. We present the microbial taxa associated with Acromymex ants in a phylogenetic context (using sequences from GenBank to assess and illustrate to which known microorganisms they are closely related. The observed microbial diversity is discussed in the light of present knowledge on the evolutionary history of Acromyrmex leafcutter ants and their known mutualistic and parasitic symbionts. Conclusions The major merits of the screening approach documented here is its high sensitivity and specificity, which allowed us to identify several microorganisms that are promising candidates for further study of their interactions with Acromyrmex leafcutter ants or their gardens.

  7. Graveyards on the Move: The Spatio-Temporal Distribution of Dead Ophiocordyceps-Infected Ants

    DEFF Research Database (Denmark)

    Pontoppidan, Maj-Britt; Himaman, Winanda; Hywel-Jones, Nigel L.

    2009-01-01

    rainforest. We established that high density aggregations exist (up to 26 dead ants/m2), which we coined graveyards. We further established that graveyards are patchily distributed in a landscape with no or very few O. unilateralis-killed ants. At some, but not all, spatial scales of analysis the density...... unilateralis, which is pan-tropical in distribution, causes infected worker ants to leave their nest and die under leaves in the understory of tropical rainforests. Working in a forest dynamic plot in Southern Thailand we mapped the occurrence of these dead ants by examining every leaf in 1,360 m2 of primary...... of dead ants correlated with temperature, humidity and vegetation cover. Remarkably, having found 2243 dead ants inside graveyards we only found 2 live ants of the principal host, ant Camponotus leonardi, suggesting that foraging host ants actively avoid graveyards. We discovered that the principal host...

  8. Ants recognize foes and not friends

    Science.gov (United States)

    Guerrieri, Fernando J.; Nehring, Volker; Jørgensen, Charlotte G.; Nielsen, John; Galizia, C. Giovanni; d'Ettorre, Patrizia

    2009-01-01

    Discriminating among individuals and rejecting non-group members is essential for the evolution and stability of animal societies. Ants are good models for studying recognition mechanisms, because they are typically very efficient in discriminating ‘friends’ (nest-mates) from ‘foes’ (non-nest-mates). Recognition in ants involves multicomponent cues encoded in cuticular hydrocarbon profiles. Here, we tested whether workers of the carpenter ant Camponotus herculeanus use the presence and/or absence of cuticular hydrocarbons to discriminate between nest-mates and non-nest-mates. We supplemented the cuticular profile with synthetic hydrocarbons mixed to liquid food and then assessed behavioural responses using two different bioassays. Our results show that (i) the presence, but not the absence, of an additional hydrocarbon elicited aggression and that (ii) among the three classes of hydrocarbons tested (unbranched, mono-methylated and dimethylated alkanes; for mono-methylated alkanes, we present a new synthetic pathway), only the dimethylated alkane was effective in eliciting aggression. Our results suggest that carpenter ants use a fundamentally different mechanism for nest-mate recognition than previously thought. They do not specifically recognize nest-mates, but rather recognize and reject non-nest-mates bearing odour cues that are novel to their own colony cuticular hydrocarbon profile. This begs for a reappraisal of the mechanisms underlying recognition systems in social insects. PMID:19364750

  9. Trail Pheromone Disruption of Argentine Ant Trail Formation and Foraging

    Science.gov (United States)

    Suckling, D.M.; Peck, R.W.; Stringer, L.D.; Snook, K.; Banko, P.C.

    2010-01-01

    Trail pheromone disruption of invasive ants is a novel tactic that builds on the development of pheromone-based pest management in other insects. Argentine ant trail pheromone, (Z)-9-hexadecenal, was formulated as a micro-encapsulated sprayable particle and applied against Argentine ant populations in 400 m2 field plots in Hawai'i Volcanoes National Park. A widely dispersed point source strategy for trail pheromone disruption was used. Traffic rates of ants in bioassays of treated filter paper, protected from rainfall and sunlight, indicated the presence of behaviorally significant quantities of pheromone being released from the formulation for up to 59 days. The proportion of plots, under trade wind conditions (2-3 m s-1), with visible trails was reduced for up to 14 days following treatment, and the number of foraging ants at randomly placed tuna-bait cards was similarly reduced. The success of these trail pheromone disruption trials in a natural ecosystem highlights the potential of this method for control of invasive ant species in this and other environments. ?? Springer Science+Business Media, LLC 2010.

  10. Water stress strengthens mutualism among ants, trees, and scale insects.

    Directory of Open Access Journals (Sweden)

    Elizabeth G Pringle

    2013-11-01

    Full Text Available Abiotic environmental variables strongly affect the outcomes of species interactions. For example, mutualistic interactions between species are often stronger when resources are limited. The effect might be indirect: water stress on plants can lead to carbon stress, which could alter carbon-mediated plant mutualisms. In mutualistic ant-plant symbioses, plants host ant colonies that defend them against herbivores. Here we show that the partners' investments in a widespread ant-plant symbiosis increase with water stress across 26 sites along a Mesoamerican precipitation gradient. At lower precipitation levels, Cordia alliodora trees invest more carbon in Azteca ants via phloem-feeding scale insects that provide the ants with sugars, and the ants provide better defense of the carbon-producing leaves. Under water stress, the trees have smaller carbon pools. A model of the carbon trade-offs for the mutualistic partners shows that the observed strategies can arise from the carbon costs of rare but extreme events of herbivory in the rainy season. Thus, water limitation, together with the risk of herbivory, increases the strength of a carbon-based mutualism.

  11. Water stress strengthens mutualism among ants, trees, and scale insects.

    Science.gov (United States)

    Pringle, Elizabeth G; Akçay, Erol; Raab, Ted K; Dirzo, Rodolfo; Gordon, Deborah M

    2013-11-01

    Abiotic environmental variables strongly affect the outcomes of species interactions. For example, mutualistic interactions between species are often stronger when resources are limited. The effect might be indirect: water stress on plants can lead to carbon stress, which could alter carbon-mediated plant mutualisms. In mutualistic ant-plant symbioses, plants host ant colonies that defend them against herbivores. Here we show that the partners' investments in a widespread ant-plant symbiosis increase with water stress across 26 sites along a Mesoamerican precipitation gradient. At lower precipitation levels, Cordia alliodora trees invest more carbon in Azteca ants via phloem-feeding scale insects that provide the ants with sugars, and the ants provide better defense of the carbon-producing leaves. Under water stress, the trees have smaller carbon pools. A model of the carbon trade-offs for the mutualistic partners shows that the observed strategies can arise from the carbon costs of rare but extreme events of herbivory in the rainy season. Thus, water limitation, together with the risk of herbivory, increases the strength of a carbon-based mutualism.

  12. Ant colony algorithm for clustering in portfolio optimization

    Science.gov (United States)

    Subekti, R.; Sari, E. R.; Kusumawati, R.

    2018-03-01

    This research aims to describe portfolio optimization using clustering methods with ant colony approach. Two stock portfolios of LQ45 Indonesia is proposed based on the cluster results obtained from ant colony optimization (ACO). The first portfolio consists of assets with ant colony displacement opportunities beyond the defined probability limits of the researcher, where the weight of each asset is determined by mean-variance method. The second portfolio consists of two assets with the assumption that each asset is a cluster formed from ACO. The first portfolio has a better performance compared to the second portfolio seen from the Sharpe index.

  13. Automating ActionScript Projects with Eclipse and Ant

    CERN Document Server

    Koning, Sidney

    2011-01-01

    Automating repetitive programming tasks is easier than many Flash/AS3 developers think. With the Ant build tool, the Eclipse IDE, and this concise guide, you can set up your own "ultimate development machine" to code, compile, debug, and deploy projects faster. You'll also get started with versioning systems, such as Subversion and Git. Create a consistent workflow for multiple machines, or even complete departments, with the help of extensive Ant code samples. If you want to work smarter and take your skills to a new level, this book will get you on the road to automation-with Ant. Set up y

  14. Carbohydrate supply limits invasion of natural communities by Argentine ants.

    Science.gov (United States)

    Rowles, Alexei D; Silverman, Jules

    2009-08-01

    The ability of species to invade new habitats is often limited by various biotic and physical factors or interactions between the two. Invasive ants, frequently associated with human activities, flourish in disturbed urban and agricultural environments. However, their ability to invade and establish in natural habitats is more variable. This is particularly so for the invasive Argentine ant (Linepithema humile). While biotic resistance and low soil moisture limits their invasion of natural habitats in some instances, the effect of food availability has been poorly explored. We conducted field experiments to determine if resource availability limits the spread and persistence of Argentine ants in remnant natural forest in North Carolina. Replicated transects paired with and without sucrose solution feeding stations were run from invaded urban edges into forest remnants and compared over time using baits and direct counts at feeding stations. Repeated under different timing regimes in 2006 and 2007, access to sucrose increased local Argentine ant abundances (1.6-2.5 fold) and facilitated their progression into the forest up to 73 +/- 21% of 50-m transects. Resource removal caused an expected decrease in Argentine ant densities in 2006, in conjunction with their retreat to the urban/forest boundary. However, in 2007, Argentine ant numbers unexpectedly continued to increase in the absence of sugar stations, possibly through access to alternative resources or conditions not available the previous year such as honeydew-excreting Hemiptera. Our results showed that supplementing carbohydrate supply facilitates invasion of natural habitat by Argentine ants. This is particularly evident where Argentine ants continued to thrive following sugar station removal.

  15. Exotic ants (Hymenoptera, Formicidae) of Ohio

    OpenAIRE

    Ivanov,Kal

    2016-01-01

    The worldwide transfer of plants and animals outside their native ranges is an ever increasing problem for global biodiversity. Ants are no exception and many species have been transported to new locations often with profound negative impacts on local biota. The current study is based on data gathered since the publication of the “Ants of Ohio” in 2005. Here I expand on our knowledge of Ohio’s myrmecofauna by contributing new records, new distributional information and natural history notes. ...

  16. Individual Rules for Trail Pattern Formation in Argentine Ants (Linepithema humile)

    OpenAIRE

    Perna, Andrea; Granovskiy, Boris; Garnier, Simon; Nicolis, Stamatios C.; Labédan, Marjorie; Theraulaz, Guy; Fourcassié, Vincent; Sumpter, David J. T.

    2012-01-01

    We studied the formation of trail patterns by Argentine ants exploring an empty arena. Using a novel imaging and analysis technique we estimated pheromone concentrations at all spatial positions in the experimental arena and at different times. Then we derived the response function of individual ants to pheromone concentrations by looking at correlations between concentrations and changes in speed or direction of the ants. Ants were found to turn in response to local pheromone concentrations,...

  17. Ant-mediated effects on spruce litter decomposition, solution chemistry, and microbial activity

    DEFF Research Database (Denmark)

    Stadler, B.; Schramm, Andreas; Kalbitz, K.

    2006-01-01

    the effects of ants and aphid honeydew on litter solution of Norway spruce, microbial enzyme activities, and needle decomposition in a field and greenhouse experiment during summer 2003. In the field, low ant densities had relatively little effects on litter solution 30 cm away from a tree trunk...... and %N were not affected by ants or honeydew. Our results suggest that ants have a distinct and immediate effect on solution composition and microbial activity in the litter layer indicating accelerated litter decay whereas the effect of honeydew was insignificant. Keywords: Ants; Decomposition; Formica......Forest management practices often generate clear-cut patches, which may be colonized by ants not present in the same densities in mature forests. In addition to the associated changes in abiotic conditions ants can initiate processes, which do not occur in old-growth stands. Here, we analyse...

  18. Ants: Major Functional Elements in Fruit Agro-Ecosystems and Biological Control Agents

    Directory of Open Access Journals (Sweden)

    Lamine Diamé

    2017-12-01

    Full Text Available Ants are a very diverse taxonomic group. They display remarkable social organization that has enabled them to be ubiquitous throughout the world. They make up approximately 10% of the world’s animal biomass. Ants provide ecosystem services in agrosystems by playing a major role in plant pollination, soil bioturbation, bioindication, and the regulation of crop-damaging insects. Over recent decades, there have been numerous studies in ant ecology and the focus on tree cropping systems has given added importance to ant ecology knowledge. The only missing point in this knowledge is the reasons underlying difference between the positive and negative effects of ants in tree cropping systems. This review article provides an overview of knowledge of the roles played by ants in orchards as functional elements, and on the potential of Oecophylla weaver ants as biological control agents. It also shows the potential and relevance of using ants as an agro-ecological diagnosis tool in orchards. Lastly, it demonstrates the potential elements which may determine the divergent negative and positive of their effects on cropping systems.

  19. Economy of scale: third partner strengthens a keystone ant-plant mutualism.

    Science.gov (United States)

    Prior, Kirsten M; Palmer, Todd M

    2018-02-01

    While foundation species can stabilize ecosystems at landscape scales, their ability to persist is often underlain by keystone interactions occurring at smaller scales. Acacia drepanolobium is a foundation tree, comprising >95% of woody cover in East African black-cotton savanna ecosystems. Its dominance is underlain by a keystone mutualistic interaction with several symbiotic ant species in which it provides housing (swollen thorns) and carbohydrate-rich nectar from extra-floral nectaries (EFN). In return, it gains protection from catastrophic damage from mega-herbivores. Crematogaster mimosae is the ecologically dominant symbiotic ant in this system, also providing the highest protection services. In addition to tending EFN, C. mimosae tend scale insects for carbohydrate-rich honeydew. We investigated the role of scale insects in this specialized ant-plant interaction. Specifically, does this putatively redundant third partner strengthen the ant-plant mutualism by making the ant a better protector of the tree? Or does it weaken the mutualism by being costly to the tree while providing no additional benefit to the ant-plant mutualism? We coupled observational surveys with two scale-manipulation experiments and found evidence that this third partner strengthens the ant-plant mutualism. Trees with scale insects experimentally removed experienced a 2.5X increase in elephant damage compared to trees with scale insects present over 10 months. Reduced protection was driven by scale removal causing a decrease in ant colony size and per capita baseline activity and defensive behavior. We also found that ants increased scale-tending and the density of scale insects on trees when EFN were experimentally reduced. Thus, in this system, scale insects and EFN are likely complementary, rather than redundant, resources with scale insects benefitting ants when EFN production is low (such as during annual dry periods in this semi-arid ecosystem). This study reveals that a third

  20. An invasive slug exploits an ant-seed dispersal mutualism.

    Science.gov (United States)

    Meadley Dunphy, Shannon A; Prior, Kirsten M; Frederickson, Megan E

    2016-05-01

    Plant-animal mutualisms, such as seed dispersal, are often vulnerable to disruption by invasive species. Here, we show for the first time how a non-ant invasive species negatively affects seed dispersal by ants. We examined the effects of several animal species that co-occur in a temperate deciduous forest-including native and invasive seed-dispersing ants (Aphaenogaster rudis and Myrmica rubra, respectively), an invasive slug (Arion subfuscus), and native rodents-on a native myrmecochorous plant, Asarum canadense. We experimentally manipulated ant, slug, and rodent access to seed depots and measured seed removal. We also video-recorded depots to determine which other taxa interact with seeds. We found that A. rudis was the main disperser of seeds and that A. subfuscus consumed elaiosomes without dispersing seeds. Rodent visitation was rare, and rodent exclusion had no significant effect on seed or elaiosome removal. We then used data obtained from laboratory and field mesocosm experiments to determine how elaiosome robbing by A. subfuscus affects seed dispersal by A. rudis and M. rubra. We found that elaiosome robbing by slugs reduced seed dispersal by ants, especially in mesocosms with A. rudis, which picks up seeds more slowly than M. rubra. Taken together, our results show that elaiosome robbing by an invasive slug reduces seed dispersal by ants, suggesting that invasive slugs can have profound negative effects on seed dispersal mutualisms.

  1. Olfactory memory established during trophallaxis affects food search behaviour in ants

    OpenAIRE

    Provecho, Y.; Josens, R.

    2009-01-01

    Camponotus mus ants can associate sucrose and odour at the source during successive foraging cycles and use this memory to locate the nectar in the absence of other cues. These ants perform conspicuous trophallactic behaviour during recruitment while foraging for nectar. In this work, we studied whether Camponotus mus ants are able to establish this odour-sucrose association in the social context of trophallaxis and we evaluated this memory in another context previously experienced by the ant...

  2. Plant genotype shapes ant-aphid interactions: implications for community structure and indirect plant defense.

    Science.gov (United States)

    Mooney, Kailen A; Agrawal, Anurag A

    2008-06-01

    Little is known about the mechanisms by which plant genotype shapes arthropod community structure. In a field experiment, we measured the effects of milkweed (Asclepias syriaca) genotype and ants on milkweed arthropods. Populations of the ant-tended aphid Aphis asclepiadis and the untended aphid Myzocallis asclepiadis varied eight- to 18-fold among milkweed genotypes, depending on aphid species and whether ants were present. There was no milkweed effect on predatory arthropods. Ants increased Aphis abundance 59%, decreased Myzocallis abundance 52%, and decreased predator abundance 56%. Milkweed genotype indirectly influenced ants via direct effects on Aphis and Myzocallis abundance. Milkweed genotype also modified ant-aphid interactions, influencing the number of ants attracted per Aphis and Myzocallis. While ant effects on Myzocallis were consistently negative, effects on Aphis ranged from antagonistic to mutualistic among milkweed genotypes. As a consequence of milkweed effects on ant-aphid interactions, ant abundance varied 13-fold among milkweed genotypes, and monarch caterpillar survival was negatively correlated with genetic variation in ant abundance. We speculate that heritable variation in milkweed phloem sap drives these effects on aphids, ants, and caterpillars. In summary, milkweed exerts genetic control over the interactions between aphids and an ant that provides defense against foliage-feeding caterpillars.

  3. Commentary: Warring ants

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 27; Issue 2. Commentary: Warring ants: Lessons from Lanchester's laws of combat? Renee M Borges. Volume 27 Issue 2 March 2002 pp 75-78. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/027/02/0075-0078 ...

  4. Individual Rules for Trail Pattern Formation in Argentine Ants (Linepithema humile)

    Science.gov (United States)

    Perna, Andrea; Granovskiy, Boris; Garnier, Simon; Nicolis, Stamatios C.; Labédan, Marjorie; Theraulaz, Guy; Fourcassié, Vincent; Sumpter, David J. T.

    2012-01-01

    We studied the formation of trail patterns by Argentine ants exploring an empty arena. Using a novel imaging and analysis technique we estimated pheromone concentrations at all spatial positions in the experimental arena and at different times. Then we derived the response function of individual ants to pheromone concentrations by looking at correlations between concentrations and changes in speed or direction of the ants. Ants were found to turn in response to local pheromone concentrations, while their speed was largely unaffected by these concentrations. Ants did not integrate pheromone concentrations over time, with the concentration of pheromone in a 1 cm radius in front of the ant determining the turning angle. The response to pheromone was found to follow a Weber's Law, such that the difference between quantities of pheromone on the two sides of the ant divided by their sum determines the magnitude of the turning angle. This proportional response is in apparent contradiction with the well-established non-linear choice function used in the literature to model the results of binary bridge experiments in ant colonies (Deneubourg et al. 1990). However, agent based simulations implementing the Weber's Law response function led to the formation of trails and reproduced results reported in the literature. We show analytically that a sigmoidal response, analogous to that in the classical Deneubourg model for collective decision making, can be derived from the individual Weber-type response to pheromone concentrations that we have established in our experiments when directional noise around the preferred direction of movement of the ants is assumed. PMID:22829756

  5. Individual rules for trail pattern formation in Argentine ants (Linepithema humile.

    Directory of Open Access Journals (Sweden)

    Andrea Perna

    Full Text Available We studied the formation of trail patterns by Argentine ants exploring an empty arena. Using a novel imaging and analysis technique we estimated pheromone concentrations at all spatial positions in the experimental arena and at different times. Then we derived the response function of individual ants to pheromone concentrations by looking at correlations between concentrations and changes in speed or direction of the ants. Ants were found to turn in response to local pheromone concentrations, while their speed was largely unaffected by these concentrations. Ants did not integrate pheromone concentrations over time, with the concentration of pheromone in a 1 cm radius in front of the ant determining the turning angle. The response to pheromone was found to follow a Weber's Law, such that the difference between quantities of pheromone on the two sides of the ant divided by their sum determines the magnitude of the turning angle. This proportional response is in apparent contradiction with the well-established non-linear choice function used in the literature to model the results of binary bridge experiments in ant colonies (Deneubourg et al. 1990. However, agent based simulations implementing the Weber's Law response function led to the formation of trails and reproduced results reported in the literature. We show analytically that a sigmoidal response, analogous to that in the classical Deneubourg model for collective decision making, can be derived from the individual Weber-type response to pheromone concentrations that we have established in our experiments when directional noise around the preferred direction of movement of the ants is assumed.

  6. Molecular structure and diversity of PBAN/Pyrokinin family peptides in ants

    Directory of Open Access Journals (Sweden)

    Man-Yeon eChoi

    2012-02-01

    Full Text Available Neuropeptides are the largest group of insect hormones. They are produced in the central and peripheral nervous systems and affect insect development, reproduction, feeding and behavior. A variety of neuropeptide families have been identified in insects. One of these families is the PBAN/pyrokinin family defined by a common FXPRLamide or similar amino acid fragment at the C-terminal end. These peptides, found in all insects studied thus far, have been conserved throughout evolution. The most well studied physiological function is regulation of moth sex pheromone biosynthesis through the Pheromone Biosynthesis Activating Neurohormone (PBAN, although several developmental functions have also been reported. Over the past years we have extended knowledge of the PBAN/pyrokinin family of peptides to ants, focusing mainly on the fire ant, Solenopsis invicta. The fire ant is one of the most studied social insects and over the last 60 years a great deal has been learned about many aspects of this ant, including the behaviors and chemistry of pheromone communication. However, virtually nothing is known about the regulation of these pheromone systems. Recently, we demonstrated the presence of PBAN/pyrokinin immunoreactive neurons in the fire ant, and identified and characterized PBAN and additional neuropeptides. We have mapped the fire ant PBAN gene structure and determined the tissue expression level in the central nervous system of the ant. We review here our research to date on the molecular structure and diversity of ant PBAN/pyrokinin peptides in preparation for determining the function of the neuropeptides in ants and other social insects.

  7. Ultrastructure of antennal sensillae of the samsum ant ...

    African Journals Online (AJOL)

    Black ant (Samsum), Pachycodyla sennarrensis, stings and injects venom and inflicts allergy (a rare clinical problem) due to its local and systemic reaction, which is considered as a health hazard amongst Saudi society. Thus, black ant is a source of serious concern for the government and experts as well.

  8. The effect of diet and opponent size on aggressive interactions involving caribbean crazy ants (Nylanderia fulva.

    Directory of Open Access Journals (Sweden)

    Katherine C Horn

    Full Text Available Biotic interactions are often important in the establishment and spread of invasive species. In particular, competition between introduced and native species can strongly influence the distribution and spread of exotic species and in some cases competition among introduced species can be important. The Caribbean crazy ant, Nylanderia fulva, was recently introduced to the Gulf Coast of Texas, and appears to be spreading inland. It has been hypothesized that competition with the red imported fire ant, Solenopsis invicta, may be an important factor in the spread of crazy ants. We investigated the potential of interspecific competition among these two introduced ants by measuring interspecific aggression between Caribbean crazy ant workers and workers of Solenopsis invicta. Specifically, we examined the effect of body size and diet on individual-level aggressive interactions among crazy ant workers and fire ants. We found that differences in diet did not alter interactions between crazy ant workers from different nests, but carbohydrate level did play an important role in antagonistic interactions with fire ants: crazy ants on low sugar diets were more aggressive and less likely to be killed in aggressive encounters with fire ants. We found that large fire ants engaged in fewer fights with crazy ants than small fire ants, but fire ant size affected neither fire ant nor crazy ant mortality. Overall, crazy ants experienced higher mortality than fire ants after aggressive encounters. Our findings suggest that fire ant workers might outcompete crazy ant workers on an individual level, providing some biotic resistance to crazy ant range expansion. However, this resistance may be overcome by crazy ants that have a restricted sugar intake, which may occur when crazy ants are excluded from resources by fire ants.

  9. Weaver Ants to Control Fruit Fly Damage to Tanzanian Mangoes

    DEFF Research Database (Denmark)

    Kirkegaard, Nina

    in Australia and West Africa. In this study, small scale farmers did not think weaver ants protected their mangoes from fruit flies. Observational studies confirmed the farmers’ views. No volatile compounds, likely to be responsible for the weaver ants’ deterrent effect, were identified. This study focused...... mangoes varied a lot with zero infestation in some fruits and more than 100 pupae emerging from other fruits, indicating that other factors than the presence of weaver ants affect the fruit flies’ decision on where to oviposit. It was not uncommon for farmers to place newly harvested mangoes below mango...... not shown to be effectively deterring fruit flies, there is no great motivation for farmers to adopt weaver ants. Assuming the weaver ants could be managed in a way that made weaver ants deter fruit flies effectively there are still some economic aspects which should be studied further. It is necessary...

  10. Advances in Research on the Venom Chemistry of Imported Fire Ants

    Science.gov (United States)

    Workers of the imported fire ants, including red imported fire ants, Solenopsis invicta Buren, black imported fire ants, S. richteri Forel, and their hybrid (S. invicta × S. richteri), are vicious stingers. Since the venomous sting is a significant medical problem to humans, the chemistry of import...

  11. Comparing different methods to assess weaver ant abundance in plantation trees

    DEFF Research Database (Denmark)

    Wargui, Rosine; Offenberg, Joachim; Sinzogan, Antonio

    2015-01-01

    Weaver ants (Oecophylla spp.) are widely used as effective biological control agents. In order to optimize their use, ant abundance needs to be tracked. As several methods have been used to estimate ant abundance on plantation trees, abundances are not comparable between studies and no guideline...... is available on which method to apply in a particular study. This study compared four existing methods: three methods based on the number of ant trails on the main branches of a tree (called the Peng 1, Peng 2 and Offenberg index) and one method based on the number of ant nests per tree. Branch indices did...... not produce equal scores and cannot be compared directly. The Peng 1 index was the fastest to assess, but showed only limited seasonal fluctuations when ant abundance was high, because it approached its upper limit. The Peng 2 and Offenberg indices were lower and not close to the upper limit and therefore...

  12. Various chemical strategies to deceive ants in three Arhopala species (lepidoptera: Lycaenidae exploiting Macaranga myrmecophytes.

    Directory of Open Access Journals (Sweden)

    Yoko Inui

    Full Text Available Macaranga myrmecophytes (ant-plants are generally well protected from herbivore attacks by their symbiotic ants (plant-ants. However, larvae of Arhopala (Lepidoptera: Lycaenidae species survive and develop on specific Macaranga ant-plant species without being attacked by the plant-ants of their host species. We hypothesized that Arhopala larvae chemically mimic or camouflage themselves with the ants on their host plant so that the larvae are accepted by the plant-ant species of their host. Chemical analyses of cuticular hydrocarbons showed that chemical congruency varied among Arhopala species; A. dajagaka matched well the host plant-ants, A. amphimuta did not match, and unexpectedly, A. zylda lacked hydrocarbons. Behaviorally, the larvae and dummies coated with cuticular chemicals of A. dajagaka were well attended by the plant-ants, especially by those of the host. A. amphimuta was often attacked by all plant-ants except for the host plant-ants toward the larvae, and those of A. zylda were ignored by all plant-ants. Our results suggested that conspicuous variations exist in the chemical strategies used by the myrmecophilous butterflies that allow them to avoid ant attack and be accepted by the plant-ant colonies.

  13. Cercomacra and related antbirds (Aves, Formicariidae as army ant followers

    Directory of Open Access Journals (Sweden)

    Edwin O. Willis

    1984-01-01

    Full Text Available Cercomacra and Schistocichla antbirds (Formicariidae favor dense foliage and seldom follow army ants for flushed prey, since the ants move through open forest understory as well as through dense zones. Two other lineages, the Drymophila-Hypocnemis lineage (of dense woodland understory and the Formicivora lineage (of dense bushes in dry or semiopen zones, also cannot follow ants regularly through open forest understory.

  14. Uni-directional trail sharing by two species of ants a Monte Carlo study

    International Nuclear Information System (INIS)

    Kunduraci, T; Kayacan, O

    2015-01-01

    We study insect traffic, specifically ant traffic on a uni-directional trail which is shared by two species of ants, one of which is ‘good’ at smelling and the other ‘poor’. The two distinct species of ants are placed mixed on the same trail and individuals of both are permitted to make a U-turn when they encounter another ant in front of them. The theoretical scheme for the ant traffic is based on an asymmetric simple exclusion model. The ant traffic on the uni-directional trail is studied as a function of the number of ‘good-smelling’ ants and the evaporation probability of pheromones by keeping the number of ‘poor-smelling ants’ constant during Monte Carlo simulations. (paper)

  15. Improving Emergency Management by Modeling Ant Colonies

    Science.gov (United States)

    2015-03-01

    perform functions such as nursing the brood or maintaining the nest. The more mature workers will begin to travel outside the nest to perform foraging...small sized ants predominantly act in functional roles such as nurses or transport services within the nest. The larger sizes predominantly function...stages: the founding stage, the ergonomic stage, and the reproductive stage. The founding stage is marked by a queen ant successful mating and laying

  16. Revolutionizing Remote Exploration with ANTS

    Science.gov (United States)

    Clark, P. E.; Rilee, M. L.; Curtis, S.; Truszkowski, W.

    2002-05-01

    We are developing the Autonomous Nano-Technology Swarm (ANTS) architecture based on an insect colony analogue for the cost-effective, efficient, systematic survey of remote or inaccessible areas with multiple object targets, including planetary surface, marine, airborne, and space environments. The mission context is the exploration in the 2020s of the most compelling remaining targets in the solar system: main belt asteroids. Main belt asteroids harbor important clues to Solar System origins and evolution which are central to NASA's goals in Space Science. Asteroids are smaller than planets, but their number is far greater, and their combined surface area likely dwarfs the Earth's. An asteroid survey will dramatically increase our understanding of the local resources available for the Human Exploration and Development of Space. During the mission composition, shape, gravity, and orbit parameters could be returned to Earth for perhaps several thousand asteroids. A survey of this area will rival the great explorations that encircled this globe, opened up the New World, and laid the groundwork for the progress and challenges of the last centuries. The ANTS architecture for a main belt survey consists of a swarm of as many as a thousand or more highly specialized pico-spacecraft that form teams to survey as many as one hundred asteroids a month. Multi-level autonomy is critical for ANTS and the objective of the proposed study is to work through the implications and constraints this entails. ANTS couples biologically inspired autonomic control for basic functions to higher level artificial intelligence that together enable individual spacecraft to operate as specialized, cooperative, social agents. This revolutionary approach postulates highly advanced, but familiar, components integrated and operated in a way that uniquely transcends any evolutionary extrapolation of existing trends and enables thousand-spacecraft missions.

  17. Urban habitat complexity affects species richness but not environmental filtering of morphologically-diverse ants

    Directory of Open Access Journals (Sweden)

    Alessandro Ossola

    2015-10-01

    Full Text Available Habitat complexity is a major determinant of structure and diversity of ant assemblages. Following the size-grain hypothesis, smaller ant species are likely to be advantaged in more complex habitats compared to larger species. Habitat complexity can act as an environmental filter based on species size and morphological traits, therefore affecting the overall structure and diversity of ant assemblages. In natural and semi-natural ecosystems, habitat complexity is principally regulated by ecological successions or disturbance such as fire and grazing. Urban ecosystems provide an opportunity to test relationships between habitat, ant assemblage structure and ant traits using novel combinations of habitat complexity generated and sustained by human management. We sampled ant assemblages in low-complexity and high-complexity parks, and high-complexity woodland remnants, hypothesizing that (i ant abundance and species richness would be higher in high-complexity urban habitats, (ii ant assemblages would differ between low- and high-complexity habitats and (iii ants living in high-complexity habitats would be smaller than those living in low-complexity habitats. Contrary to our hypothesis, ant species richness was higher in low-complexity habitats compared to high-complexity habitats. Overall, ant assemblages were significantly different among the habitat complexity types investigated, although ant size and morphology remained the same. Habitat complexity appears to affect the structure of ant assemblages in urban ecosystems as previously observed in natural and semi-natural ecosystems. However, the habitat complexity filter does not seem to be linked to ant morphological traits related to body size.

  18. Urban habitat complexity affects species richness but not environmental filtering of morphologically-diverse ants

    Science.gov (United States)

    Nash, Michael A.; Christie, Fiona J.; Hahs, Amy K.; Livesley, Stephen J.

    2015-01-01

    Habitat complexity is a major determinant of structure and diversity of ant assemblages. Following the size-grain hypothesis, smaller ant species are likely to be advantaged in more complex habitats compared to larger species. Habitat complexity can act as an environmental filter based on species size and morphological traits, therefore affecting the overall structure and diversity of ant assemblages. In natural and semi-natural ecosystems, habitat complexity is principally regulated by ecological successions or disturbance such as fire and grazing. Urban ecosystems provide an opportunity to test relationships between habitat, ant assemblage structure and ant traits using novel combinations of habitat complexity generated and sustained by human management. We sampled ant assemblages in low-complexity and high-complexity parks, and high-complexity woodland remnants, hypothesizing that (i) ant abundance and species richness would be higher in high-complexity urban habitats, (ii) ant assemblages would differ between low- and high-complexity habitats and (iii) ants living in high-complexity habitats would be smaller than those living in low-complexity habitats. Contrary to our hypothesis, ant species richness was higher in low-complexity habitats compared to high-complexity habitats. Overall, ant assemblages were significantly different among the habitat complexity types investigated, although ant size and morphology remained the same. Habitat complexity appears to affect the structure of ant assemblages in urban ecosystems as previously observed in natural and semi-natural ecosystems. However, the habitat complexity filter does not seem to be linked to ant morphological traits related to body size. PMID:26528416

  19. Species-Specific Effects of Ant Inhabitants on Bromeliad Nutrition.

    Directory of Open Access Journals (Sweden)

    Ana Z Gonçalves

    Full Text Available Predator activities may lead to the accumulation of nutrients in specific areas of terrestrial habitats where they dispose of prey carcasses. In their feeding sites, predators may increase nutrient availability in the soil and favor plant nutrition and growth. However, the translocation of nutrients from one habitat to another may depend on predator identity and diet, as well as on the amount of prey intake. Here we used isotopic (15N and physiological methods in greenhouse experiments to evaluate the effects of the identity of predatory ants (i.e., the consumption of prey and nest sites on the nutrition and growth of the bromeliad Quesnelia arvensis. We showed that predatory ants with protein-based nutrition (i.e., Odontomachus hastatus, Gnamptogenys moelleri improved the performance of their host bromeliads (i.e., increased foliar N, production of soluble proteins and growth. On the other hand, the contribution of Camponotus crassus for the nutritional status of bromeliads did not differ from bromeliads without ants, possibly because this ant does not have arthropod prey as a preferred food source. Our results show, for the first time, that predatory ants can translocate nutrients from one habitat to another within forests, accumulating nutrients in their feeding sites that become available to bromeliads. Additionally, we highlight that ant contribution to plant nutrition may depend on predator identity and its dietary requirements. Nest debris may be especially important for epiphytic and terrestrial bromeliads in nutrient-poor environments.

  20. New fossil ants in French Cretaceous amber (Hymenoptera: Formicidae)

    Science.gov (United States)

    Perrichot, Vincent; Nel, André; Néraudeau, Didier; Lacau, Sébastien; Guyot, Thierry

    2008-02-01

    Recent studies on the ant phylogeny are mainly based on the molecular analyses of extant subfamilies and do not include the extinct, only Cretaceous subfamily Sphecomyrminae. However, the latter is of major importance for ant relationships, as it is considered the most basal subfamily. Therefore, each new discovery of a Mesozoic ant is of high interest for improving our understanding of their early history and basal relationships. In this paper, a new sphecomyrmine ant, allied to the Burmese amber genus Haidomyrmex, is described from mid-Cretaceous amber of France as Haidomyrmodes mammuthus gen. and sp. n. The diagnosis of the tribe Haidomyrmecini is emended based on the new type material, which includes a gyne (alate female) and two incomplete workers. The genus Sphecomyrmodes, hitherto known by a single species from Burmese amber, is also reported and a new species described as S. occidentalis sp. n. after two workers remarkably preserved in a single piece of Early Cenomanian French amber. The new fossils provide additional information on early ant diversity and relationships and demonstrate that the monophyly of the Sphecomyrminae, as currently defined, is still weakly supported.

  1. Ants farm subterranean aphids mostly in single clone groups

    DEFF Research Database (Denmark)

    Ivens, Aniek B.F.; Kronauer, Daniel Jan Christoph; Pen, Ido

    2012-01-01

    mutualisms have been studied in sufficient genetic detail to address these issues, so we decided to characterize symbiont diversity in the complex mutualism between multiple root aphid species and Lasius flavus ants. After showing elsewhere that three of these aphid species have low dispersal and mostly...... if not exclusively asexual reproduction, we here investigate aphid diversity within and between ant nest mounds. Results The three focal species (Geoica utricularia, Forda marginata and Tetraneura ulmi) had considerable clonal diversity at the population level. Yet more than half of the ant mounds contained just....... The ants appear to eat most of the early instar aphids, so that adult aphids are unlikely to face limited phloem resources and scramble competition with other aphids. We suggest that such culling of carbohydrate-providing symbionts for protein ingestion may maintain maximal host yield per aphid while also...

  2. Novel fungal disease in complex leaf-cutting ant societies

    DEFF Research Database (Denmark)

    Hughes, David Peter; Evans, Harry C.; Hywel-Jones, Nigel

    2009-01-01

    1. The leaf-cutting ants practise an advanced system of mycophagy where they grow a fungus as a food source. As a consequence of parasite threats to their crops, they have evolved a system of morphological, behavioural, and chemical defences, particularly against fungal pathogens (mycopathogens). 2....... Specific fungal diseases of the leaf-cutting ants themselves have not been described, possibly because broad spectrum anti-fungal defences against mycopathogens have reduced their susceptibility to entomopathogens. 3. Using morphological and molecular tools, the present study documents three rare infection...... events of Acromyrmex and Atta leaf-cutting ants by Ophiocordyceps fungi, agenus of entomopathogens that is normally highly specific in its host choice. 4. As leaf-cutting ants have been intensively studied, the absence of prior records of Ophiocordyceps suggests that these infections may be a novel event...

  3. Operant conditioning in the ant Myrmica sabuleti.

    Science.gov (United States)

    Cammaerts, M C

    2004-11-30

    Operant conditioning could be obtained in the ant Myrmica sabuleti by presenting to the workers, during a six-day period, an apparatus containing either sugared water or meat as a reward. The conditioning obtained using sugared water as a reward was short lasting. A reconditioning was more persistent and lasted four hours. The ants' response was very precise, since they exhibited it only in front of an apparatus identical to that used during the training phase. Operant conditioning obtained using meat as a reward was more pronounced than that obtained by using sugared water, probably because meat is more valuable as a reward than sugar for the species studied, which is essentially a carnivorous one. Such a conditioning was rather persistent. Indeed, a first operant conditioning obtained by using meat as a reward could still be detected after seven hours, and a reconditioning was still significant after eight hours. One day after this eight-hour period without rewarding the ants, the response was higher again and a further day later, it was still significant. Since the operant conditioning is easy to perform and quantify and since the ants' response is very precise, such a conditioning can be used for further studying M. sabuleti workers' visual perception.

  4. Ant parasite queens revert to mating singly

    DEFF Research Database (Denmark)

    Sumner, Seirian; Hughes, William Owen Hamar; Pedersen, Jes Søe

    2004-01-01

    quantified and they tend to be similar in related species. Here we compare the mating strategies of the leaf-cutting ant Acromyrmex echinatior and its recently derived social parasite Acromyrmex insinuator, which is also its closest relative 2 (see Fig. 1 ). We find that although the host queens mate with up......A parasitic ant has abandoned the multiple mating habit of the queens of its related host. Multiple mating (polyandry) is widespread among animal groups, particularly insects 1 . But the factors that maintain it and underlie its evolution are hard to verify because benefits and costs are not easily...... to a dozen different males, the social parasite mates only singly. This rapid and surprising reversion to single mating in a socially parasitic ant indicates that the costs of polyandry are probably specific to a free-living lifestyle....

  5. The worldwide expansion of the Argentine ant

    DEFF Research Database (Denmark)

    Vogel, Valerie; Pedersen, Jes Søe; Giraud, Tatiana

    2010-01-01

    Aim The aim of this study was to determine the number of successful establishments of the invasive Argentine ant outside native range and to see whether introduced supercolonies have resulted from single or multiple introductions. We also compared the genetic diversity of native versus introduced...... supercolonies to assess the size of the propagules (i.e. the number of founding individuals) at the origin of the introduced supercolonies. Location Global. Methods We used mitochondrial DNA (mtDNA) markers and microsatellite loci to study 39 supercolonies of the Argentine ant Linepithema humile covering both......) and secondary introductions (from sites with established invasive supercolonies) were important in the global expansion of the Argentine ant. In combination with the similar social organization of colonies in the native and introduced range, this indicates that invasiveness did not evolve recently as a unique...

  6. Urban physiology: city ants possess high heat tolerance.

    Directory of Open Access Journals (Sweden)

    Michael J Angilletta

    Full Text Available Urbanization has caused regional increases in temperature that exceed those measured on a global scale, leading to urban heat islands as much as 12 degrees C hotter than their surroundings. Optimality models predict ectotherms in urban areas should tolerate heat better and cold worse than ectotherms in rural areas. We tested these predications by measuring heat and cold tolerances of leaf-cutter ants from South America's largest city (São Paulo, Brazil. Specifically, we compared thermal tolerances of ants from inside and outside of the city. Knock-down resistance and chill-coma recovery were used as indicators of heat and cold tolerances, respectively. Ants from within the city took 20% longer to lose mobility at 42 degrees C than ants from outside the city. Interestingly, greater heat tolerance came at no obvious expense of cold tolerance; hence, our observations only partially support current theory. Our results indicate that thermal tolerances of some organisms can respond to rapid changes in climate. Predictive models should account for acclimatory and evolutionary responses during climate change.

  7. Extrafloral nectar fuels ant life in deserts

    OpenAIRE

    Aranda-Rickert, Adriana; Diez, Patricia; Marazzi, Brigitte

    2014-01-01

    Interactions mediated by extrafloral nectary (EFN)-bearing plants that reward ants with a sweet liquid secretion are well documented in temperate and tropical habitats. However, their distribution and abundance in deserts are poorly known. In this study, we test the predictions that biotic interactions between EFN plants and ants are abundant and common also in arid communities and that EFNs are only functional when new vegetative and reproductive structures are developing. In a seasonal dese...

  8. Antígonas. Una visión intertextual

    Directory of Open Access Journals (Sweden)

    Elena Cano Turrión

    2011-04-01

    Full Text Available In this article and from an intertextual point of view, we will try to examine how theSophoclean hypotext has generated three very different hypertexts. The first one is the short story“Antígona o la elección” by M. Yourcenar, which goes further the religious motivation in the originaltext; then, there is an essay written as a dialogue by Maria Zambrano, entitled La tumba de Antígonawhich main topics are confrontation against power, lack of freedom and destiny and faith in humanconscience. Finally, Luis Riaza’s Antígona…¡Cerda! Appears closer to its hypotext but at the same timesemantic deviation becomes more relevant.

  9. Reaction of mutualistic and granivorous ants to ulex elaiosome chemicals.

    Science.gov (United States)

    Gammans, Nicola; Bullock, James M; Gibbons, Hannah; Schönrogge, Karsten

    2006-09-01

    It has been proposed that chemicals on plant elaiosomes aid seed detection by seed-dispersing ants. We hypothesized that the chemical interaction between ants and elaiosomes is more intimate than a generic attraction, and that elaiosome chemicals will attract mutualistic but not granivorous ant species. We investigated this by using two gorse species, Ulex minor and U. europaeus, and two associated ant species from European heathlands, the mutualist Myrmica ruginodis and the granivore Tetramorium caespitum. Behavioral studies were conducted with laboratory nests and foraging arenas. Both ants will take Ulex seeds, but while M. ruginodis showed increased antennation toward ether extracts of elaiosome surface chemicals compared with controls, T. caespitum showed no response. Elaiosome extracts were separated into seven lipid fractions. M. ruginodis showed increased antennation only toward the diglyceride fractions of both Ulex species, whereas T. caespitum showed no consistent reaction. This indicates that M. ruginodis can detect the elaiosome by responding to its surface chemicals, but T. caespitum is unresponsive to these chemicals. Responses to surface chemicals could increase the rate of seed detection in the field, and so these results suggest that Ulex elaiosomes produce chemicals that facilitate attraction of mutualistic rather than granivorous ant species. This could reduce seed predation and increase Ulex fitness.

  10. [Syagrus romanzoffiana (Arecaceae) seed utilization by ants in a secondary forest in South Brazil].

    Science.gov (United States)

    Silva, Fernanda R; Begnini, Romualdo M; Klier, Vinícius A; Scherer, Karla Z; Lopes, Benedito C; Castellani, Tânia T

    2009-01-01

    Ants can nest in a wide variety of substracts. This paper shows Syagrus romanzoffiana seed utilization by ants in an Atlantic secondary forest. We report 29 seeds occupied by small-bodied ants, with 27 of them showing at least two ant development stages. Although a large number of seeds were sampled, a low level of ant occupation was observed.

  11. Recognition of social identity in ants

    Directory of Open Access Journals (Sweden)

    Nick eBos

    2012-03-01

    Full Text Available Recognizing the identity of others, from the individual to the group level, is a hallmark of society. Ants, and other social insects, have evolved advanced societies characterized by efficient social recognition systems. Colony identity is mediated by colony specific signature mixtures, a blend of hydrocarbons present on the cuticle of every individual (the label. Recognition occurs when an ant encounters another individual, and compares the label it perceives to an internal representation of its own colony odor (the template. A mismatch between label and template leads to rejection of the encountered individual. Although advances have been made in our understanding of how the label is produced and acquired, contradictory evidence exists about information processing of recognition cues. Here, we review the literature on template acquisition in ants and address how and when the template is formed, where in the nervous system it is localized, and the possible role of learning. We combine seemingly contradictory evidence in to a novel, parsimonious theory for the information processing of nestmate recognition cues.

  12. In vitro studies of ante-mortem proliferation kinetics

    International Nuclear Information System (INIS)

    McBride, W.H.; Withers, H.R.

    1986-01-01

    Using K562 human erythroblastoid cells, it was concluded that dose fractionation has no discrepant effect on the ante-mortem proliferation kinetics of doomed cells as opposed to clonogenic cell survival and that effects on ante-mortem proliferation kinetics cannot be solely responsible for the differences in fractionation response between early and late responding tissues. (UK)

  13. Bacteria may contribute to distant species recognition in ant-aphid mutualistic relationships.

    Science.gov (United States)

    Fischer, Christophe Y; Detrain, Claire; Thonart, Philippe; Haubruge, Eric; Francis, Frédéric; Verheggen, François J; Lognay, Georges C

    2017-04-01

    Mutualistic interactions between ant and aphid species have been the subject of considerable historical and contemporary investigations, the primary benefits being cleaning and protection for the aphids and carbohydrate-rich honeydew for the ants. Questions remained, however, as to the volatile semiochemical factor influencing this relationship. A recent study highlighted the role of bacterial honeydew volatile compounds in ant attraction. Here, ant's ability to distantly discriminate 2 aphid species was investigated based on bacterial honeydew semiochemicals emissions using a two-way olfactometer. Both the mutualistic aphid Aphis fabae L. and the nonmyrmecophilous aphid Acyrthosiphon pisum Harris were found to be attractive for the ant Lasius niger L. The level of attraction was similar in both assays (control vs. one of the aphid species). However, when given a choice between these 2 aphid species, ants showed a significant preference for Aphis fabae. Honeydew volatiles, mostly from bacterial origins, are known to be a key element in ant attraction. Using the same olfactometry protocol, the relative attractiveness of volatiles emitted by honeydews collected from each aphid species and by bacteria isolated from each honeydew was investigated. Again, ants significantly preferred volatiles released by Aphis fabae honeydew and bacteria. This information suggests that microbial honeydew volatiles enable ants to distantly discriminate aphid species. These results strengthen the interest of studying the occurrence and potential impact of microorganisms in insect symbioses. © 2015 Institute of Zoology, Chinese Academy of Sciences.

  14. Targeted removal of ant colonies in ecological experiments, using hot water.

    Science.gov (United States)

    Tschinkel, Walter R; King, Joshua R

    2007-01-01

    Ecological experiments on fire ants cannot, or should not, use poison baits to eliminate the fire ants because such baits are not specific to fire ants, or even to ants. Hot water is an extremely effective and specific killing agent for fire ant colonies, but producing large amounts of hot water in the field, and making the production apparatus mobile have been problematical. The construction and use of a charcoal-fired kiln made from a 55-gal. oil drum lined with a sand-fireclay mixture is described. An automobile heater fan powered from a 12-v battery provided a draft. Dual bilge pumps pumped water from a large tank through a long coil of copper tubing within the kiln to produce 4 to 5 l. of hot water per min. The hot water was collected in 20 l. buckets and poured into fire ant nests previously opened by piercing with a stick. The entire assembly was transported in and operated from the back of a pickup truck. Five experimental plots containing 32 to 38 colonies of the fire ant, Solenopsis invicta, Buren (Hymenoptera: Formicidae), were treated with hot water over a period of two years. All colonies on the treatment plots were treated twice with hot water early in 2004, reducing their numbers to zero. However new colonies were formed, and mature colonies expanded into the plots. A third treatment was made in the spring of 2005, after which fire ant populations were suppressed for over a year. Whereas the 5 control plots contained a total of 166 mostly large colonies, the 5 treatment plots contained no live colonies at all. Averaged over a two-year period, a 70% reduction in total number of colonies was achieved (P ants.

  15. The genomic impact of 100 million years of social evolution in seven ant species

    DEFF Research Database (Denmark)

    Gadau, Jürgen; Helmkampf, Martin; Nygaard, Sanne

    2012-01-01

    Ants (Hymenoptera, Formicidae) represent one of the most successful eusocial taxa in terms of both their geographic distribution and species number. The publication of seven ant genomes within the past year was a quantum leap for socio- and ant genomics. The diversity of social organization in ants...... between social and solitary insects, as well as among ant species. Altogether, these seven ant genomes open exciting new research avenues and opportunities for understanding the genetic basis and regulation of social species, and adaptive complex systems in general....... makes them excellent model organisms to study the evolution of social systems. Comparing the ant genomes with those of the honeybee, a lineage that evolved eusociality independently from ants, and solitary insects suggests that there are significant differences in key aspects of genome organization...

  16. Two castes sizes of leafcutter ants in task partitioning in foraging activity

    Directory of Open Access Journals (Sweden)

    Marcelo Arruda de Toledo

    Full Text Available ABSTRACT: Task partitioning in eusocial animals is most likely an evolutionary adaptation that optimizes the efficiency of the colony to grow and reproduce. It was investigated indirect task partitioning in two castes sizes; this involves task partitioning in which the material transported is not transferred directly from one individual to another, but where it is dropped by one ant to be picked up by another. In two separate approaches, it was confirmed previous results pertaining to leaf caching activities among Atta colombica with task partitioning activities involving leaf dropping among Atta sexdens rubropilosa , in which there is a correlation between the size of an individual ant and the leaf fragment it transports. It was also suggested that this correlation exists only in individual ants that cut and transport (CaT the same fragment to the nest. When task partitioning occurs and individual ants transporting (T leaf fragments cut by other ants, the correlation becomes looser or disappears. We also observed that CaT ants are smaller than T ants.

  17. Infection of army ant pupae by two new parasitoid mites (Mesostigmata: Uropodina

    Directory of Open Access Journals (Sweden)

    Adrian Brückner

    2017-10-01

    Full Text Available A great variety of parasites and parasitoids exploit ant societies. Among them are the Mesostigmata mites, a particularly common and diverse group of ant-associated arthropods. While parasitism is ubiquitous in Mesostigmata, parasitoidism has only been described in the genus Macrodinychus. Yet information about the basic biology of most Macrodinychus species is lacking. Out of 24 formally described species, information about basic life-history traits is only available for three species. Here we formally describe two new Macrodinychus species, i.e. Macrodinychus hilpertae and Macrodinychus derbyensis. In both species, immature stages developed as ecto-parasitoids on ant pupae of the South-East Asian army ant Leptogenys distinguenda. By piercing the developing ant with their chelicera, the mites apparently suck ant hemolymph, ultimately killing host individuals. We compare infection rates among all studied Macrodinychus species and discuss possible host countermeasures against parasitoidism. The cryptic lifestyle of living inside ant nests has certainly hampered the scientific discovery of Macrodinychus mites and we expect that many more macrodinychid species await scientific discovery and description.

  18. Infection of army ant pupae by two new parasitoid mites (Mesostigmata: Uropodina).

    Science.gov (United States)

    Brückner, Adrian; Klompen, Hans; Bruce, Andrew Iain; Hashim, Rosli; von Beeren, Christoph

    2017-01-01

    A great variety of parasites and parasitoids exploit ant societies. Among them are the Mesostigmata mites, a particularly common and diverse group of ant-associated arthropods. While parasitism is ubiquitous in Mesostigmata, parasitoidism has only been described in the genus Macrodinychus . Yet information about the basic biology of most Macrodinychus species is lacking. Out of 24 formally described species, information about basic life-history traits is only available for three species. Here we formally describe two new Macrodinychus species, i.e. Macrodinychus hilpertae and Macrodinychus derbyensis . In both species, immature stages developed as ecto-parasitoids on ant pupae of the South-East Asian army ant Leptogenys distinguenda . By piercing the developing ant with their chelicera, the mites apparently suck ant hemolymph, ultimately killing host individuals. We compare infection rates among all studied Macrodinychus species and discuss possible host countermeasures against parasitoidism. The cryptic lifestyle of living inside ant nests has certainly hampered the scientific discovery of Macrodinychus mites and we expect that many more macrodinychid species await scientific discovery and description.

  19. Evidences that human disturbance simplify the ant fauna associated a Stachytarpheta glabra Cham. (Verbenaceae compromising the benefits of ant-plant mutualism

    Directory of Open Access Journals (Sweden)

    BC. Barbosa

    Full Text Available Interaction among species, like ants and plants through extrafloral nectaries (EFNs, are important components of ecological communities’ evolution. However, the effect of human disturbance on such specific interactions and its ecological consequences is poorly understood. This study evaluated the outcomes of mutualism between ants and the EFN-bearing plant Stachytarpheta glabra under anthropogenic disturbance. We compared the arthropod fauna composition between two groups of twenty plant individuals, one in an area disturbed by human activities and one in a preserved area. We also check the plant investment in herbivory defense and the consequential leaf damage by herbivore. Our results indicate that such disturbances cause simplification of the associated fauna and lack of proper ant mutualist. This led to four times more herbivory on plants of disturbed areas, despite the equal amount of EFN and ant visitors and low abundance of herbivores. The high pressure of herbivory may difficult the re-establishment of S. glabra, an important pioneer species in ferruginous fields, therefore it may affect resilience of this fragile ecological community.

  20. Olfactory memory established during trophallaxis affects food search behaviour in ants.

    Science.gov (United States)

    Provecho, Yael; Josens, Roxana

    2009-10-01

    Camponotus mus ants can associate sucrose and odour at the source during successive foraging cycles and use this memory to locate the nectar in the absence of other cues. These ants perform conspicuous trophallactic behaviour during recruitment while foraging for nectar. In this work, we studied whether Camponotus mus ants are able to establish this odour-sucrose association in the social context of trophallaxis and we evaluated this memory in another context previously experienced by the ant, as a nectar source. After a single trophallaxis of a scented solution, the receiver ant was tested in a Y-maze without any reward, where two scents were presented: in one arm, the solution scent and in the other, a new scent. Ants consistently chose the arm with the solution scent and stayed longer therein. Trophallaxis duration had no effect on the arm choice or with the time spent in each arm. Workers are able to associate an odour (conditioned stimulus) with the sucrose (unconditioned stimulus) they receive through a social interaction and use this memory as choice criteria during food searching.

  1. USING ANT COMMUNITIES FOR RAPID ASSESSMENT OF TERRESTRIAL ECOSYSTEM HEALTH

    Energy Technology Data Exchange (ETDEWEB)

    Wike, L; Doug Martin, D; Michael Paller, M; Eric Nelson, E

    2007-01-12

    Ecosystem health with its near infinite number of variables is difficult to measure, and there are many opinions as to which variables are most important, most easily measured, and most robust, Bioassessment avoids the controversy of choosing which physical and chemical parameters to measure because it uses responses of a community of organisms that integrate all aspects of the system in question. A variety of bioassessment methods have been successfully applied to aquatic ecosystems using fish and macroinvertebrate communities. Terrestrial biotic index methods are less developed than those for aquatic systems and we are seeking to address this problem here. This study had as its objective to examine the baseline differences in ant communities at different seral stages from clear cut back to mature pine plantation as a precursor to developing a bioassessment protocol. Comparative sampling was conducted at four seral stages; clearcut, 5 year, 15 year and mature pine plantation stands. Soil and vegetation data were collected at each site. All ants collected were preserved in 70% ethyl alcohol and identified to genus. Analysis of the ant data indicates that ants respond strongly to the habitat changes that accompany ecological succession in managed pine forests and that individual genera as well as ant community structure can be used as an indicator of successional change. Ants exhibited relatively high diversity in both early and mature seral stages. High ant diversity in the mature seral stages was likely related to conditions on the forest floor which favored litter dwelling and cool climate specialists.

  2. Novel Phialophora species from leaf-cutting ants (tribe Attini)

    NARCIS (Netherlands)

    Attili-Angelis, D.; Duarte, A.P.M.; Pagnocca, F.C.; Nagamoto, N.S.; de Vries, M.; Stielow, J.B.; de Hoog, G.S.

    2014-01-01

    Ants in the tribe Attini (Hymenoptera, Formicidae) maintain a 50 million-year-old lifestyle of co-evolution with symbiotic basidiomycetous fungi which they cultivate as essential source of nutrition. However, other microorganisms have been reported from ant habitats indicating a higher diversity of

  3. Why do house-hunting ants recruit in both directions?

    NARCIS (Netherlands)

    Planqué, R.; Dechaume-Moncharmont, F.-X.; Franks, N.R.; Kovacs, T.; Marshall, J.A.R.

    2007-01-01

    To perform tasks, organisms often use multiple procedures. Explaining the breadth of such behavioural repertoires is not always straightforward. During house hunting, colonies of Temnothorax albipennis ants use a range of behaviours to organise their emigrations. In particular, the ants use tandem

  4. AntBot: Anti-pollution peer-to-peer botnets

    Energy Technology Data Exchange (ETDEWEB)

    Yan, Guanhua [Los Alamos National Laboratory; Eidenbenz, Stephan [Los Alamos National Laboratory; Ha, Duc T [UNIV. AT BUFFALO

    2009-01-01

    Botnets, which are responsible for many email sparnming and DDoS (Distributed Denial of Service) attacks in the current Internet, have emerged as one of most severe cyber-threats in recent years. To evade detection and improve resistance against countermeasures, botnets have evolved from the first generation that relies on IRC chat channels to deliver commands to the current generation that uses highly resilient P2P (Peer-to-Peer) protocols to spread their C&C (Command and Control) information. It is, however, revealed that P2P botnets, although relieved from the single point of failure that IRC botnets suffer, can be easily disrupted using pollution-based mitigation schemes [15]. In this paper, we play the devil's advocate and propose a new type of hypothetical botnets called AntBot, which aim to propagate their C&C information to individual bots even though there exists an adversary that persistently pollutes keys used by seized bots to search the command information. The key idea of AntBot is a tree-like structure that bots use to deliver the command so that captured bots reveal only limited information. To evaluate effectiveness of AntBot against pollution-based mitigation in a virtual environment, we develop a distributed P2P botnet simulator. Using extensive experiments, we demonstrate that AntBot operates resiliently against pollution-based mitigation. We further present a few potential defense schemes that could effectively disrupt AntBot operations.

  5. Intrapopulation differences in ant eating in the mountain gorillas of Bwindi Impenetrable National Park, Uganda.

    Science.gov (United States)

    Ganas, Jessica; Robbins, Martha M

    2004-10-01

    Variability in ant eating has been observed in several populations of eastern and western gorillas. We investigated the occurrence of ant (Dorylus sp.) eating in two groups of mountain gorillas (Gorilla beringei beringei) with overlapping home ranges within Bwindi Impenetrable National Park, Uganda from September 2001 to August 2002. We calculated the frequency of ant eating by an indirect method of analyzing fecal samples from silverbacks, adult females, and juveniles. One group consumed ants significantly more often than the other (3.3 vs 17.6% of days sampled). Furthermore, the group that consumed ants more often also consumed them on a seasonal basis (September-February monthly range: 0-8%; March-August monthly range: 30-42.9%). Finally, females and juveniles of this group consumed ants significantly more often than did the silverback (total samples containing ants: silverback, 2.1%; adult female, 13.2%; juvenile, 11.2%). Differences in ant eating between groups are likely due to variability in use of habitats where ants occur (particularly secondary forests). Surveys of ant densities in differing habitats, nutritional analysis of ants, and quantification of the amount of ants in their diets are necessary to understand if ant consumption is due to availability, nutritional value, group traditions, or taste preference.

  6. Seasonal dynamics of ant community structure in the Moroccan Argan Forest.

    Science.gov (United States)

    El Keroumi, Abderrahim; Naamani, Khalid; Soummane, Hassna; Dahbi, Abdallah

    2012-01-01

    In this study we describe the structure and composition of ant communities in the endemic Moroccan Argan forest, using pitfall traps sampling technique throughout the four seasons between May 2006 and February 2007. The study focused on two distinct climatic habitats within the Essaouira Argan forest, a semi-continental site at Lahssinate, and a coastal site at Boutazarte. Thirteen different ant species were identified, belonging to seven genera. Monomorium subopacum Smith and Tapinoma simrothi Krausse-Heldrungen (Hymenoptera: Formicidae) were the most abundant and behaviorally dominant ant species in the arganeraie. In addition, more specimens were captured in the semi-continental site than in the coastal area. However, no significant difference was observed in species richness, evenness, or diversity between both sites. Composition and community structure showed clear seasonal dynamics. The number of species, their abundance, their diversity, and their evenness per Argan tree were significantly dissimilar among seasons. The richness (except between summer and autumn), and the abundance and the evenness of ant species among communities, showed a significant difference between the dry period (summer and spring) and the rainy period (winter and autumn). Higher abundance and richness values occurred in the dry period of the year. Ant species dominance and seasonal climatic variations in the arganeraie might be among the main factors affecting the composition, structure, and foraging activity of ant communities. This study, together with recent findings on ant predation behavior below Argan trees, highlights the promising use of dominant ant species as potential agents of Mediterranean fruit fly bio-control in the Argan forest and surrounding ecosystems.

  7. Trail pheromone of the Argentine ant, Linepithema humile (Mayr (Hymenoptera: Formicidae.

    Directory of Open Access Journals (Sweden)

    Dong-Hwan Choe

    Full Text Available The Argentine ant (Linepithema humile is recognized as one of the world's most damaging invasive species. One reason for the ecological dominance of introduced Argentine ant populations is their ability to dominate food and habitat resources through the rapid mobilization and recruitment of thousands of workers. More than 30 years ago, studies showed that (Z-9-hexadecenal strongly attracted Argentine ant workers in a multi-choice olfactometer, suggesting that (Z-9-hexadecenal might be the trail pheromone, or a component of a trail pheromone mixture. Since then, numerous studies have considered (Z-9-hexadecenal as the key component of the Argentine ant trails. Here, we report the first chemical analyses of the trails laid by living Argentine ants and find that (Z-9-hexadecenal is not present in a detectible quantity. Instead, two iridoids, dolichodial and iridomyrmecin, appear to be the primary chemical constituents of the trails. Laboratory choice tests confirmed that Argentine ants were attracted to artificial trails comprised of these two chemicals significantly more often than control trails. Although (Z-9-hexadecenal was not detected in natural trails, supplementation of artificial dolichodial+iridomyrmecin trails with an extremely low concentraion of (Z-9-hexadecenal did increase the efficacy of the trail-following behavior. In stark contrast with previous dogma, our study suggests that dolichodial and iridomyrmecin are major components of the Argentine ant trail pheromone. (Z-9-hexadecenal may act in an additive manner with these iridoids, but it does not occur in detectable quantities in Argentine ant recruitment trails.

  8. The effects of ant nests on soil fertility and plant performance: a meta-analysis.

    Science.gov (United States)

    Farji-Brener, Alejandro G; Werenkraut, Victoria

    2017-07-01

    Ants are recognized as one of the major sources of soil disturbance world-wide. However, this view is largely based on isolated studies and qualitative reviews. Here, for the first time, we quantitatively determined whether ant nests affect soil fertility and plant performance, and identified the possible sources of variation of these effects. Using Bayesian mixed-models meta-analysis, we tested the hypotheses that ant effects on soil fertility and plant performance depend on the substrate sampled, ant feeding type, latitude, habitat and the plant response variable measured. Ant nests showed higher nutrient and cation content than adjacent non-nest soil samples, but similar pH. Nutrient content was higher in ant refuse materials than in nest soils. The fertilizer effect of ant nests was also higher in dry habitats than in grasslands or savannas. Cation content was higher in nests of plant-feeding ants than in nests of omnivorous species, and lower in nests from agro-ecosystems than in nests from any other habitat. Plants showed higher green/root biomass and fitness on ant nests soils than in adjacent, non-nest sites; but plant density and diversity were unaffected by the presence of ant nests. Root growth was particularly higher in refuse materials than in ant nest soils, in leaf-cutting ant nests and in deserts habitats. Our results confirm the major role of ant nests in influencing soil fertility and vegetation patterns and provide information about the factors that mediate these effects. First, ant nests improve soil fertility mainly through the accumulation of refuse materials. Thus, different refuse dump locations (external or in underground nest chambers) could benefit different vegetation life-forms. Second, ant nests could increase plant diversity at larger spatial scales only if the identity of favoured plants changes along environmental gradients (i.e. enhancing β-diversity). Third, ant species that feed on plants play a relevant role fertilizing soils

  9. Specialized Fungal Parasites and Opportunistic Fungi in Gardens of Attine Ants

    Directory of Open Access Journals (Sweden)

    Fernando C. Pagnocca

    2012-01-01

    Full Text Available Ants in the tribe Attini (Hymenoptera: Formicidae comprise about 230 described species that share the same characteristic: all coevolved in an ancient mutualism with basidiomycetous fungi cultivated for food. In this paper we focused on fungi other than the mutualistic cultivar and their roles in the attine ant symbiosis. Specialized fungal parasites in the genus Escovopsis negatively impact the fungus gardens. Many fungal parasites may have small impacts on the ants' fungal colony when the colony is balanced, but then may opportunistically shift to having large impacts if the ants' colony becomes unbalanced.

  10. Ant-caterpillar antagonism at the community level: interhabitat variation of tritrophic interactions in a neotropical savanna.

    Science.gov (United States)

    Sendoya, Sebastián F; Oliveira, Paulo S

    2015-03-01

    Ant foraging on foliage can substantially affect how phytophagous insects use host plants and represents a high predation risk for caterpillars, which are important folivores. Ant-plant-herbivore interactions are especially pervasive in cerrado savanna due to continuous ant visitation to liquid food sources on foliage (extrafloral nectaries, insect honeydew). While searching for liquid rewards on plants, aggressive ants frequently attack or kill insect herbivores, decreasing their numbers. Because ants vary in diet and aggressiveness, their effect on herbivores also varies. Additionally, the differential occurrence of ant attractants (plant and insect exudates) on foliage produces variable levels of ant foraging within local floras and among localities. Here, we investigate how variation of ant communities and of traits among host plant species (presence or absence of ant attractants) can change the effect of carnivores (predatory ants) on herbivore communities (caterpillars) in a cerrado savanna landscape. We sampled caterpillars and foliage-foraging ants in four cerrado localities (70-460 km apart). We found that: (i) caterpillar infestation was negatively related with ant visitation to plants; (ii) this relationship depended on local ant abundance and species composition, and on local preference by ants for plants with liquid attractants; (iii) this was not related to local plant richness or plant size; (iv) the relationship between the presence of ant attractants and caterpillar abundance varied among sites from negative to neutral; and (v) caterpillars feeding on plants with ant attractants are more resistant to ant predation than those feeding on plants lacking attractants. Liquid food on foliage mediates host plant quality for lepidopterans by promoting generalized ant-caterpillar antagonism. Our study in cerrado shows that the negative effects of generalist predatory ants on herbivores are detectable at a community level, affecting patterns of abundance and

  11. Myrmeciza and related antbirds (Aves, Formicariidae as army ant followers

    Directory of Open Access Journals (Sweden)

    Edwin O. Willis

    1984-01-01

    Full Text Available Antbirds of the genera Myrmeciza (including Sipia and Myrmoborus, Gymnocichla, and Sclateria hop near or on the ground in fairly dense vegetation, "pounding" their tails downward. Where dense understory vegetation is widespread and ants move in it for long distances, certain of these antbirds become regular ant followers: M. immaculata and M. fortis in cluttered moist foothill forest from Costa Rica to upper Amazonia; Gymnocichla nudiceps in moist cluttered second growth of Central America to Colombia. Where the forest understory is more open, Myrmeciza species follow ants mainly in cluttered patches: M. exsul in lowland forest west of the Andes, M. myotherina east of the Andes. Myrmeciza or relatives that specialize on water-edge or very dense zones rarely follow ants.

  12. Edge Effects on Community and Social Structure of Northern Temperate Deciduous Forest Ants

    Directory of Open Access Journals (Sweden)

    Valerie S. Banschbach

    2012-01-01

    Full Text Available Determining how ant communities are impacted by challenges from habitat fragmentation, such as edge effects, will help us understand how ants may be used as a bioindicator taxon. To assess the impacts of edge effects upon the ant community in a northern temperate deciduous forest, we studied edge and interior sites in Jericho, VT, USA. The edges we focused upon were created by recreational trails. We censused the ants at these sites for two consecutive growing seasons using pitfall traps and litter plot excavations. We also collected nests of the most common ant species at our study sites, Aphaenogaster rudis, for study of colony demography. Significantly greater total numbers of ants and ant nests were found in the edge sites compared to the interior sites but rarefaction analysis showed no significant difference in species richness. Aphaenogaster rudis was the numerically dominant ant in the habitats sampled but had a greater relative abundance in the interior sites than in the edge sites both in pitfall and litter plot data. Queen number of A. rudis significantly differed between the nests collected in the edge versus the interior sites. Habitat-dependent changes in social structure of ants represent another possible indicator of ecosystem health.

  13. Reciprocal genomic evolution in the ant-fungus agricultural symbiosis

    DEFF Research Database (Denmark)

    Nygaard, Sanne; Hu, Haofu; Li, Cai

    2016-01-01

    The attine ant-fungus agricultural symbiosis evolved over tens of millions of years, producing complex societies with industrial-scale farming analogous to that of humans. Here we document reciprocal shifts in the genomes and transcriptomes of seven fungus-farming ant species and their fungal...

  14. Patterns of male parentage in the fungus-growing ants

    DEFF Research Database (Denmark)

    Villesen, Palle; Boomsma, JJ

    2003-01-01

    Ant queens from eight species, covering three genera of lower and two genera of higher attine ants, have exclusively or predominantly single mating. The ensuing full-sib colonies thus have a strong potential reproductive conflict between the queen and the workers over male production...

  15. Ant Systems for a Dynamic TSP - Ants Caught in a Traffic Jam

    NARCIS (Netherlands)

    Eyckelhof, C.J.; Dorigo, M.; Caro Di, G.; Snoek, M.; Sampels, M.

    2002-01-01

    In this paper we present a new Ants System approach to a dynamic Travelling Salesman Problem. Here the travel times between the cities are subject to change. To handle this dynamism several ways of adapting the pheromone matrix both locally and globally are considered. We show that the strategy of

  16. Comparative studies of the secretome of fungus-growing ants

    DEFF Research Database (Denmark)

    Linde, Tore; Grell, Morten Nedergaard; Schiøtt, Morten

    2009-01-01

    Leafcutter ants of the species Acromyrmex echinatior live in symbiosis with the fungus Leucoagaricus gongylophorus. The ants harvest fragments of leaves and carry them to the nest where they place the material on the fungal colony. The fungus secretes a wide array of proteins to degrade the leaves...... into nutrients that the ants can feed on. The focus of this study is to discover, characterize and compare the secreted proteins. In order to do so cDNA libraries are constructed from mRNA extracted from the fungus material. The most efficient technology to screen cDNA libraries selectively for secreted...

  17. PARAMETER ESTIMATION OF VALVE STICTION USING ANT COLONY OPTIMIZATION

    Directory of Open Access Journals (Sweden)

    S. Kalaivani

    2012-07-01

    Full Text Available In this paper, a procedure for quantifying valve stiction in control loops based on ant colony optimization has been proposed. Pneumatic control valves are widely used in the process industry. The control valve contains non-linearities such as stiction, backlash, and deadband that in turn cause oscillations in the process output. Stiction is one of the long-standing problems and it is the most severe problem in the control valves. Thus the measurement data from an oscillating control loop can be used as a possible diagnostic signal to provide an estimate of the stiction magnitude. Quantification of control valve stiction is still a challenging issue. Prior to doing stiction detection and quantification, it is necessary to choose a suitable model structure to describe control-valve stiction. To understand the stiction phenomenon, the Stenman model is used. Ant Colony Optimization (ACO, an intelligent swarm algorithm, proves effective in various fields. The ACO algorithm is inspired from the natural trail following behaviour of ants. The parameters of the Stenman model are estimated using ant colony optimization, from the input-output data by minimizing the error between the actual stiction model output and the simulated stiction model output. Using ant colony optimization, Stenman model with known nonlinear structure and unknown parameters can be estimated.

  18. Effects of dam-induced landscape fragmentation on amazonian ant-plant mutualistic networks.

    Science.gov (United States)

    Emer, Carine; Venticinque, Eduardo Martins; Fonseca, Carlos Roberto

    2013-08-01

    Mutualistic networks are critical to biological diversity maintenance; however, their structures and functionality may be threatened by a swiftly changing world. In the Amazon, the increasing number of dams poses a large threat to biological diversity because they greatly alter and fragment the surrounding landscape. Tight coevolutionary interactions typical of tropical forests, such as the ant-myrmecophyte mutualism, where the myrmecophyte plants provide domatia nesting space to their symbiotic ants, may be jeopardized by the landscape changes caused by dams. We analyzed 31 ant-myrmecophyte mutualistic networks in undisturbed and disturbed sites surrounding Balbina, the largest Central Amazonian dam. We tested how ant-myrmecophyte networks differ among dam-induced islands, lake edges, and undisturbed forests in terms of species richness, composition, structure, and robustness (number of species remaining in the network after partner extinctions). We also tested how landscape configuration in terms of area, isolation, shape, and neighborhood alters the structure of the ant-myrmecophyte networks on islands. Ant-myrmecophytic networks were highly compartmentalized in undisturbed forests, and the compartments had few strongly connected mutualistic partners. In contrast, networks at lake edges and on islands were not compartmentalized and were negatively affected by island area and isolation in terms of species richness, density, and composition. Habitat loss and fragmentation led to coextinction cascades that contributed to the elimination of entire ant-plant compartments. Furthermore, many myrmecophytic plants in disturbed sites lost their mutualistic ant partners or were colonized by opportunistic, nonspecialized ants. Robustness of ant-myrmecophyte networks on islands was lower than robustness near lake edges and in undisturbed forest and was particularly susceptible to the extinction of plants. Beyond the immediate habitat loss caused by the building of large dams

  19. Hybridization in East African swarm-raiding army ants

    DEFF Research Database (Denmark)

    Kronauer, Daniel Jc; Peters, Marcell K; Schöning, Caspar

    2011-01-01

    Hybridization can have complex effects on evolutionary dynamics in ants because of the combination of haplodiploid sex-determination and eusociality. While hybrid non-reproductive workers have been found in a range of species, examples of gene-flow via hybrid queens and males are rare. We studied...... hybridization in East African army ants (Dorylus subgenus Anomma) using morphology, mitochondrial DNA sequences, and nuclear microsatellites....

  20. Ants at Ton Nga Chang Wildlife Sanctuary, Songkhla

    Directory of Open Access Journals (Sweden)

    Watanasit, S.

    2005-03-01

    Full Text Available The aim of this study was to investigate diversity of ant at Ton Nga Chang Wildlife Sanctuary, Hat Yai, Songkhla. Three line transects (100 m each were randomly set up in 2 types of forest area, disturbed and undisturbed. Hand collecting (HC and leaf litter sampling (LL were applied for ant collection within a time limit of 30 minutes for each method. This study was carried out every month during Febuary 2002- Febuary 2003. The results showed that 206 species were placed under 8 subfamilies: Aenictinae, Cerapachyinae, Dolichoderinae, Formicinae, Leptanillinae, Myrmicinae, Ponerinae and Pseudomyrmecinae. Study sites and collection methods could divide ant species into 2 groups, whereas seasonal change could not distinguish the groups by DCA of multivariate analysis.

  1. Visual cues for the retrieval of landmark memories by navigating wood ants.

    Science.gov (United States)

    Harris, Robert A; Graham, Paul; Collett, Thomas S

    2007-01-23

    Even on short routes, ants can be guided by multiple visual memories. We investigate here the cues controlling memory retrieval as wood ants approach a one- or two-edged landmark to collect sucrose at a point along its base. In such tasks, ants store the desired retinal position of landmark edges at several points along their route. They guide subsequent trips by retrieving the appropriate memory and moving to bring the edges in the scene toward the stored positions. The apparent width of the landmark turns out to be a powerful cue for retrieving the desired retinal position of a landmark edge. Two other potential cues, the landmark's apparent height and the distance that the ant walks, have little effect on memory retrieval. A simple model encapsulates these conclusions and reproduces the ants' routes in several conditions. According to this model, the ant stores a look-up table. Each entry contains the apparent width of the landmark and the desired retinal position of vertical edges. The currently perceived width provides an index for retrieving the associated stored edge positions. The model accounts for the population behavior of ants and the idiosyncratic training routes of individual ants. Our results imply binding between the edge of a shape and its width and, further, imply that assessing the width of a shape does not depend on the presence of any particular local feature, such as a landmark edge. This property makes the ant's retrieval and guidance system relatively robust to edge occlusions.

  2. Ant-inspired density estimation via random walks.

    Science.gov (United States)

    Musco, Cameron; Su, Hsin-Hao; Lynch, Nancy A

    2017-10-03

    Many ant species use distributed population density estimation in applications ranging from quorum sensing, to task allocation, to appraisal of enemy colony strength. It has been shown that ants estimate local population density by tracking encounter rates: The higher the density, the more often the ants bump into each other. We study distributed density estimation from a theoretical perspective. We prove that a group of anonymous agents randomly walking on a grid are able to estimate their density within a small multiplicative error in few steps by measuring their rates of encounter with other agents. Despite dependencies inherent in the fact that nearby agents may collide repeatedly (and, worse, cannot recognize when this happens), our bound nearly matches what would be required to estimate density by independently sampling grid locations. From a biological perspective, our work helps shed light on how ants and other social insects can obtain relatively accurate density estimates via encounter rates. From a technical perspective, our analysis provides tools for understanding complex dependencies in the collision probabilities of multiple random walks. We bound the strength of these dependencies using local mixing properties of the underlying graph. Our results extend beyond the grid to more general graphs, and we discuss applications to size estimation for social networks, density estimation for robot swarms, and random walk-based sampling for sensor networks.

  3. A global database of ant species abundances

    Science.gov (United States)

    Gibb, Heloise; Dunn, Rob R.; Sanders, Nathan J.; Grossman, Blair F.; Photakis, Manoli; Abril, Silvia; Agosti, Donat; Andersen, Alan N.; Angulo, Elena; Armbrecht, Ingre; Arnan, Xavier; Baccaro, Fabricio B.; Bishop, Tom R.; Boulay, Raphael; Bruhl, Carsten; Castracani, Cristina; Cerda, Xim; Del Toro, Israel; Delsinne, Thibaut; Diaz, Mireia; Donoso, David A.; Ellison, Aaron M.; Enriquez, Martha L.; Fayle, Tom M.; Feener Jr., Donald H.; Fisher, Brian L.; Fisher, Robert N.; Fitpatrick, Matthew C.; Gomez, Cristanto; Gotelli, Nicholas J.; Gove, Aaron; Grasso, Donato A.; Groc, Sarah; Guenard, Benoit; Gunawardene, Nihara; Heterick, Brian; Hoffmann, Benjamin; Janda, Milan; Jenkins, Clinton; Kaspari, Michael; Klimes, Petr; Lach, Lori; Laeger, Thomas; Lattke, John; Leponce, Maurice; Lessard, Jean-Philippe; Longino, John; Lucky, Andrea; Luke, Sarah H.; Majer, Jonathan; McGlynn, Terrence P.; Menke, Sean; Mezger, Dirk; Mori, Alessandra; Moses, Jimmy; Munyai, Thinandavha Caswell; Pacheco, Renata; Paknia, Omid; Pearce-Duvet, Jessica; Pfeiffer, Martin; Philpott, Stacy M.; Resasco, Julian; Retana, Javier; Silva, Rogerio R.; Sorger, Magdalena D.; Souza, Jorge; Suarez, Andrew V.; Tista, Melanie; Vasconcelos, Heraldo L.; Vonshak, Merav; Weiser, Michael D.; Yates, Michelle; Parr, Catherine L.

    2017-01-01

    What forces structure ecological assemblages? A key limitation to general insights about assemblage structure is the availability of data that are collected at a small spatial grain (local assemblages) and a large spatial extent (global coverage). Here, we present published and unpublished data from 51,388 ant abundance and occurrence records of more than 2693 species and 7953 morphospecies from local assemblages collected at 4212 locations around the world. Ants were selected because they are diverse and abundant globally, comprise a large fraction of animal biomass in most terrestrial communities, and are key contributors to a range of ecosystem functions. Data were collected between 1949 and 2014, and include, for each geo-referenced sampling site, both the identity of the ants collected and details of sampling design, habitat type and degree of disturbance. The aim of compiling this dataset was to provide comprehensive species abundance data in order to test relationships between assemblage structure and environmental and biogeographic factors. Data were collected using a variety of standardised methods, such as pitfall and Winkler traps, and will be valuable for studies investigating large-scale forces structuring local assemblages. Understanding such relationships is particularly critical under current rates of global change. We encourage authors holding additional data on systematically collected ant assemblages, especially those in dry and cold, and remote areas, to contact us and contribute their data to this growing dataset.

  4. Effects of invasive European fire ants (Myrmica rubra on herring gull (Larus argentatus reproduction.

    Directory of Open Access Journals (Sweden)

    Luke E DeFisher

    Full Text Available Various invasive ant species have negatively affected reproductive success in birds by disrupting nest site selection, incubation patterns, food supply, and by direct predation on nestlings. Impacts can be particularly severe when non-native ants colonize seabird nesting islands where thousands of birds may nest in high densities on the ground or in burrows or crevices. Here we report on the first documented effects of Myrmica rubra, the European fire ant, on the reproduction of birds in its non-native range. We documented herring gulls (Larus argentatus on Appledore Island, Maine, engaging in more erratic incubation behaviors at nests infested by the ants. Newly-hatched chicks in some nests were swarmed by ants, leading to rapid chick death. Due to high overall rates of chick mortality, survival probabilities did not vary between nests with and without ant activity, however chick growth rates were slower at nests with ants than at ant-free nests. Ant infestation likely leads to longer-term fitness consequences because slower growth rates early in life may ultimately lead to lower post-fledging survival probabilities.

  5. Studies of laboulbeniales (Fungi, Ascomycota) on myrmica ants (II)

    NARCIS (Netherlands)

    Haelewaters, Danny; Boer, Peter; Gort, Gerrit; Noordijk, Jinze

    2015-01-01

    One group of important insect parasites are the Laboulbeniales (Ascomycota), microscopic fungi that live attached to the exterior of their hosts, mainly beetles, but also mites, millipedes, earwigs, and ants. Rickia wasmannii is a common fungus in Europe and is limited to the ant genus Myrmica

  6. Disease dynamics in a specialized parasite of ant societies.

    Directory of Open Access Journals (Sweden)

    Sandra B Andersen

    Full Text Available Coevolution between ant colonies and their rare specialized parasites are intriguing, because lethal infections of workers may correspond to tolerable chronic diseases of colonies, but the parasite adaptations that allow stable coexistence with ants are virtually unknown. We explore the trade-offs experienced by Ophiocordyceps parasites manipulating ants into dying in nearby graveyards. We used field data from Brazil and Thailand to parameterize and fit a model for the growth rate of graveyards. We show that parasite pressure is much lower than the abundance of ant cadavers suggests and that hyperparasites often castrate Ophiocordyceps. However, once fruiting bodies become sexually mature they appear robust. Such parasite life-history traits are consistent with iteroparity--a reproductive strategy rarely considered in fungi. We discuss how tropical habitats with high biodiversity of hyperparasites and high spore mortality has likely been crucial for the evolution and maintenance of iteroparity in parasites with low dispersal potential.

  7. A new fire ant (Hymenoptera: Formicidae) bait base carrier for moist conditions.

    Science.gov (United States)

    Kafle, Lekhnath; Wu, Wen-Jer; Shih, Cheng-Jen

    2010-10-01

    A new water-resistant fire ant bait (T-bait; cypermethrin 0.128%) consisting of dried distillers grains with solubles (DDGS) as a carrier was developed and evaluated against a standard commercial bait (Advion; indoxacarb 0.045%) under both laboratory and field conditions. When applying the normal T-bait or Advion in the laboratory, 100% of Solenopsis invicta Buren worker ants were killed within 4 days. However, when the T-bait and Advion were wetted, 70.6 and 39.7% of the ants were killed respectively. Under field conditions, dry T-bait and dry Advion had almost the same efficacy against ant colonies. However, when T-bait and Advion came in contact with water, the former's ability to kill S. invicta colonies in the field was only marginally reduced, while Advion lost virtually all of its activity. In addition, DDGS was also shown to be compatible with a number of other insecticides, such as d-allethrin, permethrin and pyrethrin. Based on its properties of remaining attractive to the fire ants when wetted, combined with its ant-killing abilities both in the laboratory and in the field, T-bait is an efficient fire ant bait, especially under moist conditions.

  8. Coevolved crypts and exocrine glands support mutualistic bacteria in fungus-growing ants

    DEFF Research Database (Denmark)

    Currie, Cameron R; Poulsen, Michael; Mendenhall, John

    2006-01-01

    Attine ants engage in a quadripartite symbiosis with fungi they cultivate for food, specialized garden parasites, and parasite-inhibiting bacteria. Molecular phylogenetic evidence supports an ancient host-pathogen association between the ant-cultivar mutualism and the garden parasite. Here we show...... that ants rear the antibiotic-producing bacteria in elaborate cuticular crypts, supported by unique exocrine glands, and that these structures have been highly modified across the ants' evolutionary history. This specialized structural evolution, together with the absence of these bacteria and modifications...

  9. Absence of jamming in ant trails: feedback control of self-propulsion and noise.

    Science.gov (United States)

    Chaudhuri, Debasish; Nagar, Apoorva

    2015-01-01

    We present a model of ant traffic considering individual ants as self-propelled particles undergoing single-file motion on a one-dimensional trail. Recent experiments on unidirectional ant traffic in well-formed natural trails showed that the collective velocity of ants remains approximately unchanged, leading to the absence of jamming even at very high densities [John et al., Phys. Rev. Lett. 102, 108001 (2009)]. Assuming a feedback control mechanism of self-propulsion force generated by each ant using information about the distance from the ant in front, our model captures all the main features observed in the experiment. The distance headway distribution shows a maximum corresponding to separations within clusters. The position of this maximum remains independent of average number density. We find a non-equilibrium first-order transition, with the formation of an infinite cluster at a threshold density where all the ants in the system suddenly become part of a single cluster.

  10. Macrodinychus mites as parasitoids of invasive ants: an overlooked parasitic association.

    Science.gov (United States)

    Lachaud, Jean-Paul; Klompen, Hans; Pérez-Lachaud, Gabriela

    2016-07-21

    Mites are frequent ant symbionts, yet the exact nature of their interactions with their hosts is poorly known. Generally, myrmecophilous mites show adaptations for dispersal through phoresis, but species that lack such an adaptation may have evolved unusual specialized relationships with their hosts. The immature stages of Macrodinychus multispinosus develop as ectoparasitoids of pupae of the invasive ant Paratrechina longicornis. Feeding stages show regressed locomotor appendages. These mites complete their development on a single host, sucking all of its body content and therefore killing it. Locally high proportions of parasitized host pupae suggest that M. multispinosus could serve as a biological control agent. This is the ninth species of Macrodinychus reported as ant parasite, and the third known as parasitoid of invasive ants, confirming a unique habit in the evolution of mite feeding strategies and suggesting that the entire genus might be parasitic on ants. Several mites' characteristics, such as their protective morphology, possible viviparity, lack of a specialized stage for phoretic dispersal, and low host specificity, combined with both the general low aggressiveness of invasive P. longicornis towards other ants and its possible susceptibility to generalist ectoparasites would account for the host shift in native macrodinychid mites.

  11. Tree-Dwelling Ants: Contrasting Two Brazilian Cerrado Plant Species without Extrafloral Nectaries

    Directory of Open Access Journals (Sweden)

    Jonas Maravalhas

    2012-01-01

    Full Text Available Ants dominate vegetation stratum, exploiting resources like extrafloral nectaries (EFNs and insect honeydew. These interactions are frequent in Brazilian cerrado and are well known, but few studies compare ant fauna and explored resources between plant species. We surveyed two cerrado plants without EFNs, Roupala montana (found on preserved environments of our study area and Solanum lycocarpum (disturbed ones. Ants were collected and identified, and resources on each plant noted. Ant frequency and richness were higher on R. montana (67%; 35 spp than S. lycocarpum (52%; 26, the occurrence of the common ant species varied between them, and similarity was low. Resources were explored mainly by Camponotus crassus and consisted of scale insects, aphids, and floral nectaries on R. montana and two treehopper species on S. lycocarpum. Ants have a high diversity on cerrado plants, exploring liquid and prey-based resources that vary in time and space and affect their presence on plants.

  12. Ants use partner specific odors to learn to recognize a mutualistic partner.

    Directory of Open Access Journals (Sweden)

    Masaru K Hojo

    Full Text Available Regulation via interspecific communication is an important for the maintenance of many mutualisms. However, mechanisms underlying the evolution of partner communication are poorly understood for many mutualisms. Here we show, in an ant-lycaenid butterfly mutualism, that attendant ants selectively learn to recognize and interact cooperatively with a partner. Workers of the ant Pristomyrmex punctatus learn to associate cuticular hydrocarbons of mutualistic Narathura japonica caterpillars with food rewards and, as a result, are more likely to tend the caterpillars. However, the workers do not learn to associate the cuticular hydrocarbons of caterpillars of a non-ant-associated lycaenid, Lycaena phlaeas, with artificial food rewards. Chemical analysis revealed cuticular hydrocarbon profiles of the mutualistic caterpillars were complex compared with those of non-ant-associated caterpillars. Our results suggest that partner-recognition based on partner-specific chemical signals and cognitive abilities of workers are important mechanisms underlying the evolution and maintenance of mutualism with ants.

  13. A diverse ant fauna from the mid-cretaceous of Myanmar (Hymenoptera: Formicidae.

    Directory of Open Access Journals (Sweden)

    Phillip Barden

    Full Text Available A new collection of 24 wingless ant specimens from mid-Cretaceous Burmese amber (Albian-Cenomanian, 99 Ma comprises nine new species belonging to the genus Sphecomyrmodes Engel and Grimaldi. Described taxa vary considerably with regard to total size, head and body proportion, cuticular sculpturing, and petiole structure while all species are unified by a distinct shared character. The assemblage represents the largest known diversification of closely related Cretaceous ants with respect to species number. These stem-group ants exhibit some characteristics previously known only from their extant counterparts along with presumed plesiomorphic morphology. Consequently, their morphology may inform hypotheses relating to basal relationships and general patterns of ant evolution. These and other uncovered Cretaceous species indicate that stem-group ants are not simply wasp-like, transitional formicids, but rather a group of considerable adaptive diversity, exhibiting innovations analogous to what crown-group ants would echo 100 million years later.

  14. A preliminary checklist of the ants (Hymenoptera: Formicidae) of ...

    African Journals Online (AJOL)

    A preliminary species checklist of the ants (Hymenoptera: Formicidae) of. Kakamega Forest, Western Kenya, is presented. The species list is based on specimens sampled from 1999 until 2009, which are deposited in the ant collection of the Zoological Research Museum Koenig, Bonn, Germany, and the Natural History ...

  15. Automatic optimization of a nuclear reactor reload using the algorithm Ant-Q; A otimizacao automatica da recarga nuclear utilizando o algoritmo Ant-Q

    Energy Technology Data Exchange (ETDEWEB)

    Machado, Liana; Schirru, Roberto [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia. Programa de Engenharia Nuclear

    2002-07-01

    The nuclear fuel reload optimization is a NP-Complete combinatorial optimization problem. For decades this problem was solved using an expert's knowledge. From the eighties, however there have been efforts to automatic fuel reload and the more recent ones show the Genetic Algorithm's (GA) efficiency on this problem. Following this trend, our aim is to optimization nuclear fuel reload using Ant-Q, artificial theory based algorithms. Ant-Q's results on the Traveling salesman Problem, which is conceptuality similar to fuel reload, are better than GA's. Ant-Q was tested in real application on the cycle 7 reload of Angra I. Comparing Ant-Q result with the GA's, it can be verified that, even without a local heuristics, the former algorithm, as it superiority comparing the GA in Angra I show. Is a valid technique to solve the nuclear fuel reload problem. (author)

  16. Characterization of actinobacteria associated with three ant-plant mutualisms.

    Science.gov (United States)

    Hanshew, Alissa S; McDonald, Bradon R; Díaz Díaz, Carol; Djiéto-Lordon, Champlain; Blatrix, Rumsaïs; Currie, Cameron R

    2015-01-01

    Ant-plant mutualisms are conspicuous and ecologically important components of tropical ecosystems that remain largely unexplored in terms of insect-associated microbial communities. Recent work has revealed that ants in some ant-plant systems cultivate fungi (Chaetothyriales) within their domatia, which are fed to larvae. Using Pseudomyrmex penetrator/Tachigali sp. from French Guiana and Petalomyrmex phylax/Leonardoxa africana and Crematogaster margaritae/Keetia hispida, both from Cameroon, as models, we tested the hypothesis that ant-plant-fungus mutualisms co-occur with culturable Actinobacteria. Using selective media, we isolated 861 putative Actinobacteria from the three systems. All C. margaritae/K. hispida samples had culturable Actinobacteria with a mean of 10.0 colony forming units (CFUs) per sample, while 26 % of P. penetrator/Tachigali samples (mean CFUs 1.3) and 67 % of P. phylax/L. africana samples (mean CFUs 3.6) yielded Actinobacteria. The largest number of CFUs was obtained from P. penetrator workers, P. phylax alates, and C. margaritae pupae. 16S rRNA gene sequencing and phylogenetic analysis revealed the presence of four main clades of Streptomyces and one clade of Nocardioides within these three ant-plant mutualisms. Streptomyces with antifungal properties were isolated from all three systems, suggesting that they could serve as protective symbionts, as found in other insects. In addition, a number of isolates from a clade of Streptomyces associated with P. phylax/L. africana and C. margaritae/K. hispida were capable of degrading cellulose, suggesting that Streptomyces in these systems may serve a nutritional role. Repeated isolation of particular clades of Actinobacteria from two geographically distant locations supports these isolates as residents in ant-plant-fungi niches.

  17. Hybrid Bee Ant Colony Algorithm for Effective Load Balancing And ...

    African Journals Online (AJOL)

    PROF. OLIVER OSUAGWA

    Ant Colony algorithm is used in this hybrid Bee Ant Colony algorithm to solve load balancing issues ... Genetic Algorithm (MO-GA) for dynamic job scheduling that .... Information Networking and Applications Workshops. [7]. M. Dorigo & T.

  18. The interplay between scent trails and group-mass recruitment systems in ants

    NARCIS (Netherlands)

    Planque, R.; van den Berg, G.J.B.; Franks, N.R.

    2013-01-01

    Large ant colonies invariably use effective scent trails to guide copious ant numbers to food sources. The success of mass recruitment hinges on the involvement of many colony members to lay powerful trails. However, many ant colonies start off as single queens. How do these same colonies forage

  19. Evolution of Fungal enzymes in the attine ant symbiosis

    DEFF Research Database (Denmark)

    de Fine Licht, Henrik Hjarvard; Schiøtt, Morten; Boomsma, Jacobus Jan

    The attine ant symbiosis is characterized by ancient but varying degrees of diffuse co-evolution between the ants and their fungal cultivars. Domesticated fungi became dependent on vertical transmission by queens and the ant colonies came to rely on their symbiotic fungus for food and thus...... as garden substrate, whereas the more basal genera use leaf litter, insect feces and insect carcasses. We hypothesized that enzyme activity of fungal symbionts has co-evolved with substrate use and we measured enzyme activities of fungus gardens in the field to test this, focusing particularly on plant...... essential for the symbiosis in general, but have contributed specifically to the evolution of the symbiosis....

  20. Social context predicts recognition systems in ant queens

    DEFF Research Database (Denmark)

    Dreier, Stéphanie Agnès Jeanine; d'Ettorre, Patrizia

    2009-01-01

    Recognition of group-members is a key feature of sociality. Ants use chemical communication to discriminate nestmates from intruders, enhancing kin cooperation and preventing parasitism. The recognition code is embedded in their cuticular chemical profile, which typically varies between colonies....... We predicted that ants might be capable of accurate recognition in unusual situations when few individuals interact repeatedly, as new colonies started by two to three queens. Individual recognition would be favoured by selection when queens establish dominance hierarchies, because repeated fights...... for dominance are costly; but it would not evolve in absence of hierarchies. We previously showed that Pachycondyla co-founding queens, which form dominance hierarchies, have accurate individual recognition based on chemical cues. Here, we used the ant Lasius niger to test the null hypothesis that individual...

  1. Ant colonies prefer infected over uninfected nest sites

    DEFF Research Database (Denmark)

    Pontieri, Luigi; Vojvodic, Svjetlana; Graham, Riley

    2014-01-01

    with sporulating mycelium of the entomopathogenic fungus Metarhizium brunneum (infected nests), nests containing nestmates killed by freezing (uninfected nests), and empty nests. In contrast to the expectation pharaoh ant colonies preferentially (84%) moved into the infected nest when presented with the choice...... the high risk of epidemics in group-living animals. Choosing nest sites free of pathogens is hypothesized to be highly efficient in invasive ants as each of their introduced populations is often an open network of nests exchanging individuals (unicolonial) with frequent relocation into new nest sites...... and low genetic diversity, likely making these species particularly vulnerable to parasites and diseases. We investigated the nest site preference of the invasive pharaoh ant, Monomorium pharaonis, through binary choice tests between three nest types: nests containing dead nestmates overgrown...

  2. Co-evolution of enzyme function in the attine ant-fungus symbiosis

    DEFF Research Database (Denmark)

    de Fine Licht, Henrik Hjarvard; Schiøtt, Morten; Boomsma, Jacobus Jan

    Introduction: Fungus-growing ants cultivate specialized fungi in the tribe Leucocoprineae (Lepiotaceae: Basidiomycota) inside their nests. The conspicuous leaf-cutting ants in the genus Atta build huge nests displacing several cubic meters of soil, whereas lower attine genera such as Cyphomyrmex ...... garden. This system can be viewed as ant induced crop optimization similar to human agricultural practices....... have small nests with a fungus garden the size of a table-tennis ball. Only the leaf-cutting ants are specialized on using fresh leaves as substrate for their fungus gardens, whereas the more basal attine genera use substrates such as dry plant material (leaf litter and small twigs) and also insect...... feces and insect carcasses. This diverse array of fungal substrates across the attine lineage implies that the symbiotic fungus needs different enzymes to break down the plant material that the ants provide or different efficiencies of enzyme function. Methods: (1.) We made a literature survey...

  3. Leaf endophyte load influences fungal garden development in leaf-cutting ants

    Directory of Open Access Journals (Sweden)

    Van Bael Sunshine A

    2012-11-01

    Full Text Available Abstract Background Previous work has shown that leaf-cutting ants prefer to cut leaf material with relatively low fungal endophyte content. This preference suggests that fungal endophytes exact a cost on the ants or on the development of their colonies. We hypothesized that endophytes may play a role in their host plants’ defense against leaf-cutting ants. To measure the long-term cost to the ant colony of fungal endophytes in their forage material, we conducted a 20-week laboratory experiment to measure fungal garden development for colonies that foraged on leaves with low or high endophyte content. Results Colony mass and the fungal garden dry mass did not differ significantly between the low and high endophyte feeding treatments. There was, however, a marginally significant trend toward greater mass of fungal garden per ant worker in the low relative to the high endophyte treatment. This trend was driven by differences in the fungal garden mass per worker from the earliest samples, when leaf-cutting ants had been foraging on low or high endophyte leaf material for only 2 weeks. At two weeks of foraging, the mean fungal garden mass per worker was 77% greater for colonies foraging on leaves with low relative to high endophyte loads. Conclusions Our data suggest that the cost of endophyte presence in ant forage material may be greatest to fungal colony development in its earliest stages, when there are few workers available to forage and to clean leaf material. This coincides with a period of high mortality for incipient colonies in the field. We discuss how the endophyte-leaf-cutter ant interaction may parallel constitutive defenses in plants, whereby endophytes reduce the rate of colony development when its risk of mortality is greatest.

  4. Disentangling the diversity of arboreal ant communities in tropical forest trees.

    Science.gov (United States)

    Klimes, Petr; Fibich, Pavel; Idigel, Cliffson; Rimandai, Maling

    2015-01-01

    Tropical canopies are known for their high abundance and diversity of ants. However, the factors which enable coexistence of so many species in trees, and in particular, the role of foragers in determining local diversity, are not well understood. We censused nesting and foraging arboreal ant communities in two 0.32 ha plots of primary and secondary lowland rainforest in New Guinea and explored their species diversity and composition. Null models were used to test if the records of species foraging (but not nesting) in a tree were dependent on the spatial distribution of nests in surrounding trees. In total, 102 ant species from 389 trees occurred in the primary plot compared with only 50 species from 295 trees in the secondary forest plot. However, there was only a small difference in mean ant richness per tree between primary and secondary forest (3.8 and 3.3 sp. respectively) and considerably lower richness per tree was found only when nests were considered (1.5 sp. in both forests). About half of foraging individuals collected in a tree belonged to species which were not nesting in that tree. Null models showed that the ants foraging but not nesting in a tree are more likely to nest in nearby trees than would be expected at random. The effects of both forest stage and tree size traits were similar regardless of whether only foragers, only nests, or both datasets combined were considered. However, relative abundance distributions of species differed between foraging and nesting communities. The primary forest plot was dominated by native ant species, whereas invasive species were common in secondary forest. This study demonstrates the high contribution of foragers to arboreal ant diversity, indicating an important role of connectivity between trees, and also highlights the importance of primary vegetation for the conservation of native ant communities.

  5. A phylogenetic perspective on the association between ants (Hymenoptera: Formicidae) and black yeasts (Ascomycota: Chaetothyriales).

    Science.gov (United States)

    Vasse, Marie; Voglmayr, Hermann; Mayer, Veronika; Gueidan, Cécile; Nepel, Maximilian; Moreno, Leandro; de Hoog, Sybren; Selosse, Marc-André; McKey, Doyle; Blatrix, Rumsaïs

    2017-03-15

    The frequency and the geographical extent of symbiotic associations between ants and fungi of the order Chaetothyriales have been highlighted only recently. Using a phylogenetic approach based on seven molecular markers, we showed that ant-associated Chaetothyriales are scattered through the phylogeny of this order. There was no clustering according to geographical origin or to the taxonomy of the ant host. However, strains tended to be clustered according to the type of association with ants: strains from ant-made carton and strains from plant cavities occupied by ants ('domatia') rarely clustered together. Defining molecular operational taxonomic units (MOTUs) with an internal transcribed spacer sequence similarity cut-off of 99% revealed that a single MOTU could be composed of strains collected from various ant species and from several continents. Some ant-associated MOTUs also contained strains isolated from habitats other than ant-associated structures. Altogether, our results suggest that the degree of specialization of the interactions between ants and their fungal partners is highly variable. A better knowledge of the ecology of these interactions and a more comprehensive sampling of the fungal order are needed to elucidate the evolutionary history of mutualistic symbioses between ants and Chaetothyriales. © 2017 The Author(s).

  6. Plant-ants feed their host plant, but above all a fungal symbiont to recycle nitrogen.

    Science.gov (United States)

    Defossez, Emmanuel; Djiéto-Lordon, Champlain; McKey, Doyle; Selosse, Marc-André; Blatrix, Rumsaïs

    2011-05-07

    In ant-plant symbioses, plants provide symbiotic ants with food and specialized nesting cavities (called domatia). In many ant-plant symbioses, a fungal patch grows within each domatium. The symbiotic nature of the fungal association has been shown in the ant-plant Leonardoxa africana and its protective mutualist ant Petalomyrmex phylax. To decipher trophic fluxes among the three partners, food enriched in (13)C and (15)N was given to the ants and tracked in the different parts of the symbiosis up to 660 days later. The plant received a small, but significant, amount of nitrogen from the ants. However, the ants fed more intensively the fungus. The pattern of isotope enrichment in the system indicated an ant behaviour that functions specifically to feed the fungus. After 660 days, the introduced nitrogen was still present in the system and homogeneously distributed among ant, plant and fungal compartments, indicating efficient recycling within the symbiosis. Another experiment showed that the plant surface absorbed nutrients (in the form of simple molecules) whether or not it is coated by fungus. Our study provides arguments for a mutualistic status of the fungal associate and a framework for investigating the previously unsuspected complexity of food webs in ant-plant mutualisms.

  7. Dispersal for survival: some observations on the trunk ant (Formica truncorum Fabricius)

    NARCIS (Netherlands)

    Mabelis, A.A.; Korczynska, J.

    2001-01-01

    The survival chance of the trunk ant (Formica truncorum) is compared with the survival chance of two other species of red wood ants: F.rufa and F.polyctena. Nest populations of F.truncorum are much smaller than nest populations of the other red wood ant species, which makes the species a weaker

  8. Behavioral mechanisms and morphological symptoms of zombie ants dying from fungal infection

    Directory of Open Access Journals (Sweden)

    Himaman Winanda

    2011-05-01

    Full Text Available Abstract Background Parasites that manipulate host behavior can provide prominent examples of extended phenotypes: parasite genomes controlling host behavior. Here we focus on one of the most dramatic examples of behavioral manipulation, the death grip of ants infected by Ophiocordyceps fungi. We studied the interaction between O. unilateralis s.l. and its host ant Camponotus leonardi in a Thai rainforest, where infected ants descend from their canopy nests down to understory vegetation to bite into abaxial leaf veins before dying. Host mortality is concentrated in patches (graveyards where ants die on sapling leaves ca. 25 cm above the soil surface where conditions for parasite development are optimal. Here we address whether the sequence of ant behaviors leading to the final death grip can also be interpreted as parasite adaptations and describe some of the morphological changes inside the heads of infected workers that mediate the expression of the death grip phenotype. Results We found that infected ants behave as zombies and display predictable stereotypical behaviors of random rather than directional walking, and of repeated convulsions that make them fall down and thus precludes returning to the canopy. Transitions from erratic wandering to death grips on a leaf vein were abrupt and synchronized around solar noon. We show that the mandibles of ants penetrate deeply into vein tissue and that this is accompanied by extensive atrophy of the mandibular muscles. This lock-jaw means the ant will remain attached to the leaf after death. We further present histological data to show that a high density of single celled stages of the parasite within the head capsule of dying ants are likely to be responsible for this muscular atrophy. Conclusions Extended phenotypes in ants induced by fungal infections are a complex example of behavioral manipulation requiring coordinated changes of host behavior and morphology. Future work should address the

  9. Evolutionary transition from single to multiple mating in fungus-growing ants

    DEFF Research Database (Denmark)

    Villesen, Palle; Gertsch, P J; Frydenberg, Jane

    1999-01-01

    Queens of leafcutter ants exhibit the highest known levels of multiple mating (up to 10 mates per queen) among ants. Multiple mating may have been selected to increase genetic diversity among nestmate workers, which is hypothesized to be critical in social systems with large, long-lived colonies...... under severe pressure of pathogens. Advanced fungus-growing (leafcutter) ants have large numbers (104-106 workers) and long-lived colonies, whereas basal genera in the attine tribe have small (... to have lower queen mating frequencies, similar to those found in most other ants. We tested this prediction by analysing queen mating frequency and colony kin structure in three basal attine species: Myrmicocrypta ednaella, Apterostigma collare and Cyphomyrmex longiscapus. Microsatellite marker analyses...

  10. Modeling no-jam traffic in ant trails: a pheromone-controlled approach

    Science.gov (United States)

    Guo, Ning; Hu, Mao-Bin; Jiang, Rui; Ding, Jianxun; Ling, Xiang

    2018-05-01

    The experiment in John et al (2009 Phys. Rev. Lett. 102 108001) shows that when ants move in a single-file trail, no jam emerges even at very high densities. We propose a self-propelled model of ant traffic to reproduce the fundamental diagram without a jammed branch. In this model, ants can adjust their desired velocities actively by perceiving pheromone concentration near the front of the trail. Moreover, ants will bear the repulsive force when they have physical contact with neighbors. The velocity in the simulation decreases slightly with increasing density, which captures the main feature observed in the experiment. Distributions of velocity and distance headway basically also conform to the experimental ones.

  11. Isolation of a pyrazine alarm pheromone component from the fire ant, Solenopsis invicta.

    Science.gov (United States)

    Vander Meer, Robert K; Preston, Catherine A; Choi, Man-Yeon

    2010-02-01

    Alarm pheromones in social insects are an essential part of a complex of pheromone interactions that contribute to the maintenance of colony integrity and sociality. The alarm pheromones of ants were among the first examples of animal pheromones identified, primarily because of the large amount of chemical produced and the distinctive responses of ants to the pheromone. However, the alarm pheromone of the fire ant, Solenopsis invicta, eluded identification for over four decades. We identified 2-ethyl-3,6-dimethylpyrazine as an alarm pheromone component of S. invicta. Worker fire ants detect the pyrazine alarm pheromone at 30 pg/ml, which is comparable to alarm pheromone sensitivities reported for other ant species. The source of this alarm pheromone are the mandibular glands, which, in fire ants, are not well developed and contain only about 300 pg of the compound, much less than the microgram quantities of alarm pheromones reported for several other ant species. Female and male sexuals and workers produce the pyrazine, which suggests that it may be involved in fire ant mating flight initiation, as well as the typical worker alarm response. This is the first report of 2-ethyl-3,6-dimethylpyrazine from a Solenopsis species and the first example of this alkaloid functioning as an alarm pheromone.

  12. Canopy cover negatively affects arboreal ant species richness in a tropical open habitat

    Directory of Open Access Journals (Sweden)

    A. C. M. Queiroz

    Full Text Available Abstract We tested the hypothesis of a negative relationship between vegetation characteristics and ant species richness in a Brazilian open vegetation habitat, called candeial. We set up arboreal pitfalls to sample arboreal ants and measured the following environmental variables, which were used as surrogate of environmental heterogeneity: tree richness, tree density, tree height, circumference at the base of the plants, and canopy cover. Only canopy cover had a negative effect on the arboreal ant species richness. Vegetation characteristics and plant species composition are probably homogeneous in candeial, which explains the lack of relationship between other environmental variables and ant richness. Open vegetation habitats harbor a large number of opportunistic and generalist species, besides specialist ants from habitats with high temperatures. An increase in canopy cover decreases sunlight incidence and may cause local microclimatic differences, which negatively affect the species richness of specialist ants from open areas. Canopy cover regulates the richness of arboreal ants in open areas, since only few ant species are able to colonize sites with dense vegetation; most species are present in sites with high temperature and luminosity. Within open vegetation habitats the relationship between vegetation characteristics and species richness seems to be the opposite from closed vegetation areas, like forests.

  13. Salticid predation as one potential driving force of ant mimicry in jumping spiders

    Science.gov (United States)

    Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min

    2011-01-01

    Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

  14. An ant-plant mutualism through the lens of cGMP-dependent kinase genes.

    Science.gov (United States)

    Malé, Pierre-Jean G; Turner, Kyle M; Doha, Manjima; Anreiter, Ina; Allen, Aaron M; Sokolowski, Marla B; Frederickson, Megan E

    2017-09-13

    In plant-animal mutualisms, how an animal forages often determines how much benefit its plant partner receives. In many animals, foraging behaviour changes in response to foraging gene expression or activation of the cGMP-dependent protein kinase (PKG) that foraging encodes. Here, we show that this highly conserved molecular mechanism affects the outcome of a plant-animal mutualism. We studied the two PKG genes of Allomerus octoarticulatus, an Amazonian ant that defends the ant-plant Cordia nodosa against herbivores. Some ant colonies are better 'bodyguards' than others. Working in the field in Peru, we found that colonies fed with a PKG activator recruited more workers to attack herbivores than control colonies. This resulted in less herbivore damage. PKG gene expression in ant workers correlated with whether an ant colony discovered an herbivore and how much damage herbivores inflicted on leaves in a complex way; natural variation in expression levels of the two genes had significant interaction effects on ant behaviour and herbivory. Our results suggest a molecular basis for ant protection of plants in this mutualism. © 2017 The Author(s).

  15. Temporal Variation in the Abundance and Richness of Foliage-Dwelling Ants Mediated by Extrafloral Nectar.

    Directory of Open Access Journals (Sweden)

    Ceres Belchior

    Full Text Available Plants bearing extrafloral nectaries (EFNs are common in the Brazilian cerrado savanna, where climatic conditions having marked seasonality influence arboreal ant fauna organization. These ant-plant interactions have rarely been studied at community level. Here, we tested whether: 1 EFN-bearing plants are more visited by ants than EFN-lacking plants; 2 ant visitation is higher in the rainy season than in dry season; 3 plants producing young leaves are more visited than those lacking young leaves in the rainy season; 4 during the dry season, plants with old leaves and flowers are more visited than plants with young leaves and bare of leaves or flowers; 5 the composition of visiting ant fauna differs between plants with and without EFNs. Field work was done in a cerrado reserve near Uberlândia, MG State, Brazil, along ten transects (total area 3,000 m2, in the rainy (October-January and dry seasons (April-July of 2010-2011. Plants (72 species; 762 individuals were checked three times per season for ant presence. Results showed that 21 species (29% and 266 individuals (35% possessed EFNs. These plants attracted 38 ant species (36 in rainy, 26 in dry season. In the rainy season, plants with EFNs had higher ant abundance/richness than plants without EFNs, but in the dry season, EFN presence did not influence ant visitation. Plant phenology affected ant richness and abundance in different ways: plants with young leaves possessed higher ant richness in the rainy season, but in the dry season ant abundance was higher on plants possessing old leaves or flowers. The species composition of plant-associated ant communities, however, did not differ between plants with and without EFNs in either season. These findings suggest that the effect of EFN presence on a community of plant-visiting ants is context dependent, being conditioned to seasonal variation.

  16. Temporal Variation in the Abundance and Richness of Foliage-Dwelling Ants Mediated by Extrafloral Nectar.

    Science.gov (United States)

    Belchior, Ceres; Sendoya, Sebastián F; Del-Claro, Kleber

    2016-01-01

    Plants bearing extrafloral nectaries (EFNs) are common in the Brazilian cerrado savanna, where climatic conditions having marked seasonality influence arboreal ant fauna organization. These ant-plant interactions have rarely been studied at community level. Here, we tested whether: 1) EFN-bearing plants are more visited by ants than EFN-lacking plants; 2) ant visitation is higher in the rainy season than in dry season; 3) plants producing young leaves are more visited than those lacking young leaves in the rainy season; 4) during the dry season, plants with old leaves and flowers are more visited than plants with young leaves and bare of leaves or flowers; 5) the composition of visiting ant fauna differs between plants with and without EFNs. Field work was done in a cerrado reserve near Uberlândia, MG State, Brazil, along ten transects (total area 3,000 m2), in the rainy (October-January) and dry seasons (April-July) of 2010-2011. Plants (72 species; 762 individuals) were checked three times per season for ant presence. Results showed that 21 species (29%) and 266 individuals (35%) possessed EFNs. These plants attracted 38 ant species (36 in rainy, 26 in dry season). In the rainy season, plants with EFNs had higher ant abundance/richness than plants without EFNs, but in the dry season, EFN presence did not influence ant visitation. Plant phenology affected ant richness and abundance in different ways: plants with young leaves possessed higher ant richness in the rainy season, but in the dry season ant abundance was higher on plants possessing old leaves or flowers. The species composition of plant-associated ant communities, however, did not differ between plants with and without EFNs in either season. These findings suggest that the effect of EFN presence on a community of plant-visiting ants is context dependent, being conditioned to seasonal variation.

  17. Different tolerances of symbiotic and nonsymbiotic ant-plant networks to species extinctions

    Directory of Open Access Journals (Sweden)

    Wesley Dattilo

    2012-12-01

    Full Text Available The knowledge of the mechanisms that shape biodiversity-stability relationships is essential to understand ecological and evolutionary dynamics of interacting species. However, most studies focus only on species loss and ignore the loss of interactions. In this study, I evaluated the topological structure of two different ant-plant networks: symbiotic (ants and myrmecophytes and nonsymbiotic (ants and plants with extrafloral nectaries. Moreover, I also evaluated in both networks the tolerance to plant and ant species extinction using a new approach. For this, I used models based on simulations of cumulative removals of species from the network at random. Both networks were fundamentally different in the interaction and extinction patterns. The symbiotic network was more specialized and less robust to species extinction. On the other hand, the nonsymbiotic network tends to be functionally redundant and more robust to species extinction. The difference for food resource utilization and ant nesting in both ant-plant interactions can explain the observed pattern. In short, I contributed in this manner to our understanding of the biodiversity maintenance and coevolutionary processes in facultative and obligate mutualisms.

  18. Symbiont recognition of mutualistic bacteria by Acromyrmex leaf-cutting ants

    DEFF Research Database (Denmark)

    Zhang, Mingzi; Poulsen, Michael; Currie, Cameron R

    2007-01-01

    Symbiont choice has been proposed to play an important role in shaping many symbiotic relationships, including the fungus-growing ant-microbe mutualism. Over millions of years, fungus-growing ants have defended their fungus gardens from specialized parasites with antibiotics produced...

  19. Volatile chemicals in glands of the carpenter ant, Camponotus ...

    African Journals Online (AJOL)

    Volatile chemicals in glands of the carpenter ant, Camponotus arminius. J.M. Brand, L.V. Mabinya, E.D. Morgan. Abstract. Camponotus arminius is a large black carpenter ant that occurs in tropical and sub-tropical Africa and has extensive foraging trails both in trees and on the ground. Analysis of excised mandibular glands ...

  20. Ants of the Peloponnese, Greece (Hymenoptera: Formicidae

    Directory of Open Access Journals (Sweden)

    Borowiec Lech

    2017-09-01

    Full Text Available This paper relates to material obtained during two field trips to the Peloponnese in 2013 and 2016. With the inclusion of some hitherto unpublished ant material, it gives new records from a total of 92 sampling localities. 129 species (including morphospecies not attributed to any known taxon of ants have been recorded from the Peloponnese (southern Greece, 27 of which have been recorded from this region for the first time. Lasius reginae and 5 other morphospecies attributed only to species complexes are new to Greece.

  1. Density-dependent effects of ants on selection for bumble bee pollination in Polemonium viscosum.

    Science.gov (United States)

    Galen, Candace; Geib, Jennifer C

    2007-05-01

    Mutualisms are commonly exploited by cheater species that usurp rewards without providing reciprocal benefits. Yet most studies of selection between mutualist partners ignore interactions with third species and consequently overlook the impact of cheaters on evolution in the mutualism. Here, we explicitly investigate how the abundance of nectar-thieving ants (cheaters) influences selection in a pollination mutualism between bumble bees and the alpine skypilot, Polemonium viscosum. As suggested in past work with this species, bumble bees accounted for most of the seed production (78% +/- 6% [mean +/- SE]) in our high tundra study population and, in the absence of ants, exerted strong selection for large flowers. We tested for indirect effects of ant abundance on seed set through bumble bee pollination services (pollen delivery and pollen export) and a direct effect through flower damage. Ants reduced seed set per flower by 20% via flower damage. As ant density increased within experimental patches, the rate of flower damage rose, but pollen delivery and export did not vary significantly, showing that indirect effects of increased cheater abundance on pollinator service are negligible in this system. To address how ants affect selection for plant participation in the pollination mutualism we tested the impact of ant abundance on selection for bumble bee-mediated pollination. Results show that the impact of ants on fitness (seed set) accruing under bumble bee pollination is density dependent in P. viscosum. Selection for bumble bee pollination declined with increasing ant abundance in experimental patches, as predicted if cheaters constrain fitness returns of mutualist partner services. We also examined how ant abundance influences selection on flower size, a key component of plant investment in bumble bee pollination. We predicted that direct effects of ants would constrain bumble bee selection for large flowers. However, selection on flower size was significantly

  2. Heavy metal pollution disturbs immune response in wild ant populations

    International Nuclear Information System (INIS)

    Sorvari, Jouni; Rantala, Liisa M.; Rantala, Markus J.; Hakkarainen, Harri; Eeva, Tapio

    2007-01-01

    Concern about the effects of environmental contaminants on immune function in both humans and wildlife is growing and practically nothing is known about this impact on terrestrial invertebrates, even though they are known to easily accumulate pollutants. We studied the effect of industrial heavy metal contamination on immune defense of a free-living wood ant (Formica aquilonia). To find out whether ants show an adapted immune function in a polluted environment, we compared encapsulation responses between local and translocated colonies. Local colonies showed higher heavy metal levels than the translocated ones but the encapsulation response was similar between the two groups, indicating that the immune system of local ants has not adapted to high contamination level. The encapsulation response was elevated in moderate whereas suppressed in high heavy metal levels suggesting higher risk for infections in heavily polluted areas. - Heavy metal pollution affects immune function in ants

  3. Nine novel microsatellite markers for the army ant Simopelta pergandei (subfamily Ponerinae)

    DEFF Research Database (Denmark)

    Kronauer, D.J.C.; Boomsma, J.J.; Pierce, N.E.

    2011-01-01

    Simopelta (subfamily Ponerinae) army ants are specialized predators of other ants in New World tropical forests. Although they show a striking convergence in overall life-history with the well known army ants of the subfamilies Aenictinae, Dorylinae, and Ecitoninae, the genus has been little...... studied. We developed and characterized nine novel microsatellite loci for S. pergandei with 2-8 observed alleles (mean: 5.2) and expected heterozygosities between 0.16 and 0.87 (mean: 0.68). Three of these loci reliably cross-amplified in a second species, S. pentadentata, with 4-8 alleles (mean: 8.......0) and expected heterozygosities between 0.32 and 0.85 (mean: 0.65). These genetic markers will be useful in studying the sociobiology and molecular ecology of Simopelta army ants and in elucidating convergent evolutionary trajectories that have culminated in the army ant lifestyle...

  4. Ants avoid superinfections by performing risk-adjusted sanitary care.

    Science.gov (United States)

    Konrad, Matthias; Pull, Christopher D; Metzler, Sina; Seif, Katharina; Naderlinger, Elisabeth; Grasse, Anna V; Cremer, Sylvia

    2018-03-13

    Being cared for when sick is a benefit of sociality that can reduce disease and improve survival of group members. However, individuals providing care risk contracting infectious diseases themselves. If they contract a low pathogen dose, they may develop low-level infections that do not cause disease but still affect host immunity by either decreasing or increasing the host's vulnerability to subsequent infections. Caring for contagious individuals can thus significantly alter the future disease susceptibility of caregivers. Using ants and their fungal pathogens as a model system, we tested if the altered disease susceptibility of experienced caregivers, in turn, affects their expression of sanitary care behavior. We found that low-level infections contracted during sanitary care had protective or neutral effects on secondary exposure to the same (homologous) pathogen but consistently caused high mortality on superinfection with a different (heterologous) pathogen. In response to this risk, the ants selectively adjusted the expression of their sanitary care. Specifically, the ants performed less grooming and more antimicrobial disinfection when caring for nestmates contaminated with heterologous pathogens compared with homologous ones. By modulating the components of sanitary care in this way the ants acquired less infectious particles of the heterologous pathogens, resulting in reduced superinfection. The performance of risk-adjusted sanitary care reveals the remarkable capacity of ants to react to changes in their disease susceptibility, according to their own infection history and to flexibly adjust collective care to individual risk.

  5. Stigmergic construction and topochemical information shape ant nest architecture.

    Science.gov (United States)

    Khuong, Anaïs; Gautrais, Jacques; Perna, Andrea; Sbaï, Chaker; Combe, Maud; Kuntz, Pascale; Jost, Christian; Theraulaz, Guy

    2016-02-02

    The nests of social insects are not only impressive because of their sheer complexity but also because they are built from individuals whose work is not centrally coordinated. A key question is how groups of insects coordinate their building actions. Here, we use a combination of experimental and modeling approaches to investigate nest construction in the ant Lasius niger. We quantify the construction dynamics and the 3D structures built by ants. Then, we characterize individual behaviors and the interactions of ants with the structures they build. We show that two main interactions are involved in the coordination of building actions: (i) a stigmergic-based interaction that controls the amplification of depositions at some locations and is attributable to a pheromone added by ants to the building material; and (ii) a template-based interaction in which ants use their body size as a cue to control the height at which they start to build a roof from existing pillars. We then develop a 3D stochastic model based on these individual behaviors to analyze the effect of pheromone presence and strength on construction dynamics. We show that the model can quantitatively reproduce key features of construction dynamics, including a large-scale pattern of regularly spaced pillars, the formation and merging of caps over the pillars, and the remodeling of built structures. Finally, our model suggests that the lifetime of the pheromone is a highly influential parameter that controls the growth and form of nest architecture.

  6. The cavity-nest ant Temnothorax crassispinus prefers larger nests.

    Science.gov (United States)

    Mitrus, S

    Colonies of the ant Temnothorax crassispinus inhabit mostly cavities in wood and hollow acorns. Typically in the field, nest sites that can be used by the ant are a limited resource. In a field experiment, it was investigated whether the ants prefer a specific size of nest, when different ones are available. In July 2011, a total of 160 artificial nests were placed in a beech-pine forest. Four artificial nests (pieces of wood with volume cavities, ca 415, 605, 730, and 980 mm 3 , respectively) were located on each square meter of the experimental plot. One year later, shortly before the emergence of new sexuals, the nests were collected. In July 2012, colonies inhabited more frequently bigger nests. Among queenright colonies, the ones which inhabited bigger nests had more workers. However, there was no relationship between volume of nest and number of workers for queenless colonies. Queenright colonies from bigger nests produced more sexual individuals, but there was no correlation between number of workers and sex allocation ratio, or between volume of nest and sex allocation ratio. In a laboratory experiment where ant colonies were kept in 470 and 860 mm 3 nests, larger colonies allocated more energy to produce sexual individuals. The results of this study show the selectivity of T. crassispinus ants regarding the size of nest cavity, and that the nest volume has an impact on life history parameters.

  7. Symmetry breaking on density in escaping ants: experiment and alarm pheromone model.

    Directory of Open Access Journals (Sweden)

    Geng Li

    Full Text Available The symmetry breaking observed in nature is fascinating. This symmetry breaking is observed in both human crowds and ant colonies. In such cases, when escaping from a closed space with two symmetrically located exits, one exit is used more often than the other. Group size and density have been reported as having no significant impact on symmetry breaking, and the alignment rule has been used to model symmetry breaking. Density usually plays important roles in collective behavior. However, density is not well-studied in symmetry breaking, which forms the major basis of this paper. The experiment described in this paper on an ant colony displays an increase then decrease of symmetry breaking versus ant density. This result suggests that a Vicsek-like model with an alignment rule may not be the correct model for escaping ants. Based on biological facts that ants use pheromones to communicate, rather than seeing how other individuals move, we propose a simple yet effective alarm pheromone model. The model results agree well with the experimental outcomes. As a measure, this paper redefines symmetry breaking as the collective asymmetry by deducing the random fluctuations. This research indicates that ants deposit and respond to the alarm pheromone, and the accumulation of this biased information sharing leads to symmetry breaking, which suggests true fundamental rules of collective escape behavior in ants.

  8. The role of ant-tended extrafloral nectaries in the protection and benefit of a Neotropical rainforest tree.

    Science.gov (United States)

    de la Fuente, Marie Ann S; Marquis, Robert J

    1999-02-01

    One possible function of extrafloral nectaries is to attract insects, particularly ants, which defend plants from herbivores. We determined whether ants visiting saplings of the tree Stryphnodendronmicrostachyum (Leguminosae) provide protection (decreased plant damage due to ant molestation or killing of herbivores) and benefit (increased plant growth and reproduction associated with ant presence) to the plant. We compared ant and herbivore abundance, herbivore damage and growth of ant-visited plants and ant-excluded plants grown in sun and shade microhabitats of a 6-ha plantation in Costa Rica over a 7-month period. Results show that ants provided protection to plants not by reducing herbivore numbers but by molesting herbivores. Ants also reduced the incidence of pathogen attack on leaves. Protection was greater in the shade than in the sun, probably due to lower herbivore attack in the sun. Protection was also variable within sun and shade habitats, and this variability appeared to be related to variable ant visitation. Results also indicate that ant presence benefits the plant: ant-visited plants grew significantly more in height than ant-excluded plants. The cultivation of ants may serve as an important natural biological control in tropical forestry and agroforestry systems, where increased plant density can otherwise lead to increased herbivore attack.

  9. Host-ant specificity of endangered large blue butterflies (Phengaris spp., Lepidoptera: Lycaenidae) in Japan.

    Science.gov (United States)

    Ueda, Shouhei; Komatsu, Takashi; Itino, Takao; Arai, Ryusuke; Sakamoto, Hironori

    2016-11-03

    Large blue butterflies, Phengaris (Maculinea), are an important focus of endangered-species conservation in Eurasia. Later-instar Phengaris caterpillars live in Myrmica ant nests and exploit the ant colony's resources, and they are specialized to specific host-ant species. For example, local extinction of P. arion in the U. K. is thought to have been due to the replacement of its host-ant species with a less-suitable congener, as a result of changes in habitat. In Japan, Myrmica kotokui hosts P. teleius and P. arionides caterpillars. We recently showed, however, that the morphological species M. kotokui actually comprises four genetic clades. Therefore, to determine to which group of ants the hosts of these two Japanese Phengaris species belong, we used mitochondrial COI-barcoding of M. kotokui specimens from colonies in the habitats of P. teleius and P. arionides to identify the ant clade actually parasitized by the caterpillars of each species. We found that these two butterfly species parasitize different ant clades within M. kotokui.

  10. Polarized light use in the nocturnal bull ant, Myrmecia midas.

    Science.gov (United States)

    Freas, Cody A; Narendra, Ajay; Lemesle, Corentin; Cheng, Ken

    2017-08-01

    Solitary foraging ants have a navigational toolkit, which includes the use of both terrestrial and celestial visual cues, allowing individuals to successfully pilot between food sources and their nest. One such celestial cue is the polarization pattern in the overhead sky. Here, we explore the use of polarized light during outbound and inbound journeys and with different home vectors in the nocturnal bull ant, Myrmecia midas . We tested foragers on both portions of the foraging trip by rotating the overhead polarization pattern by ±45°. Both outbound and inbound foragers responded to the polarized light change, but the extent to which they responded to the rotation varied. Outbound ants, both close to and further from the nest, compensated for the change in the overhead e-vector by about half of the manipulation, suggesting that outbound ants choose a compromise heading between the celestial and terrestrial compass cues. However, ants returning home compensated for the change in the e-vector by about half of the manipulation when the remaining home vector was short (1-2 m) and by more than half of the manipulation when the remaining vector was long (more than 4 m). We report these findings and discuss why weighting on polarization cues change in different contexts.

  11. Autonomous Agents on Expedition: Humans and Progenitor Ants and Planetary Exploration

    Science.gov (United States)

    Rilee, M. L.; Clark, P. E.; Curtis, S. A.; Truszkowski, W. F.

    2002-01-01

    The Autonomous Nano-Technology Swarm (ANTS) is an advanced mission architecture based on a social insect analog of many specialized spacecraft working together to achieve mission goals. The principal mission concept driving the ANTS architecture is a Main Belt Asteroid Survey in the 2020s that will involve a thousand or more nano-technology enabled, artificially intelligent, autonomous pico-spacecraft (architecture. High level, mission-oriented behaviors are to be managed by a control / communications layer of the swarm, whereas common low level functions required of all spacecraft, e.g. attitude control and guidance and navigation, are handled autonomically on each spacecraft. At the higher levels of mission planning and social interaction deliberative techniques are to be used. For the asteroid survey, ANTS acts as a large community of cooperative agents while for precursor missions there arises the intriguing possibility of Progenitor ANTS and humans acting together as agents. For optimal efficiency and responsiveness for individual spacecraft at the lowest levels of control we have been studying control methods based on nonlinear dynamical systems. We describe the critically important autonomous control architecture of the ANTS mission concept and a sequence of partial implementations that feature increasingly autonomous behaviors. The scientific and engineering roles that these Progenitor ANTS could play in human missions or remote missions with near real time human interactions, particularly to the Moon and Mars, will be discussed.

  12. Nonintegrated Host Association of Myrmecophilus tetramorii, a Specialist Myrmecophilous Ant Cricket (Orthoptera: Myrmecophilidae

    Directory of Open Access Journals (Sweden)

    Takashi Komatsu

    2013-01-01

    Full Text Available Myrmecophilus ant crickets (Orthoptera: Myrmecophilidae are typical ant guests. In Japan, about 10 species are recognized on the basis of morphological and molecular phylogenetic frameworks. Some of these species have restricted host ranges and behave intimately toward their host ant species (i.e., they are host specialist. We focused on one species, M. tetramorii, which uses the myrmicine ant Tetramorium tsushimae as its main host. All but one M. tetramorii individuals were collected specifically from nests of T. tsushimae in the field. However, behavioral observation showed that all individuals used in the experiment received hostile reactions from the host ants. There were no signs of intimate behaviors such as grooming of hosts or receipt of mouth-to-mouth feeding from hosts, which are seen in some host-specialist Myrmecophilus species among obligate host-ant species. Therefore, it may be that M. tetramorii is the species that is specialized to exploit the host by means other than chemical integration.

  13. Are ant assemblages of Brazilian veredas characterised by location or habitat type?

    Science.gov (United States)

    Costa-Milanez, C B; Lourenço-Silva, G; Castro, P T A; Majer, J D; Ribeiro, S P

    2014-02-01

    Wetland areas in the Brazilian Cerrado, known as "veredas", represent ecosystems formed on sandy soils with high concentrations of peat, and are responsible for the recharge of aquiferous reservoirs. They are currently under threat by various human activities, most notably the clearing of vegetation for Eucalyptus plantations. Despite their ecological importance and high conservation value, little is known about the actual effects of human disturbance on the animal community. To assess how habitat within different veredas, and plantations surrounding them affect ant assemblages, we selected four independent vereda locations, two being impacted by Eucalyptus monoculture (one younger and one mature plantation) and two controls, where the wetland was surrounded by cerrado vegetation. Ant sampling was conducted in May 2010 (dry season) using three complementary methods, namely baits, pitfall traps, and hand collection, in the wetland and in the surrounding habitats. A total of 7,575 ants were sampled, belonging to seven subfamilies, 32 genera and 124 species. Ant species richness and abundance did not differ between vereda locations, but did between the habitats. When impacted by the monoculture, ant species richness and abundance decreased in wetlands, but were less affected in the cerrado habitat. Ant species composition differed between the three habitats and between vereda locations. Eucalyptus plantations had an ant species composition defined by high dominance of Pheidole sp. and Solenopsis invicta, while natural habitats were defined by Camponotus and Crematogaster species. Atta sexdens was strictly confined to native habitats of non-impacted "veredas". Eucalyptus monocultures require high quantities of water in the early stages, which may have caused a decrease in groundwater level in the wetland, allowing hypogeic ants such as Labidus praedator to colonise this habitat.

  14. Effect of irradiation on queen survivorship and reproduction in the invasive fire ant Solenopsis invicta,(Hymenoptera: Formicidae) and a generic phytosanitary irradiation treatment for ants

    Science.gov (United States)

    Ants are common hitchhiker pests on traded agricultural commodities that could be controlled by postharvest irradiation treatment. We studied radiation tolerance in queens of the red imported fire ant Solenopsis invicta Buren to determine the dose sufficient for its control. Virgin or fertile queens...

  15. Ant Colony Optimization ACO For The Traveling Salesman Problem TSP Using Partitioning

    Directory of Open Access Journals (Sweden)

    Alok Bajpai

    2015-08-01

    Full Text Available Abstract An ant colony optimization is a technique which was introduced in 1990s and which can be applied to a variety of discrete combinatorial optimization problem and to continuous optimization. The ACO algorithm is simulated with the foraging behavior of the real ants to find the incremental solution constructions and to realize a pheromone laying-and-following mechanism. This pheromone is the indirect communication among the ants. In this paper we introduces the partitioning technique based on the divide and conquer strategy for the traveling salesman problem which is one of the most important combinatorial problem in which the original problem is partitioned into the group of sub problems. And then we apply the ant colony algorithm using candidate list strategy for each smaller sub problems. After that by applying the local optimization and combining the sub problems to find the good solution for the original problem by improving the exploration efficiency of the ants. At the end of this paper we have also be presented the comparison of result with the normal ant colony system for finding the optimal solution to the traveling salesman problem.

  16. Using ant-behavior-based simulation model AntWeb to improve website organization

    Science.gov (United States)

    Li, Weigang; Pinheiro Dib, Marcos V.; Teles, Wesley M.; Morais de Andrade, Vlaudemir; Alves de Melo, Alba C. M.; Cariolano, Judas T.

    2002-03-01

    Some web usage mining algorithms showed the potential application to find the difference among the organizations expected by visitors to the website. However, there are still no efficient method and criterion for a web administrator to measure the performance of the modification. In this paper, we developed an AntWeb, a model inspired by ants' behavior to simulate the sequence of visiting the website, in order to measure the efficient of the web structure. We implemented a web usage mining algorithm using backtrack to the intranet website of the Politec Informatic Ltd., Brazil. We defined throughput (the number of visitors to reach their target pages per time unit relates to the total number of visitors) as an index to measure the website's performance. We also used the link in a web page to represent the effect of visitors' pheromone trails. For every modification in the website organization, for example, putting a link from the expected location to the target object, the simulation reported the value of throughput as a quick answer about this modification. The experiment showed the stability of our simulation model, and a positive modification to the intranet website of the Politec.

  17. Development of a Bait System for the Pharaoh's Ant, Monomorium ...

    African Journals Online (AJOL)

    The infestation of the Pharaoh's ant, Monomorium pharaonis L. is widespread and, sometimes, very serious in homes, hospitals, restaurants, factories, etc. People are helpless because effective baited traps are not available locally, and little has been done locally to develop effective control strategies for these ants.

  18. A Generalized Ant Colony Algorithm for Job一shop Scheduling Problem

    Directory of Open Access Journals (Sweden)

    ZHANG Hong-Guo

    2017-02-01

    Full Text Available Aiming at the problem of ant colony algorithm for solving Job一shop scheduling problem. Considering the complexity of the algorithm that uses disjunctive graph to describe the relationship between workpiece processing. To solve the problem of optimal solution,a generalized ant colony algorithm is proposed. Under the premise of considering constrained relationship between equipment and process,the pheromone update mechanism is applied to solve Job-shop scheduling problem,so as to improve the quality of the solution. In order to improve the search efficiency,according to the state transition rules of ant colony algorithm,this paper makes a detailed study on the selection and improvement of the parameters in the algorithm,and designs the pheromone update strategy. Experimental results show that a generalized ant colony algorithm is more feasible and more effective. Compared with other algorithms in the literature,the results prove that the algorithm improves in computing the optimal solution and convergence speed.

  19. Ant groups optimally amplify the effect of transiently informed individuals

    Science.gov (United States)

    Gelblum, Aviram; Pinkoviezky, Itai; Fonio, Ehud; Ghosh, Abhijit; Gov, Nir; Feinerman, Ofer

    2015-07-01

    To cooperatively transport a large load, it is important that carriers conform in their efforts and align their forces. A downside of behavioural conformism is that it may decrease the group's responsiveness to external information. Combining experiment and theory, we show how ants optimize collective transport. On the single-ant scale, optimization stems from decision rules that balance individuality and compliance. Macroscopically, these rules poise the system at the transition between random walk and ballistic motion where the collective response to the steering of a single informed ant is maximized. We relate this peak in response to the divergence of susceptibility at a phase transition. Our theoretical models predict that the ant-load system can be transitioned through the critical point of this mesoscopic system by varying its size; we present experiments supporting these predictions. Our findings show that efficient group-level processes can arise from transient amplification of individual-based knowledge.

  20. Harnessing ant defence at fruits reduces bruchid seed predation in a symbiotic ant–plant mutualism

    Science.gov (United States)

    Pringle, Elizabeth G.

    2014-01-01

    In horizontally transmitted mutualisms, mutualists disperse separately and reassemble in each generation with partners genetically unrelated to those in the previous generation. Because of this, there should be no selection on either partner to enhance the other's reproductive output directly. In symbiotic ant–plant mutualisms, myrmecophytic plants host defensive ant colonies, and ants defend the plants from herbivores. Plants and ants disperse separately, and, although ant defence can indirectly increase plant reproduction by reducing folivory, it is unclear whether ants can also directly increase plant reproduction by defending seeds. The neotropical tree Cordia alliodora hosts colonies of Azteca pittieri ants. The trees produce domatia where ants nest at stem nodes and also at the node between the peduncle and the rachides of the infloresence. Unlike the stem domatia, these reproductive domatia senesce after the tree fruits each year. In this study, I show that the tree's resident ant colony moves into these ephemeral reproductive domatia, where they tend honeydew-producing scale insects and patrol the nearby developing fruits. The presence of ants significantly reduced pre-dispersal seed predation by Amblycerus bruchid beetles, thereby directly increasing plant reproductive output. PMID:24807259

  1. Species-specific ant brain manipulation by a specialized fungal parasite.

    Science.gov (United States)

    de Bekker, Charissa; Quevillon, Lauren E; Smith, Philip B; Fleming, Kimberly R; Ghosh, Debashis; Patterson, Andrew D; Hughes, David P

    2014-08-29

    A compelling demonstration of adaptation by natural selection is the ability of parasites to manipulate host behavior. One dramatic example involves fungal species from the genus Ophiocordyceps that control their ant hosts by inducing a biting behavior. Intensive sampling across the globe of ants that died after being manipulated by Ophiocordyceps suggests that this phenomenon is highly species-specific. We advance our understanding of this system by reconstructing host manipulation by Ophiocordyceps parasites under controlled laboratory conditions and combining this with field observations of infection rates and a metabolomics survey. We report on a newly discovered species of Ophiocordyceps unilateralis sensu lato from North America that we use to address the species-specificity of Ophiocordyceps-induced manipulation of ant behavior. We show that the fungus can kill all ant species tested, but only manipulates the behavior of those it infects in nature. To investigate if this could be explained at the molecular level, we used ex vivo culturing assays to measure the metabolites that are secreted by the fungus to mediate fungus-ant tissue interactions. We show the fungus reacts heterogeneously to brains of different ant species by secreting a different array of metabolites. By determining which ion peaks are significantly enriched when the fungus is grown alongside brains of its naturally occurring host, we discovered candidate compounds that could be involved in behavioral manipulation by O. unilateralis s.l.. Two of these candidates are known to be involved in neurological diseases and cancer. The integrative work presented here shows that ant brain manipulation by O. unilateralis s.l. is species-specific seemingly because the fungus produces a specific array of compounds as a reaction to the presence of the host brain it has evolved to manipulate. These studies have resulted in the discovery of candidate compounds involved in establishing behavioral manipulation

  2. The introduction history of invasive garden ants in Europe: integrating genetic, chemical and behavioural approaches

    DEFF Research Database (Denmark)

    Ugelvig, Line; Drijfhout, Falko; Kronauer, Daniel

    2008-01-01

    BACKGROUND: The invasive garden ant, Lasius neglectus, is the most recently detected pest ant and the first known invasive ant able to become established and thrive in the temperate regions of Eurasia. In this study, we aim to reconstruct the invasion history of this ant in Europe analysing 14 po...

  3. Indirect effects of mutualism: ant-treehopper associations deter pollinators and reduce reproduction in a tropical shrub.

    Science.gov (United States)

    Ibarra-Isassi, Javier; Oliveira, Paulo S

    2018-03-01

    Animal-pollinated plants can be susceptible to changes in pollinator availability. Honeydew-producing treehoppers frequently occur on inflorescences, potentially enhancing ant-mediated negative effects on pollination services. However, the effect of ant-attended, honeydew-producing insects on plant reproduction remains uncertain. We recorded the abundance of treehoppers and ants on Byrsonima intermedia (Malpighiaceae), and monitored floral visitors in a Brazilian cerrado savanna. We manipulated the presence of ants and ant-treehopper associations on inflorescences to assess their effect on pollination and fruit formation. We used dried ants pinned to inflorescences to evaluate the effect of ant presence and ant identity on potential pollinators. Results show that the presence of treehoppers increases ant abundance on flowers and disrupts pollination by oil-collecting bees, decreasing the frequency and duration of floral visits and reducing fruit and seed set. Treehopper herbivory has no direct effect on fruit or seed production, which are independent of treehopper density. Pinned ants promote avoidance by floral visitors, reducing the number of visits. Ant identity mediates visitation decisions, with Ectatomma brunneum causing greater avoidance by floral visitors than Camponotus rufipes. Field videos show that pollinating bees are harassed by ants near flowers, prompting avoidance behavior by the bees. This is the first demonstration of indirect effects by honeydew-gathering ants, via disrupted pollination, on plant reproduction in tropical cerrado savanna. Our results highlight the importance of studying other interactions near flowers, in addition to just observing pollinators, for a proper understanding of plant reproduction.

  4. [Behavioral mechanisms of spatial competition between red wood ants (Formica aquilonia) and ground beetles (Carabidae)].

    Science.gov (United States)

    Dorosheva, E A; Reznikova, Zh I

    2006-01-01

    Behavioral aspects of spatial competition between red wood ants (Formica aquilonia) and six mass species of Carabidae were studied in field and laboratory experiments. We showed that red wood ants essentially influence spatial distribution of ground beetles on their common territories. Transplantation experiments suggest that in newly established ants' settlements stronger forms of interrelations arise than in old stable colony. To examine the ability of beetles to avoid collisions with ants we used two experimental techniques. In laboratory, we tested carabids ability to avoid a clash in a Y-shaped labyrinth containing an active tethered ant in one section. In field experiments we compared quantitative characteristics of movements (such as crookedness of individual trajectories, speed of movement, the time spent on stops) for beetles placed close to ants foraging routes and on ant-free plots. All beetles studied displayed a clear tendency to learn, that is, to modity their behavior in order to avoid collisions with ants. Species that exhibited best parameters of learning were closer to ants by their size and characteristic movement, namely, Pterostichus oblogopunctatus and P. magus. Beetles' stereotyped behavioral tactics can be considered universal for avoiding collisions with any subject (for instance, with an ant) of a certain size and speed of movements. A set of tactics in the labyrinth included: (1) attempts to round the ant; (2) turns away after touching the ant with antennae; (3) turns away without a contact; (4) avoidances of a dangerous section; (5) stops near the ant with the antennae hidden. Comparing pairwise difference between four species shows that beetles use species-specific preference for definite combinations of tactics. Effective learning allows carabids to penetrate into ant foraging territory and partly avoide interference competition. It seems that red wood ants are not inclined to learn to avoid collisions with competing carabid species

  5. CO2 efflux from subterranean nests of ant communities in a seasonal tropical forest, Thailand

    OpenAIRE

    Hasin, Sasitorn; Ohashi, Mizue; Yamada, Akinori; Hashimoto, Yoshiaki; Tasen, Wattanachai; Kume, Tomonori; Yamane, Seiki

    2014-01-01

    Many ant species construct subterranean nests. The presence of their nests may explain soil respiration “hot spots”, an important factor in the high CO2 efflux from tropical forests. However, no studies have directly measured CO2 efflux from ant nests. We established 61 experimental plots containing 13 subterranean ant species to evaluate the CO2 efflux from subterranean ant nests in a tropical seasonal forest, Thailand. We examined differences in nest CO2 efflux among ant species. We determi...

  6. DATA MINING UNTUK KLASIFIKASI PELANGGAN DENGAN ANT COLONY OPTIMIZATION

    Directory of Open Access Journals (Sweden)

    Maulani Kapiudin

    2007-01-01

    Full Text Available In this research the system for potentially customer classification is designed by extracting rule based classification from raw data with certain criteria. The searching process uses customer database from a bank with data mining technic by using ant colony optimization. A test based on min_case_per_rule variety and phenomene updating were done on a certain period of time. The result are group of customer class which base on rules built by ant and by modifying the pheromone updating, the area of the case is getting bigger. Prototype of the software is coded with C++ 6 version. The customer database master is created by using Microsoft Access. This paper gives information about potential customer of bank that can be classified by prototype of the software. Abstract in Bahasa Indonesia : Pada penelitian untuk sistem klasifikasi potensial customer ini didesain dengan melakukan ekstrak rule berdasarkan klasifikasi dari data mentah dengan kriteria tertentu. Proses pencarian menggunakan database pelanggan dari suatu bank dengan teknik data mining dengan ant colony optimization. Dilakukan percobaan dengan min_case_per_rule variety dan phenomene updating pada periode waktu tertentu. Hasilnya adalah sekelompok class pelanggan yang didasarkan dari rules yang dibangun dengan ant dan dengan dimodifikasi dengan pheromone updating, area permasalahan menjadi lebih melebar. Prototype dari software ini menggunakan C++ versi 6. Database pelanggan dibangun dengan Microsoft Access. Paper ini memberikan informasi mengenai potensi pelanggan dari bank, sehingga dapat diklasifikasikan dengan prototype dari software. Kata kunci: ant colony optimization, classification, min_case_per_rule, term, pheromone updating

  7. Bacterial Infections across the Ants: Frequency and Prevalence of Wolbachia, Spiroplasma, and Asaia

    Directory of Open Access Journals (Sweden)

    Stefanie Kautz

    2013-01-01

    Full Text Available Bacterial endosymbionts are common across insects, but we often lack a deeper knowledge of their prevalence across most organisms. Next-generation sequencing approaches can characterize bacterial diversity associated with a host and at the same time facilitate the fast and simultaneous screening of infectious bacteria. In this study, we used 16S rRNA tag encoded amplicon pyrosequencing to survey bacterial communities of 310 samples representing 221 individuals, 176 colonies and 95 species of ants. We found three distinct endosymbiont groups—Wolbachia (Alphaproteobacteria: Rickettsiales, Spiroplasma (Firmicutes: Entomoplasmatales, and relatives of Asaia (Alphaproteobacteria: Rhodospirillales—at different infection frequencies (at the ant species level: 22.1%, 28.4%, and 14.7%, resp. and relative abundances within bacterial communities (1.0%–99.9%. Spiroplasma was particularly enriched in the ant genus Polyrhachis, while Asaia relatives were most prevalent in arboreal ants of the genus Pseudomyrmex. While Wolbachia and Spiroplasma have been surveyed in ants before, Asaia, an acetic acid bacterium capable of fixing atmospheric nitrogen, has received much less attention. Due to sporadic prevalence across all ant taxa investigated, we hypothesize facultative associations for all three bacterial genera. Infection patterns are discussed in relation to potential adaptation of specific bacteria in certain ant groups.

  8. Are ant assemblages of Brazilian veredas characterised by location or habitat type?

    Directory of Open Access Journals (Sweden)

    CB Costa-Milanez

    Full Text Available Wetland areas in the Brazilian Cerrado, known as “veredas”, represent ecosystems formed on sandy soils with high concentrations of peat, and are responsible for the recharge of aquiferous reservoirs. They are currently under threat by various human activities, most notably the clearing of vegetation for Eucalyptus plantations. Despite their ecological importance and high conservation value, little is known about the actual effects of human disturbance on the animal community. To assess how habitat within different veredas, and plantations surrounding them affect ant assemblages, we selected four independent vereda locations, two being impacted by Eucalyptus monoculture (one younger and one mature plantation and two controls, where the wetland was surrounded by cerrado vegetation. Ant sampling was conducted in May 2010 (dry season using three complementary methods, namely baits, pitfall traps, and hand collection, in the wetland and in the surrounding habitats. A total of 7,575 ants were sampled, belonging to seven subfamilies, 32 genera and 124 species. Ant species richness and abundance did not differ between vereda locations, but did between the habitats. When impacted by the monoculture, ant species richness and abundance decreased in wetlands, but were less affected in the cerrado habitat. Ant species composition differed between the three habitats and between vereda locations. Eucalyptus plantations had an ant species composition defined by high dominance of Pheidole sp. and Solenopsis invicta, while natural habitats were defined by Camponotus and Crematogaster species. Atta sexdens was strictly confined to native habitats of non-impacted “veredas”. Eucalyptus monocultures require high quantities of water in the early stages, which may have caused a decrease in groundwater level in the wetland, allowing hypogeic ants such as Labidus praedator to colonise this habitat.

  9. Ant species richness of fynbos and forest ecosystems in the ...

    African Journals Online (AJOL)

    The ant fauna in fynbos and forest habitats in the southern Cape are compared. There is no significant difference in ant species richness between the two undisturbed habitat types, and the only two species common to both are Acantholepis capensis and Camponotus maculatus. The degree of Hakea sericea infestation in ...

  10. Mating, hybridisation and introgression in Lasius ants (Hymenoptera: Formicidae)

    DEFF Research Database (Denmark)

    Van der Have, Tom; Pedersen, Jes Søe; Boomsma, Jacobus Jan

    2011-01-01

    Recent reviews have shown that hybridisation among ant species is likely to be more common than previously appreci-ated, but that documented cases of introgression remain rare. After molecular phylogenetic work had shown that Euro-pean Lasius niger (LINNAEUS, 1758) and L. psammophilus SEIFERT, 1992...... (formerly L. alienus (FOERSTER, 1850)) are unlikely to be very closely related, we decided to analyse an old data set confirming the conclusion by PEARSON (1983) that these two ants can indeed form viable hybrids. We show that signatures of introgression can be detected in a Danish site...... sympatrically. This would imply that multiple accessible field sites are available to study the molecular details of hybridisation and in-trogression between two ant species that have variable degrees of sympatry throughout their distributional ranges...

  11. EVOLUTIONARY TRANSITIONS IN ENZYME ACTIVITY OF ANT FUNGUS GARDENS

    DEFF Research Database (Denmark)

    De Fine Licht, Henrik H; Schiøtt, Morten; Mueller, Ulrich G

    2010-01-01

    an association with a monophyletic clade of specialized symbionts. In conjunction with the transition to specialized symbionts, the ants advanced in colony size and social complexity. Here we provide a comparative study of the functional specialization in extracellular enzyme activities in fungus gardens across...... the attine phylogeny. We show that, relative to sister clades, gardens of higher-attine ants have enhanced activity of protein-digesting enzymes, whereas gardens of leaf-cutting ants also have increased activity of starch-digesting enzymes. However, the enzyme activities of lower-attine fungus gardens...... are targeted primarily towards partial degradation of plant cell walls, reflecting a plesiomorphic state of non-domesticated fungi. The enzyme profiles of the higher-attine and leaf-cutting gardens appear particularly suited to digest fresh plant materials and to access nutrients from live cells without major...

  12. Unusual animal-plant interaction: Feeding of Schomburgkia tibicinis (Orchidaceae) by ants

    International Nuclear Information System (INIS)

    Rico-Gray, V.; Barber, J.T.; Thien, L.B.; Ellgaard, E.G.; Toney, J.J.

    1989-01-01

    The hollow pseudobulbs of Schomburgkia tibicinis (Orchidaceae; Central America) serve as domatia for many species of ants. The ants pack many of the pseudobulbs with debris including dead insects, plant material, and sand. Ants were fed 14 C-labelled D-glucose in honey, killed, and placed in the pseudobulbs for up to eight weeks. Samples of plant tissue were harvested and tested for radioactivity after 1, 2, 3, 4, 6, and 8 weeks. The labelled material had moved into various parts of the plant and demonstrated direct nutrient uptake

  13. Interaction specificity between leaf-cutting ants and vertically transmitted Pseudonocardia bacteria

    DEFF Research Database (Denmark)

    Breum Andersen, Sandra; Yek, Sze Huei; Nash, David R.

    2015-01-01

    Background: The obligate mutualism between fungus-growing ants and microbial symbionts offers excellent opportunities to study the specificity and stability of multi-species interactions. In addition to cultivating fungus gardens, these ants have domesticated actinomycete bacteria to defend garde...

  14. The relationship between canopy cover and colony size of the wood ant Formica lugubris--implications for the thermal effects on a keystone ant species.

    Directory of Open Access Journals (Sweden)

    Yi-Huei Chen

    Full Text Available Climate change may affect ecosystems and biodiversity through the impacts of rising temperature on species' body size. In terms of physiology and genetics, the colony is the unit of selection for ants so colony size can be considered the body size of a colony. For polydomous ant species, a colony is spread across several nests. This study aims to clarify how climate change may influence an ecologically significant ant species group by investigating thermal effects on wood ant colony size. The strong link between canopy cover and the local temperatures of wood ant's nesting location provides a feasible approach for our study. Our results showed that nests were larger in shadier areas where the thermal environment was colder and more stable compared to open areas. Colonies (sum of nests in a polydomous colony also tended to be larger in shadier areas than in open areas. In addition to temperature, our results supported that food resource availability may be an additional factor mediating the relationship between canopy cover and nest size. The effects of canopy cover on total colony size may act at the nest level because of the positive relationship between total colony size and mean nest size, rather than at the colony level due to lack of link between canopy cover and number of nests per colony. Causal relationships between the environment and the life-history characteristics may suggest possible future impacts of climate change on these species.

  15. El periodista, ante la espiral de silencio

    Directory of Open Access Journals (Sweden)

    Dr. Fermín Galindo Arranz

    1998-01-01

    Full Text Available La percepción de la profesión periodística y de su influencia cambia mucho a lo largo del tiempo, de las coyunturas históricas y de los diferentes países y sociedades en los que desempeñan su labor. En un contexto mundial, la gravedad de las situaciones de riesgo periodístico se encuadran en situaciones políticas, económicas o sociales también conflictivas; es entonces cuando se suele reproducir con facilidad en la opinión pública el fenómeno de la espiral del silencio, ante el que inevitablemente se sitúa el periodista. Por definición, el trabajo del periodista consiste en ser portavoz de las novedades que se producen, en dar informaciones y emitir opiniones en la esfera pública, se tiene que situar, por tanto, de forma individual y notoriamente pública ante los fenómenos de espiral de silencio que puedan producirse en la opinión pública. Antonio Tabucchi nos presenta en su novela "Sostiene Pereira" un ejemplo magnífico del dilema del periodista ante este tipo de situaciones.

  16. Leaf-cutting ant fungi produce cell wall degrading pectinase complexes reminiscent of phytopathogenic fungi.

    Science.gov (United States)

    Schiøtt, Morten; Rogowska-Wrzesinska, Adelina; Roepstorff, Peter; Boomsma, Jacobus J

    2010-12-31

    Leaf-cutting (attine) ants use their own fecal material to manure fungus gardens, which consist of leaf material overgrown by hyphal threads of the basidiomycete fungus Leucocoprinus gongylophorus that lives in symbiosis with the ants. Previous studies have suggested that the fecal droplets contain proteins that are produced by the fungal symbiont to pass unharmed through the digestive system of the ants, so they can enhance new fungus garden growth. We tested this hypothesis by using proteomics methods to determine the gene sequences of fecal proteins in Acromyrmex echinatior leaf-cutting ants. Seven (21%) of the 33 identified proteins were pectinolytic enzymes that originated from the fungal symbiont and which were still active in the fecal droplets produced by the ants. We show that these enzymes are found in the fecal material only when the ants had access to fungus garden food, and we used quantitative polymerase chain reaction analysis to show that the expression of six of these enzyme genes was substantially upregulated in the fungal gongylidia. These unique structures serve as food for the ants and are produced only by the evolutionarily advanced garden symbionts of higher attine ants, but not by the fungi reared by the basal lineages of this ant clade. Pectinolytic enzymes produced in the gongylidia of the fungal symbiont are ingested but not digested by Acromyrmex leaf-cutting ants so that they end up in the fecal fluid and become mixed with new garden substrate. Substantial quantities of pectinolytic enzymes are typically found in pathogenic fungi that attack live plant tissue, where they are known to breach the cell walls to allow the fungal mycelium access to the cell contents. As the leaf-cutting ant symbionts are derived from fungal clades that decompose dead plant material, our results suggest that their pectinolytic enzymes represent secondarily evolved adaptations that are convergent to those normally found in phytopathogens.

  17. Leaf-cutting ant fungi produce cell wall degrading pectinase complexes reminiscent of phytopathogenic fungi

    Directory of Open Access Journals (Sweden)

    Boomsma Jacobus J

    2010-12-01

    Full Text Available Abstract Background Leaf-cutting (attine ants use their own fecal material to manure fungus gardens, which consist of leaf material overgrown by hyphal threads of the basidiomycete fungus Leucocoprinus gongylophorus that lives in symbiosis with the ants. Previous studies have suggested that the fecal droplets contain proteins that are produced by the fungal symbiont to pass unharmed through the digestive system of the ants, so they can enhance new fungus garden growth. Results We tested this hypothesis by using proteomics methods to determine the gene sequences of fecal proteins in Acromyrmex echinatior leaf-cutting ants. Seven (21% of the 33 identified proteins were pectinolytic enzymes that originated from the fungal symbiont and which were still active in the fecal droplets produced by the ants. We show that these enzymes are found in the fecal material only when the ants had access to fungus garden food, and we used quantitative polymerase chain reaction analysis to show that the expression of six of these enzyme genes was substantially upregulated in the fungal gongylidia. These unique structures serve as food for the ants and are produced only by the evolutionarily advanced garden symbionts of higher attine ants, but not by the fungi reared by the basal lineages of this ant clade. Conclusions Pectinolytic enzymes produced in the gongylidia of the fungal symbiont are ingested but not digested by Acromyrmex leaf-cutting ants so that they end up in the fecal fluid and become mixed with new garden substrate. Substantial quantities of pectinolytic enzymes are typically found in pathogenic fungi that attack live plant tissue, where they are known to breach the cell walls to allow the fungal mycelium access to the cell contents. As the leaf-cutting ant symbionts are derived from fungal clades that decompose dead plant material, our results suggest that their pectinolytic enzymes represent secondarily evolved adaptations that are convergent to

  18. Are Tree Species Diversity and Genotypic Diversity Effects on Insect Herbivores Mediated by Ants?

    Directory of Open Access Journals (Sweden)

    María José Campos-Navarrete

    Full Text Available Plant diversity can influence predators and omnivores and such effects may in turn influence herbivores and plants. However, evidence for these ecological feedbacks is rare. We evaluated if the effects of tree species (SD and genotypic diversity (GD on the abundance of different guilds of insect herbivores associated with big-leaf mahogany (Swietenia macrophylla were contingent upon the protective effects of ants tending extra-floral nectaries of this species. This study was conducted within a larger experiment consisting of mahogany monocultures and species polycultures of four species and -within each of these two plot types- mahogany was represented by either one or four maternal families. We selected 24 plots spanning these treatment combinations, 10 mahogany plants/plot, and within each plot experimentally reduced ant abundance on half of the selected plants, and surveyed ant and herbivore abundance. There were positive effects of SD on generalist leaf-chewers and sap-feeders, but for the latter group this effect depended on the ant reduction treatment: SD positively influenced sap-feeders under ambient ant abundance but had no effect when ant abundance was reduced; at the same time, ants had negative effects on sap feeders in monoculture but no effect in polyculture. In contrast, SD did not influence specialist stem-borers or leaf-miners and this effect was not contingent upon ant reduction. Finally, GD did not influence any of the herbivore guilds studied, and such effects did not depend on the ant treatment. Overall, we show that tree species diversity influenced interactions between a focal plant species (mahogany and ants, and that such effects in turn mediated plant diversity effects on some (sap-feeders but not all the herbivores guilds studied. Our results suggest that the observed patterns are dependent on the combined effects of herbivore identity, diet breadth, and the source of plant diversity.

  19. Activity of bifenthrin, chlorfenapyr, fipronil, and thiamethoxam against Argentine ants (Hymenoptera: Formicidae).

    Science.gov (United States)

    Wiltz, B A; Suiter, D R; Gardner, W A

    2009-12-01

    Bifenthrin, chlorfenapyr, fipronil, and thiamethoxam were evaluated for activity against the Argentine ant, Linepithema humile (Mayr) (Hymenoptera: Formicidae). Mobility impairment and lethal times were determined after topical treatments. Ants were immobilized most quickly by bifenthrin, followed by chlorfenapyr and thiamethoxam. After 2 h, the number of fipronil-treated ants unable to walk out of test arenas did not differ from control ants. Median lethal time (LT50) after topical treatment was lowest in the bifenthrin treatment, followed by thiamethoxam, chlorfenapyr, and then fipronil. Mortality due to horizontal exposure was evaluated at 10, 20, or 30 degrees C, with topically treated ant corpses serving as donors. There was low to moderate horizontal activity in bifenthrin and chlorfenapyr treatments, with no temperature effect in bifenthrin treatments and a positive temperature effect in chlorfenapyr treatments. Mortality in the fipronil treatments was highest and was positively correlated with temperature. Thiamethoxam treatments did not differ from controls at 10 degrees C, but mortality increased with temperature. To evaluate contact activity, either all of 20% of the ants in a cohort were exposed to insecticide-treated pine needles. In both tests, mortality was highest in fipronil and bifenthrin treatments, followed by thiamethoxam, with lowest mortality in chlorfenapyr treatments. Effectiveness as a barrier was evaluated by providing a choice between bridges treated with insecticide or water. Although bifenthrin did not provide an impenetrable barrier, it was the only treatment having fewer ants than its paired control. Mortality data suggest that lack of recruitment rather than repellency account for this result.

  20. Behavior of ergatoid males in the ant, Cardiocondyla nuda

    OpenAIRE

    Heinze, Jürgen; Künholz, S.; Schilder, K.; Hölldobler, B.

    1993-01-01

    Ergatoid males of the ant, Cardiocondyla nuda, attack and frequently kill young males during or shortly after eclosion. Smaller colonies therefore contain typically only one adult male, which may inseminate all alate queens which are reared in the colony over a few weeks. In larger colonies, several males may be present, however, fighting among adult males was not observed. We discuss the significance of male fighting behavior in ants.

  1. Image Edge Tracking via Ant Colony Optimization

    Science.gov (United States)

    Li, Ruowei; Wu, Hongkun; Liu, Shilong; Rahman, M. A.; Liu, Sanchi; Kwok, Ngai Ming

    2018-04-01

    A good edge plot should use continuous thin lines to describe the complete contour of the captured object. However, the detection of weak edges is a challenging task because of the associated low pixel intensities. Ant Colony Optimization (ACO) has been employed by many researchers to address this problem. The algorithm is a meta-heuristic method developed by mimicking the natural behaviour of ants. It uses iterative searches to find the optimal solution that cannot be found via traditional optimization approaches. In this work, ACO is employed to track and repair broken edges obtained via conventional Sobel edge detector to produced a result with more connected edges.

  2. Laccase detoxification mediates the nutritional alliance between leaf-cutting ants and fungus-garden symbionts.

    Science.gov (United States)

    De Fine Licht, Henrik H; Schiøtt, Morten; Rogowska-Wrzesinska, Adelina; Nygaard, Sanne; Roepstorff, Peter; Boomsma, Jacobus J

    2013-01-08

    Leaf-cutting ants combine large-scale herbivory with fungus farming to sustain advanced societies. Their stratified colonies are major evolutionary achievements and serious agricultural pests, but the crucial adaptations that allowed this mutualism to become the prime herbivorous component of neotropical ecosystems has remained elusive. Here we show how coevolutionary adaptation of a specific enzyme in the fungal symbiont has helped leaf-cutting ants overcome plant defensive phenolic compounds. We identify nine putative laccase-coding genes in the fungal genome of Leucocoprinus gongylophorus cultivated by the leaf-cutting ant Acromyrmex echinatior. One of these laccases (LgLcc1) is highly expressed in the specialized hyphal tips (gongylidia) that the ants preferentially eat, and we confirm that these ingested laccase molecules pass through the ant guts and remain active when defecated on the leaf pulp that the ants add to their gardens. This accurate deposition ensures that laccase activity is highest where new leaf material enters the fungus garden, but where fungal mycelium is too sparse to produce extracellular enzymes in sufficient quantities to detoxify phenolic compounds. Phylogenetic analysis of LgLcc1 ortholog sequences from symbiotic and free-living fungi revealed significant positive selection in the ancestral lineage that gave rise to the gongylidia-producing symbionts of leaf-cutting ants and their non-leaf-cutting ant sister group. Our results are consistent with fungal preadaptation and subsequent modification of a particular laccase enzyme for the detoxification of secondary plant compounds during the transition to active herbivory in the ancestor of leaf-cutting ants between 8 and 12 Mya.

  3. Diversity of ants (Hymenoptera: Formicidae in two rubber plantations in Songkhla Province, Southern Thailand

    Directory of Open Access Journals (Sweden)

    Suparoek Watanasit

    2011-04-01

    Full Text Available Ants play important roles in tropical rainforest ecosystems. In southern Thailand, many such areas have been extensivelylogged and replaced by rubber plantations. Since changes to the environment can cause changes to the diversity offlora and fauna, the objectives of this study were to determine habitat influences on the ant composition between homogenousand heterogeneous rubber plantations, and to investigate if any environmental factors can be directly correlated withchanges in the ant community. Three 100 m–line-transects, spaced 100 m apart, were laid out at two study sites. Four samplingmethods, hand collecting (HC, leaf litter sampling (LL, honey bait (HB and soil sampling (SS, were used to sample ants.Temperature, humidity, and precipitation were recorded. Samples were collected every two months from June 2004 to April2005. The results showed that a total of six subfamilies (Aenictinae, Dolichoderinae, Formicinae, Myrmicinae, Ponerinaemand Pseudomyrmecinae, comprising 29 genera and 87 species were found in the two study sites. The dominant genera werePheidole and Crematogaster, followed by Pheidologeton and Pachycondyla. The sampling methods used in this studyindicated that LL and HC were most suitable for sampling ants, and any combination of sampling methods detected moreant species than a single method did. Detrended correspondence analysis (DCA grouped ant species between the two typesof rubber plantation, and also divided ant species into three groups by sampling method: HC group, SS group and LL+HBgroup. DCA did not group ant species by seasonal changes, however. Further, canonical correspondence analysis detectedno effect of temperature, humidity, or precipitation on the ant community.

  4. Agricultural matrices affect ground ant assemblage composition inside forest fragments.

    Directory of Open Access Journals (Sweden)

    Diego Santana Assis

    Full Text Available The establishment of agricultural matrices generally involves deforestation, which leads to fragmentation of the remaining forest. This fragmentation can affect forest dynamics both positively and negatively. Since most animal species are affected, certain groups can be used to measure the impact of such fragmentation. This study aimed to measure the impacts of agricultural crops (matrices on ant communities of adjacent lower montane Atlantic rainforest fragments. We sampled nine forest fragments at locations surrounded by different agricultural matrices, namely: coffee (3 replicates; sugarcane (3; and pasture (3. At each site we installed pitfall traps along a 500 m transect from the interior of the matrix to the interior of the fragment (20 pitfall traps ~25 m apart. Each transect was partitioned into four categories: interior of the matrix; edge of the matrix; edge of the fragment; and interior of the fragment. For each sample site, we measured ant species richness and ant community composition within each transect category. Ant richness and composition differed between fragments and matrices. Each sample location had a specific composition of ants, probably because of the influence of the nature and management of the agricultural matrices. Species composition in the coffee matrix had the highest similarity to its corresponding fragment. The variability in species composition within forest fragments surrounded by pasture was greatest when compared with forest fragments surrounded by sugarcane or, to a lesser extent, coffee. Functional guild composition differed between locations, but the most representative guild was 'generalist' both in the agricultural matrices and forest fragments. Our results are important for understanding how agricultural matrices act on ant communities, and also, how these isolated forest fragments could act as an island of biodiversity in an 'ocean of crops'.

  5. Agricultural matrices affect ground ant assemblage composition inside forest fragments.

    Science.gov (United States)

    Assis, Diego Santana; Dos Santos, Iracenir Andrade; Ramos, Flavio Nunes; Barrios-Rojas, Katty Elena; Majer, Jonathan David; Vilela, Evaldo Ferreira

    2018-01-01

    The establishment of agricultural matrices generally involves deforestation, which leads to fragmentation of the remaining forest. This fragmentation can affect forest dynamics both positively and negatively. Since most animal species are affected, certain groups can be used to measure the impact of such fragmentation. This study aimed to measure the impacts of agricultural crops (matrices) on ant communities of adjacent lower montane Atlantic rainforest fragments. We sampled nine forest fragments at locations surrounded by different agricultural matrices, namely: coffee (3 replicates); sugarcane (3); and pasture (3). At each site we installed pitfall traps along a 500 m transect from the interior of the matrix to the interior of the fragment (20 pitfall traps ~25 m apart). Each transect was partitioned into four categories: interior of the matrix; edge of the matrix; edge of the fragment; and interior of the fragment. For each sample site, we measured ant species richness and ant community composition within each transect category. Ant richness and composition differed between fragments and matrices. Each sample location had a specific composition of ants, probably because of the influence of the nature and management of the agricultural matrices. Species composition in the coffee matrix had the highest similarity to its corresponding fragment. The variability in species composition within forest fragments surrounded by pasture was greatest when compared with forest fragments surrounded by sugarcane or, to a lesser extent, coffee. Functional guild composition differed between locations, but the most representative guild was 'generalist' both in the agricultural matrices and forest fragments. Our results are important for understanding how agricultural matrices act on ant communities, and also, how these isolated forest fragments could act as an island of biodiversity in an 'ocean of crops'.

  6. Traumatic brain injury: Comparison between autopsy and ante-mortem CT.

    Science.gov (United States)

    Panzer, Stephanie; Covaliov, Lidia; Augat, Peter; Peschel, Oliver

    2017-11-01

    The aim of this study was to compare pathological findings after traumatic brain injury between autopsy and ante-mortem computed tomography (CT). A second aim was to identify changes in these findings between the primary posttraumatic CT and the last follow-up CT before death. Through the collaboration between clinical radiology and forensic medicine, 45 patients with traumatic brain injury were investigated. These patients had undergone ante-mortem CT as well as autopsy. During autopsy, the brain was cut in fronto-parallel slices directly after removal without additional fixation or subsequent histology. Typical findings of traumatic brain injury were compared between autopsy and radiology. Additionally, these findings were compared between the primary CT and the last follow-up CT before death. The comparison between autopsy and radiology revealed a high specificity (≥80%) in most of the findings. Sensitivity and positive predictive value were high (≥80%) in almost half of the findings. Sixteen patients had undergone craniotomy with subsequent follow-up CT. Thirteen conservatively treated patients had undergone a follow-up CT. Comparison between the primary CT and the last ante-mortem CT revealed marked changes in the presence and absence of findings, especially in patients with severe traumatic brain injury requiring decompression craniotomy. The main pathological findings of traumatic brain injury were comparable between clinical ante-mortem CT examinations and autopsy. Comparison between the primary CT after trauma and the last ante-mortem CT revealed marked changes in the findings, especially in patients with severe traumatic brain injury. Hence, clinically routine ante-mortem CT should be included in the process of autopsy interpretation. Copyright © 2017 Elsevier Ltd and Faculty of Forensic and Legal Medicine. All rights reserved.

  7. The effectiveness of weaver ant (Oecophylla smaragdina) biocontrol in Southeast Asian citrus and mango

    DEFF Research Database (Denmark)

    Offenberg, Joachim; Cuc, Nguyen Thi Thu; Wiwatwitaya, Decha

    2013-01-01

    Oecophylla ants may protect tropical plantation crops against pests. Cost-benefit studies comparing ant-based protection with conventional methods are needed to assess whether it is economically viable. Here we contrast profits in ant and chemically protected plots in a Thai and a Vietnamese citrus...

  8. The dynamics of plant cell-wall polysaccharide decomposition in leaf-cutting ant fungus gardens.

    Directory of Open Access Journals (Sweden)

    Isabel E Moller

    Full Text Available The degradation of live plant biomass in fungus gardens of leaf-cutting ants is poorly characterised but fundamental for understanding the mutual advantages and efficiency of this obligate nutritional symbiosis. Controversies about the extent to which the garden-symbiont Leucocoprinus gongylophorus degrades cellulose have hampered our understanding of the selection forces that induced large scale herbivory and of the ensuing ecological footprint of these ants. Here we use a recently established technique, based on polysaccharide microarrays probed with antibodies and carbohydrate binding modules, to map the occurrence of cell wall polymers in consecutive sections of the fungus garden of the leaf-cutting ant Acromyrmex echinatior. We show that pectin, xyloglucan and some xylan epitopes are degraded, whereas more highly substituted xylan and cellulose epitopes remain as residuals in the waste material that the ants remove from their fungus garden. These results demonstrate that biomass entering leaf-cutting ant fungus gardens is only partially utilized and explain why disproportionally large amounts of plant material are needed to sustain colony growth. They also explain why substantial communities of microbial and invertebrate symbionts have evolved associations with the dump material from leaf-cutting ant nests, to exploit decomposition niches that the ant garden-fungus does not utilize. Our approach thus provides detailed insight into the nutritional benefits and shortcomings associated with fungus-farming in ants.

  9. Water Stress Strengthens Mutualism Among Ants, Trees, and Scale Insects

    Science.gov (United States)

    Pringle, Elizabeth G.; Akçay, Erol; Raab, Ted K.; Dirzo, Rodolfo; Gordon, Deborah M.

    2013-01-01

    Abiotic environmental variables strongly affect the outcomes of species interactions. For example, mutualistic interactions between species are often stronger when resources are limited. The effect might be indirect: water stress on plants can lead to carbon stress, which could alter carbon-mediated plant mutualisms. In mutualistic ant–plant symbioses, plants host ant colonies that defend them against herbivores. Here we show that the partners' investments in a widespread ant–plant symbiosis increase with water stress across 26 sites along a Mesoamerican precipitation gradient. At lower precipitation levels, Cordia alliodora trees invest more carbon in Azteca ants via phloem-feeding scale insects that provide the ants with sugars, and the ants provide better defense of the carbon-producing leaves. Under water stress, the trees have smaller carbon pools. A model of the carbon trade-offs for the mutualistic partners shows that the observed strategies can arise from the carbon costs of rare but extreme events of herbivory in the rainy season. Thus, water limitation, together with the risk of herbivory, increases the strength of a carbon-based mutualism. PMID:24223521

  10. Do host species evolve a specific response to slave-making ants?

    Directory of Open Access Journals (Sweden)

    Delattre Olivier

    2012-12-01

    Full Text Available Abstract Background Social parasitism is an important selective pressure for social insect species. It is particularly the case for the hosts of dulotic (so called slave-making ants, which pillage the brood of host colonies to increase the worker force of their own colony. Such raids can have an important impact on the fitness of the host nest. An arms race which can lead to geographic variation in host defenses is thus expected between hosts and parasites. In this study we tested whether the presence of a social parasite (the dulotic ant Myrmoxenus ravouxi within an ant community correlated with a specific behavioral defense strategy of local host or non-host populations of Temnothorax ants. Social recognition often leads to more or less pronounced agonistic interactions between non-nestmates ants. Here, we monitored agonistic behaviors to assess whether ants discriminate social parasites from other ants. It is now well-known that ants essentially rely on cuticular hydrocarbons to discriminate nestmates from aliens. If host species have evolved a specific recognition mechanism for their parasite, we hypothesize that the differences in behavioral responses would not be fully explained simply by quantitative dissimilarity in cuticular hydrocarbon profiles, but should also involve a qualitative response due to the detection of particular compounds. We scaled the behavioral results according to the quantitative chemical distance between host and parasite colonies to test this hypothesis. Results Cuticular hydrocarbon profiles were distinct between species, but host species did not show a clearly higher aggression rate towards the parasite than toward non-parasite intruders, unless the degree of response was scaled by the chemical distance between intruders and recipient colonies. By doing so, we show that workers of the host and of a non-host species in the parasitized site displayed more agonistic behaviors (bites and ejections towards parasite

  11. Warehouse stocking optimization based on dynamic ant colony genetic algorithm

    Science.gov (United States)

    Xiao, Xiaoxu

    2018-04-01

    In view of the various orders of FAW (First Automotive Works) International Logistics Co., Ltd., the SLP method is used to optimize the layout of the warehousing units in the enterprise, thus the warehouse logistics is optimized and the external processing speed of the order is improved. In addition, the relevant intelligent algorithms for optimizing the stocking route problem are analyzed. The ant colony algorithm and genetic algorithm which have good applicability are emphatically studied. The parameters of ant colony algorithm are optimized by genetic algorithm, which improves the performance of ant colony algorithm. A typical path optimization problem model is taken as an example to prove the effectiveness of parameter optimization.

  12. Ants can learn to forage on one-way trails.

    Directory of Open Access Journals (Sweden)

    Pedro Leite Ribeiro

    Full Text Available The trails formed by many ant species between nest and food source are two-way roads on which outgoing and returning workers meet and touch each other all along. The way to get back home, after grasping a food load, is to take the same route on which they have arrived from the nest. In many species such trails are chemically marked by pheromones providing orientation cues for the ants to find their way. Other species rely on their vision and use landmarks as cues. We have developed a method to stop foraging ants from shuttling on two-way trails. The only way to forage is to take two separate roads, as they cannot go back on their steps after arriving at the food or at the nest. The condition qualifies as a problem because all their orientation cues -- chemical, visual or any other -- are disrupted, as all of them cannot but lead the ants back to the route on which they arrived. We have found that workers of the leaf-cutting ant Atta sexdens rubropilosa can solve the problem. They could not only find the alternative way, but also used the unidirectional traffic system to forage effectively. We suggest that their ability is an evolutionary consequence of the need to deal with environmental irregularities that cannot be negotiated by means of excessively stereotyped behavior, and that it is but an example of a widespread phenomenon. We also suggest that our method can be adapted to other species, invertebrate and vertebrate, in the study of orientation, memory, perception, learning and communication.

  13. Predatory behavior of Pseudodorus clavatus (Diptera, Syrphidae on aphids tended by ants

    Directory of Open Access Journals (Sweden)

    Alexandra Bächtold

    2013-12-01

    Full Text Available Predatory behavior of Pseudodorus clavatus (Diptera, Syrphidae on aphids tended by ants. In this study, we examined the interactions between myrmecophilous aphids, their ant-guards and a predatory syrphid species, Pseudodorus clavatus (F.. Larvae of this predator were found in the colonies of three aphid species: Aphis gossypii, A. spiraecola and Toxoptera sp., which were tended by eight ant species, especially Camponotus. Hoverfly larvae managed to infiltrate the aphid colonies and consume nymphs. Predator larvae exhibited inconspicuous movements and were not detected by ants which were commonly observed touching and antennating the larvae they come into contact. These results suggest that behavioral and chemical cues are involved in the infiltration and on the successful predation of syrphids upon aphids.

  14. Phylogenomics and Divergence Dating of Fungus-Farming Ants (Hymenoptera: Formicidae of the Genera Sericomyrmex and Apterostigma.

    Directory of Open Access Journals (Sweden)

    Ana Ješovnik

    Full Text Available Fungus-farming ("attine" ants are model systems for studies of symbiosis, coevolution, and advanced eusociality. A New World clade of nearly 300 species in 15 genera, all attine ants cultivate fungal symbionts for food. In order to better understand the evolution of ant agriculture, we sequenced, assembled, and analyzed transcriptomes of four different attine ant species in two genera: three species in the higher-attine genus Sericomyrmex and a single lower-attine ant species, Apterostigma megacephala, representing the first genomic data for either genus. These data were combined with published genomes of nine other ant species and the honey bee Apis mellifera for phylogenomic and divergence-dating analyses. The resulting phylogeny confirms relationships inferred in previous studies of fungus-farming ants. Divergence-dating analyses recovered slightly older dates than most prior analyses, estimating that attine ants originated 53.6-66.7 million of years ago, and recovered a very long branch subtending a very recent, rapid radiation of the genus Sericomyrmex. This result is further confirmed by a separate analysis of the three Sericomyrmex species, which reveals that 92.71% of orthologs have 99% - 100% pairwise-identical nucleotide sequences. We searched the transcriptomes for genes of interest, most importantly argininosuccinate synthase and argininosuccinate lyase, which are functional in other ants but which are known to have been lost in seven previously studied attine ant species. Loss of the ability to produce the amino acid arginine has been hypothesized to contribute to the obligate dependence of attine ants upon their cultivated fungi, but the point in fungus-farming ant evolution at which these losses occurred has remained unknown. We did not find these genes in any of the sequenced transcriptomes. Although expected for Sericomyrmex species, the absence of arginine anabolic genes in the lower-attine ant Apterostigma megacephala strongly

  15. Male parentage in army ants

    DEFF Research Database (Denmark)

    Kronauer, Daniel J C; Schöning, Caspar; Boomsma, Jacobus J

    2006-01-01

    of active research in insect sociobiology. Here we present microsatellite data for 176 males from eight colonies of the African army ant Dorylus (Anomma) molestus. Comparison with worker genotypes and inferred queen genotypes from the same colonies show that workers do not or at best very rarely reproduce...

  16. Evolutionary transitions in enzyme activity of ant fungus gardens.

    Science.gov (United States)

    De Fine Licht, Henrik H; Schiøtt, Morten; Mueller, Ulrich G; Boomsma, Jacobus J

    2010-07-01

    Fungus-growing (attine) ants and their fungal symbionts passed through several evolutionary transitions during their 50 million year old evolutionary history. The basal attine lineages often shifted between two main cultivar clades, whereas the derived higher-attine lineages maintained an association with a monophyletic clade of specialized symbionts. In conjunction with the transition to specialized symbionts, the ants advanced in colony size and social complexity. Here we provide a comparative study of the functional specialization in extracellular enzyme activities in fungus gardens across the attine phylogeny. We show that, relative to sister clades, gardens of higher-attine ants have enhanced activity of protein-digesting enzymes, whereas gardens of leaf-cutting ants also have increased activity of starch-digesting enzymes. However, the enzyme activities of lower-attine fungus gardens are targeted primarily toward partial degradation of plant cell walls, reflecting a plesiomorphic state of nondomesticated fungi. The enzyme profiles of the higher-attine and leaf-cutting gardens appear particularly suited to digest fresh plant materials and to access nutrients from live cells without major breakdown of cell walls. The adaptive significance of the lower-attine symbiont shifts remains unclear. One of these shifts was obligate, but digestive advantages remained ambiguous, whereas the other remained facultative despite providing greater digestive efficiency.

  17. Extracción y caracterización de antígeno micelial de Aspergillus fumigatus

    Directory of Open Access Journals (Sweden)

    Bernarda Cuadrado

    1995-06-01

    Full Text Available Este estudio presenta la estandarización y caracterización antigénica de un extracto micelial de Aspergillus fumigatus, con el fin de utilizarlo posteriormente en pruebas diagnósticas de aspergilosis pulmonar. Para la evaluación del antígeno micelial, se emplearon técnicas de doble inmunodifusión (DD, contra inmunoelectroforesis (CIE+ ID y enzimoinmuno ensayo (ELISA, comparando sus resultados con un antígeno de referencia. La concentración de proteínas y carbohidratos del antígeno estudiado fue de 8.800pglmL y 2.452 pg/mL respectivamente, muy similares a los encontrados en el antígeno de referencia. Los antígenos analizados presentaron bandas de identidad total y parcial en la DD. No hubo bandas de precipitinas al enfrentar ambos antígenos con 20 sueros negativos, utilizando las pruebas de DD y CIE+ID. En la ClE+lD se presentaron precipitinas en los lados anódico y catódico de ambos antígenos. El punto de corte determinado en la prueba de ELlSA para el antígeno del estudio fué de 0,352, con un intervalo de confianza del 95%. Es posible concluir que el antígeno micelial estudiado puede ser empleado en pruebas serológicas diagnósticas.

  18. Diapriinae Wasps (Hymenoptera: Diaprioidea: Diapriidae Associated with Ants (Hymenoptera: Formicidae in Argentina

    Directory of Open Access Journals (Sweden)

    Marta S. Loiácono

    2013-01-01

    Full Text Available We provide an overview of diapriid wasps associated with ants in Argentina and the diversity of interactions they have developed with their hosts. As a result, we report 16 species of nine genera of Diapriinae, two new geographic distributions, three new association records, illustrations, and photographs. We highlight myrmecophile symphylic species, with a high degree of integration with the host ants, adaptation being morphological and behavioral. A table with diapriid species and ant hosts is given.

  19. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano

    2009-01-01

    . To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

  20. Attracting predators without falling prey: chemical camouflage protects honeydew-producing treehoppers from ant predation.

    Science.gov (United States)

    Silveira, Henrique C P; Oliveira, Paulo S; Trigo, José R

    2010-02-01

    Predaceous ants are dominant organisms on foliage and represent a constant threat to herbivorous insects. The honeydew of sap-feeding hemipterans has been suggested to appease aggressive ants, which then begin tending activities. Here, we manipulated the cuticular chemical profiles of freeze-dried insect prey to show that chemical background matching with the host plant protects Guayaquila xiphias treehoppers against predaceous Camponotus crassus ants, regardless of honeydew supply. Ant predation is increased when treehoppers are transferred to a nonhost plant with which they have low chemical similarity. Palatable moth larvae manipulated to match the chemical background of Guayaquila's host plant attracted lower numbers of predatory ants than unchanged controls. Although aggressive tending ants can protect honeydew-producing hemipterans from natural enemies, they may prey on the trophobionts under shortage of alternative food resources. Thus chemical camouflage in G. xiphias allows the trophobiont to attract predaceous bodyguards at reduced risk of falling prey itself.

  1. Time optimized path-choice in the termite hunting ant Megaponera analis.

    Science.gov (United States)

    Frank, Erik T; Hönle, Philipp O; Linsenmair, K Eduard

    2018-05-10

    Trail network systems among ants have received a lot of scientific attention due to their various applications in problem solving of networks. Recent studies have shown that ants select the fastest available path when facing different velocities on different substrates, rather than the shortest distance. The progress of decision-making by these ants is determined by pheromone-based maintenance of paths, which is a collective decision. However, path optimization through individual decision-making remains mostly unexplored. Here we present the first study of time-optimized path selection via individual decision-making by scout ants. Megaponera analis scouts search for termite foraging sites and lead highly organized raid columns to them. The path of the scout determines the path of the column. Through installation of artificial roads around M. analis nests we were able to influence the pathway choice of the raids. After road installation 59% of all recorded raids took place completely or partly on the road, instead of the direct, i.e. distance-optimized, path through grass from the nest to the termites. The raid velocity on the road was more than double the grass velocity, the detour thus saved 34.77±23.01% of the travel time compared to a hypothetical direct path. The pathway choice of the ants was similar to a mathematical model of least time allowing us to hypothesize the underlying mechanisms regulating the behavior. Our results highlight the importance of individual decision-making in the foraging behavior of ants and show a new procedure of pathway optimization. © 2018. Published by The Company of Biologists Ltd.

  2. Radiocesium contamination of the web spider Nephila clavata (Nephilidae: Arachnida) 1.5 years after the Fukushima Dai-ichi Nuclear Power Plant accident.

    Science.gov (United States)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato

    2014-01-01

    We measured the concentrations of radiocesium ((134)Cs and (137)Cs) in a large web spider, Nephila clavata L. Koch (Nephilidae: Arachnida), collected at three sites at different distances from the Fukushima Dai-ichi Nuclear Power Plant about 1.5 y after the accident in March 2011. The radiocesium concentrations in spiders were highest in a streamside secondary forest 33 km northwest of the power plant: mean ± a standard deviation of 2.401 ± 1.197 Bq g(-1) dry for (134)Cs and 3.955 ± 1.756 Bq g(-1) dry for (137)Cs. In a hillside secondary forest 37 km northwest of the power plant, the mean concentrations of (134)Cs and (137)Cs were 0.825 ± 0.247 Bq g(-1) dry and 1.470 ± 0.454 Bq g(-1) dry, respectively. In a pine forest 62 km west of the power plant, very low radiocesium concentrations were detected, but in only a few individuals. The concentrations of (134)Cs and (137)Cs in spiders collected at each site tended to be correlated with the air radiation dose rate at each site. Since spiders are key components of food webs in forests, the high concentrations in this species at contaminated sites suggested that the radiocesium from the accident has transferred through food chains and reached to higher trophic level of the food chains. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  3. Defensive traits exhibit an evolutionary trade-off and drive diversification in ants.

    Science.gov (United States)

    Blanchard, Benjamin D; Moreau, Corrie S

    2017-02-01

    Evolutionary biologists have long predicted that evolutionary trade-offs among traits should constrain morphological divergence and species diversification. However, this prediction has yet to be tested in a broad evolutionary context in many diverse clades, including ants. Here, we reconstruct an expanded ant phylogeny representing 82% of ant genera, compile a new family-wide trait database, and conduct various trait-based analyses to show that defensive traits in ants do exhibit an evolutionary trade-off. In particular, the use of a functional sting negatively correlates with a suite of other defensive traits including spines, large eye size, and large colony size. Furthermore, we find that several of the defensive traits that trade off with a sting are also positively correlated with each other and drive increased diversification, further suggesting that these traits form a defensive suite. Our results support the hypothesis that trade-offs in defensive traits significantly constrain trait evolution and influence species diversification in ants. © 2016 The Author(s). Evolution © 2016 The Society for the Study of Evolution.

  4. Disease in the Society: Infectious Cadavers Result in Collapse of Ant Sub-Colonies

    Science.gov (United States)

    Loreto, Raquel G.; Hughes, David P.

    2016-01-01

    Despite the growing number of experimental studies on mechanisms of social immunity in ant societies, little is known about how social behavior relates to disease progression within the nests of ants. In fact, when empirically studying disease in ant societies, it is common to remove dead ants from experiments to confirm infection by the studied parasite. This unfortunately does not allow disease to progress within the nest as it may be assumed would happen under natural conditions. Therefore, the approach taken so far has resulted in a limited knowledge of diseases dynamics within the nest environment. Here we introduced a single infectious cadaver killed by the fungus Beauveria bassiana into small nests of the ant Camponotus castaneus. We then observed the natural progression of the disease by not removing the corpses of the ants that died following the first entry of the disease. Because some behaviors such as social isolation of sick individuals or the removal of cadavers by nestmates are considered social immune functions and thus adaptations at the colony level that reduce disease spread, we also experimentally confined some sub-colonies to one or two chamber nests to prevent the expression of such behaviors. Based on 51 small nests and survival studies in 1,003 ants we found that a single introduced infectious cadaver was able to transmit within the nest, and social immunity did not prevent the collapse of the small sub-colonies here tested. This was true whether ants did or did not have the option to remove the infectious cadaver. Therefore, we found no evidence that the typically studied social immunity behaviors can reduce disease spread in the conditions here tested. PMID:27529548

  5. Using insect traps to increase weaver ant (Oecophylla longinoda) prey capture

    DEFF Research Database (Denmark)

    Lynegaard, Gina; Offenberg, Joachim; Fast, Thora

    2014-01-01

    Weaver ants (Oecophylla spp.) are managed in plantations to control insect pests and are sometimes harvested as a protein rich food source. In both cases, the amount of insect prey caught by the ants is imperative for returns, as more prey leads to more effective biocontrol and to a higher...... by O. longinoda under natural conditions (without traps), potentially increasing to 14% if ants learn to extract all insects. Thus, prey intake may be increased with 5-14% per 3.9 USD invested in traps. These numbers increased to 38 and 78%, respectively, when light was used to attract insects during...

  6. Forage collection, substrate preparation, and diet composition in fungus-growing ants

    DEFF Research Database (Denmark)

    Licht, H.H.D.; Boomsma, J.J.

    2010-01-01

    , whereas most of the other attine species use dry and partly degraded plant material such as leaf litter and caterpillar frass, but systematic comparative studies of actual resource acquisition across the attine ants have not been done. 3. Here we review 179 literature records of diet composition across...... the extant genera of fungus-growing ants. The records confirm the dependence of leaf-cutting ants on fresh vegetation but find that flowers, dry plant debris, seeds (husks), and insect frass are used by all genera, whereas other substrates such as nectar and insect carcasses are only used by some. 4. Diet...

  7. Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

    Directory of Open Access Journals (Sweden)

    Paula E. Cushing

    2012-01-01

    Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

  8. Bi-stability in cooperative transport by ants in the presence of obstacles.

    Directory of Open Access Journals (Sweden)

    Jonathan E Ron

    2018-05-01

    Full Text Available To cooperatively carry large food items to the nest, individual ants conform their efforts and coordinate their motion. Throughout this expedition, collective motion is driven both by internal interactions between the carrying ants and a response to newly arrived informed ants that orient the cargo towards the nest. During the transport process, the carrying group must overcome obstacles that block their path to the nest. Here, we investigate the dynamics of cooperative transport, when the motion of the ants is frustrated by a linear obstacle that obstructs the motion of the cargo. The obstacle contains a narrow opening that serves as the only available passage to the nest, and through which single ants can pass but not with the cargo. We provide an analytical model for the ant-cargo system in the constrained environment that predicts a bi-stable dynamic behavior between an oscillatory mode of motion along the obstacle and a convergent mode of motion near the opening. Using both experiments and simulations, we show how for small cargo sizes, the system exhibits spontaneous transitions between these two modes of motion due to fluctuations in the applied force on the cargo. The bi-stability provides two possible problem solving strategies for overcoming the obstacle, either by attempting to pass through the opening, or take large excursions to circumvent the obstacle.

  9. Chemical camouflage--a frog's strategy to co-exist with aggressive ants.

    Directory of Open Access Journals (Sweden)

    Mark-Oliver Rödel

    Full Text Available Whereas interspecific associations receive considerable attention in evolutionary, behavioural and ecological literature, the proximate bases for these associations are usually unknown. This in particular applies to associations between vertebrates with invertebrates. The West-African savanna frog Phrynomantis microps lives in the underground nest of ponerine ants (Paltothyreus tarsatus. The ants usually react highly aggressively when disturbed by fiercely stinging, but the frog is not attacked and lives unharmed among the ants. Herein we examined the proximate mechanisms for this unusual association. Experiments with termites and mealworms covered with the skin secretion of the frog revealed that specific chemical compounds seem to prevent the ants from stinging. By HPLC-fractionation of an aqueous solution of the frogs' skin secretion, two peptides of 1,029 and 1,143 Da were isolated and found to inhibit the aggressive behaviour of the ants. By de novo sequencing using tandem mass spectrometry, the amino acid sequence of both peptides consisting of a chain of 9 and 11 residues, respectively, was elucidated. Both peptides were synthesized and tested, and exhibited the same inhibitory properties as the original frog secretions. These novel peptides most likely act as an appeasement allomone and may serve as models for taming insect aggression.

  10. Prey and mound disassembly, manipulation and transport by fire ant collectives

    Science.gov (United States)

    Dutta, Bahnisikha; Monaenkova, Daria; Goodisman, Michael A.; Goldman, Daniel

    Fire ants inhabit subterranean nests covered by a hemispherical mound of soil permeated by narrow ( 1 body length diameter) tunnels. Fire ants can use their mound for long-term food storage [Gayahan &Tschinkel, J. Insect Sci.,2008]. Since mound tunnels are narrow, we expect that in addition to prey manipulation, mound reconfiguration could also be an important aspect of the food storage strategy. Ant colonies collected from wild were allowed to build nests in containers filled with clay soil in the laboratory. These colonies were offered diverse prey embedded with lead markers, including mealworms, crickets and shrimp. Ant-prey-soil interactions on the nest surface were recorded using overhead video and subsurface using x-ray imaging. Individual ants involved in prey storage exhibited three distinct behaviors: prey maneuvering, prey dissection and mound reconfiguration. Small prey (e.g. mealworms) were collectively carried intact into the mound through a tunnel, and then disassembled within the mound. Larger prey (e.g. shrimp) were dismantled into small pieces above the surface and carried to mound tunnels. The bodies of hard medium-sized prey (e.g. crickets) were buried after limb removal and then disassembled and moved into tunnels. Soil reconfiguration occurred in all cases.

  11. A preliminary checklist of the ants (Hymenoptera, Formicidae of Andorra

    Directory of Open Access Journals (Sweden)

    Abel Bernadou

    2013-03-01

    Full Text Available Within the last decade, checklists of the ant fauna of several European countries have been published or updated. Nevertheless, no ant checklists have hitherto been published for the principality of Andorra, a small landlocked country located in the eastern part of the Pyrenees. This work presents a critical list of the ant species of Andorra based on a review of the literature and on the biological material we collected during several field campaigns conducted in Andorra since the year 2005. Seventy-five species belonging to 21 genera of Formicidae were recorded. Nine species were recorded for the first time in Andorra: Aphaenogaster gibbosa (Latreille, 1798, Camponotus lateralis (Olivier, 1792, Camponotus piceus (Leach, 1825, Formica exsecta Nylander, 1846, Lasius piliferus Seifert, 1992, Tapinoma madeirense Forel, 1895, Temnothorax lichtensteini (Bondroit, 1918, Temnothorax niger (Forel, 1894, Temnothorax nigriceps (Mayr, 1855. The most speciose genera were Formica Linnaeus, 1758 and Temnothorax Forel, 1890 with 14 and 12 species, respectively. The ant fauna of Andorra is mostly dominated by Central European species (some are typical cold climate specialists; however species belonging to the Mediterranean ant fauna were also found. This can be explained by the particular geographic situation of Andorra which is characterized by a high mountain Mediterranean climate.

  12. Variation in the effectiveness of biotic defence: the case of an opportunistic ant-plant protection mutualism.

    Science.gov (United States)

    Giusto, Bruno; Anstett, Marie-Charlotte; Dounias, Edmond; McKey, Doyle B

    2001-11-01

    Benefits to plants in facultative ant protection mutualisms are highly variable. This allows examination of the sources of this variation and the mechanisms by which ants protect plants. We studied opportunistic interactions between ants and an extrafloral nectary-bearing vine, Dioscorea praehensilis, during 3 different years. Variation in plant protection among years was striking. Several factors affected the effectiveness of the biotic defence. Stems recently emerged from the underground tuber were self-supporting, contacting no other plants and encountering few foraging ants. Stems then became lianescent, and contact with supporting plants greatly increased ant recruitment. Both species and number of ant workers influenced the effect of ants on the major herbivore, the chrysomelid beetle Lilioceris latipennis. Protective actions included limitation of oviposition (reduction in the number of eggs laid on the plant) and predation, leading to increased larval mortality. The probability of successful predation was strongly dependent on larval size. If temporarily low ant-patrolling activity allows larvae to grow beyond a critical size, their mechanical (thick integument) or chemical (plant-derived compounds in a fecal shield) defences become more effective against ants. Secondary metabolites derived from the host plant thus appear to be important for the anti-predator mechanisms of this beetle, being necessary for its survival and reproduction on a host plant that actively recruits ants as a biotic defence against herbivores.

  13. How to find home backwards? Navigation during rearward homing of Cataglyphis fortis desert ants.

    Science.gov (United States)

    Pfeffer, Sarah E; Wittlinger, Matthias

    2016-07-15

    Cataglyphis ants are renowned for their impressive navigation skills, which have been studied in numerous experiments during forward locomotion. However, the ants' navigational performance during backward homing when dragging large food loads has not been investigated until now. During backward locomotion, the odometer has to deal with unsteady motion and irregularities in inter-leg coordination. The legs' sensory feedback during backward walking is not just a simple reversal of the forward stepping movements: compared with forward homing, ants are facing towards the opposite direction during backward dragging. Hence, the compass system has to cope with a flipped celestial view (in terms of the polarization pattern and the position of the sun) and an inverted retinotopic image of the visual panorama and landmark environment. The same is true for wind and olfactory cues. In this study we analyze for the first time backward-homing ants and evaluate their navigational performance in channel and open field experiments. Backward-homing Cataglyphis fortis desert ants show remarkable similarities in the performance of homing compared with forward-walking ants. Despite the numerous challenges emerging for the navigational system during backward walking, we show that ants perform quite well in our experiments. Direction and distance gauging was comparable to that of the forward-walking control groups. Interestingly, we found that backward-homing ants often put down the food item and performed foodless search loops around the left food item. These search loops were mainly centred around the drop-off position (and not around the nest position), and increased in length the closer the ants came to their fictive nest site. © 2016. Published by The Company of Biologists Ltd.

  14. Colony Diet Influences Ant Worker Foraging and Attendance of Myrmecophilous Lycaenid Caterpillars

    Directory of Open Access Journals (Sweden)

    Sebastian Pohl

    2016-09-01

    Full Text Available Foraging animals regulate their intake of macronutrients such as carbohydrates and proteins. However, regulating the intake of these two macronutrients can be constrained by the nutrient content of available food sources. Compensatory foraging is a method to adjust nutrient intake under restricted nutrient availability by preferentially exploiting food sources that contain limiting nutrients. Here we studied the potential for compensatory foraging in the dolichoderine ant Iridomyrmex mayri, which is commonly found in associations with caterpillars of the obligatorily ant-associated lycaenid butterfly Jalmenus evagoras. The caterpillars receive protection against predators and parasites, and reward the ants with nutritional secretions from specialized exocrine glands. These secretions contain a mixture of sugars and free amino acids, particularly serine. We tested the influence of nutrient-deficient diets on foraging patterns in I. mayri by recording the intake of test solutions containing single types of macronutrients during food preference tests. We also investigated the level of ant attendance on fifth instar J. evagoras caterpillars to evaluate how changes in diet influenced ant tending of caterpillars and foraging on their secretions. Foragers on a protein diet compensated for the nutritional deficit by increasing the intake of test solutions that contained sucrose, compared to their counterparts on a non-restricted diet. Ants on a sugar diet, however, did not show a corresponding increased consumption of test solutions containing the amino acid serine. Additionally, compared with their counterparts on a mixed diet, ants on limited nutrient diets showed an increase in the number of caterpillar-tending workers, suggesting that the caterpillars’ secretions are suitable to compensate for the ants’ nutritional deficit.

  15. Recolonization patterns of ants in a rehabilitated lignite mine in central Italy: Potential for the use of Mediterranean ants as indicators of restoration processes

    Energy Technology Data Exchange (ETDEWEB)

    Ottonetti, L.; Tucci, L.; Santini, G. [University of Florence, Florence (Italy)

    2006-03-15

    Ant (Hymenoptera: Formicidae) assemblages were sampled with pitfall traps in three different habitats associated with a rehabilitated mine district and in undisturbed forests in Tuscany, Italy. The four habitats were (1) open fields (3-4 years old); (2) a middle-age mixed plantation (10 years); (3) an old-age mixed plantation (20 years); and (4) an oak woodland (40 years) not directly affected by mining activities. The aim of the study was to analyze ant recolonization patterns in order to provide insights on the use of Mediterranean ant fauna as indicators of restoration processes. Species richness and diversity were not significantly different among the four habitats. However, multivariate analyses showed that the assemblages in the different habitats were clearly differentiated, with similarity relationships reflecting a successional gradient among rehabilitated sites. The observed patterns of functional group changes along the gradient broadly accord with those of previous studies in other biogeographic regions. These were (1) a decrease of dominant Dolichoderinae and opportunists; (2) an increase in the proportion of cold-climate specialists; and (3) the appearance of the Cryptic species in the oldest plantations, with a maximum of abundance in the woodland. In conclusion, the results of our study supported the use of Mediterranean ants as a suitable tool for biomonitoring of restoration processes, and in particular, the functional group approach proved a valuable framework to better interpret local trends in terms of global ecological patterns. Further research is, however, needed in order to obtain a reliable classification of Mediterranean ant functional groups.

  16. Evolutionary transition from single to multiple mating in fungus-growing ants

    DEFF Research Database (Denmark)

    Villesen, P.; Gertsch, Pia J.; Frydenberg, J.

    1999-01-01

    Queens of leafcutter ants exhibit the highest known levels of multiple mating (up to 10 mates per queen) among ants. Multiple mating may have been selected to increase genetic diversity among nestmate workers, which is hypothesized to be critical in social systems with large, long-lived colonies ...

  17. The interplay between scent trails and group-mass recruitment systems in ants.

    Science.gov (United States)

    Planqué, Robert; van den Berg, Jan Bouwe; Franks, Nigel R

    2013-10-01

    Large ant colonies invariably use effective scent trails to guide copious ant numbers to food sources. The success of mass recruitment hinges on the involvement of many colony members to lay powerful trails. However, many ant colonies start off as single queens. How do these same colonies forage efficiently when small, thereby overcoming the hurdles to grow large? In this paper, we study the case of combined group and mass recruitment displayed by some ant species. Using mathematical models, we explore to what extent early group recruitment may aid deployment of scent trails, making such trails available at much smaller colony sizes. We show that a competition between group and mass recruitment may cause oscillatory behaviour mediated by scent trails. This results in a further reduction of colony size to establish trails successfully.

  18. Rovno Amber Ant Assamblage: Bias toward Arboreal Strata or Sampling Effect?

    Directory of Open Access Journals (Sweden)

    Perkovsky E. E.

    2016-06-01

    Full Text Available In 2015 B. Guenard with co-authors indicated that the Rovno amber ant assemblage, as described by G. Dlussky and A. Rasnitsyn (2009, showed modest support for a bias towards arboreal origin comparing the Baltic and Bitterfeld assemblages, although it is not clear whether this reflects a sampling error or a signal of real deviation. Since 2009, the Rovno ant collection has now grown more than twice in volume which makes possible to check if the above inference about the essentially arboreal character of the assemblage is real or due to a sampling error. The comparison provided suggests in favour of the latter reason for the bias revealed by B. Guenard and co-authors. The new and larger data on the Rovno assemblage show that the share of non-arboreal ants is now well comparable with those concerning the Baltic and Bitterfeld assemblages. This holds true for the both total assemblages and subassemblages of worker ants only.

  19. Solenopsis ant magnetic material: statistical and seasonal studies

    International Nuclear Information System (INIS)

    Abraçado, Leida G; Esquivel, Darci M S; Wajnberg, Eliane

    2009-01-01

    In this paper, we quantify the magnetic material amount in Solenopsis ants using ferromagnetic resonance (FMR) at room temperature. We sampled S. interrupta workers from several morphologically indistinguishable castes. Twenty-five oriented samples of each body part of S. interrupta (20 units each) showed that FMR line shapes are reproducible. The relative magnetic material amount was 31 ± 12% (mean ± SD) in the antennae, 27 ± 13% in the head, 21 ± 12% in the thorax and 20 ± 10% in the abdomen. In order to measure variation in the magnetic material from late summer to early winter, ants were collected each month between March and July. The amount of magnetic material was greatest in all four body parts in March and least in all four body parts in June. In addition, S. richteri majors presented more magnetic material than minor workers. Extending these findings to the genera Solenopsis, the reduction in magnetic material found in winter could be explained by our sampling fewer foraging major ants

  20. Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders.

    Science.gov (United States)

    Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B

    2011-10-01

    Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.

  1. Natural selection drives the evolution of ant life cycles.

    Science.gov (United States)

    Wilson, Edward O; Nowak, Martin A

    2014-09-02

    The genetic origin of advanced social organization has long been one of the outstanding problems of evolutionary biology. Here we present an analysis of the major steps in ant evolution, based for the first time, to our knowledge, on combined recent advances in paleontology, phylogeny, and the study of contemporary life histories. We provide evidence of the causal forces of natural selection shaping several key phenomena: (i) the relative lateness and rarity in geological time of the emergence of eusociality in ants and other animal phylads; (ii) the prevalence of monogamy at the time of evolutionary origin; and (iii) the female-biased sex allocation observed in many ant species. We argue that a clear understanding of the evolution of social insects can emerge if, in addition to relatedness-based arguments, we take into account key factors of natural history and study how natural selection acts on alleles that modify social behavior.

  2. Precision Rescue Behavior in North American Ants

    Directory of Open Access Journals (Sweden)

    Katherine Taylor

    2013-07-01

    Full Text Available Altruistic behavior, in which one individual provides aid to another at some cost to itself, is well documented. However, some species engage in a form of altruism, called rescue, that places the altruist in immediate danger. Here we investigate one such example, namely rescuing victims captured by predators. In a field experiment with two North American ant species, Tetramorium sp. E and Prenolepis imparis, individuals were held in artificial snares simulating capture. T. sp. E, but not P. imparis, exhibited digging, pulling, and snare biting, the latter precisely targeted to the object binding the victim. These results are the first to document precision rescue in a North American ant species; moreover, unlike rescue in other ants, T. sp. E rescues conspecifics from different colonies, mirroring their atypical social behavior, namely the lack of aggression between non-nestmate (heterocolonial conspecifics. In a second, observational study designed to demonstrate rescue from an actual predator, T. sp. E victims were dropped into an antlion's pit and the behavior of a single rescuer was observed. Results showed that T. sp. E not only attempted to release the victim, but also risked attacking the predator, suggesting that precision rescue may play an important role in this species' antipredator behavior.

  3. Genetic transformation of midgut bacteria from the red imported fire ant (Solenopsis invicta).

    Science.gov (United States)

    Medina, Freder; Li, Haiwen; Vinson, S Bradleigh; Coates, Craig J

    2009-05-01

    In our previous study we isolated 10 bacterial species from fourth-instar larval midguts of the red imported fire ant, Solenopsis invicta. Here we report the genetic transformation and reintroduction of three species (Kluyvera cryocrescens, Serratia marcescens, and isolate 38) into the fire ant host. All three species were transformed with the plasmid vector, pZeoDsRed. High expression levels of DsRed were observed and the plasmid is maintained in these bacteria at 37 degrees C in the absence of antibiotic selection for at least 9 days of subculturing. The transformed bacteria were successfully reintroduced into fire ant larvae and survived in the fire ant gut for at least 7 days. Upon pupal emergence, 7 days after reintroduction, transformed bacteria can still be isolated, however, most were passed out in the meconium. We further demonstrated that the engineered bacteria could be spread within the colony by feeding this meconium to naive larvae with the aid of worker fire ants.

  4. Adoption of parasitic Maculinea alcon caterpillars (Lepidoptera : Lycaenidae) by three Myrmica ant species

    DEFF Research Database (Denmark)

    Als, Thomas Damm; Nash, David Richard; Boomsma, J. J.

    2001-01-01

    Maculinea butterflies are parasites of Myrmica ant nests. The Alcon blue, Maculinea alcon, is unusual in that it parasitizes the nests of several Myrmica species, using M. rubra, M. ruginodis and M. scabrinodis as hosts in different parts of Europe. In Denmark it uses M. rubra and M. ruginodis....... alcon from three populations differing in their host use to laboratory nests of all three recorded host ant species collected from each of the M. alcon populations. We measured the attractiveness of the caterpillars to their host ants as the time taken for them to be adopted by each ant colony....... Caterpillars from all populations took longer to be adopted to M. scabrinodis nests than to nests of the other two ant species. Adoption times to M. rubra and M. ruginodis colonies differed: caterpillars from each of the two populations that used a single host species were adopted most quickly by that species...

  5. ANTS/PAM: Future Exploration of the Asteroid Belt

    Science.gov (United States)

    Clark, P. E.; Curtis, S. A.; Rilee, M. L.; Cheung, C. Y.

    2004-05-01

    The Autonomous Nano-Technology Swarm (ANTS) is applied to the Prospecting Asteroid Mission (PAM) concept, as part of a NASA RASC study. The ANTS architecture is inspired by success of social insect colonies, based on the division of labor within the colonies: 1) within their specialties, individual specialists generally outperform general-ists, and 2) with sufficiently efficient social interaction and coordination, the group of specialists generally outper-forms the group of generalists. ANTS as applied to PAM involves a thousand individual specialist `sciencecraft', one subswarm per target, in an environment where detection and tracking of irregular, infrequent targets is a major chal-lenge. Workers, carry and operate eight to nine different scientific instruments, including spectrometers, ranging and radio science devices, imagers. The remaining specialists, Messenger/Rulers, provide communication and coordina-tion. The non-expendable propulsion system is based on autonomously deployable and configurable solar sails, a system suitable to a low gravity environment. The design of the neural basis function requires a minimum of 4 or 5 specialists for collective decision making. Allowing for ten instrument specialist teams and compensating for antici-pated high attrition, we calculate an initial minimum of 100 per subswarm should allow characterization of hundreds of asteroids. The difficulty in observing irregular, rapidly moving, poorly illuminated objects is largely overcome by the ANT sciencecraft capability to optimize conditions for each instrument. Components are composed of carbon nanotubules reversibly deployable from NEMS nodes, allowing 100 times decrease in packaging volume. 1000 smart 10 centimeter, 1 kg cubic boxes create a 1000 kg 1 meter cube.

  6. Caterpillars and fungal pathogens: two co-occurring parasites of an ant-plant mutualism.

    Directory of Open Access Journals (Sweden)

    Olivier Roux

    Full Text Available In mutualisms, each interacting species obtains resources from its partner that it would obtain less efficiently if alone, and so derives a net fitness benefit. In exchange for shelter (domatia and food, mutualistic plant-ants protect their host myrmecophytes from herbivores, encroaching vines and fungal pathogens. Although selective filters enable myrmecophytes to host those ant species most favorable to their fitness, some insects can by-pass these filters, exploiting the rewards supplied whilst providing nothing in return. This is the case in French Guiana for Cecropia obtusa (Cecropiaceae as Pseudocabima guianalis caterpillars (Lepidoptera, Pyralidae can colonize saplings before the installation of their mutualistic Azteca ants. The caterpillars shelter in the domatia and feed on food bodies (FBs whose production increases as a result. They delay colonization by ants by weaving a silk shield above the youngest trichilium, where the FBs are produced, blocking access to them. This probable temporal priority effect also allows female moths to lay new eggs on trees that already shelter caterpillars, and so to occupy the niche longer and exploit Cecropia resources before colonization by ants. However, once incipient ant colonies are able to develop, they prevent further colonization by the caterpillars. Although no higher herbivory rates were noted, these caterpillars are ineffective in protecting their host trees from a pathogenic fungus, Fusarium moniliforme (Deuteromycetes, that develops on the trichilium in the absence of mutualistic ants. Therefore, the Cecropia treelets can be parasitized by two often overlooked species: the caterpillars that shelter in the domatia and feed on FBs, delaying colonization by mutualistic ants, and the fungal pathogen that develops on old trichilia. The cost of greater FB production plus the presence of the pathogenic fungus likely affect tree growth.

  7. Establishment of Black Ant (Dolichoderus thoracicuson Cocoa Plantation and Its Effects on Helopeltisspp. Infestation

    Directory of Open Access Journals (Sweden)

    Soekadar Wiryadiputra

    2007-05-01

    Full Text Available Black ant (Dolichoderus thoracicusis the efficient biological control agent in suppressing main cocoa pests. It was reported that besides controlling the cocoa mirids, Helopeltisspp., this agent also can be used for biological control of cocoa pod borer (Conopomorpha cramerellaand rodents pest. Nevertheles, establishment of black ant in cocoa plantation is difficult. The objectives of research were to obtain the best method of black ant establisment and to know its effect on suppressing population and infestation of Helopeltis spp. The experiment was conducted on two cocoa ecosystems, namely cocoa plantation with coconut shading trees and with Gliricidia sepium shading trees. There were six methods of black ant establisment tried using a combination between black ant nest types and innoculation of mealybug (Cataenococcus hispidus. A control plot also added on these trial, therefore seven treatments were tried in this experiment and each treatmentwasreplicated three times. The results revealedthat on cocoa shaded by coconuts, ant establishment by the nests of coconut leaves combined with mealybug(Cataenococcus hispidusinoculation on husk wedges were the best method and could effectively control Helopeltis infestation. Good results of ant establishment also occurred on cocoa shaded by Gliricidia but its effect on Helopeltis infestation has not been significant. Four months after establishment of black ant on cocoa with coconut shading trees, Helopeltisspp. population on the plots treated by coconut leaves nest combined with innoculation of mealybug using husk wedges were very low, namely only one Helopeltisper 36 cocoa trees, whereas on control plot reaches of 85 Helopeltis. Infestation of Helopeltis measured by percentage of trees occupied by Helopeltisper 36 cocoa trees in the same period and treatment plot revealed also very low, namely 1.04% compared to 27.86% on that of the control plot. Key words : Cocoa, black ant (Dolichoderus thoracicus

  8. Generation of Nutrients and Detoxification: Possible Roles of Yeasts in Leaf-Cutting Ant Nests

    Directory of Open Access Journals (Sweden)

    Fernando C. Pagnocca

    2012-02-01

    Full Text Available The possible roles played by yeasts in attine ant nests are mostly unknown. Here we present our investigations on the plant polysaccharide degradation profile of 82 yeasts isolated from fungus gardens of Atta and Acromyrmex species to demonstrate that yeasts found in ant nests may play the role of making nutrients readily available throughout the garden and detoxification of compounds that may be deleterious to the ants and their fungal cultivar. Among the yeasts screened, 65% exhibited cellulolytic enzymes, 44% exhibited pectinolytic activity while 27% and 17% possess enzyme systems for the degradation of protease and amylase, respectively. Galacturonic acid, which had been reported in previous work to be poorly assimilated by the ant fungus and also to have a negative effect on ants’ survival, was assimilated by 64% and 79% of yeasts isolated from nests of A. texana and Acromyrmex respectively. Our results suggest that yeasts found in ant nests may participate in generation of nutrients and removal of potentially toxic compounds, thereby contributing to the stability of the complex microbiota found in the leaf-cutting ant nests.

  9. Ant-egg cataract. A study of a family with dominantly inherited congenital (ant-egg) cataract, including a histological examination of the formed elements

    DEFF Research Database (Denmark)

    Nissen, Steffen; Schrøder, H D

    1979-01-01

    A family with "ant-egg" cataract in three generations is described. The cataract is congenital, probably of autosomal dominant inheritance. Light microscopy of the ant-eggs showed that they are made up of a peripheral zone of lens material and a large almost homogenous centre. Element analysis by......-ray spectrophotometry showed a high content of calcium and phosphorus in the centre. The cataract has been easy to operate on and the postoperative visual results have been good....

  10. The Haleakala Argentine ant project: a synthesis of past research and prospects for the future

    Science.gov (United States)

    Krushelnycky, Paul; Haines, William; Loope, Lloyd; Van Gelder, Ellen

    2011-01-01

    1. The Haleakala Argentine Ant Project is an ongoing effort to study the ecology of the invasive Argentine ant in the park, and if possible to develop a strategy to control this destructive species. 2. Past research has demonstrated that the Argentine ant causes very significant impacts on native arthropods where it invades, threatening a large portion of the park’s biodiversity in subalpine shrubland and alpine aeolian ecosystems. 3. Patterns of spread over the past 30+ years indicate that the invasion process is influenced to a substantial degree by abiotic factors such as elevation, rainfall and temperature, and that the ant has not reached its potential range. Predictions of total range in the park suggest that it has only invaded a small fraction of available suitable habitat, confirming that this species is one of most serious threats to the park’s natural resources. 4. Numerous experiments have been conducted since 1994 in an attempt to develop a method for eradicating the Argentine ant at Haleakala using pesticidal ant baits. Thirty baits have been screened for attractiveness to ants in the park, and ten of these were tested for effectiveness of control in field plots. While some of these baits have been very effective in reducing numbers of ants, none has been able to eliminate all nests in experimental plots. 5. Research into a secondary management goal of ant population containment was initiated in 1996. By treating only expanding margins of the park’s two ant populations with an ant pesticide, rates of outward spread were substantially reduced in some areas. While this strategy was implemented from 1997 to 2004, it was ultimately discontinued after 2004 because of the difficulty and insufficient effectiveness of the technique. 6. In order to achieve the types of results necessary for eradication, the project would probably need to explore the possibility of developing a specialized bait, rather than relying on a commercially produced bait. An

  11. Las pruebas intradérmicas de evaluación de competencia celular Estudio comparativo entre antígenos clásicos y otros antígenos

    Directory of Open Access Journals (Sweden)

    Miguel Guzmán

    1982-12-01

    Full Text Available Se presenta un estudio comparativo en la respuesta de hipersensibilidad demorada frente a 4 antígenos universalmente recomendados. Tuberculina (TU. Candidina (CA, Streptokinasa/Streptodornasa (SK/SD y virus de Parotiditis (PA con otros antígenos de uso menos común tal como Antígeno-Respiratorio-Mixto (ARM y lisado de Staphylococcus aureus 80/81 (LS. De igual manera se estudió la respuesta al Dinitroclorobenceno (DNCB. La población probada fue de 49 personas normales con edades entre 18-23 años. Los resultados mostraron que la reactividad para ARM es de 91,8%, para LS 91.8%. para Candidina 75%. para TU (10U 24.4%. pare SK/SD de solo 6.8% y para Parotiditis 6,1%. Los estudios con DNCB permiten aconsejar su uso solo en casos muy especiales. El trabajo presentado sugiere una normalización en la lectura y el uso de 4 antígenos con la más alta frecuencia de positividad dentro del grupo probado así: ARM, LS, CA, y TU.

  12. Are queen ants inhibited by their own pheromone?

    DEFF Research Database (Denmark)

    Holman, L.; Leroy, C.; Jørgensen, Charlotte

    2013-01-01

    . Communication in social insects is predominantly chemical, and the mechanisms regulating processes such as reproductive division of labor are becoming increasingly well understood. Recently, a queen cuticular hydrocarbon (3-MeC31) that inhibits worker reproduction and aggression was isolated in the ant Lasius...... niger. Here, we find that this pheromone also has a weak negative effect on queen productivity and oogenesis. Because 3-MeC31 is present on both queens and their brood, we suggest that it is used by ants of both castes to adjust their fecundity to the amount of developing brood and the presence of other...

  13. Sperm storage induces an immunity cost in ants

    DEFF Research Database (Denmark)

    Baer, Boris; Armitage, Sophie A O; Boomsma, Jacobus J

    2006-01-01

    Ant queens are among the most long-lived insects known. They mate early in adult life and maintain millions of viable sperm in their sperm storage organ until they die many years later. Because they never re-mate, the reproductive success of queens is ultimately sperm-limited, but it is not known...... what selective forces determine the upper limit to sperm storage. Here we show that sperm storage carries a significant cost of reduced immunity during colony founding. Newly mated queens of the leaf-cutting ant Atta colombica upregulate their immune response shortly after completing their nest burrow...

  14. Microbial community structure of leaf-cutter ant fungus gardens and refuse dumps.

    Science.gov (United States)

    Scott, Jarrod J; Budsberg, Kevin J; Suen, Garret; Wixon, Devin L; Balser, Teri C; Currie, Cameron R

    2010-03-29

    Leaf-cutter ants use fresh plant material to grow a mutualistic fungus that serves as the ants' primary food source. Within fungus gardens, various plant compounds are metabolized and transformed into nutrients suitable for ant consumption. This symbiotic association produces a large amount of refuse consisting primarily of partly degraded plant material. A leaf-cutter ant colony is thus divided into two spatially and chemically distinct environments that together represent a plant biomass degradation gradient. Little is known about the microbial community structure in gardens and dumps or variation between lab and field colonies. Using microbial membrane lipid analysis and a variety of community metrics, we assessed and compared the microbiota of fungus gardens and refuse dumps from both laboratory-maintained and field-collected colonies. We found that gardens contained a diverse and consistent community of microbes, dominated by Gram-negative bacteria, particularly gamma-Proteobacteria and Bacteroidetes. These findings were consistent across lab and field gardens, as well as host ant taxa. In contrast, dumps were enriched for Gram-positive and anaerobic bacteria. Broad-scale clustering analyses revealed that community relatedness between samples reflected system component (gardens/dumps) rather than colony source (lab/field). At finer scales samples clustered according to colony source. Here we report the first comparative analysis of the microbiota from leaf-cutter ant colonies. Our work reveals the presence of two distinct communities: one in the fungus garden and the other in the refuse dump. Though we find some effect of colony source on community structure, our data indicate the presence of consistently associated microbes within gardens and dumps. Substrate composition and system component appear to be the most important factor in structuring the microbial communities. These results thus suggest that resident communities are shaped by the plant degradation

  15. Walking on inclines: how do desert ants monitor slope and step length

    Directory of Open Access Journals (Sweden)

    Seidl Tobias

    2008-06-01

    Full Text Available Abstract Background During long-distance foraging in almost featureless habitats desert ants of the genus Cataglyphis employ path-integrating mechanisms (vector navigation. This navigational strategy requires an egocentric monitoring of the foraging path by incrementally integrating direction, distance, and inclination of the path. Monitoring the latter two parameters involves idiothetic cues and hence is tightly coupled to the ant's locomotor behavior. Results In a kinematic study of desert ant locomotion performed on differently inclined surfaces we aimed at pinpointing the relevant mechanisms of estimating step length and inclination. In a behavioral experiment with ants foraging on slippery surfaces we broke the otherwise tightly coupled relationship between stepping frequency and step length and examined the animals' ability to monitor distances covered even under those adverse conditions. We show that the ants' locomotor system is not influenced by inclined paths. After removing the effect of speed, slope had only marginal influence on kinematic parameters. Conclusion From the obtained data we infer that the previously proposed monitoring of angles of the thorax-coxa joint is not involved in inclinometry. Due to the tiny variations in cycle period, we also argue that an efference copy of the central pattern generator coding the step length in its output frequency will most likely not suffice for estimating step length and complementing the pedometer. Finally we propose that sensing forces acting on the ant's legs could provide the desired neuronal correlate employed in monitoring inclination and step length.

  16. Arboreal ants use the "Velcro(R principle" to capture very large prey.

    Directory of Open Access Journals (Sweden)

    Alain Dejean

    2010-06-01

    Full Text Available Plant-ants live in a mutualistic association with host plants known as "myrmecophytes" that provide them with a nesting place and sometimes with extra-floral nectar (EFN and/or food bodies (FBs; the ants can also attend sap-sucking Hemiptera for their honeydew. In return, plant-ants, like most other arboreal ants, protect their host plants from defoliators. To satisfy their nitrogen requirements, however, some have optimized their ability to capture prey in the restricted environment represented by the crowns of trees by using elaborate hunting techniques. In this study, we investigated the predatory behavior of the ant Azteca andreae which is associated with the myrmecophyte Cecropia obtusa. We noted that up to 8350 ant workers per tree hide side-by-side beneath the leaf margins of their host plant with their mandibles open, waiting for insects to alight. The latter are immediately seized by their extremities, and then spread-eagled; nestmates are recruited to help stretch, carve up and transport prey. This group ambush hunting technique is particularly effective when the underside of the leaves is downy, as is the case for C. obtusa. In this case, the hook-shaped claws of the A. andreae workers and the velvet-like structure of the underside of the leaves combine to act like natural Velcro that is reinforced by the group ambush strategy of the workers, allowing them to capture prey of up to 13,350 times the mean weight of a single worker.

  17. Temperature limits trail following behaviour through pheromone decay in ants

    Science.gov (United States)

    van Oudenhove, Louise; Billoir, Elise; Boulay, Raphaël; Bernstein, Carlos; Cerdá, Xim

    2011-12-01

    In Mediterranean habitats, temperature affects both ant foraging behaviour and community structure. Many studies have shown that dominant species often forage at lower temperature than subordinates. Yet, the factors that constrain dominant species foraging activity in hot environments are still elusive. We used the dominant ant Tapinoma nigerrimum as a model species to test the hypothesis that high temperatures hinder trail following behaviour by accelerating pheromone degradation. First, field observations showed that high temperatures (> 30°C) reduce the foraging activity of T. nigerrimum independently of the daily and seasonal rhythms of this species. Second, we isolated the effect of high temperatures on pheromone trail efficacy from its effect on worker physiology. A marked substrate was heated during 10 min (five temperature treatments from 25°C to 60°C), cooled down to 25°C, and offered in a test choice to workers. At hot temperature treatments (>40°C), workers did not discriminate the previously marked substrate. High temperatures appeared therefore to accelerate pheromone degradation. Third, we assessed the pheromone decay dynamics by a mechanistic model fitted with Bayesian inference. The model predicted ant choice through the evolution of pheromone concentration on trails as a function of both temperature and time since pheromone deposition. Overall, our results highlighted that the effect of high temperatures on recruitment intensity was partly due to pheromone evaporation. In the Mediterranean ant communities, this might affect dominant species relying on chemical recruitment, more than subordinate ant species, less dependent on chemical communication and less sensitive to high temperatures.

  18. Evaluation of Liquid and Bait Insecticides against the Dark Rover Ant (Brachymyrmex patagonicus

    Directory of Open Access Journals (Sweden)

    Javier G. Miguelena

    2014-11-01

    Full Text Available Dark rover ants (Brachymyrmex patagonicus, Mayr are an exotic ant species native to South America that has recently spread through the southern US. We evaluated the residual activity of three liquid insecticides (indoxacarb, fipronil and lambda-cyhalothrin as potential barrier treatments against these ants. The factors we considered include the use of a porous or non-porous surface, a short or long exposure time and the changes in insecticide activity after treatment during a 90 day period. We also tested the effect of baits containing three different active ingredients (imidacloprid, sodium tetraborate and indoxacarb on colony fragments of this species for a 15 day period. Both lambda-cyhalothrin® and indoxacarb® resulted in high levels of ant mortality up to 90 days after application. The results of exposure to fipronil® resembled those from the control treatment. Application of insecticides on a porous surface and the shorter exposure time generally resulted in greater ant survival. Of the baits tested, only the imidacloprid based one decreased ant survival significantly during the evaluation period. Within three days, the imidacloprid bait produced over 50% mortality which increased to over 95% by the end of the experiment. Results from the other two bait treatments were not significantly different from the control.

  19. Ecological consequences of interactions between ants and honeydew-producing insects

    OpenAIRE

    Styrsky, John D; Eubanks, Micky D

    2006-01-01

    Interactions between ants and honeydew-producing hemipteran insects are abundant and widespread in arthropod food webs, yet their ecological consequences are very poorly known. Ant–hemipteran interactions have potentially broad ecological effects, because the presence of honeydew-producing hemipterans dramatically alters the abundance and predatory behaviour of ants on plants. We review several studies that investigate the consequences of ant–hemipteran interactions as ‘keystone interactions’...

  20. Automatic optimization of a nuclear reactor reload using the algorithm Ant-Q

    International Nuclear Information System (INIS)

    Machado, Liana; Schirru, Roberto

    2002-01-01

    The nuclear fuel reload optimization is a NP-Complete combinatorial optimization problem. For decades this problem was solved using an expert's knowledge. From the eighties, however there have been efforts to automatic fuel reload and the more recent ones show the Genetic Algorithm's (GA) efficiency on this problem. Following this trend, our aim is to optimization nuclear fuel reload using Ant-Q, artificial theory based algorithms. Ant-Q's results on the Traveling salesman Problem, which is conceptuality similar to fuel reload, are better than GA's. Ant-Q was tested in real application on the cycle 7 reload of Angra I. Comparing Ant-Q result with the GA's, it can be verified that, even without a local heuristics, the former algorithm, as it superiority comparing the GA in Angra I show. Is a valid technique to solve the nuclear fuel reload problem. (author)

  1. Hybrid chaotic ant swarm optimization

    International Nuclear Information System (INIS)

    Li Yuying; Wen Qiaoyan; Li Lixiang; Peng Haipeng

    2009-01-01

    Chaotic ant swarm optimization (CASO) is a powerful chaos search algorithm that is used to find the global optimum solution in search space. However, the CASO algorithm has some disadvantages, such as lower solution precision and longer computational time, when solving complex optimization problems. To resolve these problems, an improved CASO, called hybrid chaotic swarm optimization (HCASO), is proposed in this paper. The new algorithm introduces preselection operator and discrete recombination operator into the CASO; meanwhile it replaces the best position found by own and its neighbors' ants with the best position found by preselection operator and discrete recombination operator in evolution equation. Through testing five benchmark functions with large dimensionality, the experimental results show the new method enhances the solution accuracy and stability greatly, as well as reduces the computational time and computer memory significantly when compared to the CASO. In addition, we observe the results can become better with swarm size increasing from the sensitivity study to swarm size. And we gain some relations between problem dimensions and swam size according to scalability study.

  2. Discovery of defense- and neuropeptides in social ants by genome-mining.

    Directory of Open Access Journals (Sweden)

    Christian W Gruber

    Full Text Available Natural peptides of great number and diversity occur in all organisms, but analyzing their peptidome is often difficult. With natural product drug discovery in mind, we devised a genome-mining approach to identify defense- and neuropeptides in the genomes of social ants from Atta cephalotes (leaf-cutter ant, Camponotus floridanus (carpenter ant and Harpegnathos saltator (basal genus. Numerous peptide-encoding genes of defense peptides, in particular defensins, and neuropeptides or regulatory peptide hormones, such as allatostatins and tachykinins, were identified and analyzed. Most interestingly we annotated genes that encode oxytocin/vasopressin-related peptides (inotocins and their putative receptors. This is the first piece of evidence for the existence of this nonapeptide hormone system in ants (Formicidae and supports recent findings in Tribolium castaneum (red flour beetle and Nasonia vitripennis (parasitoid wasp, and therefore its confinement to some basal holometabolous insects. By contrast, the absence of the inotocin hormone system in Apis mellifera (honeybee, another closely-related member of the eusocial Hymenoptera clade, establishes the basis for future studies on the molecular evolution and physiological function of oxytocin/vasopressin-related peptides (vasotocin nonapeptide family and their receptors in social insects. Particularly the identification of ant inotocin and defensin peptide sequences will provide a basis for future pharmacological characterization in the quest for potent and selective lead compounds of therapeutic value.

  3. Development of virtual bait stations to control Argentine ants (Hymenoptera: Formicidae) in environmentally sensitive habitats.

    Science.gov (United States)

    Choe, Dong-Hwan; Vetter, Richard S; Rust, Michael K

    2010-10-01

    A novel bait station referred to as a virtual bait station was developed and tested against field populations of the invasive Argentine ant, Linepithema humile (Mayr) (Hymenoptera: Formicidae), at White Beach, Camp Pendleton, in Oceanside, CA. White Beach is a nesting habitat for an endangered seabird, the California least tern (Sterna antillarum browni Mearns). The beach is heavily infested with Argentine ants, one of the threats for the California least tern chicks. Conventional pest control strategies are prohibited because of the existence of the protected bird species and the site's proximity to the ocean. The bait station consisted of a polyvinyl chloride pipe that was treated on the inside with fipronil insecticide at low concentrations to obtain delayed toxicity against ants. The pipe was provisioned with an inverted bottle of 25% sucrose solution, then capped, and buried in the sand. Foraging ants crossed the treated surface to consume the sucrose solution. The delayed toxicity of fipronil deposits allowed the ants to continue foraging on the sucrose solution and to interact with their nestmates, killing them within 3-5 d after exposure. Further modification of the bait station design minimized the accumulation of dead ants in the sucrose solution, significantly improving the longevity and efficacy of the bait station. The virtual bait station exploits the foraging behavior of the ants and provides a low impact approach to control ants in environmentally sensitive habitats. It excluded all insects except ants, required only milligram quantities of toxicant, and eliminated the problem of formulating toxicants into aqueous sugar baits.

  4. Convergent coevolution in the domestication of coral mushrooms by fungus-growing ants

    DEFF Research Database (Denmark)

    Munkacsi, A.B.; Pan, J.J.; Villesen, P.

    2004-01-01

    family Pterulaceae using phylogenetic reconstructions based on broad taxon sampling, including the first mushroom collected from the garden of an ant species in the A. pilosum group. The domestication of the pterulaceous cultivar is independent from the domestication of the gilled mushrooms cultivated...... of parallel coevolution, where the symbionts of each functional group are members of monophyletic groups. However, there is one outstanding exception in the fungus-growing ant system, the unidentified cultivar grown only by ants in the Apterostigma pilosum group. We classify this cultivar in the coral-mushroom...

  5. Indigenous weaver ants and fruit fly control in Tanzanian smallholder mango production

    DEFF Research Database (Denmark)

    Kirkegaard, Nina; Offenberg, Hans Joachim; Msogoya, T. J.

    2016-01-01

    The presence of weaver ant colonies can reduce fruit fly oviposition in mango production and can be effective as a fruit fly control strategy. Patrolling ants may disturb landing flies and may also deposit repellent compounds on to the fruits. This control strategy is being applied to export...... temperatures to lethal levels for fruit fly eggs and larvae. Direct observations showed a small, but significant reduction in fly landings on fruits previously patrolled by ants, supporting the proposed role for persistent repellents. Gas chromatography/mass spectroscopy did not identify any compounds uniquely...

  6. The Use of Weaver Ants in the Management of Fruit Flies in Africa

    DEFF Research Database (Denmark)

    Vayssières, Jean-François; Offenberg, Hans Joachim; Sinzogan, Antonio

    2016-01-01

    Generalist predators such as the weaver ant, Oecophylla longinoda (Latreille), play an important role as biological control agents in West African orchards and, by extension, also in forest and savanna ecosystems within sub-Saharan Africa. These weaver ants are one of the most effective and effi...... an interest in the use of weaver ants. Protection of tropical forests and savannas is ecologically and environmentally crucial and also essential for the protection of O. longinoda....

  7. ANTS AS BIOLOGICAL INDICATORS FOR MONITORING CHANGES IN ARID ENVIRONMENTS: LESSONS FOR MONITORING PROTECTED AREAS

    Science.gov (United States)

    The responses of ant communities to structural change (removal of an invasive were studied in a replicated experiment in a Chihuahuan Desert grassland. The results from sampling of ant communities by pit-fall trapping were validated by mapping ant colonies on the experimental plo...

  8. Towards a better understanding of the evolution of specialized parasites of fungus-growing ant crops

    DEFF Research Database (Denmark)

    Yek, Sze Huei; Boomsma, Jacobus Jan; Poulsen, Michael

    2012-01-01

    Fungus-growing ants have interacted and partly coevolved with specialised microfungal parasites of the genus Escovopsis since the origin of ant fungiculture about 50 million years ago. Here, we review the recent progress in understanding the patterns of specificity of this ant-parasite associatio...

  9. CO2 efflux from subterranean nests of ant communities in a seasonal tropical forest, Thailand.

    Science.gov (United States)

    Hasin, Sasitorn; Ohashi, Mizue; Yamada, Akinori; Hashimoto, Yoshiaki; Tasen, Wattanachai; Kume, Tomonori; Yamane, Seiki

    2014-10-01

    Many ant species construct subterranean nests. The presence of their nests may explain soil respiration "hot spots", an important factor in the high CO2 efflux from tropical forests. However, no studies have directly measured CO2 efflux from ant nests. We established 61 experimental plots containing 13 subterranean ant species to evaluate the CO2 efflux from subterranean ant nests in a tropical seasonal forest, Thailand. We examined differences in nest CO2 efflux among ant species. We determined the effects of environmental factors on nest CO2 efflux and calculated an index of nest structure. The mean CO2 efflux from nests was significantly higher than those from the surrounding soil in the wet and dry seasons. The CO2 efflux was species-specific, showing significant differences among the 13 ant species. The soil moisture content significantly affected nest CO2 efflux, but there was no clear relationship between nest CO2 efflux and nest soil temperature. The diameter of the nest entrance hole affected CO2 efflux. However, there was no significant difference in CO2 efflux rates between single-hole and multiple-hole nests. Our results suggest that in a tropical forest ecosystem the increase in CO2 efflux from subterranean ant nests is caused by species-specific activity of ants, the nest soil environment, and nest structure.

  10. The nature of culture: technological variation in chimpanzee predation on army ants revisited.

    Science.gov (United States)

    Schöning, Caspar; Humle, Tatyana; Möbius, Yasmin; McGrew, W C

    2008-07-01

    Chimpanzee (Pan troglodytes) predation on army ants (Dorylus, subgenus Anomma) is an impressive example of skillful use of elementary technology, and it has been suggested to reflect cultural differences among chimpanzee communities. Alternatively, the observed geographic diversity in army-ant-eating may represent local behavioral responses of the chimpanzees to the anti-predator traits of the army ant species present at the different sites. We examined assemblages of available prey species, their behavior and morphology, consumption by chimpanzees, techniques employed, and tool lengths at 14 sites in eastern, central, and western Africa. Where army ants are eaten, tool length and concomitant technique are a function of prey type. Epigaeically foraging species with aggressive workers that inflict painful bites are harvested with longer tools and usually by the "pull-through" technique; species foraging in leaf-litter with less aggressive workers that inflict less painful bites are harvested with short tools and by the "direct-mouthing" technique. However, prey species characteristics do not explain several differences in army-ant-eating between Bossou (Guinea) and Taï (Ivory Coast), where the same suite of prey species is available and is consumed. Moreover, the absence of army-ant-eating at five sites cannot be explained by the identity of available prey species, as all the species found at these sites are eaten elsewhere. We conclude that some of the observed variation in the predator-prey relationship of chimpanzees and army ants reflects environmental influences driven by the prey, while other variation is not linked to prey characteristics and may be solely sociocultural.

  11. An assessment of rehabilitation success in an African grassland using ants as bioindicators

    Directory of Open Access Journals (Sweden)

    Samantha-Leigh Jamison

    2016-09-01

    Full Text Available Many studies that evaluate rehabilitation make use of invertebrate bioindicators. Invertebrates, especially ants, make useful indicators as they are sensitive to environmental change. We compared ant assemblages in rehabilitated and control sites in the Rietvlei Nature Reserve, a protected area important for grassland conservation in South Africa. Pitfall traps were used to sample ant assemblages at six control sites and six rehabilitated sites. In addition, environmental and vegetation surveys were conducted at each site. We found that the ant assemblages differed significantly between the control and rehabilitated sites, although there was considerable overlap; the control sites supported a greater species density and higher abundance of ants than the rehabilitated sites. In total, 36 ant species were collected (control sites: 34 species; rehabilitated sites: 26 species. The environmental survey revealed that percentages of bare ground and coarse sand, as well as soil pH, differed significantly between the control and rehabilitated sites. The control and rehabilitated sites also supported significantly different plant assemblages. Three indicator ant species were identified for the control sites: Crematogaster rectinota, Crematogaster amita and Monomorium fastidium. No indicator species were identified for the rehabilitated sites. These results suggest that recovery from the previous agricultural use of the area is still incomplete and highlights the lack of research examining the success of rehabilitation in the grassland biome. Conservation implications: The present study illustrates the need for further research on rehabilitation techniques utilised in the grassland biome. This is of value as the remainder of South African grasslands are considered critically endangered.

  12. Heavy metal distribution and bioaccumulation in Chihuahuan Desert Rough Harvester ant (Pogonomyrmex rugosus) populations

    International Nuclear Information System (INIS)

    Del Toro, I.; Floyd, K.; Gardea-Torresdey, J.; Borrok, D.

    2010-01-01

    Heavy metal contamination can negatively impact arid ecosystems; however a thorough examination of bioaccumulation patterns has not been completed. We analyzed the distribution of As, Cd, Cu, Pb and Zn in soils, seeds and ant (Pogonomyrmex rugosus) populations of the Chihuahuan Desert near El Paso, TX, USA. Concentrations of As, Cd, Cu, and Pb in soils, seeds and ants declined as a function of distance from a now inactive Cu and Pb smelter and all five metals bioaccumulated in the granivorous ants. The average bioaccumulation factors for the metals from seeds to ants ranged from 1.04x (As) to 8.12x (Cd). The findings show bioaccumulation trends in linked trophic levels in an arid ecosystem and further investigation should focus on the impacts of heavy metal contamination at the community level. - Heavy metals bioaccumulate in desert ants.

  13. Nutritional and fatty acid profiles of sun-dried edible black ants (Polyrhachis vicina Roger

    Directory of Open Access Journals (Sweden)

    Duo Li

    2010-03-01

    Full Text Available Determination of the nutritional composition of sun-dried edible black ants (Polyrhachis vicina Roger cultivated in Zhejiang and Guizhou Provinces, China, was carried out. The Zhejiang and Guizhou ants contained 31.5% and 41.5% protein, 15.7% and 15.9% lipid, and 25.4% and 26.4% fibre respectively. Monounsaturated fatty acids were the most predominant fatty acids (71.472.7% of total fatty acids found in both ant samples, followed by saturated fatty acids (23.825.5% and polyunsaturated fatty acids (3.13.7%. A significant amount of n-3 fatty acids was detected: 87.4 mg/100g and 145.6 mg/100g in Zhejiang and Guizhou ants respectively. Phosphorus, iron and calcium were the main minerals found in the ant samples. A small amount of selenium was also found.

  14. Evolutionary patterns of proteinase activity in attine ant fungus gardens

    DEFF Research Database (Denmark)

    Semenova, Tatyana; Hughes, David Peter; Boomsma, Jacobus Jan

    2011-01-01

    hypothesized that fungal proteinase activity may have been under selection for efficiency and that different classes of proteinases might be involved. Results: We determined proteinase activity profiles across a wide pH range for fungus gardens of 14 Panamanian species of fungus-growing ants, representing...... classes. Remarkably, the single symbiont that is shared by species of the crown group of Atta and Acromyrmex leaf-cutting ants mostly showed metalloproteinase activity, suggesting that recurrent changes in enzyme production may have occurred throughout the domestication history of fungus-garden symbionts......Background: Attine ants live in symbiosis with a basidiomycetous fungus that they rear on a substrate of plant material. This indirect herbivory implies that the symbiosis is likely to be nitrogen deprived, so that specific mechanisms may have evolved to enhance protein availability. We therefore...

  15. Native supercolonies of unrelated individuals in the invasive Argentine ant

    DEFF Research Database (Denmark)

    Pedersen, Jes Søe; Krieger, Michael J. B.; Vogel, Valérie

    2006-01-01

    organization is not only a key attribute responsible for the ecological dominance of these ants, but also an evolutionary paradox because relatedness between nestmates is effectively zero. Recently, it has been proposed that, in the Argentine ant, unicoloniality is a derived trait that evolved after its......Kinship among group members has long been recognized as a main factor promoting the evolution of sociality and reproductive altruism, yet some ants have an extraordinary social organization, called unicoloniality, whereby individuals mix freely among physically separated nests. This type of social...... with related individuals who are aggressive toward members of other colonies, we found that native populations also form supercolonies, and are effectively unicolonial. Moreover, just as in introduced populations, the relatedness between nestmates is not distinguishable from zero in these native range...

  16. How ants find each other; temporal and spatial patterns in nuptial flights

    NARCIS (Netherlands)

    Noordijk, J.; Morssinkhof, R.; Boer, P.; Schaffers, A.P.; Heijerman, Th.; Sykora, K.V.

    2008-01-01

    Reproduction is a key factor in understanding population ecology and therefore species occurrence. However, patterns in reproductive behaviour for distinct ant species remain insufficiently known. In this paper strategies in mate finding are studied for six ant species (Lasius niger, Lasius

  17. Effect of an invasive ant and its chemical control on a threatened endemic Seychelles millipede.

    Science.gov (United States)

    Lawrence, James M; Samways, Michael J; Henwood, Jock; Kelly, Janine

    2011-06-01

    The impact of invasive species on island faunas can be of major local consequence, while their control is an important part of island ecosystem restoration. Among these invasive species are ants, of which some have a disruptive impact on indigenous arthropod populations. Here, we study the impact of the invasive African big-headed ant, Pheidole megacephala, on a small Seychelles island, Cousine, and assess the impact of this ant, and its chemical control, using the commercially available hydramethylnon-based bait, Siege, on the endemic keystone Seychelles giant millipede species, Sechelleptus seychellarum. We found no significant correlations in landscape-scale spatial overlap and abundance between the ant and the millipede. Furthermore, the ant did not attack healthy millipedes, but fed only on dying and dead individuals. The chemical defences of the millipede protected it from ant predation. Ingestion of the bait at standard concentration had no obvious impact on the millipede. The most significant threat to the Seychelles giant millipede in terms of P. megacephala invasion is from possible catastrophic shifts in ecosystem function through ant hemipteran mutualisms which can lead to tree mortality, resulting in alteration of the millipede's habitat.

  18. Vegetation structure of plantain-based agrosystems determines numerical dominance in community of ground-dwelling ants.

    Science.gov (United States)

    Dassou, Anicet Gbéblonoudo; Tixier, Philippe; Dépigny, Sylvain; Carval, Dominique

    2017-01-01

    In tropics, ants can represent an important part of animal biomass and are known to be involved in ecosystem services, such as pest regulation. Understanding the mechanisms underlying the structuring of local ant communities is therefore important in agroecology. In the humid tropics of Africa, plantains are cropped in association with many other annual and perennial crops. Such agrosystems differ greatly in vegetation diversity and structure and are well-suited for studying how habitat-related factors affect the ant community. We analysed abundance data for the six numerically dominant ant taxa in 500 subplots located in 20 diversified, plantain-based fields. We found that the density of crops with foliage at intermediate and high canopy strata determined the numerical dominance of species. We found no relationship between the numerical dominance of each ant taxon with the crop diversity. Our results indicate that the manipulation of the densities of crops with leaves in the intermediate and high strata may help maintain the coexistence of ant species by providing different habitat patches. Further research in such agrosystems should be performed to assess if the effect of vegetation structure on ant abundance could result in efficient pest regulation.

  19. Chemical composition of metapleural gland secretions of fungus-growing and non-fungus-growing ants.

    Science.gov (United States)

    Vieira, Alexsandro S; Morgan, E David; Drijfhout, Falko P; Camargo-Mathias, Maria I

    2012-10-01

    The metapleural gland is exclusive to ants, and unusual among exocrine glands in having no mechanism for closure and retention of secretion. As yet, no clear conclusion has been reached as to the function of metapleural gland secretion. Metapleural gland secretions were investigated for fungus-growing ants representing the derived attines Trachymyrmex fuscus, Atta laevigata, and Acromyrmex coronatus, the basal attines Apterostigma pilosum and Mycetarotes parallelus, and non-fungus-growing ants of the tribes Ectatommini (Ectatomma brunneum) and Myrmicini (Pogonomyrmex naegeli). Our results showed that the secretions of leaf-cutting ants (A. laevigata and A. coronatus) and the derived attine, T. fuscus, contain a greater variety and larger quantities of volatile compounds than those of myrmicine and ectatommine ants. The most abundant compounds found in the metapleural glands of A. laevigata and A. coronatus were hydroxyacids, and phenylacetic acid (only in A. laevigata). Indole was present in all groups examined, while skatole was found in large quantities only in attines. Ketones and aldehydes are present in the secretion of some attines. Esters are present in the metapleural gland secretion of all species examined, although mainly in A. laevigata, A. coronatus, and T. fuscus. Compared with basal attines and non-fungus-growing ants, the metapleural glands of leaf-cutting ants produce more acidic compounds that may have an antibiotic or antifungal function.

  20. Recognition of social identity in ants

    DEFF Research Database (Denmark)

    Bos, Nick; d'Ettorre, Patrizia

    2012-01-01

    Recognizing the identity of others, from the individual to the group level, is a hallmark of society. Ants, and other social insects, have evolved advanced societies characterized by efficient social recognition systems. Colony identity is mediated by colony specific signature mixtures, a blend...

  1. Chemical and behavioral integration of army ant-associated rove beetles - a comparison between specialists and generalists.

    Science.gov (United States)

    von Beeren, Christoph; Brückner, Adrian; Maruyama, Munetoshi; Burke, Griffin; Wieschollek, Jana; Kronauer, Daniel J C

    2018-01-01

    Host-symbiont interactions are embedded in ecological communities and range from unspecific to highly specific relationships. Army ants and their arthropod guests represent a fascinating example of species-rich host-symbiont associations where host specificity ranges across the entire generalist - specialist continuum. In the present study, we compared the behavioral and chemical integration mechanisms of two extremes of the generalist - specialist continuum: generalist ant-predators in the genus Tetradonia (Staphylinidae: Aleocharinae: Athetini), and specialist ant-mimics in the genera Ecitomorpha and Ecitophya (Staphylinidae: Aleocharinae: Ecitocharini). Similar to a previous study of Tetradonia beetles, we combined DNA barcoding with morphological studies to define species boundaries in ant-mimicking beetles. This approach found four ant-mimicking species at our study site at La Selva Biological Station in Costa Rica. Community sampling of Eciton army ant parasites revealed that ant-mimicking beetles were perfect host specialists, each beetle species being associated with a single Eciton species. These specialists were seamlessly integrated into the host colony, while generalists avoided physical contact to host ants in behavioral assays. Analysis of the ants' nestmate recognition cues, i.e. cuticular hydrocarbons (CHCs), showed close similarity in CHC composition and CHC concentration between specialists and Eciton burchellii foreli host ants. On the contrary, the chemical profiles of generalists matched host profiles less well, indicating that high accuracy in chemical host resemblance is only accomplished by socially integrated species. Considering the interplay between behavior, morphology, and cuticular chemistry, specialists but not generalists have cracked the ants' social code with respect to various sensory modalities. Our results support the long-standing idea that the evolution of host-specialization in parasites is a trade-off between the range of

  2. Can anthropic fires affect epigaeic and hypogaeic Cerrado ant (Hymenoptera: Formicidae) communities in the same way?

    Science.gov (United States)

    Canedo-Júnior, Ernesto de Oliveira; Cuissi, Rafael Gonçalves; Nelson Henrique de Almeida, Curi; Demetrio, Guilherme Ramos; Lasmar, Chaim José; Malves, Kira

    2016-03-01

    Fire occurrences are a common perturbation in Cerrado ecosystems, and may differently impact the local biodiversity. Arthropods are one of the taxa affected by fires, and among them, ants are known as good bioindicators. We aimed to evaluate the effect of anthropic fires on epigaeic and hypogaeic ant communities (species richness and composition) in Cerrado areas with different post-fire event recovery periods. We conducted the study in four Cerrado areas during two weeks of 2012 dry season: one unburned and three at different post-fire times (one month, one and two years). We sampled ants with pitfall traps in epigaeic and hypogaeic microhabitats. We collected 71 ant morpho-species from 25 genera. In the epigaeic microhabitat we sampled 56 morpho-species and 42 in the hypogaeic microhabitat. The area with the shortest recovery time presented lower epigaeic ant species richness (4.3 ± 2.00) in comparison to the other areas (8.1 ± 2.68 species on one year area; 10.3 ± 2.66 species on two years area; 10.4 ± 2.31 species on control area), but recovery time did not affect hypogaeic ant species richness. Regarding ant species composition, fire did not directly affect hypogaeic ant species, which remained the same even one month after fire event. However, two years were not enough to reestablish ant species composition in both microhabitats in relation to our control group samples. Our study is the first to assess anthropic fire effects upon epigaeic and hypogaeic ants communities; highlighting the importance of evaluating different microhabitats, to more accurately detect the effects of anthropic disturbances in biological communities. We concluded that ant communities are just partially affected by fire occurrences, and epigaeic assemblages are the most affected ones in comparison to hypogaeic ants. Furthermore the study provides knowledge to aid in the creation of vegetation management programs that allow Cerrado conservation.

  3. Polyacrylamide hydrogels: an effective tool for delivering liquid baits to pest ants (Hymenoptera: Formicidae).

    Science.gov (United States)

    Buczkowski, Grzegorz; Roper, Elray; Chin, Darren

    2014-04-01

    Ant management in urban and natural areas often relies on toxic baits. Liquid baits are highly attractive to pest ants because they mimic natural food sources such as honeydew and nectar, the principal dietary components of many ants. However, liquid bait use has been limited owing to the lack of bait dispensers that are effective, inexpensive, and easy to service. The current study evaluated the potential of water-storing crystals (polyacrylamide spheres) to effectively deliver liquid thiamethoxam baits to laboratory colonies of Argentine ants, Linepithema humile Mayr. Results of laboratory trials show that bait crystals saturated in 25% sucrose solution containing 0.007% thiamethoxam are highly attractive to Argentine ants and highly effective against all castes and life stages, including workers, queens, and brood. Fresh bait crystals were highly effective and required approximately 2 d to kill all workers and approximately 6 d to achieve complete mortality in queens and brood. Results of bait aging tests show that the crystals lose approximately 70% of moisture in 8 h and the duration of outdoor exposure has a significant effect on moisture loss and subsequently bait acceptance and bait efficacy. A gradual decrease in mortality was observed for all castes and life stages as bait age increased. In general, fresh baits and those aged for ants that obtain thiamethoxam by feeding on bait crystals effectively transfer it to untreated recipient ants. The level of secondary mortality depended on the donor:recipient ratio, with approximately 40% recipient worker mortality with the 1:5 ratio and 15% recipient worker mortality with 1:10 or 1:20 ratios. However, no queens died in any transfer tests, suggesting that multiple feedings from multiple donors may be necessary to produce queen mortality. The results of the transfer tests demonstrate the role of trophallaxis in the distribution of thiamethoxam and confirm that thiamethoxam is effectively transferred in Argentine

  4. Drowning out the protection racket: partner manipulation or drought can strengthen ant-plant mutualism.

    Science.gov (United States)

    Denison, R Ford

    2014-07-01

    Two recent reports discuss interactions between plants and ants that defend them from herbivores. Acacia trees provide their ant bodyguards with a diet that reduces their ability to benefit from alternate hosts. Provisioning of ants by Cordia trees during drought may buy insurance against extreme defoliation events, not just average-year benefits. Copyright © 2014 Elsevier Ltd. All rights reserved.

  5. Thermoregulation strategies in ants in comparison to other social insects, with a focus on red wood ants (Formica rufa group [v2; ref status: indexed, http://f1000r.es/35p

    Directory of Open Access Journals (Sweden)

    Štěpánka Kadochová

    2014-03-01

    Full Text Available Temperature influences every aspect of ant biology, especially metabolic rate, growth and development. Maintenance of high inner nest temperature increases the rate of sexual brood development and thereby increases the colony fitness. Insect societies can achieve better thermoregulation than solitary insects due to the former’s ability to build large and elaborated nests and display complex behaviour. In ants and termites the upper part of the nest, the mound, often works as a solar collector and can also have an efficient ventilation system. Two thermoregulatory strategies could be applied. Firstly the ants use an increased thermal gradient available in the mound for brood relocation. Nurse workers move the brood according to the thermal gradients to ensure the ideal conditions for development. A precise perception of temperature and evolution of temperature preferences are needed to make the correct choices. A second thermoregulatory strategy used by mound nesting ants is keeping a high temperature inside large nests. The unique thermal and insulation properties of the nest material help to maintain stable conditions, which is the case of the Wood ant genus Formica. Ants can regulate thermal loss by moving nest aggregation and alternating nest ventilation. Metabolic heat produced by ant workers or associated micro organisms is an important additional source of heat which helps to maintain thermal homeostasis in the nest.

  6. Mutualistic fungi control crop diversity in fungus-growing ants

    DEFF Research Database (Denmark)

    Poulsen, Michael; Boomsma, Jacobus J

    2005-01-01

    Leaf-cutting ants rear clonal fungi for food and transmit the fungi from mother to daughter colonies so that symbiont mixing and conflict, which result from competition between genetically different clones, are avoided. Here we show that despite millions of years of predominantly vertical...... transmission, the domesticated fungi actively reject mycelial fragments from neighboring colonies, and that the strength of these reactions are in proportion to the overall genetic difference between these symbionts. Fungal incompatibility compounds remain intact during ant digestion, so that fecal droplets...

  7. The effects of age and social interactions on innate immunity in a leaf-cutting ant

    DEFF Research Database (Denmark)

    Armitage, S.A.O.; Boomsma, J.J.

    2010-01-01

    defence is affected by both age and the short-term presence or absence of nestmates in the leaf-cutting ant Acromyrmex octospinosus. We predicted that older ants would show immune senescence and that group living may result in prophylactic differences in immune defence compared to solitarily kept ants. We...

  8. Myrmica Ants and Their Butterfly Parasites with Special Focus on the Acoustic Communication

    Directory of Open Access Journals (Sweden)

    F. Barbero

    2012-01-01

    Full Text Available About 10,000 arthropod species live as ants' social parasites and have evolved a number of mechanisms allowing them to penetrate and survive inside the ant nests. Myrmica colonies, in particular, are exploited by numerous social parasites, and the presence of their overwintering brood, as well as of their polygyny, contributes to make them more vulnerable to infestation. Butterflies of the genus Maculinea are among the most investigated Myrmica inquilines. These lycaenids are known for their very complex biological cycles. Maculinea species are obligated parasites that depend on a particular food plant and on a specific Myrmica species for their survival. Maculinea larvae are adopted by Myrmica ants, which are induced to take them into their nests by chemical mimicry. Then the parasite spends the following 11–23 months inside the ants' nest. Mimicking the acoustic emission of the queen ants, Maculinea parasites not only manage to become integrated, but attain highest rank within the colony. Here we review the biology of Maculinea/Myrmica system with a special focus on some recent breakthrough concerning their acoustical patterns.

  9. Kunstikriitik Ants Juske sai doktoriks / Neeme Korv

    Index Scriptorium Estoniae

    Korv, Neeme, 1974-

    2003-01-01

    Tartu Kõrgema Kunstikooli rektor Ants Juske kaitses 7. veebruaril Tallinnas Kunstiakadeemias edukalt doktoriväitekirja, juhendajaks oli professor Boris Bernštein ning oponeerisid doktor Altti Kuusamo Soomest ja professor Peeter Tulviste

  10. The ejaculatory biology of leafcutter ants

    DEFF Research Database (Denmark)

    den Boer, Susanne; Stürup, Marlene; Boomsma, Jacobus Jan

    2015-01-01

    understanding of the fundamental biology of ejaculate production, transfer and physiological function remains extremely limited. We studied the ejaculation process in the leafcutter ant Atta colombica and found that it starts with the appearance of a clear pre-ejaculatory fluid (PEF) at the tip...

  11. Ant brood function as life preservers during floods.

    Directory of Open Access Journals (Sweden)

    Jessica Purcell

    Full Text Available Social organisms can surmount many ecological challenges by working collectively. An impressive example of such collective behavior occurs when ants physically link together into floating 'rafts' to escape from flooded habitat. However, raft formation may represent a social dilemma, with some positions posing greater individual risks than others. Here, we investigate the position and function of different colony members, and the costs and benefits of this functional geometry in rafts of the floodplain-dwelling ant Formica selysi. By causing groups of ants to raft in the laboratory, we observe that workers are distributed throughout the raft, queens are always in the center, and 100% of brood items are placed on the base. Through a series of experiments, we show that workers and brood are extremely resistant to submersion. Both workers and brood exhibit high survival rates after they have rafted, suggesting that occupying the base of the raft is not as costly as expected. The placement of all brood on the base of one cohesive raft confers several benefits: it preserves colony integrity, takes advantage of brood buoyancy, and increases the proportion of workers that immediately recover after rafting.

  12. Geographical variation in host-ant specificity of the parasitic butterfly Maculinea alcon in Denmark

    DEFF Research Database (Denmark)

    Als, Thomas Damm; Nash, David Richard; Boomsma, J. J.

    2002-01-01

    1. Maculinea alcon uses three different species of Myrmica host ants along a north-south gradient in Europe. Based on this geographical variation in host ant use, Elmes et al. (1994) suggested that M. alcon might consist of three or more cryptic species or host races, each using a single...... and different host-ant species.2. Population-specific differences in allozyme genotypes of M. alcon in Denmark (Gadeberg Boomsma, 1997) have suggested that genetically differentiated forms may occur in a gradient across Denmark, possibly in relation to the use of different host ants.3. It was found that two...... host-ant species are indeed used as hosts in Denmark, but not in a clear-cut north-south gradient. Furthermore, specificity was not complete for many M. alcon populations. Of five populations investigated in detail, one used primarily M. rubra as a host, another exclusively used M. ruginodis, while...

  13. Serpentine soils affect heavy metal tolerance but not genetic diversity in a common Mediterranean ant.

    Science.gov (United States)

    Frizzi, Filippo; Masoni, Alberto; Çelikkol, Mine; Palchetti, Enrico; Ciofi, Claudio; Chelazzi, Guido; Santini, Giacomo

    2017-08-01

    Natural habitats with serpentine soils are rich in heavy metal ions, which may significantly affect ecological communities. Exposure to metal pollutants results, for instance, in a reduction of population genetic diversity and a diffused higher tolerance towards heavy metals. In this study, we investigated whether chronic exposure to metals in serpentine soils affect accumulation patterns, tolerance towards metal pollutants, and genetic diversity in ants. In particular, we studied colonies of the common Mediterranean ant, Crematogaster scutellaris, along a contamination gradient consisting of two differently contaminated forests and a reference soil with no geogenic contamination. We first evaluated the metal content in both soil and ants' body. Then, we tested for tolerance towards metal pollutants by evaluating the mortality of ants fed with nickel (Ni) solutions of increasing concentrations. Finally, differences in genetic diversity among ants from different areas were assessed using eight microsatellite loci. Interestingly, a higher tolerance to nickel solutions was found in ants sampled in sites with intermediate levels of heavy metals. This may occur, because ants inhabiting strongly contaminated areas tend to accumulate higher amounts of contaminants. Additional ingestion of toxicants beyond the saturation threshold would lead to death. There was no difference in the genetic diversity among ant colonies sampled in different sites. This was probably the result of queen mediated gene flow during nuptial flights across uncontaminated and contaminated areas of limited geographical extent. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. A mutualism without honeydew: what benefits for Melissotarsus emeryi ants and armored scale insects (Diaspididae?

    Directory of Open Access Journals (Sweden)

    Christian Peeters

    2017-07-01

    Full Text Available Mutualisms between ants and sap-sucking insects generally involve clear benefits for both partners: the ants provide protection in exchange for honeydew. However, a single ant genus associates with armoured scale insects (Diaspididae that do not excrete honeydew. We studied three colonies of Melissotarsus emeryi ants from two localities in Mozambique. Vast numbers of the diaspidid Morganella conspicua occupied galleries dug by the ants under the bark of living trees. Unlike free-living M. conspicua and other diaspidids, M. conspicua living with ants are known to lack shields, likely because they gain protection against enemies and desiccation. Nevertheless, we documented the occurrence of rare individuals with shields inside ant galleries, indicating that their glands continue to secrete wax and proteins as building material. This is likely to constitute a significant portion of the ants’ diet, in addition to diaspidid exuviae and excretions from the Malpighian tubules. Indeed, Melissotarsus workers cannot walk outside the galleries due to modified middle legs, forcing them to obtain all nourishment within the tree. Melissotarsus founding queens, however, must locate a suitable host tree while flying, and acquire diaspidid crawlers. This mutualism involves ants that are highly specialised to chew through living wood, and diaspidids that can also live freely outside the bark. It is extremely widespread in Africa and Madagascar, recorded from 20 tree families, and harmful effects on plant hosts require rapid study.

  15. Radiocesium contamination of the web spider Nephila clavata (Nephilidae: Arachnida) 1.5 years after the Fukushima Dai-ichi Nuclear Power Plant accident

    International Nuclear Information System (INIS)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato

    2014-01-01

    We measured the concentrations of radiocesium ( 134 Cs and 137 Cs) in a large web spider, Nephila clavata L. Koch (Nephilidae: Arachnida), collected at three sites at different distances from the Fukushima Dai-ichi Nuclear Power Plant about 1.5 y after the accident in March 2011. The radiocesium concentrations in spiders were highest in a streamside secondary forest 33 km northwest of the power plant: mean ± a standard deviation of 2.401 ± 1.197 Bq g −1 dry for 134 Cs and 3.955 ± 1.756 Bq g −1 dry for 137 Cs. In a hillside secondary forest 37 km northwest of the power plant, the mean concentrations of 134 Cs and 137 Cs were 0.825 ± 0.247 Bq g −1 dry and 1.470 ± 0.454 Bq g −1 dry, respectively. In a pine forest 62 km west of the power plant, very low radiocesium concentrations were detected, but in only a few individuals. The concentrations of 134 Cs and 137 Cs in spiders collected at each site tended to be correlated with the air radiation dose rate at each site. Since spiders are key components of food webs in forests, the high concentrations in this species at contaminated sites suggested that the radiocesium from the accident has transferred through food chains and reached to higher trophic level of the food chains. -- Highlights: • We investigated radiocesium contamination of large web spiders in Fukushima. • Spiders collected at three different sites in Fukushima were contaminated. • Radiocesium concentrations of spiders tended to increase with the air radiation dose rates. • Radiocesium concentrations of spiders did not affect by the amount of prey

  16. Variability in individual activity bursts improves ant foraging success.

    Science.gov (United States)

    Campos, Daniel; Bartumeus, Frederic; Méndez, Vicenç; Andrade, José S; Espadaler, Xavier

    2016-12-01

    Using experimental and computational methods, we study the role of behavioural variability in activity bursts (or temporal activity patterns) for individual and collective regulation of foraging in A. senilis ants. First, foraging experiments were carried out under special conditions (low densities of ants and food and absence of external cues or stimuli) where individual-based strategies are most prevalent. By using marked individuals and recording all foraging trajectories, we were then able to precisely quantify behavioural variability among individuals. Our main conclusions are that (i) variability of ant trajectories (turning angles, speed, etc.) is low compared with variability of temporal activity profiles, and (ii) this variability seems to be driven by plasticity of individual behaviour through time, rather than the presence of fixed behavioural stereotypes or specialists within the group. The statistical measures obtained from these experimental foraging patterns are then used to build a general agent-based model (ABM) which includes the most relevant properties of ant foraging under natural conditions, including recruitment through pheromone communication. Using the ABM, we are able to provide computational evidence that the characteristics of individual variability observed in our experiments can provide a functional advantage (in terms of foraging success) to the group; thus, we propose the biological basis underpinning our observations. Altogether, our study reveals the potential utility of experiments under simplified (laboratory) conditions for understanding information-gathering in biological systems. © 2016 The Author(s).

  17. Aphid alarm pheromone as a cue for ants to locate aphid partners.

    Directory of Open Access Journals (Sweden)

    François J Verheggen

    Full Text Available The mutualistic relationships that occur between myrmecophilous aphids and ants are based on the rich food supply that honeydew represents for ants and on the protection they provide against aphid natural enemies. While aphid predators and parasitoids actively forage for oviposition sites by using aphid semiochemicals, scouts of aphid-tending ant species would also benefit from locating honeydew resources by orienting toward aphid pheromone sources. The present study aims to provide additional information on the use of Aphis fabae alarm pheromone, i.e. (E-β-farnesene (EβF, by ant scouts. The perception and behavioral impact of EβF on Lasius niger were investigated using electroantennography and two bio-assays measuring their attraction and orientation towards aphid semiochemicals. Pronounced electrical depolarizations were observed from L. niger scout antennae to stimulations of A. fabae alarm pheromone, while other sesquiterpenes elicited weak or no responses. L. niger scouts were significantly attracted toward EβF in a four-arm olfactometer, as well as in an two-choice bioassay. These laboratory results suggest for the first time that low amounts of aphid alarm pheromone can be used by L. niger scouts as a cue indicating the presence of aphid colonies and could therefore mediate the aphid-ant partnership in the field.

  18. Ant-diaspore interactions during secondary succession in the Atlantic forest of Brazil

    Directory of Open Access Journals (Sweden)

    Victor P Zwiener

    2012-06-01

    Full Text Available Animal-plant interactions are important for the recovery of diversity and processes in secondary forests, which increasingly dominate the tropical landscape. We used a combination of observational and experimental approaches to study the interactions of ants with diaspores across a successional gradient of forests in Southern Brazil, from August 2007 to April 2008. In addition to diaspore removal rates, we assessed the species richness, diversity and behaviour of ants interacting with diaspores, in three replicated sites of four successional stages of forests. We recorded 22 ant species interacting with diaspores (an estimated 15% of the total species pool in the region. Species richness and diversity did not differ among successional stages but the behaviour of ants towards diaspores changed with the age of secondary forests. In old successional stages the removal of entire diaspores was more common than in young successional stages of forests. Concordantly, diaspore removal rates were lowest in the youngest successional stage of secondary forests and increased with the age of forests. These results indicate that ant-diaspore interactions in secondary forests are disturbed and lower removal rates in secondary forests are likely to constrain the recruitment of plant populations during secondary succession. Rev. Biol. Trop. 60 (2: 933-942. Epub 2012 June 01.

  19. Reducing losses inflicted by insect pests on cashew, using weaver ants as a biological control agent

    DEFF Research Database (Denmark)

    Anato, Florence; Wargui, Rosine; Sinzogan, Antonio

    2015-01-01

    BACKGROUND: Cashew (Anacardium occidentale Linnaeus) is the largest agricultural export product in Benin. However, yields and quality are lost due to inefficient pest control. Weaver ants (Oecophylla spp.) may control pests in this crop as they eat and deter pests. In Benin, cashew pest damages......, nut quality and yield were compared among: (i) trees with weaver ant (Oecophylla longinoda Latreille), (ii) trees where weaver ants were fed sugar, (iii) IPM trees with weaver ants combined with GF-120 (a natural insecticide), and (iv) control trees receiving no control measures. RESULTS: Thrips...... damages on nuts were higher than other damage symptoms and significantly lower on control trees compared to other treatments. Percentage of first quality nuts was higher in the control compared to ants treatments, but not different from the IPM-treatment. However, compared to the control treatment, ants...

  20. Reproduction and dispersal in an ant-associated root aphid community

    DEFF Research Database (Denmark)

    Ivens, A.B.F.; Kronauer, Daniel Jan Christoph; Pen, I.

    2012-01-01

    viscosity is high and winged aphids rare, consistent with infrequent horizontal transmission between ant host colonies. The absence of the primary host shrub (Pistacia) may explain the absence of sex in three of the studied species, but elm trees (Ulmus) that are primary hosts of the fourth species (T...... above ground, whereas dispersal constraints and dependence on ant-tending may differentially affect the costs and benefits of sex in subterranean aphids. Here, we studied reproductive mode and dispersal in a community of root aphids that are obligately associated with the ant Lasius flavus. We assessed...... the genetic population structure of four species (Geoica utricularia, Tetraneura ulmi, Forda marginata and Forda formicaria) in a Dutch population and found that all species reproduce predominantly if not exclusively asexually, so that populations consist of multiple clonal lineages. We show that population...

  1. ACOustic: A Nature-Inspired Exploration Indicator for Ant Colony Optimization

    Directory of Open Access Journals (Sweden)

    Rafid Sagban

    2015-01-01

    Full Text Available A statistical machine learning indicator, ACOustic, is proposed to evaluate the exploration behavior in the iterations of ant colony optimization algorithms. This idea is inspired by the behavior of some parasites in their mimicry to the queens’ acoustics of their ant hosts. The parasites’ reaction results from their ability to indicate the state of penetration. The proposed indicator solves the problem of robustness that results from the difference of magnitudes in the distance’s matrix, especially when combinatorial optimization problems with rugged fitness landscape are applied. The performance of the proposed indicator is evaluated against the existing indicators in six variants of ant colony optimization algorithms. Instances for travelling salesman problem and quadratic assignment problem are used in the experimental evaluation. The analytical results showed that the proposed indicator is more informative and more robust.

  2. Dissimilarity of Ant Communities Increases with Precipitation, but not Reduced Land-Use Intensity, in Indonesian Cacao Agroforestry

    Directory of Open Access Journals (Sweden)

    Damayanti Buchori

    2013-01-01

    Full Text Available Land-use degradation and climate change are well-known drivers of biodiversity loss, but little information is available about their potential interaction. Here, we focus on the effects of land-use and precipitation on ant diversity in cacao agroforestry. In Central Sulawesi, Indonesia, we selected 16 cacao agroforestry plots with a shaded vs. unshaded plot in each of eight villages differing in precipitation (1032–2051 mm annual rainfall. On each plot, 10 cacao trees with similar size and age (7–10 years were selected for hand collection of ants on each cacao tree and the soil surface. In total, we found 80 ant species belonging to five subfamilies. Land-use intensification (removal of shade trees and precipitation had no effect on species richness of ants per cacao tree (alpha diversity and, in an additive partitioning approach, within-plot beta diversity. However, higher precipitation (but not shade significantly increased ant species dissimilarity across cacao trees within a plot, with ant species showing contrasting responses to precipitation. Reduced precipitation causing drought stress appeared to contribute to convergence of ant community structure, presumably via reduced heterogeneity in cacao tree growth. In conclusion, reduced precipitation greatly influenced ant community dissimilarity and appeared to be more important for ant community structure than land-use intensification.

  3. Landmarks or panoramas: what do navigating ants attend to for guidance?

    Directory of Open Access Journals (Sweden)

    Beugnon Guy

    2011-08-01

    Full Text Available Abstract Background Insects are known to rely on terrestrial landmarks for navigation. Landmarks are used to chart a route or pinpoint a goal. The distant panorama, however, is often thought not to guide navigation directly during a familiar journey, but to act as a contextual cue that primes the correct memory of the landmarks. Results We provided Melophorus bagoti ants with a huge artificial landmark located right near the nest entrance to find out whether navigating ants focus on such a prominent visual landmark for homing guidance. When the landmark was displaced by small or large distances, ant routes were affected differently. Certain behaviours appeared inconsistent with the hypothesis that guidance was based on the landmark only. Instead, comparisons of panoramic images recorded on the field, encompassing both landmark and distal panorama, could explain most aspects of the ant behaviours. Conclusion Ants navigating along a familiar route do not focus on obvious landmarks or filter out distal panoramic cues, but appear to be guided by cues covering a large area of their panoramic visual field, including both landmarks and distal panorama. Using panoramic views seems an appropriate strategy to cope with the complexity of natural scenes and the poor resolution of insects' eyes. The ability to isolate landmarks from the rest of a scene may be beyond the capacity of animals that do not possess a dedicated object-perception visual stream like primates.

  4. A Stochastic Inversion Method for Potential Field Data: Ant Colony Optimization

    Science.gov (United States)

    Liu, Shuang; Hu, Xiangyun; Liu, Tianyou

    2014-07-01

    Simulating natural ants' foraging behavior, the ant colony optimization (ACO) algorithm performs excellently in combinational optimization problems, for example the traveling salesman problem and the quadratic assignment problem. However, the ACO is seldom used to inverted for gravitational and magnetic data. On the basis of the continuous and multi-dimensional objective function for potential field data optimization inversion, we present the node partition strategy ACO (NP-ACO) algorithm for inversion of model variables of fixed shape and recovery of physical property distributions of complicated shape models. We divide the continuous variables into discrete nodes and ants directionally tour the nodes by use of transition probabilities. We update the pheromone trails by use of Gaussian mapping between the objective function value and the quantity of pheromone. It can analyze the search results in real time and promote the rate of convergence and precision of inversion. Traditional mapping, including the ant-cycle system, weaken the differences between ant individuals and lead to premature convergence. We tested our method by use of synthetic data and real data from scenarios involving gravity and magnetic anomalies. The inverted model variables and recovered physical property distributions were in good agreement with the true values. The ACO algorithm for binary representation imaging and full imaging can recover sharper physical property distributions than traditional linear inversion methods. The ACO has good optimization capability and some excellent characteristics, for example robustness, parallel implementation, and portability, compared with other stochastic metaheuristics.

  5. Ground-dwelling ant fauna of sites with high levels of copper.

    Science.gov (United States)

    Diehl, E; Sanhudo, C E; Diehl-Fleig, Ed

    2004-02-01

    Richness and diversity of ant species are related to environmental factors such as vegetation, soil, presence of heavy metals, and insecticides, which allow the use of the assemblage members as terrestrial indicators of environmental conservation status. This study presents the results of ground ants surveyed in Minas do Camaquã in the municipality of Cacapava do Sul (Camaquã Basin), State of Rio Grande do Sul. Collections were performed in four sites, which high levels of copper in the soil, three of which--a mine, a liquid reject, and a solid reject-, had sparse or no plant cover, and one site where Pinus has been used for rehabilitation. Parque das Guaritas was the control site, since it presented normal levels of copper and a dense savanna cover. For each site, three transect lines extending 100 m were draw, and at each 10 m sardine baits were distributed; after two hours the ants present were collected. Hand collections in all five sites were performed during one hour (capture effort). A total of 51 species belonging to 17 genera were collected. The control site was the richest in ant species (r = 45). Sites with high level of copper and poor plant cover presented the lowest richness: mine (r = 14), solid reject (r = 15), and liquid reject (r = 16). In contrast, the site planted with Pinus presented an increment in richness (r = 24) of ground-dwelling ants, suggesting a reahabilitation process.

  6. Ground-dwelling ant fauna of sites with high levels of copper

    Directory of Open Access Journals (Sweden)

    E. Diehl

    Full Text Available Richness and diversity of ant species are related to environmental factors such as vegetation, soil, presence of heavy metals, and insecticides, which allow the use of the assemblage members as terrestrial indicators of environmental conservation status. This study presents the results of ground ants surveyed in Minas do Camaquã in the municipality of Caçapava do Sul (Camaquã Basin, State of Rio Grande do Sul. Collections were performed in four sites, with high levels of copper in the soil, three of which - a mine, a liquid reject, and a solid reject -, had sparse or no plant cover, and one site where Pinus has been used for rehabilitation. Parque das Guaritas was the control site, since it presented normal levels of copper and a dense savanna cover. For each site, three transect lines extending 100 m were draw, and at each 10 m sardine baits were distributed; after two hours the ants present were collected. Hand collections in all five sites were performed during one hour (capture effort. A total of 51 species belonging to 17 genera were collected. The control site was the richest in ant species (r = 45. Sites with high level of copper and poor plant cover presented the lowest richness: mine (r = 14, solid reject (r = 15, and liquid reject (r = 16. In contrast, the site planted with Pinus presented an increment in richness (r = 24 of ground-dwelling ants, suggesting a reahabilitation process.

  7. The use of artificial nests by weaver ants: a preliminary field observation

    DEFF Research Database (Denmark)

    Offenberg, Joachim

    2014-01-01

    of the plantation. This suggests that exposure to harsh weather triggered the use of artificial nests. It was also found that ants preferred to nest in bottles covered with aluminum foil compared to transparent bottles. These findings document an opportunistic nesting behavior of weaver ants and suggest...

  8. Behavioural and chemical evidence for multiple colonisation of the Argentine ant, Linepithema humile, in the Western Cape, South Africa

    Directory of Open Access Journals (Sweden)

    Wossler Theresa C

    2011-02-01

    Full Text Available Abstract Background The Argentine ant, Linepithema humile, is a widespread invasive ant species that has successfully established in nearly all continents across the globe. Argentine ants are characterised by a social structure known as unicoloniality, where territorial boundaries between nests are absent and intraspecific aggression is rare. This is particularly pronounced in introduced populations and results in the formation of large and spatially expansive supercolonies. Although it is amongst the most well studied of invasive ants, very little work has been done on this ant in South Africa. In this first study, we investigate the population structure of Argentine ants in South Africa. We use behavioural (aggression tests and chemical (CHC approaches to investigate the population structure of Argentine ants within the Western Cape, identify the number of supercolonies and infer number of introductions. Results Both the aggression assays and chemical data revealed that the Western Cape Argentine ant population can be divided into two behaviourally and chemically distinct supercolonies. Intraspecific aggression was evident between the two supercolonies of Argentine ants with ants able to discriminate among conspecific non-nestmates. This discrimination is linked to the divergence in cuticular hydrocarbon profiles of ants originating from the two supercolonies. Conclusions The presence of these two distinct supercolonies is suggestive of at least two independent introductions of this ant within the Western Cape. Moreover, the pattern of colonisation observed in this study, with the two colonies interspersed, is in agreement with global patterns of Argentine ant invasions. Our findings are of interest because recent studies show that Argentine ants from South Africa are different from those identified in other introduced ranges and therefore provide an opportunity to further understand factors that determine the distributional and spread

  9. Beneficial Effects of Ants and Spiders on the Reproductive Value of Eriotheca gracilipes (Malvaceae) in a Tropical Savanna.

    Science.gov (United States)

    Stefani, Vanessa; Pires, Tayna Lopes; Torezan-Silingardi, Helena Maura; Del-Claro, Kleber

    2015-01-01

    Predators affect plant fitness when they forage on them and reduce the action of herbivores. Our study evaluates the complementary effects of spiders and ants that visit the extrafloral nectaries of Eriotheca gracilipes (Malvaceae) on the production of fruits and viable seeds of these savanna trees. Four experimental groups were established: control group - with free access of spiders and ants; exclusion group - spiders and ants excluded; ant group - absence of spiders; and spider group - absence of ants. The presence of ants reduced the spider richness; however, the presence of spiders did not affect the ant richness. A significantly higher number of fruits per buds were found in the presence of spiders alone or spiders and ants together (control group) compared with the absence of both predators (exclusion group). The number of seeds per fruits and seed viability were higher in the control group. This is the first study showing that spiders and ants may exert a positive and complementary effect on the reproductive value of an extrafloral nectaried plant. Mostly the impact of ants and/or spiders on herbivores is considered, whereas our study reinforces the importance of evaluating the effect of multiple predators simultaneously, exploring how the interactions among predators with distinct skills may affect the herbivores and the plants on which they forage.

  10. Genetic evidence for intra- and interspecific slavery in honey ants (genus Myrmecocystus).

    Science.gov (United States)

    Kronauer, D J C; Gadau, J; Hölldobler, B

    2003-04-22

    The New World honey ant species Myrmecocystus mimicus is well known for its highly stereotyped territorial tournaments, and for the raids on conspecific nests that can lead to intraspecific slavery. Our results from mitochondrial and nuclear markers show that the raided brood emerges in the raiding colony and is subsequently incorporated into the colony's worker force. We also found enslaved conspecifics in a second honey ant species, M. depilis, the sister taxon of M. mimicus, which occurs in sympatry with M. mimicus at the study site. Colonies of this species furthermore contained raided M. mimicus workers. Both species have an effective mating frequency that is not significantly different from 1. This study provides genetic evidence for facultative intra- and interspecific slavery in the genus Myrmecocystus. Slavery in ants has evolved repeatedly and supposedly by different means. We propose that, in honey ants, secondary contact between two closely related species that both exhibit intraspecific slavery gave rise to an early form of facultative interspecific slavery.

  11. Myrmecochory and short-term seed fate in Rhamnus alaternus: Ant species and seed characteristics

    Science.gov (United States)

    Bas, J. M.; Oliveras, J.; Gómez, C.

    2009-05-01

    Benefits conferred on plants in ant-mediated seed dispersal mutualisms (myrmecochory) depend on the fate of transported seeds. We studied the effects of elaiosome presence, seed size and seed treatment (with and without passage through a bird's digestive tract) on short-term seed fate in Rhamnus alaternus. In our study, we define short-term seed, or initial, seed fate, as the location where ants release the seeds after ant contact with it. The elaiosomes had the most influence on short-term fate, i.e. whether or not seeds were transported to the nest. The workers usually transported big seeds more often than small ones, but small ants did not transport large seeds. Effect of seed size on transport depended on the ant species and on the treatment of the seed (manual extraction simulating a direct fall from the parent plant vs. bird deposition corresponding to preliminary primary dispersal). Probability of removal of elaiosome-bearing seeds to the nest by Aphaenogaster senilis increased with increasing seed weight.

  12. Riverine Landscape Patch Heterogeneity Drives Riparian Ant Assemblages in the Scioto River Basin, USA.

    Directory of Open Access Journals (Sweden)

    Paradzayi Tagwireyi

    Full Text Available Although the principles of landscape ecology are increasingly extended to include riverine landscapes, explicit applications are few. We investigated associations between patch heterogeneity and riparian ant assemblages at 12 riverine landscapes of the Scioto River, Ohio, USA, that represent urban/developed, agricultural, and mixed (primarily forested, but also wetland, grassland/fallow, and exurban land-use settings. Using remotely-sensed and ground-collected data, we delineated riverine landscape patch types (crop, grass/herbaceous, gravel, lawn, mudflat, open water, shrub, swamp, and woody vegetation, computed patch metrics (area, density, edge, richness, and shape, and conducted coordinated sampling of surface-active Formicidae assemblages. Ant density and species richness was lower in agricultural riverine landscapes than at mixed or developed reaches (measured using S [total number of species], but not using Menhinick's Index [DM], whereas ant diversity (using the Berger-Park Index [DBP] was highest in agricultural reaches. We found no differences in ant density, richness, or diversity among internal riverine landscape patches. However, certain characteristics of patches influenced ant communities. Patch shape and density were significant predictors of richness (S: R2 = 0.72; DM: R2=0.57. Patch area, edge, and shape emerged as important predictors of DBP (R2 = 0.62 whereas patch area, edge, and density were strongly related to ant density (R2 = 0.65. Non-metric multidimensional scaling and analysis of similarities distinguished ant assemblage composition in grass and swamp patches from crop, gravel, lawn, and shrub as well as ant assemblages in woody vegetation patches from crop, lawn, and gravel (stress = 0.18, R2 = 0.64. These findings lend insight into the utility of landscape ecology to river science by providing evidence that spatial habitat patterns within riverine landscapes can influence assemblage characteristics of riparian

  13. Ant system for reliability optimization of a series system with multiple-choice and budget constraints

    International Nuclear Information System (INIS)

    Nahas, Nabil; Nourelfath, Mustapha

    2005-01-01

    Many researchers have shown that insect colonies behavior can be seen as a natural model of collective problem solving. The analogy between the way ants look for food and combinatorial optimization problems has given rise to a new computational paradigm, which is called ant system. This paper presents an application of ant system in a reliability optimization problem for a series system with multiple-choice constraints incorporated at each subsystem, to maximize the system reliability subject to the system budget. The problem is formulated as a nonlinear binary integer programming problem and characterized as an NP-hard problem. This problem is solved by developing and demonstrating a problem-specific ant system algorithm. In this algorithm, solutions of the reliability optimization problem are repeatedly constructed by considering the trace factor and the desirability factor. A local search is used to improve the quality of the solutions obtained by each ant. A penalty factor is introduced to deal with the budget constraint. Simulations have shown that the proposed ant system is efficient with respect to the quality of solutions and the computing time

  14. Plant-derived differences in the composition of aphid honeydew and their effects on colonies of aphid-tending ants

    Science.gov (United States)

    Pringle, Elizabeth G; Novo, Alexandria; Ableson, Ian; Barbehenn, Raymond V; Vannette, Rachel L

    2014-01-01

    In plant–ant–hemipteran interactions, ants visit plants to consume the honeydew produced by phloem-feeding hemipterans. If genetically based differences in plant phloem chemistry change the chemical composition of hemipteran honeydew, then the plant's genetic constitution could have indirect effects on ants via the hemipterans. If such effects change ant behavior, they could feed back to affect the plant itself. We compared the chemical composition of honeydews produced by Aphis nerii aphid clones on two milkweed congeners, Asclepias curassavica and Asclepias incarnata, and we measured the responses of experimental Linepithema humile ant colonies to these honeydews. The compositions of secondary metabolites, sugars, and amino acids differed significantly in the honeydews from the two plant species. Ant colonies feeding on honeydew derived from A. incarnata recruited in higher numbers to artificial diet, maintained higher queen and worker dry weight, and sustained marginally more workers than ants feeding on honeydew derived from A. curassavica. Ants feeding on honeydew from A. incarnata were also more exploratory in behavioral assays than ants feeding from A. curassavica. Despite performing better when feeding on the A. incarnata honeydew, ant workers marginally preferred honeydew from A. curassavica to honeydew from A. incarnata when given a choice. Our results demonstrate that plant congeners can exert strong indirect effects on ant colonies by means of plant-species-specific differences in aphid honeydew chemistry. Moreover, these effects changed ant behavior and thus could feed back to affect plant performance in the field. PMID:25505534

  15. Antimicrobial defense shows an abrupt evolutionary transition in the fungus-growing ants

    DEFF Research Database (Denmark)

    Hughes, William O H; Pagliarini, Roberta; Madsen, Henning Bang

    2008-01-01

    of the reservoir did not relate with the evolutionary transition from lower to higher attines and correlated at most only slightly with colony size. The results thus suggest that the relationship between leaf-cutting ants and their parasites is distinctly different from that for other attine ants, in accord...

  16. The demographic consequences of mutualism: ants increase host-plant fruit production but not population growth.

    Science.gov (United States)

    Ford, Kevin R; Ness, Joshua H; Bronstein, Judith L; Morris, William F

    2015-10-01

    The impact of mutualists on a partner's demography depends on how they affect the partner's multiple vital rates and how those vital rates, in turn, affect population growth. However, mutualism studies rarely measure effects on multiple vital rates or integrate them to assess the ultimate impact on population growth. We used vital rate data, population models and simulations of long-term population dynamics to quantify the demographic impact of a guild of ant species on the plant Ferocactus wislizeni. The ants feed at the plant's extrafloral nectaries and attack herbivores attempting to consume reproductive organs. Ant-guarded plants produced significantly more fruit, but ants had no significant effect on individual growth or survival. After integrating ant effects across these vital rates, we found that projected population growth was not significantly different between unguarded and ant-guarded plants because population growth was only weakly influenced by differences in fruit production (though strongly influenced by differences in individual growth and survival). However, simulations showed that ants could positively affect long-term plant population dynamics through services provided during rare but important events (herbivore outbreaks that reduce survival or years of high seedling recruitment associated with abundant precipitation). Thus, in this seemingly clear example of mutualism, the interaction may actually yield no clear benefit to plant population growth, or if it does, may only do so through the actions of the ants during rare events. These insights demonstrate the value of taking a demographic approach to studying the consequences of mutualism.

  17. Combined Venom Gland Transcriptomic and Venom Peptidomic Analysis of the Predatory Ant Odontomachus monticola

    Directory of Open Access Journals (Sweden)

    Kohei Kazuma

    2017-10-01

    Full Text Available Ants (hymenoptera: Formicidae have adapted to many different environments and have become some of the most prolific and successful insects. To date, 13,258 ant species have been reported. They have been classified into 333 genera and 17 subfamilies. Except for a few Formicinae, Dolichoderinae, and members of other subfamilies, most ant species have a sting with venom. The venoms are composed of formic acid, alkaloids, hydrocarbons, amines, peptides, and proteins. Unlike the venoms of other animals such as snakes and spiders, ant venoms have seldom been analyzed comprehensively, and their compositions are not yet completely known. In this study, we used both transcriptomic and peptidomic analyses to study the composition of the venom produced by the predatory ant species Odontomachus monticola. The transcriptome analysis yielded 49,639 contigs, of which 92 encoded toxin-like peptides and proteins with 18,106,338 mapped reads. We identified six pilosulin-like peptides by transcriptomic analysis in the venom gland. Further, we found intact pilosulin-like peptide 1 and truncated pilosulin-like peptides 2 and 3 by peptidomic analysis in the venom. Our findings related to ant venom peptides and proteins may lead the way towards development and application of novel pharmaceutical and biopesticidal resources.

  18. Cultural differences in ant-dipping tool length between neighbouring chimpanzee communities at Kalinzu, Uganda.

    Science.gov (United States)

    Koops, Kathelijne; Schöning, Caspar; Isaji, Mina; Hashimoto, Chie

    2015-07-22

    Cultural variation has been identified in a growing number of animal species ranging from primates to cetaceans. The principal method used to establish the presence of culture in wild populations is the method of exclusion. This method is problematic, since it cannot rule out the influence of genetics and ecology in geographically distant populations. A new approach to the study of culture compares neighbouring groups belonging to the same population. We applied this new approach by comparing ant-dipping tool length between two neighbouring communities of chimpanzees (Pan troglodytes schweinfurthii) in the Kalinzu Forest, Uganda. Ant-dipping tool length varies across chimpanzee study sites in relation to army ant species (Dorylus spp.) and dipping location (nest vs. trail). We compared the availability of army ant species and dipping tool length between the two communities. M-group tools were significantly longer than S-group tools, despite identical army ant target species availabilities. Moreover, tool length in S-group was shorter than at all other sites where chimpanzees prey on epigaeic ants at nests. Considering the lack of ecological differences between the two communities, the tool length difference appears to be cultural. Our findings highlight how cultural knowledge can generate small-scale cultural diversification in neighbouring chimpanzee communities.

  19. Improved phylogenetic analyses corroborate a plausible position of Martialis heureka in the ant tree of life.

    Directory of Open Access Journals (Sweden)

    Patrick Kück

    Full Text Available Martialinae are pale, eyeless and probably hypogaeic predatory ants. Morphological character sets suggest a close relationship to the ant subfamily Leptanillinae. Recent analyses based on molecular sequence data suggest that Martialinae are the sister group to all extant ants. However, by comparing molecular studies and different reconstruction methods, the position of Martialinae remains ambiguous. While this sister group relationship was well supported by Bayesian partitioned analyses, Maximum Likelihood approaches could not unequivocally resolve the position of Martialinae. By re-analysing a previous published molecular data set, we show that the Maximum Likelihood approach is highly appropriate to resolve deep ant relationships, especially between Leptanillinae, Martialinae and the remaining ant subfamilies. Based on improved alignments, alignment masking, and tree reconstructions with a sufficient number of bootstrap replicates, our results strongly reject a placement of Martialinae at the first split within the ant tree of life. Instead, we suggest that Leptanillinae are a sister group to all other extant ant subfamilies, whereas Martialinae branch off as a second lineage. This assumption is backed by approximately unbiased (AU tests, additional Bayesian analyses and split networks. Our results demonstrate clear effects of improved alignment approaches, alignment masking and data partitioning. We hope that our study illustrates the importance of thorough, comprehensible phylogenetic analyses using the example of ant relationships.

  20. An Improved Ant Colony Matching by Using Discrete Curve Evolution

    OpenAIRE

    Saadi, Younes; Sari, Eka,; Herawan, Tutut

    2014-01-01

    Part 1: Information & Communication Technology-EurAsia Conference 2014, ICT-EurAsia 2014; International audience; In this paper we present an improved Ant Colony Optimization (ACO) for contour matching, which can be used to match 2D shapes. Discrete Curve Evolution (DCE) technique is used to simplify the extracted contour. In order to find the best correspondence between shapes, the match process is formulated as a Quadratic Assignment Problem (QAP) and resolved by using Ant Colony Optimizati...

  1. Description of an injury in a human caused by a false tocandira (Dinoponera gigantea, Perty, 1833 with a revision on folkloric, pharmacological and clinical aspects of the giant ants of the genera Paraponera and Dinoponera (sub-family Ponerinae Descrição de injúria humana causada por falsa tocandira (Dinoponera gigantea, Perty, 1833 com revisão dos aspectos folclóricos, farmacológicos e clínicos das formigas gigantes do gênero Paraponera e Dinoponera (sub-família Ponerinae

    Directory of Open Access Journals (Sweden)

    Vidal Haddad Junior

    2005-08-01

    Full Text Available The authors observed an injury caused by the sting of a false tocandira ant in the hand of an amateur fisherman and they describe the clinical findings and the evolution of the envenoming, which presented an acute and violent pain, cold sweating, nausea, a vomiting episode, malaise, tachycardia and left axillary's lymphadenopathy. About three hours after the accident, still feeling intense pain in the place of the sting, he presented an episode of great amount of blood in the feces with no history of digestive, hematological or vascular problems. The intense pain decreased after eight hours, but the place stayed moderately painful for about 24 hours. In that moment, he presented small grade of local edema and erythema. The authors still present the folkloric, pharmacological and clinical aspects related to the tocandiras stings, a very interesting family of ants, which presents the largest and more venomous ants of the world.A partir de um acidente causado pela picada de uma formiga falsa tocandira na mão de um pescador amador, os autores descrevem os achados clínicos locais observados, tais como edema, eritema e dor excruciante e a evolução do envenenamento, que cursou com fenômenos sistêmicos imediatos, como sudorese fria, náuseas, vômitos, mal estar, taquicardia e linfadenopatia axilar à esquerda. Após três horas, a dor intensa persistia e o paciente apresentou um episódio de hematoquesia, sem história anterior de enfermidades do trato digestivo, hematológicas ou vasculares. O uso de analgésicos (Tramal® 300 mg/dia, água quente e gelo não melhorou a dor, que arrefeceu em oito horas, tendo permanecido por cerca de 24 horas. São apresentados ainda os aspectos folclóricos, farmacológicos e clínicos relacionados às picadas de tocandiras.

  2. Influence of toxic bait type and starvation on worker and queen mortality in laboratory colonies of Argentine ant (Hymenoptera: Formicidae).

    Science.gov (United States)

    Mathieson, Melissa; Toft, Richard; Lester, Philip J

    2012-08-01

    The efficacy of toxic baits should be judged by their ability to kill entire ant colonies, including the colony queen or queens. We studied the efficacy of four toxic baits to the Argentine ant, Linepithema humile (Mayr) (Hymenoptera: Formicidae). These baits were Xstinguish that has the toxicant fipronil, Exterm-an-Ant that contains both boric acid and sodium borate, and Advion ant gel and Advion ant bait arena that both have indoxacarb. Experimental nests contained 300 workers and 10 queen ants that were starved for either 24 or 48 h before toxic bait exposure. The efficacy of the toxic baits was strongly influenced by starvation. In no treatment with 24-h starvation did we observe 100% worker death. After 24-h starvation three of the baits did not result in any queen deaths, with only Exterm-an-Ant producing an average of 25% mortality. In contrast, 100% queen and worker mortality was observed in colonies starved for 48 h and given Xstinguish or Exterm-an-Ant. The baits Advion ant gel and Advion ant bait arena were not effective against Argentine ants in these trials, resulting in ants are likely to be starved. Our results suggest queen mortality must be assessed in tests for toxic bait efficacy. Our data indicate that of these four baits, Xstinguish and Exterm-an-Ant are the best options for control of Argentine ants in New Zealand.

  3. Unraveling Trichoderma species in the attine ant environment: description of three new taxa.

    Science.gov (United States)

    Montoya, Quimi Vidaurre; Meirelles, Lucas Andrade; Chaverri, Priscila; Rodrigues, Andre

    2016-05-01

    Fungus-growing "attine" ants forage diverse substrates to grow fungi for food. In addition to the mutualistic fungal partner, the colonies of these insects harbor a rich microbiome composed of bacteria, filamentous fungi and yeasts. Previous work reported some Trichoderma species in the fungus gardens of leafcutter ants. However, no studies systematically addressed the putative association of Trichoderma with attine ants, especially in non-leafcutter ants. Here, a total of 62 strains of Trichoderma were analyzed using three molecular markers (ITS, tef1 and rpb2). In addition, 30 out of 62 strains were also morphologically examined. The strains studied correspond to the largest sampling carried out so far for Trichoderma in the attine ant environment. Our results revealed the richness of Trichoderma in this environment, since we found 20 Trichoderma species, including three new taxa described in the present work (Trichoderma attinorum, Trichoderma texanum and Trichoderma longifialidicum spp. nov.) as well as a new phylogenetic taxon (LESF 545). Moreover, we show that all 62 strains grouped within different clades across the Trichoderma phylogeny, which are identical or closely related to strains derived from several other environments. This evidence supports the transient nature of the genus Trichoderma in the attine ant colonies. The discovery of three new species suggests that the dynamic foraging behavior of these insects might be responsible for accumulation of transient fungi into their colonies, which might hold additional fungal taxa still unknown to science.

  4. Arboreal Ants Use the “Velcro® Principle” to Capture Very Large Prey

    Science.gov (United States)

    Dejean, Alain; Leroy, Céline; Corbara, Bruno; Roux, Olivier; Céréghino, Régis; Orivel, Jérôme; Boulay, Raphaël

    2010-01-01

    Plant-ants live in a mutualistic association with host plants known as “myrmecophytes” that provide them with a nesting place and sometimes with extra-floral nectar (EFN) and/or food bodies (FBs); the ants can also attend sap-sucking Hemiptera for their honeydew. In return, plant-ants, like most other arboreal ants, protect their host plants from defoliators. To satisfy their nitrogen requirements, however, some have optimized their ability to capture prey in the restricted environment represented by the crowns of trees by using elaborate hunting techniques. In this study, we investigated the predatory behavior of the ant Azteca andreae which is associated with the myrmecophyte Cecropia obtusa. We noted that up to 8350 ant workers per tree hide side-by-side beneath the leaf margins of their host plant with their mandibles open, waiting for insects to alight. The latter are immediately seized by their extremities, and then spread-eagled; nestmates are recruited to help stretch, carve up and transport prey. This group ambush hunting technique is particularly effective when the underside of the leaves is downy, as is the case for C. obtusa. In this case, the hook-shaped claws of the A. andreae workers and the velvet-like structure of the underside of the leaves combine to act like natural Velcro® that is reinforced by the group ambush strategy of the workers, allowing them to capture prey of up to 13,350 times the mean weight of a single worker. PMID:20593032

  5. Repeated evolution of fungal cultivar specificity in independently evolved ant-plant-fungus symbioses.

    Science.gov (United States)

    Blatrix, Rumsaïs; Debaud, Sarah; Salas-Lopez, Alex; Born, Céline; Benoit, Laure; McKey, Doyle B; Attéké, Christiane; Djiéto-Lordon, Champlain

    2013-01-01

    Some tropical plant species possess hollow structures (domatia) occupied by ants that protect the plant and in some cases also provide it with nutrients. Most plant-ants tend patches of chaetothyrialean fungi within domatia. In a few systems it has been shown that the ants manure the fungal patches and use them as a food source, indicating agricultural practices. However, the identity of these fungi has been investigated only in a few samples. To examine the specificity and constancy of ant-plant-fungus interactions we characterised the content of fungal patches in an extensive sampling of three ant-plant symbioses (Petalomyrmex phylax/Leonardoxa africana subsp. africana, Aphomomyrmex afer/Leonardoxa africana subsp. letouzeyi and Tetraponera aethiops/Barteria fistulosa) by sequencing the Internal Transcribed Spacers of ribosomal DNA. For each system the content of fungal patches was constant over individuals and populations. Each symbiosis was associated with a specific, dominant, primary fungal taxon, and to a lesser extent, with one or two specific secondary taxa, all of the order Chaetothyriales. A single fungal patch sometimes contained both a primary and a secondary taxon. In one system, two founding queens were found with the primary fungal taxon only, one that was shown in a previous study to be consumed preferentially. Because the different ant-plant symbioses studied have evolved independently, the high specificity and constancy we observed in the composition of the fungal patches have evolved repeatedly. Specificity and constancy also characterize other cases of agriculture by insects.

  6. Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants.

    Science.gov (United States)

    Marín, Linda; Perfecto, Ivette

    2013-04-01

    Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

  7. Social isolation and brain development in the ant Camponotus floridanus.

    Science.gov (United States)

    Seid, Marc A; Junge, Erich

    2016-06-01

    Social interactions play a key role in the healthy development of social animals and are most pronounced in species with complex social networks. When developing offspring do not receive proper social interaction, they show developmental impairments. This effect is well documented in mammalian species but controversial in social insects. It has been hypothesized that the enlargement of the mushroom bodies, responsible for learning and memory, observed in social insects is needed for maintaining the large social networks and/or task allocation. This study examines the impact of social isolation on the development of mushroom bodies of the ant Camponotus floridanus. Ants raised in isolation were shown to exhibit impairment in the growth of the mushroom bodies as well as behavioral differences when compared to ants raised in social groups. These results indicate that social interaction is necessary for the proper development of C. floridanus mushroom bodies.

  8. Social isolation and brain development in the ant Camponotus floridanus

    Science.gov (United States)

    Seid, Marc A.; Junge, Erich

    2016-06-01

    Social interactions play a key role in the healthy development of social animals and are most pronounced in species with complex social networks. When developing offspring do not receive proper social interaction, they show developmental impairments. This effect is well documented in mammalian species but controversial in social insects. It has been hypothesized that the enlargement of the mushroom bodies, responsible for learning and memory, observed in social insects is needed for maintaining the large social networks and/or task allocation. This study examines the impact of social isolation on the development of mushroom bodies of the ant Camponotus floridanus. Ants raised in isolation were shown to exhibit impairment in the growth of the mushroom bodies as well as behavioral differences when compared to ants raised in social groups. These results indicate that social interaction is necessary for the proper development of C. floridanus mushroom bodies.

  9. Nutrition mediates the expression of cultivar-farmer conflict in a fungus-growing ant.

    Science.gov (United States)

    Shik, Jonathan Z; Gomez, Ernesto B; Kooij, Pepijn W; Santos, Juan C; Wcislo, William T; Boomsma, Jacobus J

    2016-09-06

    Attine ants evolved farming 55-60 My before humans. Although evolutionarily derived leafcutter ants achieved industrial-scale farming, extant species from basal attine genera continue to farm loosely domesticated fungal cultivars capable of pursuing independent reproductive interests. We used feeding experiments with the basal attine Mycocepurus smithii to test whether reproductive allocation conflicts between farmers and cultivars constrain crop yield, possibly explaining why their mutualism has remained limited in scale and productivity. Stoichiometric and geometric framework approaches showed that carbohydrate-rich substrates maximize growth of both edible hyphae and inedible mushrooms, but that modest protein provisioning can suppress mushroom formation. Worker foraging was consistent with maximizing long-term cultivar performance: ant farmers could neither increase carbohydrate provisioning without cultivars allocating the excess toward mushroom production, nor increase protein provisioning without compromising somatic cultivar growth. Our results confirm that phylogenetically basal attine farming has been very successful over evolutionary time, but that unresolved host-symbiont conflict may have precluded these wild-type symbioses from rising to ecological dominance. That status was achieved by the evolutionarily derived leafcutter ants following full domestication of a coevolving cultivar 30-35 Mya after the first attine ants committed to farming.

  10. Visualization of Metabolic Interaction Networks in Microbial Communities Using VisANT 5.0.

    Directory of Open Access Journals (Sweden)

    Brian R Granger

    2016-04-01

    Full Text Available The complexity of metabolic networks in microbial communities poses an unresolved visualization and interpretation challenge. We address this challenge in the newly expanded version of a software tool for the analysis of biological networks, VisANT 5.0. We focus in particular on facilitating the visual exploration of metabolic interaction between microbes in a community, e.g. as predicted by COMETS (Computation of Microbial Ecosystems in Time and Space, a dynamic stoichiometric modeling framework. Using VisANT's unique metagraph implementation, we show how one can use VisANT 5.0 to explore different time-dependent ecosystem-level metabolic networks. In particular, we analyze the metabolic interaction network between two bacteria previously shown to display an obligate cross-feeding interdependency. In addition, we illustrate how a putative minimal gut microbiome community could be represented in our framework, making it possible to highlight interactions across multiple coexisting species. We envisage that the "symbiotic layout" of VisANT can be employed as a general tool for the analysis of metabolism in complex microbial communities as well as heterogeneous human tissues. VisANT is freely available at: http://visant.bu.edu and COMETS at http://comets.bu.edu.

  11. Visualization of Metabolic Interaction Networks in Microbial Communities Using VisANT 5.0.

    Science.gov (United States)

    Granger, Brian R; Chang, Yi-Chien; Wang, Yan; DeLisi, Charles; Segrè, Daniel; Hu, Zhenjun

    2016-04-01

    The complexity of metabolic networks in microbial communities poses an unresolved visualization and interpretation challenge. We address this challenge in the newly expanded version of a software tool for the analysis of biological networks, VisANT 5.0. We focus in particular on facilitating the visual exploration of metabolic interaction between microbes in a community, e.g. as predicted by COMETS (Computation of Microbial Ecosystems in Time and Space), a dynamic stoichiometric modeling framework. Using VisANT's unique metagraph implementation, we show how one can use VisANT 5.0 to explore different time-dependent ecosystem-level metabolic networks. In particular, we analyze the metabolic interaction network between two bacteria previously shown to display an obligate cross-feeding interdependency. In addition, we illustrate how a putative minimal gut microbiome community could be represented in our framework, making it possible to highlight interactions across multiple coexisting species. We envisage that the "symbiotic layout" of VisANT can be employed as a general tool for the analysis of metabolism in complex microbial communities as well as heterogeneous human tissues. VisANT is freely available at: http://visant.bu.edu and COMETS at http://comets.bu.edu.

  12. An ant colony based resilience approach to cascading failures in cluster supply network

    Science.gov (United States)

    Wang, Yingcong; Xiao, Renbin

    2016-11-01

    Cluster supply chain network is a typical complex network and easily suffers cascading failures under disruption events, which is caused by the under-load of enterprises. Improving network resilience can increase the ability of recovery from cascading failures. Social resilience is found in ant colony and comes from ant's spatial fidelity zones (SFZ). Starting from the under-load failures, this paper proposes a resilience method to cascading failures in cluster supply chain network by leveraging on social resilience of ant colony. First, the mapping between ant colony SFZ and cluster supply chain network SFZ is presented. Second, a new cascading model for cluster supply chain network is constructed based on under-load failures. Then, the SFZ-based resilience method and index to cascading failures are developed according to ant colony's social resilience. Finally, a numerical simulation and a case study are used to verify the validity of the cascading model and the resilience method. Experimental results show that, the cluster supply chain network becomes resilient to cascading failures under the SFZ-based resilience method, and the cluster supply chain network resilience can be enhanced by improving the ability of enterprises to recover and adjust.

  13. Giant ants and their shape: revealing relationships in the genus Titanomyrma with geometric morphometrics

    Directory of Open Access Journals (Sweden)

    Julian Katzke

    2018-01-01

    Full Text Available Shape is a natural phenomenon inherent to many different lifeforms. A modern technique to analyse shape is geometric morphometrics (GM, which offers a whole range of methods concerning the pure shape of an object. The results from these methods have provided new insights into biological problems and have become especially useful in the fields of entomology and palaeontology. Despite the conspicuous successes in other hymenopteran groups, GM analysis of wings and fossil wings of Formicidae has been neglected. Here we tested if landmarks defining the wing shape of fossil ants that belong to the genus Titanomyrma are reliable and if this technique is able to expose relationships among different groups of the largest Hymenoptera that ever lived. This study comprises 402 wings from 362 ants that were analysed and assigned with the GM methods linear discriminant function analysis, principal component analysis, canonical variate analysis, and regression. The giant ant genus Titanomyrma and the parataxon Formicium have different representatives that are all very similar but these modern methods were able to distinguish giant ant types even to the level of the sex. Thirty-five giant ant specimens from the Eckfeld Maar were significantly differentiable from a collection of Messel specimens that consisted of 187 Titanomyrma gigantea females and 42 T. gigantea males, and from 74 Titanomyrma simillima females and 21 T. simillima males. Out of the 324 Messel ants, 127 are newly assigned to a species and 223 giant ants are newly assigned to sex with GM analysis. All specimens from Messel fit to the two species. Moreover, shape affinities of these groups and the species Formicium brodiei, Formicium mirabile, and Formicium berryi, which are known only from wings, were investigated. T. gigantea stands out with a possible female relative in one of the Eckfeld specimens whereas the other groups show similar shape patterns that are possibly plesiomorphic. Formicidae

  14. Giant ants and their shape: revealing relationships in the genus Titanomyrma with geometric morphometrics.

    Science.gov (United States)

    Katzke, Julian; Barden, Phillip; Dehon, Manuel; Michez, Denis; Wappler, Torsten

    2018-01-01

    Shape is a natural phenomenon inherent to many different lifeforms. A modern technique to analyse shape is geometric morphometrics (GM), which offers a whole range of methods concerning the pure shape of an object. The results from these methods have provided new insights into biological problems and have become especially useful in the fields of entomology and palaeontology. Despite the conspicuous successes in other hymenopteran groups, GM analysis of wings and fossil wings of Formicidae has been neglected. Here we tested if landmarks defining the wing shape of fossil ants that belong to the genus Titanomyrma are reliable and if this technique is able to expose relationships among different groups of the largest Hymenoptera that ever lived. This study comprises 402 wings from 362 ants that were analysed and assigned with the GM methods linear discriminant function analysis, principal component analysis, canonical variate analysis, and regression. The giant ant genus Titanomyrma and the parataxon Formicium have different representatives that are all very similar but these modern methods were able to distinguish giant ant types even to the level of the sex. Thirty-five giant ant specimens from the Eckfeld Maar were significantly differentiable from a collection of Messel specimens that consisted of 187 Titanomyrma gigantea females and 42 T. gigantea males, and from 74 Titanomyrma simillima females and 21 T. simillima males. Out of the 324 Messel ants, 127 are newly assigned to a species and 223 giant ants are newly assigned to sex with GM analysis. All specimens from Messel fit to the two species. Moreover, shape affinities of these groups and the species Formicium brodiei , Formicium mirabile , and Formicium berryi , which are known only from wings, were investigated. T. gigantea stands out with a possible female relative in one of the Eckfeld specimens whereas the other groups show similar shape patterns that are possibly plesiomorphic. Formicidae are one of the

  15. Phengaris (Maculinea) teleius butterflies select host plants close to Myrmica ants for oviposition, but P. nausithous do not

    NARCIS (Netherlands)

    Wynhoff, Irma; Langevelde, van Frank

    2017-01-01

    Many lycaenid butterfly species have interactions with ants, with 12% obligatorily depending on two sequential sources of larval food, namely host plants and host ants. When host plants are abundant but the density of host ant nests is relatively low, most host plants have no host ant nest in their

  16. Flexible Job Shop Scheduling Problem Using an Improved Ant Colony Optimization

    Directory of Open Access Journals (Sweden)

    Lei Wang

    2017-01-01

    Full Text Available As an extension of the classical job shop scheduling problem, the flexible job shop scheduling problem (FJSP plays an important role in real production systems. In FJSP, an operation is allowed to be processed on more than one alternative machine. It has been proven to be a strongly NP-hard problem. Ant colony optimization (ACO has been proven to be an efficient approach for dealing with FJSP. However, the basic ACO has two main disadvantages including low computational efficiency and local optimum. In order to overcome these two disadvantages, an improved ant colony optimization (IACO is proposed to optimize the makespan for FJSP. The following aspects are done on our improved ant colony optimization algorithm: select machine rule problems, initialize uniform distributed mechanism for ants, change pheromone’s guiding mechanism, select node method, and update pheromone’s mechanism. An actual production instance and two sets of well-known benchmark instances are tested and comparisons with some other approaches verify the effectiveness of the proposed IACO. The results reveal that our proposed IACO can provide better solution in a reasonable computational time.

  17. Evaluation Toolbox: Ex-Ante Impact Assessment and Value Network Analysis for SI

    NARCIS (Netherlands)

    Dhondt, S.; Ven, H. van de; Cressey, P.; Kaderabkova, A.; Luna, Á.; Moghadam Saman, S.; Castro Spila, J.; Ziauberyte, R.; Torre, W. van der; Terstriep, J.

    2016-01-01

    This report contains a toolbox for use with the Ex-Ante Impact Assessment for social innovations as was developed in the report D7.1. This toolbox proposes a series of convenient and useful tools to apply in an ex-ante assessment of social innovation within SIMPACT's policy areas unemployment,

  18. The life of a dead ant -the expression of an adaptive extended phenotype

    DEFF Research Database (Denmark)

    Andersen, Sandra Breum; Gerritsma, Sylvia; Yusah, Kalsum M.

    2009-01-01

    to make hosts bite onto vegetation prior to killing them. We show that this represents a fine-tuned fungal adaptation: an extended phenotype. Dead ants were found under leaves, attached by their mandibles, on the northern side of saplings ca. 25 cm above the soil, where temperature and humidity conditions......Specialized parasites are expected to express complex adaptations to their hosts. Manipulation of host behavior is such an adaptation. We studied the fungus Ophiocordyceps unilateralis, a locally specialized parasite of arboreal Camponotus leonardi ants. Ant-infecting Ophiocordyceps are known...

  19. How many gamergates is an ant queen worth?

    Science.gov (United States)

    Monnin, Thibaud; Peeters, Christian

    2008-02-01

    Ant reproductives exhibit different morphological adaptations linked to dispersal and fertility. By reviewing the literature on taxa where workers can reproduce sexually (i.e. become gamergates) we show that (1) species with a single gamergate generally have lost the winged queen caste, whereas only half of the species with several gamergates have, and (2) single-gamergate species have smaller colonies than multiple-gamergate species. Comparison with “classical” ants without gamergates, where having one vs having several winged queens are two distinct syndromes, suggests that having one vs having several gamergates are not. Gamergate number does not affect the success of colony fission, but retention of the queen caste permits the option of independent foundation.

  20. Community analysis of microbial sharing and specialization in a Costa Rican ant-plant-hemipteran symbiosis.

    Science.gov (United States)

    Pringle, Elizabeth G; Moreau, Corrie S

    2017-03-15

    Ants have long been renowned for their intimate mutualisms with trophobionts and plants and more recently appreciated for their widespread and diverse interactions with microbes. An open question in symbiosis research is the extent to which environmental influence, including the exchange of microbes between interacting macroorganisms, affects the composition and function of symbiotic microbial communities. Here we approached this question by investigating symbiosis within symbiosis. Ant-plant-hemipteran symbioses are hallmarks of tropical ecosystems that produce persistent close contact among the macroorganism partners, which then have substantial opportunity to exchange symbiotic microbes. We used metabarcoding and quantitative PCR to examine community structure of both bacteria and fungi in a Neotropical ant-plant-scale-insect symbiosis. Both phloem-feeding scale insects and honeydew-feeding ants make use of microbial symbionts to subsist on phloem-derived diets of suboptimal nutritional quality. Among the insects examined here, Cephalotes ants and pseudococcid scale insects had the most specialized bacterial symbionts, whereas Azteca ants appeared to consume or associate with more fungi than bacteria, and coccid scale insects were associated with unusually diverse bacterial communities. Despite these differences, we also identified apparent sharing of microbes among the macro-partners. How microbial exchanges affect the consumer-resource interactions that shape the evolution of ant-plant-hemipteran symbioses is an exciting question that awaits further research. © 2017 The Author(s).

  1. Sampling efficacy for the red imported fire ant Solenopsis invicta (Hymenoptera: Formicidae).

    Science.gov (United States)

    Stringer, Lloyd D; Suckling, David Maxwell; Baird, David; Vander Meer, Robert K; Christian, Sheree J; Lester, Philip J

    2011-10-01

    Cost-effective detection of invasive ant colonies before establishment in new ranges is imperative for the protection of national borders and reducing their global impact. We examined the sampling efficiency of food-baits and pitfall traps (baited and nonbaited) in detecting isolated red imported fire ant (Solenopsis invicta Buren) nests in multiple environments in Gainesville, FL. Fire ants demonstrated a significantly higher preference for a mixed protein food type (hotdog or ground meat combined with sweet peanut butter) than for the sugar or water baits offered. Foraging distance success was a function of colony size, detection trap used, and surveillance duration. Colony gyne number did not influence detection success. Workers from small nests (0- to 15-cm mound diameter) traveled no >3 m to a food source, whereas large colonies (>30-cm mound diameter) traveled up to 17 m. Baited pitfall traps performed best at detecting incipient ant colonies followed by nonbaited pitfall traps then food baits, whereas food baits performed well when trying to detect large colonies. These results were used to create an interactive model in Microsoft Excel, whereby surveillance managers can alter trap type, density, and duration parameters to estimate the probability of detecting specified or unknown S. invicta colony sizes. This model will support decision makers who need to balance the sampling cost and risk of failure to detect fire ant colonies.

  2. Amb M. Antònia Canals al Nepal de Viki Sherpa

    OpenAIRE

    Siqués, Carina

    1999-01-01

    Relació del viatge fet per la Maria Antònia Canals a Nepal amb motiu de l’acte de celebració de la signatura del conveni de col·laboració entre la Universitat de Tribhuvan a Katmandu i la Universitat de Vic per crear el centre de formació del professorat d’infantil i de primària M. Antònia Canals

  3. The Life of a Dead Ant : The Expression of an Adaptive Extended Phenotype

    NARCIS (Netherlands)

    Andersen, Sandra B.; Gerritsma, Sylvia; Yusah, Kalsum M.; Mayntz, David; Hywel-Jones, Nigel L.; Billen, Johan; Boomsma, Jacobus J.; Hughes, David P.

    Specialized parasites are expected to express complex adaptations to their hosts. Manipulation of host behavior is such an adaptation. We studied the fungus Ophiocordyceps unilateralis, a locally specialized parasite of arboreal Camponotus leonardi ants. Ant-infecting Ophiocordyceps are known to

  4. Nest etiquette--where ants go when nature calls.

    Directory of Open Access Journals (Sweden)

    Tomer J Czaczkes

    Full Text Available Sanitary behaviour is an important, but seldom studied, aspect of social living. Social insects have developed several strategies for dealing with waste and faecal matter, including dumping waste outside the nest and forming specialised waste-storage chambers. In some cases waste material and faeces are put to use, either as a construction material or as a long-lasting signal, suggesting that faeces and waste may not always be dangerous. Here we examine a previously undescribed behaviour in ants - the formation of well-defined faecal patches. Lasius niger ants were housed in plaster nests and provided with coloured sucrose solution. After two months, 1-4 well defined dark patches, the colour of the sucrose solution, formed within each of the plaster nests. These patches never contained other waste material such as uneaten food items, or nestmate corpses. Such waste was collected in waste piles outside the nest. The coloured patches were thus distinct from previously described 'kitchen middens' in ants, and are best described as 'toilets'. Why faeces is not removed with other waste materials is unclear. The presence of the toilets inside the nest suggests that they may not be an important source of pathogens, and may have a beneficial role.

  5. Rationality in collective decision-making by ant colonies.

    Science.gov (United States)

    Edwards, Susan C; Pratt, Stephen C

    2009-10-22

    Economic models of animal behaviour assume that decision-makers are rational, meaning that they assess options according to intrinsic fitness value and not by comparison with available alternatives. This expectation is frequently violated, but the significance of irrational behaviour remains controversial. One possibility is that irrationality arises from cognitive constraints that necessitate short cuts like comparative evaluation. If so, the study of whether and when irrationality occurs can illuminate cognitive mechanisms. We applied this logic in a novel setting: the collective decisions of insect societies. We tested for irrationality in colonies of Temnothorax ants choosing between two nest sites that varied in multiple attributes, such that neither site was clearly superior. In similar situations, individual animals show irrational changes in preference when a third relatively unattractive option is introduced. In contrast, we found no such effect in colonies. We suggest that immunity to irrationality in this case may result from the ants' decentralized decision mechanism. A colony's choice does not depend on site comparison by individuals, but instead self-organizes from the interactions of multiple ants, most of which are aware of only a single site. This strategy may filter out comparative effects, preventing systematic errors that would otherwise arise from the cognitive limitations of individuals.

  6. Bioturbation by the Fungus-Gardening Ant, Trachymyrmex septentrionalis.

    Directory of Open Access Journals (Sweden)

    Walter R Tschinkel

    Full Text Available Soil invertebrates such as ants are thought to be important manipulators of soils in temperate and tropical ecosystems. The fungus gardening ant, Trachymyrmex septentrionalis, is an important agent of biomantling, that is, of depositing soil excavated from below onto the surface, and has been suggested as an agent of bioturbation (moving soil below ground as well. The amount of bioturbation by this ant was quantified by planting queenright colonies in sand columns consisting of 5 layers of different colored sand. The amount of each color of sand deposited on the surface was determined from April to November 2015. In November, colonies were excavated and the color and amount of sand deposited below ground (mostly as backfill in chambers was determined. Extrapolated to one ha, T. septentrionalis deposited 800 kg of sand per annum on the surface, and an additional 200 kg (17% of the total excavated below ground. On average, this mixes 1.3% of the sand from other layers within the top meter of soil per millennium, but this mixing is unlikely to be homogeneous, and probably occurs as "hotspots" in both horizontal and vertical space. Such mixing is discussed as a challenge to sediment dating by optically stimulated luminescence (OSL.

  7. Identifying the transition between single and multiple mating of queens in fungus-growing ants

    DEFF Research Database (Denmark)

    Villesen, Palle; Murakami, Takahiro; Schultz, Ted R

    2002-01-01

    Obligate mating of females (queens) with multiple males has evolved only rarely in social Hymenoptera (ants, social bees, social wasps) and for reasons that are fundamentally different from those underlying multiple mating in other animals. The monophyletic tribe of ('attine') fungus-growing ants...... is known to include evolutionarily derived genera with obligate multiple mating (the Acromyrmex and Atta leafcutter ants) as well as phylogenetically basal genera with exclusively single mating (e.g. Apterostigma, Cyphomyrmex, Myrmicocrypta). All attine genera share the unique characteristic of obligate...... dependence on symbiotic fungus gardens for food, but the sophistication of this symbiosis differs considerably across genera. The lower attine genera generally have small, short-lived colonies and relatively non-specialized fungal symbionts (capable of living independently of their ant hosts), whereas...

  8. Significance of chemical recognition cues is context dependent in ants

    DEFF Research Database (Denmark)

    Bos, N.; Guerrieri, F.J.; d'Ettorre, P.

    2010-01-01

    signatures, composed primarily of long-chain cuticular hydrocarbons. These signatures are colony specific and allow discrimination between nestmates and non-nestmates. Nevertheless, the mechanisms underlying detection, perception and information processing of chemical signatures are poorly understood. It has...... context, affects aggression against non-nestmates carrying the hydrocarbon profile associated with food. Individual ant workers were able to associate the non-nestmate chemical profile with food. However, conditioned ants were still aggressive when encountering a non-nestmate carrying the odour profile...

  9. Fidelity-Based Ant Colony Algorithm with Q-learning of Quantum System

    Science.gov (United States)

    Liao, Qin; Guo, Ying; Tu, Yifeng; Zhang, Hang

    2018-03-01

    Quantum ant colony algorithm (ACA) has potential applications in quantum information processing, such as solutions of traveling salesman problem, zero-one knapsack problem, robot route planning problem, and so on. To shorten the search time of the ACA, we suggest the fidelity-based ant colony algorithm (FACA) for the control of quantum system. Motivated by structure of the Q-learning algorithm, we demonstrate the combination of a FACA with the Q-learning algorithm and suggest the design of a fidelity-based ant colony algorithm with the Q-learning to improve the performance of the FACA in a spin-1/2 quantum system. The numeric simulation results show that the FACA with the Q-learning can efficiently avoid trapping into local optimal policies and increase the speed of convergence process of quantum system.

  10. A review of myrmecophily in ant nest beetles (Coleoptera: Carabidae: Paussinae): linking early observations with recent findings

    Science.gov (United States)

    Geiselhardt, Stefanie F.; Peschke, Klaus; Nagel, Peter

    2007-11-01

    Myrmecophily provides various examples of how social structures can be overcome to exploit vast and well-protected resources. Ant nest beetles (Paussinae) are particularly well suited for ecological and evolutionary considerations in the context of association with ants because life habits within the subfamily range from free-living and predatory in basal taxa to obligatory myrmecophily in derived Paussini. Adult Paussini are accepted in the ant society, although parasitising the colony by preying on ant brood. Host species mainly belong to the ant families Myrmicinae and Formicinae, but at least several paussine genera are not host-specific. Morphological adaptations, such as special glands and associated tufts of hair (trichomes), characterise Paussini as typical myrmecophiles and lead to two different strategical types of body shape: while certain Paussini rely on the protective type with less exposed extremities, other genera access ant colonies using glandular secretions and trichomes (symphile type). We compare these adaptations with other taxonomic groups of insects by joining contemporary research and early sources and discuss the possibility of an attracting or appeasing effect of the secretion. Species that are ignored by their host ants might use chemical mimicry instead. Furthermore, vibrational signals may contribute to ant-beetle communication, and chemical signals have proven to play a role in host finding. The powerful defense chemistry of paussines as “bombardier beetles” is not used in contact with host ants. We attempt to trace the evolution of myrmecophily in paussines by reviewing important aspects of the association between paussine beetles and ants, i.e. morphological and potential chemical adaptations, life cycle, host specificity, alimentation, parasitism and sound production.

  11. Divergent chemical cues elicit seed collecting by ants in an obligate multi-species mutualism in lowland Amazonia.

    Directory of Open Access Journals (Sweden)

    Elsa Youngsteadt

    2010-12-01

    Full Text Available In lowland Amazonian rainforests, specific ants collect seeds of several plant species and cultivate them in arboreal carton nests, forming species-specific symbioses called ant-gardens (AGs. In this obligate mutualism, ants depend on the plants for nest stability and the plants depend on ant nests for substrate and nutrients. AG ants and plants are abundant, dominant members of lowland Amazonian ecosystems, but the cues ants use to recognize the seeds are poorly understood. To address the chemical basis of the ant-seed interaction, we surveyed seed chemistry in nine AG species and eight non-AG congeners. We detected seven phenolic and terpenoid volatiles common to seeds of all or most of the AG species, but a blend of the shared compounds was not attractive to the AG ant Camponotus femoratus. We also analyzed seeds of three AG species (Anthurium gracile, Codonanthe uleana, and Peperomia macrostachya using behavior-guided fractionation. At least one chromatographic fraction of each seed extract elicited retrieval behavior in C. femoratus, but the active fractions of the three plant species differed in polarity and chemical composition, indicating that shared compounds alone did not explain seed-carrying behavior. We suggest that the various AG seed species must elicit seed-carrying with different chemical cues.

  12. Foraging of Psilocybe basidiocarps by the leaf-cutting ant Acromyrmex lobicornis in Santa Fé, Argentina.

    Science.gov (United States)

    Masiulionis, Virginia E; Weber, Roland Ws; Pagnocca, Fernando C

    2013-12-01

    It is generally accepted that material collected by leaf-cutting ants of the genus Acromyrmex consists solely of plant matter, which is used in the nest as substrate for a symbiotic fungus providing nutrition to the ants. There is only one previous report of any leaf-cutting ant foraging directly on fungal basidiocarps. Basidiocarps of Psilocybe coprophila growing on cow dung were actively collected by workers of Acromyrmex lobicornis in Santa Fé province, Argentina. During this behaviour the ants displayed typical signals of recognition and continuously recruited other foragers to the task. Basidiocarps of different stages of maturity were being transported into the nest by particular groups of workers, while other workers collected plant material. The collection of mature basidiocarps with viable spores by leaf-cutting ants in nature adds substance to theories relating to the origin of fungiculture in these highly specialized social insects.

  13. ANTES DE QUE ANOCHEZCA. DERECHOS HUMANOS Y CLASES MEDIAS EN ARGENTINA ANTES Y EN LOS INICIOS DEL GOLPE DE ESTADO DE 1976

    Directory of Open Access Journals (Sweden)

    Sebastián CARASSAI

    2010-01-01

    Full Text Available En este trabajo se analiza el tema de los derechos humanos en Argentina antes y durante el comienzo del golpe de Estado de 1976 (1970-1977. Se argumenta que la inexistencia de una conciencia social sobre tales derechos en la primera mitad de la década y el temprano y extendido consenso en torno a lo que más tarde se llamará «teoría de los dos demonios» son dos elementos fundamentales a la hora de explicar la actitud de las clases medias no radicalizadas políticamente ante el surgimiento del discurso de los derechos humanos en Argentina.

  14. Mathematical modeling on obligate mutualism: Interactions between leaf-cutter ants and their fungus garden.

    Science.gov (United States)

    Kang, Yun; Clark, Rebecca; Makiyama, Michael; Fewell, Jennifer

    2011-11-21

    We propose a simple mathematical model by applying Michaelis-Menton equations of enzyme kinetics to study the mutualistic interaction between the leaf cutter ant and its fungus garden at the early stage of colony expansion. We derive sufficient conditions on the extinction and coexistence of these two species. In addition, we give a region of initial condition that leads to the extinction of two species when the model has an interior attractor. Our global analysis indicates that the division of labor by worker ants and initial conditions are two important factors that determine whether leaf cutter ants' colonies and their fungus garden can survive and grow or not. We validate the model by comparing model simulations and data on fungal and ant colony growth rates under laboratory conditions. We perform sensitive analysis of the model based on the experimental data to gain more biological insights on ecological interactions between leaf-cutter ants and their fungus garden. Finally, we give conclusions and discuss potential future work. Published by Elsevier Ltd.

  15. Comparative Immature Morphology of Brazilian Fire Ants (Hymenoptera: Formicidae: Solenopsis

    Directory of Open Access Journals (Sweden)

    Eduardo Gonçalves Paterson Fox

    2012-01-01

    Full Text Available Although common in Brazil, the biology of the fire ant Solenopsis saevissima (Smith is still poorly studied. Larval descriptions are useful to genus-level ant systematics and sometimes to species-level taxonomy. This study presents a detailed description of juveniles of S. saevissima from Brazil, which were compared with Brazilian specimens of Solenopsis invicta Buren, Solenopsis geminata (Fabricius, and Solenopsis altipunctata Pitts. Different larval instars were separated by diagnostic morphological traits which were confirmed by observing moults. Reproductive larvae could be easily sorted by their distinctive body dimensions and shape. Contrary to previous reports on this species, the larvae of S. saevissima proved to be generally identical to those of S. invicta, while a few specimens resembled those of other close species, such as Solenopsis megergates Trager. Mature larvae thus presented considerable intraspecific variation in some characters recently proposed to aid fire ant species separation (morphology of head hairs.

  16. Effective ANT based Routing Algorithm for Data Replication in MANETs

    Directory of Open Access Journals (Sweden)

    N.J. Nithya Nandhini

    2013-12-01

    Full Text Available In mobile ad hoc network, the nodes often move and keep on change its topology. Data packets can be forwarded from one node to another on demand. To increase the data accessibility data are replicated at nodes and made as sharable to other nodes. Assuming that all mobile host cooperative to share their memory and allow forwarding the data packets. But in reality, all nodes do not share the resources for the benefits of others. These nodes may act selfishly to share memory and to forward the data packets. This paper focuses on selfishness of mobile nodes in replica allocation and routing protocol based on Ant colony algorithm to improve the efficiency. The Ant colony algorithm is used to reduce the overhead in the mobile network, so that it is more efficient to access the data than with other routing protocols. This result shows the efficiency of ant based routing algorithm in the replication allocation.

  17. Application of chaotic ant swarm optimization in electric load forecasting

    International Nuclear Information System (INIS)

    Hong, W.-C.

    2010-01-01

    Support vector regression (SVR) had revealed strong potential in accurate electric load forecasting, particularly by employing effective evolutionary algorithms to determine suitable values of its three parameters. Based on previous research results, however, these employed evolutionary algorithms themselves have several drawbacks, such as converging prematurely, reaching slowly the global optimal solution, and trapping into a local optimum. This investigation presents an SVR-based electric load forecasting model that applied a novel algorithm, namely chaotic ant swarm optimization (CAS), to improve the forecasting performance by searching its suitable parameters combination. The proposed CAS combines with the chaotic behavior of single ant and self-organization behavior of ant colony in the foraging process to overcome premature local optimum. The empirical results indicate that the SVR model with CAS (SVRCAS) results in better forecasting performance than the other alternative methods, namely SVRCPSO (SVR with chaotic PSO), SVRCGA (SVR with chaotic GA), regression model, and ANN model.

  18. Mutualism, hybrid inviability and speciation in a tropical ant-plant.

    Science.gov (United States)

    Léotard, G; Saltmarsh, A; Kjellberg, F; McKey, D

    2008-07-01

    Although biotic interactions are particularly intricate in the tropics, few studies have examined whether divergent adaptations to biotic interactions lead to speciation in tropical organisms. Ant-plant mutualisms are widespread in the tropics. Within Leonardoxa africana, two subspecies present contrasting defences against herbivores. Young leaves of subsp. africana are defended by mutualistic ants, whereas subsp. gracilicaulis satiates herbivores by synchronized leaf production. Subsp. africana possesses hollow internodes and many large foliar nectaries, housing and feeding ants. We detected no genetic introgression between the two subspecies in the contact zone between them. F1 hybrids were present. They were intermediate in phenotype, expressing reduced, nonfunctional but costly myrmecophilic traits. However, they suffered more herbivory than their parents. Hybrids remained small, failing to reach reproductive size, probably due to their maladapted defence phenotype. Hence, there could be a direct link between adaptation to mutualism and reproductive isolation: biotic interactions could be a driver of tropical diversity.

  19. Biodiversity on Broadway--enigmatic diversity of the societies of ants (Formicidae on the streets of New York City.

    Directory of Open Access Journals (Sweden)

    Marko Pećarević

    2010-10-01

    Full Text Available Each year, a larger proportion of the Earth's surface is urbanized, and a larger proportion of the people on Earth lives in those urban areas. The everyday nature, however, that humans encounter in cities remains poorly understood. Here, we consider perhaps the most urban green habitat, street medians. We sampled ants from forty-four medians along three boulevards in New York City and examined how median properties affect the abundance and species richness of native and introduced ants found on them. Ant species richness varied among streets and increased with area but was independent of the other median attributes measured. Ant assemblages were highly nested, with three numerically dominant species present at all medians and additional species present at a subset of medians. The most common ant species were the introduced Pavement ant (Tetramorium caespitum and the native Thief ant (Solenopsis molesta and Cornfield ant (Lasius neoniger. The common introduced species on the medians responded differently to natural and disturbed elements of medians. Tetramorium caespitum was most abundant in small medians, with the greatest edge/area ratio, particularly if those medians had few trees, whereas Nylanderia flavipes was most abundant in the largest medians, particularly if they had more trees. Many of the species encountered in Manhattan were similar to those found in other large North American cities, such that a relatively small subset of ant species probably represent most of the encounters humans have with ants in North America.

  20. Biomimetic Ant-Nest Electrode Structures for High Sulfur Ratio Lithium-Sulfur Batteries.

    Science.gov (United States)

    Ai, Guo; Dai, Yiling; Mao, Wenfeng; Zhao, Hui; Fu, Yanbao; Song, Xiangyun; En, Yunfei; Battaglia, Vincent S; Srinivasan, Venkat; Liu, Gao

    2016-09-14

    The lithium-sulfur (Li-S) rechargeable battery has the benefit of high gravimetric energy density and low cost. Significant research currently focuses on increasing the sulfur loading and sulfur/inactive-materials ratio, to improve life and capacity. Inspired by nature's ant-nest structure, this research results in a novel Li-S electrode that is designed to meet both goals. With only three simple manufacturing-friendly steps, which include slurry ball-milling, doctor-blade-based laminate casting, and the use of the sacrificial method with water to dissolve away table salt, the ant-nest design has been successfully recreated in an Li-S electrode. The efficient capabilities of the ant-nest structure are adopted to facilitate fast ion transportation, sustain polysulfide dissolution, and assist efficient precipitation. High cycling stability in the Li-S batteries, for practical applications, has been achieved with up to 3 mg·cm(-2) sulfur loading. Li-S electrodes with up to a 85% sulfur ratio have also been achieved for the efficient design of this novel ant-nest structure.