
Sample records for ant paraponera clavata

  1. The effect of water on the ground nesting habits of the giant tropical ant, Paraponera clavata


    Elahi, Robin


    The large predatory ant, Paraponera clavata, exerts measurable top-down effects in wet and moist Neotropical forests, and therefore its distribution has potential ecological implications. To determine how water affects the presence of this important predator, the ground nesting ecology of P. clavata was examined with respect to various habitat characteristics. Four hectares of disturbed Costa Rican lowland rain forest were surveyed for ant colonies to determine nest distribution patterns in w...

  2. The effect of water on the ground nesting habits of the giant tropical ant, Paraponera clavata. (United States)

    Elahi, Robin


    The large predatory ant, Paraponera clavata, exerts measurable top-down effects in wet and moist Neotropical forests, and therefore its distribution has potential ecological implications. To determine how water affects the presence of this important predator, the ground nesting ecology of P. clavata was examined with respect to various habitat characteristics. Four hectares of disturbed Costa Rican lowland rain forest were surveyed for ant colonies to determine nest distribution patterns in wet and dry habitat; significantly more colonies were found in dry habitat. Seventeen of 19 nests built on slopes of > 5 degrees inclination were positioned on the downward side of the tree, possibly using the trunk as a shield against runoff during rain showers. Moisture and pH inside nests were significantly different from adjacent soil. These results suggest that water influences the ground nesting habits of P. clavata, thus ecological differences between comparatively wet and dry portions of tropical forests may arise from the relative abundance of this ant species.

  3. To drink or grasp? How bullet ants ( Paraponera clavata) differentiate between sugars and proteins in liquids (United States)

    Jandt, Jennifer; Larson, Hannah K.; Tellez, Peter; McGlynn, Terrence P.


    Flexibility in behavior can increase the likelihood that a forager may respond optimally in a fluctuating environment. Nevertheless, physiological or neuronal constraints may result in suboptimal responses to stimuli. We observed foraging workers of the giant tropical ant (also referred to as the "bullet ant"), Paraponera clavata, as they reacted to liquid solutions with varying concentrations of sugar and protein. We show that when protein/sucrose concentration is high, many bullet ants will often try to grasp at the droplet, rather than gather it by drinking. Because P. clavata actively hunt for prey, fixed action patterns and rapid responses to protein may be adaptively important, regardless of the medium in which it is presented. We conclude that, in P. clavata, food-handling decisions are made in response to the nutrient content of the food rather than the texture of the food. Further, we suggest that colonies that maintain a mixture of individuals with consistent fixed or flexible behavioral responses to food-handling decisions may be better adapted to fluctuating environmental conditions, and we propose future studies that could address this.

  4. A quantification of predation rates, indirect positive effects on plants, and foraging variation of the giant tropical ant, Paraponera clavata

    Directory of Open Access Journals (Sweden)

    Lee A. Dyer


    Full Text Available While a clear consensus is emerging that predators can play a major role in shaping terrestrial communities, basic natural history observations and simple quantifications of predation rates in complex terrestrial systems are lacking. The potential indirect effect of a large predatory ant, Paraponera clavata Fabricius (Formicidae: Ponerinae, on herbivores was determined on rainforest trees at La Selva Biological Station in Costa Rica and Barro Colorado Island in Panama. Prey and other food brought back to nests by 75 colonies of P. clavata were quantified, taking into account temporal, seasonal, and microhabitat variation for both foraging activity and composition of foraging booty. The dispersion and density of ant colonies and combined density with the mean amounts of prey retrieval were used to calculate rates of predation per hectare in the two forests. In addition, herbivory was measured on trees containing P. clavata and on trees where the ants were not foraging. Colonies at La Selva brought back significantly more nectar plus prey than those at Barro Colorado Island, but foraging patterns were similar in the two forests. At both forests, the ants were more active at night, and there was no significant seasonal or colonial variation in consumption of nectar, composition of foraging booty, and overall activity of the colonies. At La Selva, trees containing P. clavata colonies had the same levels of folivory as nearest neighbor trees without P. clavata but had significantly lower folivory than randomly selected trees. Predation by this ant was high in both forests, despite its omnivorous diet. This insect predator is part of potentially important top-down controls in these wet and moist forests.

  5. Distribución, mortalidad y asociación con plantas, de nidos de Paraponera clavata (Hymenoptera: Formicidae en la isla de Barro Colorado, Panamá

    Directory of Open Access Journals (Sweden)

    Rolando Pérez


    Full Text Available Se estudió la distribución, mortalidad, reclutamiento y asociación con plantas, de 308 nidos de la hormiga neotropical Paraponera clavata en una parcela de cincuenta hectáreas de bosque viejo en la isla de Barro Colorado entre septiembre de 1993 y febrero de 1995. Los nidos estaban distribuidos uniformemente a través de toda la parcela, y se asociaban de manera significativa con el tipo de hábitat, existían más nidos de los esperados en las planicies altas y en la sección de bosque más joven de la parcela. La densidad promedio era de 6.2 nidos por hectárea. Los nidos con un mayor número de vecinos entre 0 y 20 m de distancia, tenían una mayor probabilidad de morir, si se comparaban con aquéllos que se encontraban separados por distancias mayores. La mortalidad era entre 13.36 y 69.64% dependiendo del intervalo de censo, y el reclutamiento fue del 22.63 y 31.72%. Los nidos se encontraron en las bases de 84 especies de plantas, en 34 familias con cuatro categorías de forma de vida: 76 especies eran árboles, 5 especies eran arbustos, 2 especies eran palmas y 1 era liana. Ocho especies de plantas se asociaban positivamente con los nidos de la hormiga. Plantas medianas entre 8 y 63.9 cm de DAP eran las más utilizadas. Arboles y arbustos pequeños presentan muy poca asociación con los nidos. La hormiga no se asocia con árboles que tienen nectarios extraflorales. El 53% de los nidos tenían a Phrynus gervaisii (Amblypygi: Phrynidae habitando en el interior. Estos nidos presentaron menores tasas de mortalidad en comparación con el resto.We studied the distribution, mortality and association with plants, of 308 nests of the neotropical ant Paraponera clavata, in a permanent 50 hectare plot in old-growth forest on Barro Colorado island between September 1993 and February 1995. Ant nests were uniformly dispersed throughout the plot, and significantly associated with the high plateau and patch of young forest in the plot. The average

  6. ANT

    DEFF Research Database (Denmark)

    van der Duim, René; Ren, Carina Bregnholm; Jóhannesson, Gunnar Thór


    Ten years ago actor-network theory (ANT) entered this journal. To illustrate how the relational ontology and sensibilities of ANT lend themselves to particular kinds of research, we first interrogate the main controversies as a way to open up and discuss the main premises of ANT. These debates...... concern the status and agency of objects and non-humans, ANT’s denial of the explanatory power of social structures, and the political implications of ANT. Second we present ANT’s relevance for tourism studies and discuss what ANT ‘does’ in practice. After summarizing a decade of relations between ANT...... and tourism, we conclude by tracing three future trajectories of how we have ‘moved away with’ ANT into new areas of discovery....

  7. Rediscovery of Bugulella clavata Hincks 1887 (Ectoprocta)

    Digital Repository Service at National Institute of Oceanography (India)

    Menon, N.R; Nair, N.B.

    The species Bugulella clavata collected from the Krusadai island, Gulf of Mannar is redescribed Description is based on the three fragments of a colony at a depth of 5 m Redescription has helped to important features such as nature and shape...

  8. Hormigas cazadoras en sistemas productivos del piedemonte amazónico colombiano: diversidad y especies indicadoras Hunter ants in productive systems of Colombian amazon foothills: diversity and indicator species

    Directory of Open Access Journals (Sweden)

    Maria Catalina Sanabria-Blandón


    Full Text Available Para conocer la abundancia, riqueza y composición de hormigas cazadoras y su variación en los sistemas productivos del departamento de Caquetá, se seleccionaron 27 fincas representativas de tres ventanas (agroforestal, silvopastoril y tradicional, en las cuales se identificaron hasta nueve clases de usos del suelo. Las proporciones dedicadas a pastos limpios, agroforestales y rastrojos viejos, fueron las que más contribuyeron a diferenciar las ventanas. Se muestrearon cinco puntos por finca mediante cuatro métodos para captura de hormigas (TSBF, lavado de suelo con formol, escrutinio de hojarasca y búsqueda directa. De un total de 280 individuos se determinaron nueve géneros y 35 especies de las subfamilias Ectatomminae, Paraponerinae y Ponerinae; el género más diverso fue Pachycondyla con 13 especies. La abundancia de hormigas se correlacionó directamente con la riqueza de especies y con el número de especies exclusivas. La riqueza fue mayor en la ventana agroforestal (24 especies, seguida de la silvopastoril (19 y de la tradicional (8. Cinco especies fueron comunes a las tres ventanas y siete especies (Ectatomma ruidum, Hypoponera sp.1 y sp.4, Odontomachus haematodus, O. brunneus y Pachycondyla constricta marcaron las diferencias en composición. Odontomachus brunneus resultó indicadora para la ventana tradicional y Paraponera clavata para la ventana silvopastoril. La búsqueda directa fue el método más eficiente para muestrear hormigas cazadoras en el piedemonte amazónico.We studied the abundance, richness and composition of hunting ants and their variation in production systems in department of Caquetá-Colombia, 27 farms were selected in three productive systems (agroforestry, silvopastoral and traditional, in this nine kinds of soil uses were identified. The proportions of clean pasture, agroforestry and old stubble contributed most to differentiating the systems. Five points were sampled per farm using four different

  9. Description of an injury in a human caused by a false tocandira (Dinoponera gigantea, Perty, 1833 with a revision on folkloric, pharmacological and clinical aspects of the giant ants of the genera Paraponera and Dinoponera (sub-family Ponerinae Descrição de injúria humana causada por falsa tocandira (Dinoponera gigantea, Perty, 1833 com revisão dos aspectos folclóricos, farmacológicos e clínicos das formigas gigantes do gênero Paraponera e Dinoponera (sub-família Ponerinae

    Directory of Open Access Journals (Sweden)

    Vidal Haddad Junior


    Full Text Available The authors observed an injury caused by the sting of a false tocandira ant in the hand of an amateur fisherman and they describe the clinical findings and the evolution of the envenoming, which presented an acute and violent pain, cold sweating, nausea, a vomiting episode, malaise, tachycardia and left axillary's lymphadenopathy. About three hours after the accident, still feeling intense pain in the place of the sting, he presented an episode of great amount of blood in the feces with no history of digestive, hematological or vascular problems. The intense pain decreased after eight hours, but the place stayed moderately painful for about 24 hours. In that moment, he presented small grade of local edema and erythema. The authors still present the folkloric, pharmacological and clinical aspects related to the tocandiras stings, a very interesting family of ants, which presents the largest and more venomous ants of the world.A partir de um acidente causado pela picada de uma formiga falsa tocandira na mão de um pescador amador, os autores descrevem os achados clínicos locais observados, tais como edema, eritema e dor excruciante e a evolução do envenenamento, que cursou com fenômenos sistêmicos imediatos, como sudorese fria, náuseas, vômitos, mal estar, taquicardia e linfadenopatia axilar à esquerda. Após três horas, a dor intensa persistia e o paciente apresentou um episódio de hematoquesia, sem história anterior de enfermidades do trato digestivo, hematológicas ou vasculares. O uso de analgésicos (Tramal® 300 mg/dia, água quente e gelo não melhorou a dor, que arrefeceu em oito horas, tendo permanecido por cerca de 24 horas. São apresentados ainda os aspectos folclóricos, farmacológicos e clínicos relacionados às picadas de tocandiras.

  10. Nematode CLE signaling in Arabidopsis requires CLAVATA2 and CORYNE (United States)

    Plant-parasitic cyst nematodes secrete CLAVATA3 (CLV3)/ESR(CLE)-like effector proteins. These proteins have been shown to act as ligand mimics of plant CLE peptides and are required for successful nematode infection; however, the receptors for nematode CLE-like peptides have not been identified. Her...

  11. Synergistic interaction of CLAVATA1, CLAVATA2, and RECEPTOR-LIKE PROTEIN KINASE 2 in cyst nematode parasitism of Arabidopsis (United States)

    Plant-parasitic cyst nematodes secrete CLAVATA3 (CLV3)/ENDOSPERM SURROUNDING REGION (ESR) (CLE)-like effector proteins. These proteins act as ligand mimics of plant CLE peptides and are required for successful nematode infection. Previously, we showed that CLV2 and CORYNE (CRN), a heterodimer recept...

  12. Bioaccumulation of metals and PCBs in Raja clavata. (United States)

    Torres, Paulo; Tristão da Cunha, Regina; Micaelo, Cristina; Rodrigues, Armindo Dos Santos


    The goal of this study was to assess stable isotopes profiles, metals concentration and PCBs in Raja clavata muscle and liver, according to sex and size, and to elucidate its suitability as a Mid-Atlantic biomonitor. The results reflected bioaccumulation and suggested biomagnification processes for As and Hg in muscle tissue. Cd, Cu and Zn were detected in high amounts in liver, Cr, Mn and Rb were relatively stable and low, Pb was not detected and Sr was present in muscle at high levels, decreasing with length. Hg and Se were strongly correlated, suggesting a mitigation role. Both tissues presented low concentrations of PCBs, especially the dioxin-like congeners, although always higher in liver and not correlated with size. None of these contaminants exceed EU legislated limits. However, they need to be monitored given study area's location, volcanic nature and the expected increase of anthropogenic activity related to future prospective mining activities and the establishment of the Transatlantic Trade and Investment Partnership (TTIP) between Europe and the USA. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. An insecticidal toxin from Nephila clavata spider venom. (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong


    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  14. Characterization and isolation of DNA microsatellite primers in Raja clavata L. (thornback ray, Rajidae)

    NARCIS (Netherlands)

    Chevolot, M; Reusch, TBH; Boele-Bos, S; Stam, WT; Olsen, JL

    The thornback ray, Raja clavata, is an elasmobranch (cartilaginous fish). Since the 1950s, its stock has severely declined. In order to investigate the genetic population structure of the species, we developed microsatellite loci. The five loci reported here have eight to 48 alleles per locus and

  15. Life history and viability of a long-lived marine invertebrate: the octocoral Paramuricea clavata. (United States)

    Linares, Cristina; Doak, Daniel F; Coma, Rafel; Díaz, David; Zabala, Mikel


    The red gorgonian Paramuricea clavata is a long-lived, slow-growing sessile invertebrate of ecological and conservation importance in the northwestern Mediterranean Sea. We develop a series of size-based matrix models for two Paramuricea clavata populations. These models were used to estimate basic life history traits for this species and to evaluate the viability of the red gorgonian populations we studied. As for many other slow-growing species, sensitivity and elasticity analysis demonstrate that gorgonian population growth is far more sensitive to changes in survival rates than to growth, shrinkage, or reproductive rates. The slow growth and low mortality of red gorgonians results in low damping ratios, indicating slow convergence to stable size structures (at least 50 years). The stable distributions predicted by the model did not differ from the observed ones. However, our simulations point out the fragility of this species, showing both populations in decline and high risk of extinction over moderate time horizons. These declines appear to be related to a recent increase in anthropogenic disturbances. Relative to their life span, the values of recruitment elasticity for Paramuricea clavata are lower than those reported for other marine organisms but are similar to those reported for some long-lived plants. These values and the delayed age of sexual maturity, in combination with the longevity of the species, show a clear fecundity/mortality trade-off. Full demographic studies of sessile marine species are quite scarce but can provide insight into population dynamics and life history patterns for these difficult and under-studied species. While our work shows clear results for the red gorgonian, the variability in some of our estimates suggest that future work should include data collection over longer temporal and spatial scales to better understand the long-term effects of natural and anthropogenic disturbances on red gorgonian populations.

  16. Reproductive biology of Raja clavata (Elasmobranchii: Rajidae) from Southern Black Sea coast around Turkey (United States)

    Saglam, Hacer; Ak, Orhan


    Specimens of Raja clavata were monthly collected at the coast of Havaalanı (Trabzon/Turkey) from January 2009 to December 2009 at depths between 20 and 40 m. A total of 230 individuals of thornback ray (131 females and 99 males) were collected by bottom trawls during research cruises. Using logistic regression, it was determined that TL at 50% maturity of males was 718 mm TL and of females 746 mm TL. The ovarian fecundity ranged from 27 to 60 yellow follicles in both ovaries. Females carrying egg cases were found in July and October. Variations in the gonadosomatic and hepatosomatic indices indicated a continuous reproductive cycle during the year.

  17. Solid-phase synthesis and biological evaluation of Joro spider toxin-4 from Nephila clavata

    DEFF Research Database (Denmark)

    Barslund, Anne Fuglsang; Poulsen, Mette Homann; Bach, Tinna Brøbech


    Polyamine toxins from orb weaver spiders are attractive pharmacological tools particularly for studies of ionotropic glutamate (iGlu) receptors in the brain. These polyamine toxins are biosynthesized in a combinatorial manner, providing a plethora of related, but structurally complex toxins...... to be exploited in biological studies. Here, we have used solid-phase synthetic methodology for the efficient synthesis of Joro spider toxin-4 (JSTX-4) (1) from Nephila clavata, providing sufficient amounts of the toxin for biological evaluation at iGlu receptor subtypes using electrophysiology. Biological...

  18. Ammolagena clavata (Jones and Parker, 1860), an agglutinated benthic foraminiferal species - first report from the Recent sediments, Arabian Sea, Indian Ocean region

    Digital Repository Service at National Institute of Oceanography (India)

    Nigam, R.; Mazumder, A.; Saraswat, R.

    The rare presence of the agglutinated foraminiferal species Ammolagena clavata is presented for the first time from the Recent sediments of the Indian Ocean region. This species has previously been reported in Recent sediments from all other oceans...

  19. Recovery of Proteolytic and Collagenolytic Activities from Viscera By-products of Rayfish (Raja clavata

    Directory of Open Access Journals (Sweden)

    José Antonio Vázquez


    Full Text Available The aim of this work was to study the recovery of proteolytic and collagenolytic activities from rayfish (Raja clavata viscera wastes. Initially, different parts of the gastrointestinal tract by-products (stomach, duodenum section including pancreas, final intestine were evaluated. The extracts from proximal intestine yielded the highest values of both enzymatic activities. Optimal conditions for protease activity quantification were established at pH = 6, T = 40 °C and incubation time ≤20 min. The mathematical equation used to model the joint effect of pH and temperature led to maximum activity at pH = 8.66 and 59.4 °C, respectively. Overcooled acetone was found to be best option for recovery of enzymatic activities in comparison with ethanol, PEG-4000, ammonium sulphate and ultrafiltration system. Finally, a simple and systematic protocol of partial purification and total recovery of proteases and collagenases was defined.

  20. Beyond ANT

    DEFF Research Database (Denmark)

    Jansen, Till


    Actor-Network-Theory (ANT) offers an ‘infra-language’ of the social that allows one to trace social relations very dynamically, while at the same time dissolving human agency, thus providing a flat and de-centred way into sociology. However, ANT struggles with its theoretical design that may lead...... us to reduce agency to causation and to conceptualize actor-networks as homogeneous ontologies of force. This article proposes to regard ANT’s inability to conceptualize reflexivity and the interrelatedness of different ontologies as the fundamental problem of the theory. Drawing on Günther......, it offers an ‘infra-language’ of reflexive relations while maintaining ANT’s de-centred approach. This would enable us to conceptualize actor-networks as non-homogeneous, dynamic and connecting different societal rationales while maintaining the main strengths of ANT....

  1. CLAVATA3-like genes are differentially expressed in grape vine (Vitis vinifera) tissues. (United States)

    Tominaga-Wada, Rumi; Nukumizu, Yuka; Wada, Takuji; Sawa, Shinichiro; Tetsumura, Takuya


    The CLAVATA3 (CLV3)/endosperm surrounding region [(ESR) CLE] peptides function as intercellular signaling molecules that regulate various physiological and developmental processes in diverse plant species. We identified five CLV3-like genes from grape vine (Vitis vinifera var. Pinot Noir): VvCLE 6, VvCLE 25-1, VvCLE 25-2, VvCLE 43 and VvCLE TDIF. These CLV3-like genes encode short proteins containing 43-128 amino acids. Except VvCLE TDIF, grape vine CLV3-like proteins possess a consensus amino acid sequence known as the CLE domain. Phylogenic analysis suggests that the VvCLE 6, VvCLE25-1, VvCLE25-2 and VvCLE43 genes have evolved from a single common ancestor to the Arabidopsis CLV3 gene. Expression analyses showed that the five grape CLV3-like genes are expressed in leaves, stems, roots and axillary buds with significant differences in their levels of expression. For example, while all of them were strongly expressed in axillary buds, VvCLE6 and VvCLE43 expression prevailed in roots, and VvCLE25-1, VvCLE25-2 and VvCLE TDIF expression in stems. The differential expression of the five grape CLV3-like peptides suggests that they play different roles in different organs and developmental stages. Copyright © 2013 Elsevier GmbH. All rights reserved.

  2. Relationship between radiocesium contamination and the contents of various elements in the web spider Nephila clavata (Nephilidae: Arachnida)

    International Nuclear Information System (INIS)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato


    The accident at the Fukushima Dai-ichi nuclear power plant seriously contaminated a large area in northeast Japan with a large amount of radioactive material. Consequently, various organisms, including arthropods, in the ecosystem have been contaminated with radiocesium ("1"3"7Cs) through the food chain. We previously showed that the web spider Nephila clavata was contaminated with "1"3"7Cs and that the level of contamination, which varied among spider individuals, was independent of the amount of prey consumed. The present study aimed to clarify the mechanisms that could determine the level of "1"3"7Cs contamination in N. clavata. We first demonstrated the patterns of contents of over 30 elements in N. clavata that were collected at two forest sites (PS and ES) in Fukushima and then focused on the relationships between the contents of the alkali metals Li, Na, K, and Rb and the accumulation of "1"3"7Cs in the spiders; Cs is an alkali metal and is expected to act similarly to Li, Na, K, and Rb. We also focused on the content of the non-alkali element, Cu, which is an essential element for oxygen transport in spiders. We found that Na content correlated positively with "1"3"7Cs accumulation at both sites, which suggested that "1"3"7Cs accumulation in N. clavata was related with the dynamics of Na. The K–, Rb–, and Cu–"1"3"7Cs relationships were site specific; the relationships were significant at site PS, but not significant at site ES. Factors causing the site specific relationships and the probable pathway for "1"3"7Cs transfer from soil to plants and then to higher trophic levels are discussed in terms of the transfer processes of the alkali metals. - Highlights: • Accumulation of "1"3"7Cs and various elements in web spiders was investigated. • "1"3"7Cs accumulation positively correlated with that of K, Rb, Na, and Cu. • Accumulation of alkali metals determined the level of "1"3"7Cs contamination. • K–, Rb–, Cu–"1"3"7Cs relationships were

  3. Fire Ant Bites (United States)

    ... Favorite Name: Category: Share: Yes No, Keep Private Fire Ant Bites Share | Fire ants are aggressive, venomous insects that have pinching ... across the United States, even into Puerto Rico. Fire ant stings usually occur on the feet or ...

  4. Nephila clavata L Koch, the Joro Spider of East Asia, newly recorded from North America (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    E. Richard Hoebeke


    Full Text Available Nephila clavata L Koch, known as the Joro spider and native to East Asia (Japan, China, Korea, and Taiwan, is newly reported from North America. Specimens from several locations in northeast Georgia were collected from around residential properties in Barrow, Jackson, and Madison counties in late October and early November 2014. These are the first confirmed records of the species in the New World. Our collections, along with confirmed images provided by private citizens, suggest that the Joro spider is established in northeast Georgia. Genomic sequence data for the COI gene obtained from two specimens conforms to published sequences for N. clavata, providing additional confirmation of species identity. Known collection records are listed and mapped using geocoding. Our observations are summarized along with published background information on biology in Asia and we hypothesize on the invasion history and mode of introduction into North America. Recognition features are given and photographic images of the male and female are provided to aid in their differentiation from the one native species of the genus (Nephila clavipes in North America.

  5. In planta processing and glycosylation of a nematode CLAVATA3/ENDOSPERM SURROUNDING REGION-like effector and its interaction with a host CLAVATA2-like receptor to promote parasitism. (United States)

    Chen, Shiyan; Lang, Ping; Chronis, Demosthenis; Zhang, Sheng; De Jong, Walter S; Mitchum, Melissa G; Wang, Xiaohong


    Like other biotrophic plant pathogens, plant-parasitic nematodes secrete effector proteins into host cells to facilitate infection. Effector proteins that mimic plant CLAVATA3/ENDOSPERM SURROUNDING REGION-related (CLE) proteins have been identified in several cyst nematodes, including the potato cyst nematode (PCN); however, the mechanistic details of this cross-kingdom mimicry are poorly understood. Plant CLEs are posttranslationally modified and proteolytically processed to function as bioactive ligands critical to various aspects of plant development. Using ectopic expression coupled with nanoliquid chromatography-tandem mass spectrometry analysis, we show that the in planta mature form of proGrCLE1, a multidomain CLE effector secreted by PCN during infection, is a 12-amino acid arabinosylated glycopeptide (named GrCLE1-1Hyp4,7g) with striking structural similarity to mature plant CLE peptides. This glycopeptide is more resistant to hydrolytic degradation and binds with higher affinity to a CLAVATA2-like receptor (StCLV2) from potato (Solanum tuberosum) than its nonglycosylated forms. We further show that StCLV2 is highly up-regulated at nematode infection sites and that transgenic potatoes with reduced StCLV2 expression are less susceptible to PCN infection, indicating that interference of the CLV2-mediated signaling pathway confers nematode resistance in crop plants. These results strongly suggest that phytonematodes have evolved to utilize host cellular posttranslational modification and processing machinery for the activation of CLE effectors following secretion into plant cells and highlight the significance of arabinosylation in regulating nematode CLE effector activity. Our finding also provides evidence that multidomain CLEs are modified and processed similarly to single-domain CLEs, adding new insight into CLE maturation in plants. © 2015 American Society of Plant Biologists. All Rights Reserved.

  6. In Planta Processing and Glycosylation of a Nematode CLAVATA3/ENDOSPERM SURROUNDING REGION-Like Effector and Its Interaction with a Host CLAVATA2-Like Receptor to Promote Parasitism1[OPEN (United States)

    Chen, Shiyan; Lang, Ping; Chronis, Demosthenis; Zhang, Sheng; De Jong, Walter S.; Mitchum, Melissa G.


    Like other biotrophic plant pathogens, plant-parasitic nematodes secrete effector proteins into host cells to facilitate infection. Effector proteins that mimic plant CLAVATA3/ENDOSPERM SURROUNDING REGION-related (CLE) proteins have been identified in several cyst nematodes, including the potato cyst nematode (PCN); however, the mechanistic details of this cross-kingdom mimicry are poorly understood. Plant CLEs are posttranslationally modified and proteolytically processed to function as bioactive ligands critical to various aspects of plant development. Using ectopic expression coupled with nanoliquid chromatography-tandem mass spectrometry analysis, we show that the in planta mature form of proGrCLE1, a multidomain CLE effector secreted by PCN during infection, is a 12-amino acid arabinosylated glycopeptide (named GrCLE1-1Hyp4,7g) with striking structural similarity to mature plant CLE peptides. This glycopeptide is more resistant to hydrolytic degradation and binds with higher affinity to a CLAVATA2-like receptor (StCLV2) from potato (Solanum tuberosum) than its nonglycosylated forms. We further show that StCLV2 is highly up-regulated at nematode infection sites and that transgenic potatoes with reduced StCLV2 expression are less susceptible to PCN infection, indicating that interference of the CLV2-mediated signaling pathway confers nematode resistance in crop plants. These results strongly suggest that phytonematodes have evolved to utilize host cellular posttranslational modification and processing machinery for the activation of CLE effectors following secretion into plant cells and highlight the significance of arabinosylation in regulating nematode CLE effector activity. Our finding also provides evidence that multidomain CLEs are modified and processed similarly to single-domain CLEs, adding new insight into CLE maturation in plants. PMID:25416475

  7. Transient shifts in bacterial communities associated with the temperate gorgonian Paramuricea clavata in the Northwestern Mediterranean Sea.

    Directory of Open Access Journals (Sweden)

    Marie La Rivière

    Full Text Available BACKGROUND: Bacterial communities that are associated with tropical reef-forming corals are being increasingly recognized for their role in host physiology and health. However, little is known about the microbial diversity of the communities associated with temperate gorgonian corals, even though these communities are key structural components of the ecosystem. In the Northwestern Mediterranean Sea, gorgonians undergo recurrent mass mortalities, but the potential relationship between these events and the structure of the associated bacterial communities remains unexplored. Because microbial assemblages may contribute to the overall health and disease resistance of their host, a detailed baseline of the associated bacterial diversity is required to better understand the functioning of the gorgonian holobiont. METHODOLOGY/PRINCIPAL FINDINGS: The bacterial diversity associated with the gorgonian Paramuricea clavata was determined using denaturing gradient gel electrophoresis, terminal-restriction fragment length polymorphism and the construction of clone libraries of the bacterial 16S ribosomal DNA. Three study sites were monitored for 4 years to assess the variability of communities associated with healthy colonies. Bacterial assemblages were highly dominated by one Hahellaceae-related ribotype and exhibited low diversity. While this pattern was mostly conserved through space and time, in summer 2007, a deep shift in microbiota structure toward increased bacterial diversity and the transient disappearance of Hahellaceae was observed. CONCLUSION/SIGNIFICANCE: This is the first spatiotemporal study to investigate the bacterial diversity associated with a temperate shallow gorgonian. Our data revealed an established relationship between P. clavata and a specific bacterial group within the Oceanospirillales. These results suggest a potential symbiotic role of Hahellaceae in the host-microbe association, as recently suggested for tropical corals

  8. Ant- and Ant-Colony-Inspired ALife Visual Art. (United States)

    Greenfield, Gary; Machado, Penousal


    Ant- and ant-colony-inspired ALife art is characterized by the artistic exploration of the emerging collective behavior of computational agents, developed using ants as a metaphor. We present a chronology that documents the emergence and history of such visual art, contextualize ant- and ant-colony-inspired art within generative art practices, and consider how it relates to other ALife art. We survey many of the algorithms that artists have used in this genre, address some of their aims, and explore the relationships between ant- and ant-colony-inspired art and research on ant and ant colony behavior.

  9. Structural and functional diversity of CLAVATA3/ESR (CLE)-like genes from the potato cyst nematode Globodera rostochiensis. (United States)

    Lu, Shun-Wen; Chen, Shiyan; Wang, Jianying; Yu, Hang; Chronis, Demosthenis; Mitchum, Melissa G; Wang, Xiaohong


    Plant CLAVATA3/ESR-related (CLE) peptides have diverse roles in plant growth and development. Here, we report the isolation and functional characterization of five new CLE genes from the potato cyst nematode Globodera rostochiensis. Unlike typical plant CLE peptides that contain a single CLE motif, four of the five Gr-CLE genes encode CLE proteins with multiple CLE motifs. These Gr-CLE genes were found to be specifically expressed within the dorsal esophageal gland cell of nematode parasitic stages, suggesting a role for their encoded proteins in plant parasitism. Overexpression phenotypes of Gr-CLE genes in Arabidopsis mimicked those of plant CLE genes, and Gr-CLE proteins could rescue the Arabidopsis clv3-2 mutant phenotype when expressed within meristems. A short root phenotype was observed when synthetic GrCLE peptides were exogenously applied to roots of Arabidopsis or potato similar to the overexpression of Gr-CLE genes in Arabidopsis and potato hairy roots. These results reveal that G. rostochiensis CLE proteins with either single or multiple CLE motifs function similarly to plant CLE proteins and that CLE signaling components are conserved in both Arabidopsis and potato roots. Furthermore, our results provide evidence to suggest that the evolution of multiple CLE motifs may be an important mechanism for generating functional diversity in nematode CLE proteins to facilitate parasitism.

  10. Riding with the ants

    NARCIS (Netherlands)

    Duarte, A. P. M.; Attili-Angelis, D.; Baron, N. C.; Groenewald, Johannes Z.; Crous, Pedro W.; Pagnocca, F. C.

    Isolates of Teratosphaeriaceae have frequently been found in the integument of attine ants, proving to be common and diverse in this microenvironment. The LSU phylogeny of the ant-isolated strains studied revealed that they cluster in two main lineages. The first was associated with the genus

  11. Sick ants become unsociable

    DEFF Research Database (Denmark)

    Bos, Nicky Peter Maria; Lefevre, T.; Jensen, A.B.


    Parasites represent a severe threat to social insects, which form high-density colonies of related individuals, and selection should favour host traits that reduce infection risk. Here, using a carpenter ant (Camponotus aethiops) and a generalist insect pathogenic fungus (Metarhizium brunneum), we...... show that infected ants radically change their behaviour over time to reduce the risk of colony infection. Infected individuals (i) performed less social interactions than their uninfected counterparts, (ii) did not interact with brood anymore and (iii) spent most of their time outside the nest from...... day 3 post-infection until death. Furthermore, infected ants displayed an increased aggressiveness towards non-nestmates. Finally, infected ants did not alter their cuticular chemical profile, suggesting that infected individuals do not signal their physiological status to nestmates. Our results...

  12. Commentary: Warring ants

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 27; Issue 2. Commentary: Warring ants: Lessons from Lanchester's laws of combat? Renee M Borges. Volume 27 Issue 2 March 2002 pp 75-78. Fulltext. Click here to view fulltext PDF. Permanent link: ...

  13. Antílope

    Directory of Open Access Journals (Sweden)

    Pedro Anderson Martinho Moçambique


    Full Text Available Essa espécie de antílope só é encontrada em território angolano, sendo assim um símbolo nacional. Segundo a mitologia africana é símbolo de vivacidade, velocidade e beleza - Angola.

  14. Antílope

    Directory of Open Access Journals (Sweden)

    Pedro Anderson Martinho Moçambique


    Full Text Available Essa espécie de antílope só é encontrada em território angolano, sendo assim um símbolo nacional. Segundo a mitologia africana é símbolo de vivacidade, velocidade e beleza - Angola.

  15. Fire Ant Allergy (United States)

    ... venom in a fire ant sting will kill bacteria and some of your skin cells. This results in the formation of a blister that fills with a cloudy white material in about 24 hours. While this looks like a pus-filled lesion that should be drained, ...

  16. "Ant-egg" cataract revisited

    DEFF Research Database (Denmark)

    Clemmensen, Kåre; Enghild, Jan J; Ivarsen, Anders


    -ray scans and electron microscopy. The purpose of this study was to further characterize "ant-egg" cataract using modern technology and display the history of the "ant-eggs" after cataract extraction. METHODS: "Ant-eggs" were examined using Heidelberg SPECTRALIS Optical Coherence Tomography (OCT...

  17. Ant Colony Optimization for Control

    NARCIS (Netherlands)

    Van Ast, J.M.


    The very basis of this thesis is the collective behavior of ants in colonies. Ants are an excellent example of how rather simple behavior on a local level can lead to complex behavior on a global level that is beneficial for the individuals. The key in the self-organization of ants is communication

  18. CLE-CLAVATA1 peptide-receptor signaling module regulates the expansion of plant root systems in a nitrogen-dependent manner. (United States)

    Araya, Takao; Miyamoto, Mayu; Wibowo, Juliarni; Suzuki, Akinori; Kojima, Soichi; Tsuchiya, Yumiko N; Sawa, Shinichiro; Fukuda, Hiroo; von Wirén, Nicolaus; Takahashi, Hideki


    Morphological plasticity of root systems is critically important for plant survival because it allows plants to optimize their capacity to take up water and nutrients from the soil environment. Here we show that a signaling module composed of nitrogen (N)-responsive CLE (CLAVATA3/ESR-related) peptides and the CLAVATA1 (CLV1) leucine-rich repeat receptor-like kinase is expressed in the root vasculature in Arabidopsis thaliana and plays a crucial role in regulating the expansion of the root system under N-deficient conditions. CLE1, -3, -4, and -7 were induced by N deficiency in roots, predominantly expressed in root pericycle cells, and their overexpression repressed the growth of lateral root primordia and their emergence from the primary root. In contrast, clv1 mutants showed progressive outgrowth of lateral root primordia into lateral roots under N-deficient conditions. The clv1 phenotype was reverted by introducing a CLV1 promoter-driven CLV1:GFP construct producing CLV1:GFP fusion proteins in phloem companion cells of roots. The overaccumulation of CLE2, -3, -4, and -7 in clv1 mutants suggested the amplitude of the CLE peptide signals being feedback-regulated by CLV1. When CLE3 was overexpressed under its own promoter in wild-type plants, the length of lateral roots was negatively correlated with increasing CLE3 mRNA levels; however, this inhibitory action of CLE3 was abrogated in the clv1 mutant background. Our findings identify the N-responsive CLE-CLV1 signaling module as an essential mechanism restrictively controlling the expansion of the lateral root system in N-deficient environments.

  19. Runtime analysis of the 1-ANT ant colony optimizer

    DEFF Research Database (Denmark)

    Doerr, Benjamin; Neumann, Frank; Sudholt, Dirk


    The runtime analysis of randomized search heuristics is a growing field where, in the last two decades, many rigorous results have been obtained. First runtime analyses of ant colony optimization (ACO) have been conducted only recently. In these studies simple ACO algorithms such as the 1-ANT...... that give us a more detailed impression of the 1-ANT’s performance. Furthermore, the experiments also deal with the question whether using many ant solutions in one iteration can decrease the total runtime....

  20. The metapleural gland of ants

    DEFF Research Database (Denmark)

    Yek, Sze Huei; Mueller, Ulrich G


    The metapleural gland (MG) is a complex glandular structure unique to ants, suggesting a critical role in their origin and ecological success. We synthesize the current understanding of the adaptive function, morphology, evolutionary history, and chemical properties of the MG. Two functions......-compressible invagination of the integument and the secretion is thought to ooze out passively through the non-closable opening of the MG or is groomed off by the legs and applied to target surfaces. MG loss has occurred repeatedly among the ants, particularly in the subfamilies Formicinae and Myrmicinae, and the MG...... is more commonly absent in males than in workers. MG chemistry has been characterized mostly in derived ant lineages with unique biologies (e.g. leafcutter ants, fire ants), currently precluding any inferences about MG chemistry at the origin of the ants. A synthetic approach integrating functional...

  1. Hospitales seguros ante desastres


    Celso Vladimir Bambaren Alatrista; María Del Socorro Alatrista Gutierrez


    Entre 1982 a 2005 se registraron daños en 1 143 establecimientos de salud en el Perú, generalmente debido a sismos, lluvias e inundaciones. Los daños en los servicios de salud producen la interrupción de la atención de la población y de los programas de salud, así como generan un gran gasto para la rehabilitación y reconstrucción. Por ello, se requiere proteger a los establecimientos de salud y desarrollar una política de hospitales seguros ante desastres que incluya medidas para prevenir o r...

  2. La vivienda ante emergencias

    Directory of Open Access Journals (Sweden)

    Arq. María Eugenia Gonzàlez Chipont


    Full Text Available Este trabajo propone analizar la evolución de la vivienda como respuesta ante emergencias desde principios del siglo XX hasta nuestros días. La secuencia de casos a analizar no sigue una cronología estricta sino que se organiza en función de un creciente grado de complejidad. Comienza con los aportes fundamentales de la vivienda mínima del movimiento moderno, con un fuerte acento en lo tecnológico, para ir profundizando, mientras avanzamos en el siglo, en los aspectos sociales de la arquitectura. Sin intentar oponer lo tecnológico y lo social, la estructura propuesta expresa un enriquecimiento de la cuestión técnica conforme se van ampliando sus objetivos sociales. Mientras los requerimientos tecnológicos como la inmediatez y la masividad de la respuesta, permanecen a lo largo del tiempo, la vivienda ante emergencias puede plantearse objetivos sociales cada vez más profundos. Los casos fueron elegidos a partir de autores renombrados de la Historia de la Arquitectura partiendo de ejemplos cercanos a la génesis del movimiento moderno para acercarnos cada vez más hacia el contexto actual de Latinoamérica. Se logra así un barrido geográfco pero principalmente cultural: desde las fuentes de la modernidad, bajo el paradigma sólido de la industrialización, hasta la inestabilidad de la ciudad posindustrial latinoamericana

  3. Pest repellent properties of ant pheromones

    DEFF Research Database (Denmark)

    Offenberg, Joachim


    of ant pheromones may be sufficient to repel pest insects from ant territories. The study of ant semiochemicals is in its infancy, yet, evidence for their potential use in pest management is starting to build up. Pheromones from four of five tested ant species have been shown to deter herbivorous insect...... prey and competing ant species are also deterred by ant deposits, whereas ant symbionts may be attracted to them. Based on these promising initial findings, it seems advisable to further elucidate the signaling properties of ant pheromones and to test and develop their use in future pest management....

  4. Hospitales seguros ante desastres

    Directory of Open Access Journals (Sweden)

    Celso Vladimir Bambaren Alatrista


    Full Text Available Entre 1982 a 2005 se registraron daños en 1 143 establecimientos de salud en el Perú, generalmente debido a sismos, lluvias e inundaciones. Los daños en los servicios de salud producen la interrupción de la atención de la población y de los programas de salud, así como generan un gran gasto para la rehabilitación y reconstrucción. Por ello, se requiere proteger a los establecimientos de salud y desarrollar una política de hospitales seguros ante desastres que incluya medidas para prevenir o reducción de la vulnerabilidad estructural, no estructural y funcional en los nuevos establecimientos y en los existentes.(Rev Med Hered 2007;18:149-154.

  5. A cellular automata model for ant trails

    Indian Academy of Sciences (India)

    In this study, the unidirectional ant traffic flow with U-turn in an ant trail was inves- tigated using ... the literature, it was considered in the model that (i) ant colony consists of two kinds of ants, good- ... ponents without a central controller [8].

  6. ANT, tourism and situated globality

    DEFF Research Database (Denmark)

    Jóhannesson, Gunnar Thór; Ren, Carina Bregnholm; van der Duim, René


    viable descriptions of the collective condition of humans and more-than-humans in the Anthropocene. Also and moving past a merely descriptive approach, it discusses it as a useful tool to engage with the situated globalities which come into being through the socio-spatial coupling of tourism......In recent years Actor-network theory (ANT) has increasingly been felt in the field of tourism studies (Van der Duim, Ren, & Jóhannesson, 2012). An important implication of the meeting between ANT and tourism studies is the notion of tourism being described as a heterogeneous assemblage of what we...... are used to define as the separate spheres of nature and culture. This paper explores and relates the central tenets of ANT in tourism with regard to the concept of the Anthropocene. It presents the ANT approach as a flat and object-oriented ontology and methodology and explores its potentials to carve out...

  7. Ants Orase kultuurisõnum

    Index Scriptorium Estoniae


    26. jaanuaril toimub Tallinna Ülikooli Akadeemilises Raamatukogus seminar silmapaistvast Eesti teadlasest ja tõlkijast Ants Orasest. Esinevad kirjandusteadlased Tallinna Ülikoolist, Tartu Ülikoolist ja Eesti Kirjandusmuuseumist. Avaettekandeks on sõna Oklahoma Ülikooli professoril Vincent B. Leitchil, kes oli Ants Orase viimaseks juhendatavaks doktorandiks. Seminari korraldavad Tallinna Ülikool ja Eesti Kirjandusmuuseum. Vt ka Postimees, 26, jaan., lk. 18

  8. Radiocesium contamination of the web spider Nephila clavata (Nephilidae: Arachnida) 1.5 years after the Fukushima Dai-ichi Nuclear Power Plant accident. (United States)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato


    We measured the concentrations of radiocesium ((134)Cs and (137)Cs) in a large web spider, Nephila clavata L. Koch (Nephilidae: Arachnida), collected at three sites at different distances from the Fukushima Dai-ichi Nuclear Power Plant about 1.5 y after the accident in March 2011. The radiocesium concentrations in spiders were highest in a streamside secondary forest 33 km northwest of the power plant: mean ± a standard deviation of 2.401 ± 1.197 Bq g(-1) dry for (134)Cs and 3.955 ± 1.756 Bq g(-1) dry for (137)Cs. In a hillside secondary forest 37 km northwest of the power plant, the mean concentrations of (134)Cs and (137)Cs were 0.825 ± 0.247 Bq g(-1) dry and 1.470 ± 0.454 Bq g(-1) dry, respectively. In a pine forest 62 km west of the power plant, very low radiocesium concentrations were detected, but in only a few individuals. The concentrations of (134)Cs and (137)Cs in spiders collected at each site tended to be correlated with the air radiation dose rate at each site. Since spiders are key components of food webs in forests, the high concentrations in this species at contaminated sites suggested that the radiocesium from the accident has transferred through food chains and reached to higher trophic level of the food chains. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  9. Radiocesium contamination of the web spider Nephila clavata (Nephilidae: Arachnida) 1.5 years after the Fukushima Dai-ichi Nuclear Power Plant accident

    International Nuclear Information System (INIS)

    Ayabe, Yoshiko; Kanasashi, Tsutomu; Hijii, Naoki; Takenaka, Chisato


    We measured the concentrations of radiocesium ( 134 Cs and 137 Cs) in a large web spider, Nephila clavata L. Koch (Nephilidae: Arachnida), collected at three sites at different distances from the Fukushima Dai-ichi Nuclear Power Plant about 1.5 y after the accident in March 2011. The radiocesium concentrations in spiders were highest in a streamside secondary forest 33 km northwest of the power plant: mean ± a standard deviation of 2.401 ± 1.197 Bq g −1 dry for 134 Cs and 3.955 ± 1.756 Bq g −1 dry for 137 Cs. In a hillside secondary forest 37 km northwest of the power plant, the mean concentrations of 134 Cs and 137 Cs were 0.825 ± 0.247 Bq g −1 dry and 1.470 ± 0.454 Bq g −1 dry, respectively. In a pine forest 62 km west of the power plant, very low radiocesium concentrations were detected, but in only a few individuals. The concentrations of 134 Cs and 137 Cs in spiders collected at each site tended to be correlated with the air radiation dose rate at each site. Since spiders are key components of food webs in forests, the high concentrations in this species at contaminated sites suggested that the radiocesium from the accident has transferred through food chains and reached to higher trophic level of the food chains. -- Highlights: • We investigated radiocesium contamination of large web spiders in Fukushima. • Spiders collected at three different sites in Fukushima were contaminated. • Radiocesium concentrations of spiders tended to increase with the air radiation dose rates. • Radiocesium concentrations of spiders did not affect by the amount of prey

  10. Using Ants as bioindicators: Multiscale Issues in Ant Community Ecology

    Directory of Open Access Journals (Sweden)

    Alan Andersen


    Full Text Available Ecological patterns and processes are characteristically scale dependent, and research findings often cannot be translated easily from one scale to another. Conservation biology is challenged by a lack of congruence between the spatial scales of ecological research (typically involving small plots and land management (typically involving whole landscapes. Here, I discuss spatial scaling issues as they relate to an understanding of ant communities and, consequently, their use as bioindicators in land management. Our perceptions of fundamental patterns and processes in ant communities depend on scale: taxa that are behaviorally dominant at one scale are not necessarily so at others, functional groups recognized at one scale are often inappropriate for others, and the role of competition in community structure depends on the scale of analysis. Patterns of species richness and composition, and the ability of total richness to be estimated by surrogates, are all also scale dependent. Ant community ecology has a tradition of detailed studies in small plots, but the use of ants as bioindicators requires a predictive understanding of community structure and dynamics at a range of spatial scales. Such an appreciation of ant communities and their most effective use as bioindicators is best served by studies integrating results from plot-scale research with the broad-scale paradigms of biogeography, systematics, and evolutionary biology.

  11. Monoculture of leafcutter ant gardens.

    Directory of Open Access Journals (Sweden)

    Ulrich G Mueller


    Full Text Available Leafcutter ants depend on the cultivation of symbiotic Attamyces fungi for food, which are thought to be grown by the ants in single-strain, clonal monoculture throughout the hundreds to thousands of gardens within a leafcutter nest. Monoculture eliminates cultivar-cultivar competition that would select for competitive fungal traits that are detrimental to the ants, whereas polyculture of several fungi could increase nutritional diversity and disease resistance of genetically variable gardens.Using three experimental approaches, we assessed cultivar diversity within nests of Atta leafcutter ants, which are most likely among all fungus-growing ants to cultivate distinct cultivar genotypes per nest because of the nests' enormous sizes (up to 5000 gardens and extended lifespans (10-20 years. In Atta texana and in A. cephalotes, we resampled nests over a 5-year period to test for persistence of resident cultivar genotypes within each nest, and we tested for genetic differences between fungi from different nest sectors accessed through excavation. In A. texana, we also determined the number of Attamyces cells carried as a starter inoculum by a dispersing queens (minimally several thousand Attamyces cells, and we tested for genetic differences between Attamyces carried by sister queens dispersing from the same nest. Except for mutational variation arising during clonal Attamyces propagation, DNA fingerprinting revealed no evidence for fungal polyculture and no genotype turnover during the 5-year surveys.Atta leafcutter ants can achieve stable, fungal monoculture over many years. Mutational variation emerging within an Attamyces monoculture could provide genetic diversity for symbiont choice (gardening biases of the ants favoring specific mutational variants, an analog of artificial selection.

  12. Pest repelling properties of ant pheromones

    DEFF Research Database (Denmark)

    Offenberg, Joachim


    Ants control pests via predation and physical deterrence; however, ant communication is based on chemical cues which may serve as warning signals to potential prey and other intruders. The presence of ant pheromones may, thus, be sufficient to repel pests from ant territories. This mini-review sh......-review shows that four out of five tested ant species deposit pheromones that repel herbivorous prey from their host plants.......Ants control pests via predation and physical deterrence; however, ant communication is based on chemical cues which may serve as warning signals to potential prey and other intruders. The presence of ant pheromones may, thus, be sufficient to repel pests from ant territories. This mini...

  13. How ants drop out: ant abundance on tropical mountains. (United States)

    Longino, John T; Branstetter, Michael G; Colwell, Robert K


    In tropical wet forests, ants are a large proportion of the animal biomass, but the factors determining abundance are not well understood. We characterized ant abundance in the litter layer of 41 mature wet forest sites spread throughout Central America (Chiapas, Guatemala, Honduras, Nicaragua, and Costa Rica) and examined the impact of elevation (as a proxy for temperature) and community species richness. Sites were intentionally chosen to minimize variation in precipitation and seasonality. From sea level to 1500 m ant abundance very gradually declined, community richness declined more rapidly than abundance, and the local frequency of the locally most common species increased. These results suggest that within this elevational zone, density compensation is acting, maintaining high ant abundance as richness declines. In contrast, in sites above 1500 m, ant abundance dropped abruptly to much lower levels. Among these high montane sites, community richness explained much more of the variation in abundance than elevation, and there was no evidence of density compensation. The relative stability of abundance below 1500 m may be caused by opposing effects of temperature on productivity and metabolism. Lower temperatures may decrease productivity and thus the amount of food available for consumers, but slower metabolisms of consumers may allow maintenance of higher biomass at lower resource supply rates. Ant communities at these lower elevations may be highly interactive, the result of continuous habitat presence over geological time. High montane sites may be ephemeral in geological time, resulting in non-interactive communities dominated by historical and stochastic processes. Abundance in these sites may be determined by the number of species that manage to colonize and/or avoid extinction on mountaintops.

  14. How ants drop out: ant abundance on tropical mountains.

    Directory of Open Access Journals (Sweden)

    John T Longino

    Full Text Available In tropical wet forests, ants are a large proportion of the animal biomass, but the factors determining abundance are not well understood. We characterized ant abundance in the litter layer of 41 mature wet forest sites spread throughout Central America (Chiapas, Guatemala, Honduras, Nicaragua, and Costa Rica and examined the impact of elevation (as a proxy for temperature and community species richness. Sites were intentionally chosen to minimize variation in precipitation and seasonality. From sea level to 1500 m ant abundance very gradually declined, community richness declined more rapidly than abundance, and the local frequency of the locally most common species increased. These results suggest that within this elevational zone, density compensation is acting, maintaining high ant abundance as richness declines. In contrast, in sites above 1500 m, ant abundance dropped abruptly to much lower levels. Among these high montane sites, community richness explained much more of the variation in abundance than elevation, and there was no evidence of density compensation. The relative stability of abundance below 1500 m may be caused by opposing effects of temperature on productivity and metabolism. Lower temperatures may decrease productivity and thus the amount of food available for consumers, but slower metabolisms of consumers may allow maintenance of higher biomass at lower resource supply rates. Ant communities at these lower elevations may be highly interactive, the result of continuous habitat presence over geological time. High montane sites may be ephemeral in geological time, resulting in non-interactive communities dominated by historical and stochastic processes. Abundance in these sites may be determined by the number of species that manage to colonize and/or avoid extinction on mountaintops.

  15. Male parentage in army ants

    DEFF Research Database (Denmark)

    Kronauer, Daniel J C; Schöning, Caspar; Boomsma, Jacobus J


    of active research in insect sociobiology. Here we present microsatellite data for 176 males from eight colonies of the African army ant Dorylus (Anomma) molestus. Comparison with worker genotypes and inferred queen genotypes from the same colonies show that workers do not or at best very rarely reproduce...

  16. A cellular automata model for ant trails

    Indian Academy of Sciences (India)

    In this study, the unidirectional ant traffic flow with U-turn in an ant trail was investigated using one-dimensional cellular automata model. It is known that ants communicate with each other by dropping a chemical, called pheromone, on the substrate. Apart from the studies in the literature, it was considered in the model that ...

  17. Fungal Adaptations to Mutualistic Life with Ants

    DEFF Research Database (Denmark)

    Kooij, Pepijn Wilhelmus

    Fungus-growing ants (Attini) feed off a fungus they cultivate in a mutualistic symbiosis in underground chambers by providing it substrate they collect outside the colony. The tribe of Attine ants ranges from small colonies of the paleo- and basal Attine species with a few hundred workers that fo...... that the fungus evolved some incredible adaptations to a mutualistic life with the ants....

  18. Microsatellite Primers for Fungus-Growing Ants

    DEFF Research Database (Denmark)

    Villesen Fredsted, Palle; Gertsch, Pia J.; Boomsma, Jacobus Jan (Koos)


    We isolated five polymorphic microsatellite loci from a library of two thousand recombinant clones of two fungus-growing ant species, Cyphomyrmex longiscapus and Trachymyrmex cf. zeteki. Amplification and heterozygosity were tested in five species of higher attine ants using both the newly...... developed primers and earlier published primers that were developed for fungus-growing ants. A total of 20 variable microsatellite loci, developed for six different species of fungus-growing ants, are now available for studying the population genetics and colony kin-structure of these ants....

  19. Microsatellite primers for fungus-growing ants

    DEFF Research Database (Denmark)

    Villesen, Palle; Gertsch, P J; Boomsma, JJ


    We isolated five polymorphic microsatellite loci from a library of two thousand recombinant clones of two fungus-growing ant species, Cyphomyrmex longiscapus and Trachymyrmex cf. zeteki. Amplification and heterozygosity were tested in five species of higher attine ants using both the newly...... developed primers and earlier published primers that were developed for fungus-growing ants. A total of 20 variable microsatellite loci, developed for six different species of fungus-growing ants, are now available for studying the population genetics and colony kin-structure of these ants....

  20. Revolutionizing Remote Exploration with ANTS (United States)

    Clark, P. E.; Rilee, M. L.; Curtis, S.; Truszkowski, W.


    We are developing the Autonomous Nano-Technology Swarm (ANTS) architecture based on an insect colony analogue for the cost-effective, efficient, systematic survey of remote or inaccessible areas with multiple object targets, including planetary surface, marine, airborne, and space environments. The mission context is the exploration in the 2020s of the most compelling remaining targets in the solar system: main belt asteroids. Main belt asteroids harbor important clues to Solar System origins and evolution which are central to NASA's goals in Space Science. Asteroids are smaller than planets, but their number is far greater, and their combined surface area likely dwarfs the Earth's. An asteroid survey will dramatically increase our understanding of the local resources available for the Human Exploration and Development of Space. During the mission composition, shape, gravity, and orbit parameters could be returned to Earth for perhaps several thousand asteroids. A survey of this area will rival the great explorations that encircled this globe, opened up the New World, and laid the groundwork for the progress and challenges of the last centuries. The ANTS architecture for a main belt survey consists of a swarm of as many as a thousand or more highly specialized pico-spacecraft that form teams to survey as many as one hundred asteroids a month. Multi-level autonomy is critical for ANTS and the objective of the proposed study is to work through the implications and constraints this entails. ANTS couples biologically inspired autonomic control for basic functions to higher level artificial intelligence that together enable individual spacecraft to operate as specialized, cooperative, social agents. This revolutionary approach postulates highly advanced, but familiar, components integrated and operated in a way that uniquely transcends any evolutionary extrapolation of existing trends and enables thousand-spacecraft missions.

  1. Ant-plant mutualism: a dietary by-product of a tropical ant's macronutrient requirements. (United States)

    Arcila Hernández, Lina M; Sanders, Jon G; Miller, Gabriel A; Ravenscraft, Alison; Frederickson, Megan E


    Many arboreal ants depend on myrmecophytic plants for both food and shelter; in return, these ants defend their host plants against herbivores, which are often insects. Ant-plant and other mutualisms do not necessarily involve the exchange of costly rewards or services; they may instead result from by-product benefits, or positive outcomes that do not entail a cost for one or both partners. Here, we examined whether the plant-ant Allomerus octoarticulatus pays a short-term cost to defend their host plants against herbivores, or whether plant defense is a by-product benefit of ant foraging for insect prey. Because the food offered by ant-plants is usually nitrogen-poor, arboreal ants may balance their diets by consuming insect prey or associating with microbial symbionts to acquire nitrogen, potentially shifting the costs and benefits of plant defense for the ant partner. To determine the effect of ant diet on an ant-plant mutualism, we compared the behavior, morphology, fitness, stable isotope signatures, and gaster microbiomes of A. octoarticulatus ants nesting in Cordia nodosa trees maintained for nearly a year with or without insect herbivores. At the end of the experiment, ants from herbivore exclosures preferred protein-rich baits more than ants in the control (i.e., herbivores present) treatment. Furthermore, workers in the control treatment were heavier than in the herbivore-exclusion treatment, and worker mass predicted reproductive output, suggesting that foraging for insect prey directly increased ant colony fitness. The gaster microbiome of ants was not significantly affected by the herbivore exclusion treatment. We conclude that the defensive behavior of some phytoecious ants is a by-product of their need for external protein sources; thus, the consumption of insect herbivores by ants benefits both the ant colony and the host plant. © 2017 by the Ecological Society of America.

  2. Ecosystem services delivered by weaver ants

    DEFF Research Database (Denmark)

    Offenberg, Joachim

    Weaver ants (Oecopgylla spp.) are increasingly being utilized as efficient biocontrol agents in a number of tropical tree crops, as they prey on pest insects and increase yields. However, recent studies and a review of the literature reveal that a number of other services may derive from the pres......Weaver ants (Oecopgylla spp.) are increasingly being utilized as efficient biocontrol agents in a number of tropical tree crops, as they prey on pest insects and increase yields. However, recent studies and a review of the literature reveal that a number of other services may derive from...... the presence of these ants. First of all, the chemical footprint left by the high density of ants in managed host trees may results in additional benefits. (i) Ant deposits may lead to improved fruit quality, e.g. increased sugar content, (ii) ant deposits may deter important pests (chemical deterrence) from...... crops, and lastly, (iii) ant waste products deposited ias anal spots contain urea that may be taken up by plant leaves and in this way fertilize ant-plants. On top of chemical services, weaver ants have been shown to reduce plant disease incidence via competitive exclusion of other ant species because...

  3. Roadside Survey of Ants on Oahu, Hawaii (United States)

    Tong, Reina L.; Grace, J. Kenneth; Krushelnycky, Paul D.


    Hawaii is home to over 60 ant species, including five of the six most damaging invasive ants. Although there have been many surveys of ants in Hawaii, the last island-wide hand-collection survey of ants on Oahu was conducted in 1988–1994. In 2012, a timed hand-collection of ants was made at 44 sites in a systematic, roadside survey throughout Oahu. Ants were identified and species distribution in relation to elevation, precipitation and soil type was analyzed. To assess possible convenience sampling bias, 15 additional sites were sampled further from roads to compare with the samples near roads. Twenty-four species of ants were found and mapped; Pheidole megacephala (F.), Ochetellus glaber (Mayr), and Technomyrmex difficilis Forel were the most frequently encountered ants. For six ant species, a logistic regression was performed with elevation, average annual precipitation, and soil order as explanatory variables. O. glaber was found in areas with lower precipitation around Oahu. Paratrechina longicornis (Latrielle) and Tetramorium simillimum (Smith, F.) were found more often in lower elevations and in areas with the Mollisol soil order. Elevation, precipitation, and soil type were not significant sources of variation for P. megacephala, Plagiolepis alluaudi Emery, and T. difficilis. P. megacephala was associated with fewer mean numbers of ants where it occurred. Ant assemblages near and far from roads did not significantly differ. Many species of ants remain established on Oahu, and recent invaders are spreading throughout the island. Mapping ant distributions contributes to continued documentation and understanding of these pests. PMID:29439503

  4. Ant Larval Demand Reduces Aphid Colony Growth Rates in an Ant-Aphid Interaction

    Directory of Open Access Journals (Sweden)

    James M. Cook


    Full Text Available Ants often form mutualistic interactions with aphids, soliciting honeydew in return for protective services. Under certain circumstances, however, ants will prey upon aphids. In addition, in the presence of ants aphids may increase the quantity or quality of honeydew produced, which is costly. Through these mechanisms, ant attendance can reduce aphid colony growth rates. However, it is unknown whether demand from within the ant colony can affect the ant-aphid interaction. In a factorial experiment, we tested whether the presence of larvae in Lasius niger ant colonies affected the growth rate of Aphis fabae colonies. Other explanatory variables tested were the origin of ant colonies (two separate colonies were used and previous diet (sugar only or sugar and protein. We found that the presence of larvae in the ant colony significantly reduced the growth rate of aphid colonies. Previous diet and colony origin did not affect aphid colony growth rates. Our results suggest that ant colonies balance the flow of two separate resources from aphid colonies- renewable sugars or a protein-rich meal, depending on demand from ant larvae within the nest. Aphid payoffs from the ant-aphid interaction may change on a seasonal basis, as the demand from larvae within the ant colony waxes and wanes.

  5. The distribution and diversity of insular ants

    DEFF Research Database (Denmark)

    Roura-Pascual, Núria; Sanders, Nate; Hui, Cang


    Aim: To examine the relationship between island characteristics (area, distance to the nearest continent, climate and human population size) and ant species richness, as well as the factors underlying global geographical clustering of native and exotic ant composition on islands. Location: One...... hundred and two islands from 20 island groups around the world. Methods: We used spatial linear models that consider the spatial structure of islands to examine patterns of ant species richness. We also performed modularity analyses to identify clusters of islands hosting a similar suite of species...... and constructed conditional inference trees to assess the characteristics of islands that explain the formation of these island-ant groups. Results: Island area was the best predictor of ant species richness. However, distance to the nearest continent was an important predictor of native ant species richness...

  6. Antígona y la muerte


    Pérez Alcolea, Simona Micaela


    La ponencia analiza la muerte de Antígona en la obra de Sófocles. Se propone que su suicidio es un acto consciente de voluntad preanunciado a lo largo de toda la obra y no una medida desesperada. Con ese fin se exploran las posibles motivaciones de Antígona para poner fin a su vida. En el análisis se proponen tres respuestas (no necesariamente excluyentes): -Antígona responde a la ética homérica. Está en lucha con Creón, y su suicidio es su golpe de gracia al poder del rey. -Antígona...

  7. Ant-plant symbioses: Stalking the chuyachaqui. (United States)

    Davidson, D W; McKey, D


    According to Quechua-speaking peoples, orchard-like stands ('Supay Chacras') of two Amazonian ant-plant species are cultivated by the devil, or 'Chuyachaqui'. These "devil gardens" offer extreme examples of specializations that have evolved repeatedly in ant-plant associations. Numerous investigations are beginning to disclose the identity of the Chuyachaqui - the forces behind evolutionary specialization in ant-plant symbioses. These developments have important implications for our understanding of modes of coevolution in symbiotic mutualism, remarkable convergent similarities in the form of ant-plant symbioses on different continents, and pronounced intercontinental differences in the diversity and taxonomic composition of associates. Copyright © 1993. Published by Elsevier Ltd.

  8. From Ant Trails to Pedestrian Dynamics

    Directory of Open Access Journals (Sweden)

    Andreas Schadschneider


    Full Text Available This paper presents a model for the simulation of pedestrian dynamics inspired by the behaviour of ants in ant trails. Ants communicate by producing a pheromone that can be smelled by other ants. In this model, pedestrians produce a virtual pheromone that influences the motion of others. In this way all interactions are strictly local, and so even large crowds can be simulated very efficiently. Nevertheless, the model is able to reproduce the collective effects observed empirically, eg the formation of lanes in counterflow. As an application, we reproduce a surprising result found in experiments of evacuation from an aircraft.

  9. Microorganisms transported by ants induce changes in floral nectar composition of an ant-pollinated plant. (United States)

    de Vega, Clara; Herrera, Carlos M


    Interactions between plants and ants abound in nature and have significant consequences for ecosystem functioning. Recently, it has been suggested that nectar-foraging ants transport microorganisms to flowers; more specifically, they transport yeasts, which can potentially consume sugars and alter nectar composition. Therefore, ants could indirectly change nectar sugar profile, an important floral feature involved in the plant-pollinator mutualism. But this novel role for ants has never been tested. We here investigate the effects of nectarivorous ants and their associated yeasts on the floral nectar sugar composition of an ant-pollinated plant. Differences in the nectar sugar composition of ant-excluded and ant-visited flowers were examined in 278 samples by using high-performance liquid-chromatography. The importance of the genetic identity and density of ant-transported basidiomycetous and ascomycetous yeasts on the variation of nectar traits was also evaluated. Ant visitation had significant effects on nectar sugar composition. The nectar of ant-visited flowers contained significantly more fructose, more glucose, and less sucrose than the nectar of ant-excluded flowers, but these effects were context dependent. Nectar changes were correlated with the density of yeast cells in nectar. The magnitude of the effects of ant-transported ascomycetes was much higher than that of basiodiomycetes. Ants and their associated yeasts induce changes in nectar sugar traits, reducing the chemical control of the plant over this important floral trait. The potential relevance of this new role for ants as indirect nectar modifiers is a rich topic for future research into the ecology of ant-flower interactions.

  10. Pollination and facultative ant-association in the African leopard ...

    African Journals Online (AJOL)

    The role of extra-floral nectar appears to be recruitment of foraging ants to tend the flowers resulting in a facultative ant-association between the orchid and gregarious ants. Four different ant species were found to forage on A. africana's inflorescences. Ant-tended inflorescences suffered significantly less damage by insects.

  11. Michael Jackson antes del caos


    Juan Luciano Nieves


    Michael Jackson es un buen ejemplo de cómo utilizar las relaciones públicas para realizar o manipular la imagen de un producto a través de los medios de comunicación. Este ensayo pretende analizar los eventos que tuvieron lugar antes de que el cantante fuera acusado de abuso sexual contra un menor. Dichos eventos formaron parte de un plan muy bien delineado para disminuir los efectos de la inminente crisis que se acercaba. Este trabajo combina la crítica retórica de temas de fantasía con teor...

  12. Viaje Antártico


    Lasa, Gorka


    Ah, qué grandiosa sensación esta de poder caminar por los eternos hielos y dejar que mi vista se pierda en el horizonte crepuscular de esta desolada región! Aquellas solitarias islas, lamentos blancos en la distancia, aquellos azules glaciares llorando su neblina de frío y siglos. Al llamado lejano, mi alma se ve arrastrada por los vientos australes. Mítico ensueño que genera en mi imaginación el gran continente antártico. Belleza misteriosa e intimidante de la vastedad casi mágica que envuel...

  13. Foliar uptake of nitrogen from ant fecal droplets: an overlooked service to ant plants

    DEFF Research Database (Denmark)

    Pinkalski, Christian Alexander Stidsen; Jensen, Karl-Martin Vagn; Damgaard, Christian Frølund


    and subsequently deposited fecal droplets on the seedlings, coffee leaves showed increased levels of 15N and total N compared to control plants without ants. This was evident for both exposed leaves and leaves covered in plastic bags (i.e. not directly exposed to ants). Thus, N from ant excretions was absorbed...

  14. The evolution of genome size in ants

    Directory of Open Access Journals (Sweden)

    Spagna Joseph C


    Full Text Available Abstract Background Despite the economic and ecological importance of ants, genomic tools for this family (Formicidae remain woefully scarce. Knowledge of genome size, for example, is a useful and necessary prerequisite for the development of many genomic resources, yet it has been reported for only one ant species (Solenopsis invicta, and the two published estimates for this species differ by 146.7 Mb (0.15 pg. Results Here, we report the genome size for 40 species of ants distributed across 10 of the 20 currently recognized subfamilies, thus making Formicidae the 4th most surveyed insect family and elevating the Hymenoptera to the 5th most surveyed insect order. Our analysis spans much of the ant phylogeny, from the less derived Amblyoponinae and Ponerinae to the more derived Myrmicinae, Formicinae and Dolichoderinae. We include a number of interesting and important taxa, including the invasive Argentine ant (Linepithema humile, Neotropical army ants (genera Eciton and Labidus, trapjaw ants (Odontomachus, fungus-growing ants (Apterostigma, Atta and Sericomyrmex, harvester ants (Messor, Pheidole and Pogonomyrmex, carpenter ants (Camponotus, a fire ant (Solenopsis, and a bulldog ant (Myrmecia. Our results show that ants possess small genomes relative to most other insects, yet genome size varies three-fold across this insect family. Moreover, our data suggest that two whole-genome duplications may have occurred in the ancestors of the modern Ectatomma and Apterostigma. Although some previous studies of other taxa have revealed a relationship between genome size and body size, our phylogenetically-controlled analysis of this correlation did not reveal a significant relationship. Conclusion This is the first analysis of genome size in ants (Formicidae and the first across multiple species of social insects. We show that genome size is a variable trait that can evolve gradually over long time spans, as well as rapidly, through processes that may

  15. Hybrid chaotic ant swarm optimization

    International Nuclear Information System (INIS)

    Li Yuying; Wen Qiaoyan; Li Lixiang; Peng Haipeng


    Chaotic ant swarm optimization (CASO) is a powerful chaos search algorithm that is used to find the global optimum solution in search space. However, the CASO algorithm has some disadvantages, such as lower solution precision and longer computational time, when solving complex optimization problems. To resolve these problems, an improved CASO, called hybrid chaotic swarm optimization (HCASO), is proposed in this paper. The new algorithm introduces preselection operator and discrete recombination operator into the CASO; meanwhile it replaces the best position found by own and its neighbors' ants with the best position found by preselection operator and discrete recombination operator in evolution equation. Through testing five benchmark functions with large dimensionality, the experimental results show the new method enhances the solution accuracy and stability greatly, as well as reduces the computational time and computer memory significantly when compared to the CASO. In addition, we observe the results can become better with swarm size increasing from the sensitivity study to swarm size. And we gain some relations between problem dimensions and swam size according to scalability study.

  16. The Biochemical Toxin Arsenal from Ant Venoms

    Directory of Open Access Journals (Sweden)

    Axel Touchard


    Full Text Available Ants (Formicidae represent a taxonomically diverse group of hymenopterans with over 13,000 extant species, the majority of which inject or spray secretions from a venom gland. The evolutionary success of ants is mostly due to their unique eusociality that has permitted them to develop complex collaborative strategies, partly involving their venom secretions, to defend their nest against predators, microbial pathogens, ant competitors, and to hunt prey. Activities of ant venom include paralytic, cytolytic, haemolytic, allergenic, pro-inflammatory, insecticidal, antimicrobial, and pain-producing pharmacologic activities, while non-toxic functions include roles in chemical communication involving trail and sex pheromones, deterrents, and aggregators. While these diverse activities in ant venoms have until now been largely understudied due to the small venom yield from ants, modern analytical and venomic techniques are beginning to reveal the diversity of toxin structure and function. As such, ant venoms are distinct from other venomous animals, not only rich in linear, dimeric and disulfide-bonded peptides and bioactive proteins, but also other volatile and non-volatile compounds such as alkaloids and hydrocarbons. The present review details the unique structures and pharmacologies of known ant venom proteinaceous and alkaloidal toxins and their potential as a source of novel bioinsecticides and therapeutic agents.

  17. Hey! A Fire Ant Stung Me! (United States)

    ... Videos for Educators Search English Español Hey! A Fire Ant Stung Me! KidsHealth / For Kids / Hey! A ... Me picó una roja o colorada! What's a Fire Ant? There are many different types of fire ...

  18. The Biochemical Toxin Arsenal from Ant Venoms (United States)

    Touchard, Axel; Aili, Samira R.; Fox, Eduardo Gonçalves Paterson; Escoubas, Pierre; Orivel, Jérôme; Nicholson, Graham M.; Dejean, Alain


    Ants (Formicidae) represent a taxonomically diverse group of hymenopterans with over 13,000 extant species, the majority of which inject or spray secretions from a venom gland. The evolutionary success of ants is mostly due to their unique eusociality that has permitted them to develop complex collaborative strategies, partly involving their venom secretions, to defend their nest against predators, microbial pathogens, ant competitors, and to hunt prey. Activities of ant venom include paralytic, cytolytic, haemolytic, allergenic, pro-inflammatory, insecticidal, antimicrobial, and pain-producing pharmacologic activities, while non-toxic functions include roles in chemical communication involving trail and sex pheromones, deterrents, and aggregators. While these diverse activities in ant venoms have until now been largely understudied due to the small venom yield from ants, modern analytical and venomic techniques are beginning to reveal the diversity of toxin structure and function. As such, ant venoms are distinct from other venomous animals, not only rich in linear, dimeric and disulfide-bonded peptides and bioactive proteins, but also other volatile and non-volatile compounds such as alkaloids and hydrocarbons. The present review details the unique structures and pharmacologies of known ant venom proteinaceous and alkaloidal toxins and their potential as a source of novel bioinsecticides and therapeutic agents. PMID:26805882

  19. Ant aggression and evolutionary stability in plant-ant and plant-pollinator mutualistic interactions. (United States)

    Oña, L; Lachmann, M


    Mutualistic partners derive a benefit from their interaction, but this benefit can come at a cost. This is the case for plant-ant and plant-pollinator mutualistic associations. In exchange for protection from herbivores provided by the resident ants, plants supply various kinds of resources or nests to the ants. Most ant-myrmecophyte mutualisms are horizontally transmitted, and therefore, partners share an interest in growth but not in reproduction. This lack of alignment in fitness interests between plants and ants drives a conflict between them: ants can attack pollinators that cross-fertilize the host plants. Using a mathematical model, we define a threshold in ant aggressiveness determining pollinator survival or elimination on the host plant. In our model we observed that, all else being equal, facultative interactions result in pollinator extinction for lower levels of ant aggressiveness than obligatory interactions. We propose that the capacity to discriminate pollinators from herbivores should not often evolve in ants, and when it does it will be when the plants exhibit limited dispersal in an environment that is not seed saturated so that each seed produced can effectively generate a new offspring or if ants acquire an extra benefit from pollination (e.g. if ants eat fruit). We suggest specific mutualism examples where these hypotheses can be tested empirically. © 2010 The Authors. Journal of Evolutionary Biology © 2010 European Society For Evolutionary Biology.

  20. AntStar: Enhancing Optimization Problems by Integrating an Ant System and A⁎ Algorithm

    Directory of Open Access Journals (Sweden)

    Mohammed Faisal


    Full Text Available Recently, nature-inspired techniques have become valuable to many intelligent systems in different fields of technology and science. Among these techniques, Ant Systems (AS have become a valuable technique for intelligent systems in different fields. AS is a computational system inspired by the foraging behavior of ants and intended to solve practical optimization problems. In this paper, we introduce the AntStar algorithm, which is swarm intelligence based. AntStar enhances the optimization and performance of an AS by integrating the AS and A⁎ algorithm. Applying the AntStar algorithm to the single-source shortest-path problem has been done to ensure the efficiency of the proposed AntStar algorithm. The experimental result of the proposed algorithm illustrated the robustness and accuracy of the AntStar algorithm.

  1. Cryptococcus neoformans carried by Odontomachus bauri ants

    Directory of Open Access Journals (Sweden)

    Mariana Santos de Jesus


    Full Text Available Cryptococcus neoformans is the most common causative agent of cryptococcosis worldwide. Although this fungus has been isolated from a variety of organic substrates, several studies suggest that hollow trees constitute an important natural niche for C. neoformans. A previously surveyed hollow of a living pink shower tree (Cassia grandis positive for C. neoformans in the city of Rio de Janeiro, Brazil, was chosen for further investigation. Odontomachus bauri ants (trap-jaw ants found inside the hollow were collected for evaluation as possible carriers of Cryptococcus spp. Two out of 10 ants were found to carry phenoloxidase-positive colonies identified as C. neoformans molecular types VNI and VNII. The ants may have acted as a mechanical vector of C. neoformans and possibly contributed to the dispersal of the fungi from one substrate to another. To the best of our knowledge, this is the first report on the association of C. neoformans with ants of the genus Odontomachus.

  2. Recurrence analysis of ant activity patterns.

    Directory of Open Access Journals (Sweden)

    Felipe Marcel Neves

    Full Text Available In this study, we used recurrence quantification analysis (RQA and recurrence plots (RPs to compare the movement activity of individual workers of three ant species, as well as a gregarious beetle species. RQA and RPs quantify the number and duration of recurrences of a dynamical system, including a detailed quantification of signals that could be stochastic, deterministic, or both. First, we found substantial differences between the activity dynamics of beetles and ants, with the results suggesting that the beetles have quasi-periodic dynamics and the ants do not. Second, workers from different ant species varied with respect to their dynamics, presenting degrees of predictability as well as stochastic signals. Finally, differences were found among minor and major caste of the same (dimorphic ant species. Our results underscore the potential of RQA and RPs in the analysis of complex behavioral patterns, as well as in general inferences on animal behavior and other biological phenomena.

  3. Ants defend aphids against lethal disease (United States)

    Nielsen, Charlotte; Agrawal, Anurag A.; Hajek, Ann E.


    Social insects defend their own colonies and some species also protect their mutualist partners. In mutualisms with aphids, ants typically feed on honeydew produced by aphids and, in turn guard and shelter aphid colonies from insect natural enemies. Here we report that Formica podzolica ants tending milkweed aphids, Aphis asclepiadis, protect aphid colonies from lethal fungal infections caused by an obligate aphid pathogen, Pandora neoaphidis. In field experiments, bodies of fungal-killed aphids were quickly removed from ant-tended aphid colonies. Ant workers were also able to detect infective conidia on the cuticle of living aphids and responded by either removing or grooming these aphids. Our results extend the long-standing view of ants as mutualists and protectors of aphids by demonstrating focused sanitizing and quarantining behaviour that may lead to reduced disease transmission in aphid colonies. PMID:19923138

  4. Persistence of pollination mutualisms in the presence of ants. (United States)

    Wang, Yuanshi; Wang, Shikun


    This paper considers plant-pollinator-ant systems in which the plant-pollinator interaction is mutualistic but ants have both positive and negative effects on plants. The ants also interfere with pollinators by preventing them from accessing plants. While a Beddington-DeAngelis (BD) formula can describe the plant-pollinator interaction, the formula is extended in this paper to characterize the pollination mutualism under the ant interference. Then, a plant-pollinator-ant system with the extended BD functional response is discussed, and global dynamics of the model demonstrate the mechanisms by which pollination mutualism can persist in the presence of ants. When the ant interference is strong, it can result in extinction of pollinators. Moreover, if the ants depend on pollination mutualism for survival, the strong interference could drive pollinators into extinction, which consequently lead to extinction of the ants themselves. When the ant interference is weak, a cooperation between plant-ant and plant-pollinator mutualisms could occur, which promotes survival of both ants and pollinators, especially in the case that ants (respectively, pollinators) cannot survive in the absence of pollinators (respectively, ants). Even when the level of ant interference remains invariant, varying ants' negative effect on plants can result in survival/extinction of both ants and pollinators. Therefore, our results provide an explanation for the persistence of pollination mutualism when there exist ants.

  5. Michael Jackson antes del caos

    Directory of Open Access Journals (Sweden)

    Juan Luciano Nieves


    Full Text Available Michael Jackson es un buen ejemplo de cómo utilizar las relaciones públicas para realizar o manipular la imagen de un producto a través de los medios de comunicación. Este ensayo pretende analizar los eventos que tuvieron lugar antes de que el cantante fuera acusado de abuso sexual contra un menor. Dichos eventos formaron parte de un plan muy bien delineado para disminuir los efectos de la inminente crisis que se acercaba. Este trabajo combina la crítica retórica de temas de fantasía con teoría de comunicación.

  6. Individual Recognition in Ant Queens

    DEFF Research Database (Denmark)

    D'Ettorre, Patrizia; Heinze, Jürgen


    Personal relationships are the cornerstone of vertebrate societies, but insect societies are either too large for individual recognition, or their members were assumed to lack the necessary cognitive abilities 1 and 2 . This paradigm has been challenged by the recent discovery that paper wasps...... recognize each other's unique facial color patterns [3] . Individual recognition is advantageous when dominance hierarchies control the partitioning of work and reproduction 2 and 4 . Here, we show that unrelated founding queens of the ant Pachycondyla villosa use chemical cues to recognize each other...... individually. Aggression was significantly lower in pairs of queens that had previously interacted than in pairs with similar social history but no experience with one another. Moreover, subordinates discriminated familiar and unfamiliar dominants in choice experiments in which physical contact, but not odor...

  7. FDTD-ANT User Manual (United States)

    Zimmerman, Martin L.


    This manual explains the theory and operation of the finite-difference time domain code FDTD-ANT developed by Analex Corporation at the NASA Lewis Research Center in Cleveland, Ohio. This code can be used for solving electromagnetic problems that are electrically small or medium (on the order of 1 to 50 cubic wavelengths). Calculated parameters include transmission line impedance, relative effective permittivity, antenna input impedance, and far-field patterns in both the time and frequency domains. The maximum problem size may be adjusted according to the computer used. This code has been run on the DEC VAX and 486 PC's and on workstations such as the Sun Sparc and the IBM RS/6000.

  8. Harnessing ant defence at fruits reduces bruchid seed predation in a symbiotic ant-plant mutualism. (United States)

    Pringle, Elizabeth G


    In horizontally transmitted mutualisms, mutualists disperse separately and reassemble in each generation with partners genetically unrelated to those in the previous generation. Because of this, there should be no selection on either partner to enhance the other's reproductive output directly. In symbiotic ant-plant mutualisms, myrmecophytic plants host defensive ant colonies, and ants defend the plants from herbivores. Plants and ants disperse separately, and, although ant defence can indirectly increase plant reproduction by reducing folivory, it is unclear whether ants can also directly increase plant reproduction by defending seeds. The neotropical tree Cordia alliodora hosts colonies of Azteca pittieri ants. The trees produce domatia where ants nest at stem nodes and also at the node between the peduncle and the rachides of the infloresence. Unlike the stem domatia, these reproductive domatia senesce after the tree fruits each year. In this study, I show that the tree's resident ant colony moves into these ephemeral reproductive domatia, where they tend honeydew-producing scale insects and patrol the nearby developing fruits. The presence of ants significantly reduced pre-dispersal seed predation by Amblycerus bruchid beetles, thereby directly increasing plant reproductive output.

  9. Collective search by ants in microgravity

    Directory of Open Access Journals (Sweden)

    Stefanie M. Countryman


    Full Text Available The problem of collective search is a tradeoff between searching thoroughly and covering as much area as possible. This tradeoff depends on the density of searchers. Solutions to the problem of collective search are currently of much interest in robotics and in the study of distributed algorithms, for example to design ways that without central control robots can use local information to perform search and rescue operations. Ant colonies operate without central control. Because they can perceive only local, mostly chemical and tactile cues, they must search collectively to find resources and to monitor the colony's environment. Examining how ants in diverse environments solve the problem of collective search can elucidate how evolution has led to diverse forms of collective behavior. An experiment on the International Space Station in January 2014 examined how ants (Tetramorium caespitum perform collective search in microgravity. In the ISS experiment, the ants explored a small arena in which a barrier was lowered to increase the area and thus lower ant density. In microgravity, relative to ground controls, ants explored the area less thoroughly and took more convoluted paths. It appears that the difficulty of holding on to the surface interfered with the ants’ ability to search collectively. Ants frequently lost contact with the surface, but showed a remarkable ability to regain contact with the surface.

  10. Ant-lepidopteran associations along African forest edges (United States)

    Dejean, Alain; Azémar, Frédéric; Libert, Michel; Compin, Arthur; Hérault, Bruno; Orivel, Jérôme; Bouyer, Thierry; Corbara, Bruno


    Working along forest edges, we aimed to determine how some caterpillars can co-exist with territorially dominant arboreal ants (TDAAs) in tropical Africa. We recorded caterpillars from 22 lepidopteran species living in the presence of five TDAA species. Among the defoliator and/or nectarivorous caterpillars that live on tree foliage, the Pyralidae and Nymphalidae use their silk to protect themselves from ant attacks. The Notodontidae and lycaenid Polyommatinae and Theclinae live in direct contact with ants; the Theclinae even reward ants with abundant secretions from their Newcomer gland. Lichen feeders (lycaenid; Poritiinae), protected by long bristles, also live among ants. Some lycaenid Miletinae caterpillars feed on ant-attended membracids, including in the shelters where the ants attend them; Lachnocnema caterpillars use their forelegs to obtain trophallaxis from their host ants. Caterpillars from other species live inside weaver ant nests. Those of the genus Euliphyra (Miletinae) feed on ant prey and brood and can obtain trophallaxis, while those from an Eberidae species only prey on host ant eggs. Eublemma albifascia (Erebidae) caterpillars use their thoracic legs to obtain trophallaxis and trophic eggs from ants. Through transfer bioassays of last instars, we noted that herbivorous caterpillars living in contact with ants were always accepted by alien conspecific ants; this is likely due to an intrinsic appeasing odor. Yet, caterpillars living in ant shelters or ant nests probably acquire cues from their host colonies because they were considered aliens and killed. We conclude that co-evolution with ants occurred similarly in the Heterocera and Rhopalocera.

  11. Pheromone disruption of Argentine ant trail integrity (United States)

    Suckling, D.M.; Peck, R.W.; Manning, L.M.; Stringer, L.D.; Cappadonna, J.; El-Sayed, A. M.


    Disruption of Argentine ant trail following and reduced ability to forage (measured by bait location success) was achieved after presentation of an oversupply of trail pheromone, (Z)-9-hexadecenal. Experiments tested single pheromone point sources and dispersion of a formulation in small field plots. Ant walking behavior was recorded and digitized by using video tracking, before and after presentation of trail pheromone. Ants showed changes in three parameters within seconds of treatment: (1) Ants on trails normally showed a unimodal frequency distribution of walking track angles, but this pattern disappeared after presentation of the trail pheromone; (2) ants showed initial high trail integrity on a range of untreated substrates from painted walls to wooden or concrete floors, but this was significantly reduced following presentation of a point source of pheromone; (3) the number of ants in the pheromone-treated area increased over time, as recruitment apparently exceeded departures. To test trail disruption in small outdoor plots, the trail pheromone was formulated with carnuba wax-coated quartz laboratory sand (1 g quartz sand/0.2 g wax/1 mg pheromone). The pheromone formulation, with a half-life of 30 h, was applied by rotary spreader at four rates (0, 2.5, 7.5, and 25 mg pheromone/m2) to 1- and 4-m2 plots in Volcanoes National Park, Hawaii. Ant counts at bait cards in treated plots were significantly reduced compared to controls on the day of treatment, and there was a significant reduction in ant foraging for 2 days. These results show that trail pheromone disruption of Argentine ants is possible, but a much more durable formulation is needed before nest-level impacts can be expected. ?? 2008 Springer Science+Business Media, LLC.

  12. What do myrmecophagous geckos eat when ants are not available ...

    African Journals Online (AJOL)

    Like other Pristurus species, P. samhaensis on Samha and P. sokotranus on Socotra were highly myrmecophagous (76.7% and 38.6% ants, respectively). However, ants were absent from the diet of P. samhaensis on Darsa. In contrast to the rich native ant fauna of the other islands, only one ant species was reported for ...

  13. Ants as tools in sustainable agriculture

    DEFF Research Database (Denmark)

    Offenberg, Joachim


    1. With an expanding human population placing increasing pressure on the environment, agriculture needs sustainable production that can match conventional methods. Integrated pest management (IPM) is more sustainable, but not necessarily as efficient as conventional non-sustainable measures. 2...... in multiple crops. Their efficiency is comparable to chemical pesticides or higher, while at lower costs. They provide a rare example of documented efficient conservation biological control. 3. Weaver ants share beneficial traits with almost 13 000 other ant species and are unlikely to be unique...... of agricultural systems, this review emphasizes the potential of managing ants to achieve sustainable pest management solutions. The synthesis suggests future directions and may catalyse a research agenda on the utilization of ants, not only against arthropod pests, but also against weeds and plant diseases...

  14. Kunstikriitik Ants Juske sai doktoriks / Neeme Korv

    Index Scriptorium Estoniae

    Korv, Neeme, 1974-


    Tartu Kõrgema Kunstikooli rektor Ants Juske kaitses 7. veebruaril Tallinnas Kunstiakadeemias edukalt doktoriväitekirja, juhendajaks oli professor Boris Bernštein ning oponeerisid doktor Altti Kuusamo Soomest ja professor Peeter Tulviste

  15. Fungal enzymes in the attine ant symbiosis

    DEFF Research Database (Denmark)

    de Fine Licht, Henrik Hjarvard; Schiøtt, Morten; Boomsma, Jacobus Jan

    the more basal attine genera use substrates such as flowers, plant debris, small twigs, insect feces and insect carcasses. This diverse array of fungal substrates across the attine lineage implies that the symbiotic fungus needs different enzymes to break down the plant material that the ants provide...... or different efficiencies of enzyme function. Fungal enzymes that degrade plant cell walls may have functionally co-evolved with the ants in this scenario. We explore this hypothesis with direct measurements of enzyme activity in fungus gardens in 12 species across 8 genera spanning the entire phylogeny...... and diversity of life-styles within the attine clade. We find significant differences in enzyme activity between different genera and life-styles of the ants. How these findings relate to attine ant coevolution and crop optimization are discussed....

  16. Exotic ants (Hymenoptera, Formicidae) of Ohio




    The worldwide transfer of plants and animals outside their native ranges is an ever increasing problem for global biodiversity. Ants are no exception and many species have been transported to new locations often with profound negative impacts on local biota. The current study is based on data gathered since the publication of the “Ants of Ohio” in 2005. Here I expand on our knowledge of Ohio’s myrmecofauna by contributing new records, new distributional information and natural history notes. ...

  17. Improving Emergency Management by Modeling Ant Colonies (United States)


    perform functions such as nursing the brood or maintaining the nest. The more mature workers will begin to travel outside the nest to perform foraging...small sized ants predominantly act in functional roles such as nurses or transport services within the nest. The larger sizes predominantly function...stages: the founding stage, the ergonomic stage, and the reproductive stage. The founding stage is marked by a queen ant successful mating and laying

  18. Extrafloral nectar fuels ant life in deserts


    Aranda-Rickert, Adriana; Diez, Patricia; Marazzi, Brigitte


    Interactions mediated by extrafloral nectary (EFN)-bearing plants that reward ants with a sweet liquid secretion are well documented in temperate and tropical habitats. However, their distribution and abundance in deserts are poorly known. In this study, we test the predictions that biotic interactions between EFN plants and ants are abundant and common also in arid communities and that EFNs are only functional when new vegetative and reproductive structures are developing. In a seasonal dese...

  19. Chemically armed mercenary ants protect fungus-farming societies

    DEFF Research Database (Denmark)

    Adams, Rachelle Martha Marie; Liberti, Joanito; Illum, Anders A.


    guest ants are sufficient to kill raiders that invariably exterminate host nests without a cohabiting guest ant colony. We also show that the odor of guest ants discourages raider scouts from recruiting nestmates to host colonies. Our results imply that Sericomyrmex fungus-growers obtain a net benefit......The ants are extraordinary in having evolved many lineages that exploit closely related ant societies as social parasites, but social parasitism by distantly related ants is rare. Here we document the interaction dynamics among a Sericomyrmex fungus-growing ant host, a permanently associated...... parasitic guest ant of the genus Megalomyrmex, and a raiding agro-predator of the genus Gnamptogenys. We show experimentally that the guest ants protect their host colonies against agro-predator raids using alkaloid venom that is much more potent than the biting defenses of the host ants. Relatively few...

  20. Toxic industrial deposit remediation by ant activity (United States)

    Jilkova, Veronika; Frouz, Jan


    Toxic industrial deposits are often contaminated by heavy metals and the substrates have low pH values. In such systems, soil development is thus slowed down by high toxicity and acidic conditions which are unfavourable to soil fauna. Ants (Hymenoptera, Formicidae) are considered tolerant to heavy metal pollution and are known to increase organic matter content and microbial activity in their nests. Here, we focused on soil remediation caused by three ant species (Formica sanguinea, Lasius niger, and Tetramorium sp.) in an ore-washery sedimentation basin near Chvaletice (Czech Republic). Soil samples were taken from the centre of ant nests and from the nest surroundings (>3 m from nests). Samples were then analyzed for microbial activity and biomass and contents of organic matter and nutrients. As a result, ant species that most influenced soil properties was F. sanguinea as there were higher microbial activity and total nitrogen and ammonia contents in ant nests than in the surrounding soil. We expected such a result because F. sanguinea builds conspicuous large nests and is a carnivorous species that brings substantial amounts of nitrogen in insect prey to their nests. Effects of the other two ant species might be lower because of smaller nests and different feeding habits as they rely mainly on honeydew from aphids or on plant seeds that do not contain much nutrients.

  1. Congestion and communication in confined ant traffic (United States)

    Gravish, Nick; Gold, Gregory; Zangwill, Andrew; Goodisman, Michael A. D.; Goldman, Daniel I.


    Many social animals move and communicate within confined spaces. In subterranean fire ants Solenopsis invicta, mobility within crowded nest tunnels is important for resource and information transport. Within confined tunnels, communication and traffic flow are at odds: trafficking ants communicate through tactile interactions while stopped, yet ants that stop to communicate impose physical obstacles on the traffic. We monitor the bi-directional flow of fire ant workers in laboratory tunnels of varied diameter D. The persistence time of communicating ant aggregations, τ, increases approximately linearly with the number of participating ants, n. The sensitivity of traffic flow increases as D decreases and diverges at a minimum diameter, Dc. A cellular automata model incorporating minimal traffic features--excluded volume and communication duration--reproduces features of the experiment. From the model we identify a competition between information transfer and the need to maintain jam-free traffic flow. We show that by balancing information transfer and traffic flow demands, an optimum group strategy exists which maximizes information throughput. We acknowledge funding from NSF PoLS #0957659 and #PHY-1205878.

  2. Fire ants perpetually rebuild sinking towers (United States)

    Phonekeo, Sulisay; Mlot, Nathan; Monaenkova, Daria; Hu, David L.; Tovey, Craig


    In the aftermath of a flood, fire ants, Solenopsis invicta, cluster into temporary encampments. The encampments can contain hundreds of thousands of ants and reach over 30 ants high. How do ants build such tall structures without being crushed? In this combined experimental and theoretical study, we investigate the shape and rate of construction of ant towers around a central support. The towers are bell shaped, consistent with towers of constant strength such as the Eiffel tower, where each element bears an equal load. However, unlike the Eiffel tower, the ant tower is built through a process of trial and error, whereby failed portions avalanche until the final shape emerges. High-speed and novel X-ray videography reveal that the tower constantly sinks and is rebuilt, reminiscent of large multicellular systems such as human skin. We combine the behavioural rules that produce rafts on water with measurements of adhesion and attachment strength to model the rate of growth of the tower. The model correctly predicts that the growth rate decreases as the support diameter increases. This work may inspire the design of synthetic swarms capable of building in vertical layers.

  3. The distribution of weaver ant pheromones on host trees

    DEFF Research Database (Denmark)

    Offenberg, Joachim


    The visible anal spots deposited by Oecophylla smaragdina ants have been suggested to deter ant prey, affect interspecific competition and facilitate mutualists and parasites in tracking down Oecophylla ants. I measured the density of anal spots on host trees with and without ants and tested for ...... to leaves. Also there was a positive correlation between spot density and the likelihood of being detected by ants. Anal spots may thus function as reliable cues to interacting species and be an important factor in shaping the community around Oecophylla colonies.......The visible anal spots deposited by Oecophylla smaragdina ants have been suggested to deter ant prey, affect interspecific competition and facilitate mutualists and parasites in tracking down Oecophylla ants. I measured the density of anal spots on host trees with and without ants and tested...... for correlations between spot density, ant activity and the likelihood of being detected by an ant. Spots were only found on trees with ants. On ant-trees, spots were distributed throughout the trees but with higher densities in areas with high ant activity and pheromone densities were higher on twigs compared...

  4. Fuzzy Rules for Ant Based Clustering Algorithm

    Directory of Open Access Journals (Sweden)

    Amira Hamdi


    Full Text Available This paper provides a new intelligent technique for semisupervised data clustering problem that combines the Ant System (AS algorithm with the fuzzy c-means (FCM clustering algorithm. Our proposed approach, called F-ASClass algorithm, is a distributed algorithm inspired by foraging behavior observed in ant colonyT. The ability of ants to find the shortest path forms the basis of our proposed approach. In the first step, several colonies of cooperating entities, called artificial ants, are used to find shortest paths in a complete graph that we called graph-data. The number of colonies used in F-ASClass is equal to the number of clusters in dataset. Hence, the partition matrix of dataset founded by artificial ants is given in the second step, to the fuzzy c-means technique in order to assign unclassified objects generated in the first step. The proposed approach is tested on artificial and real datasets, and its performance is compared with those of K-means, K-medoid, and FCM algorithms. Experimental section shows that F-ASClass performs better according to the error rate classification, accuracy, and separation index.

  5. Kin-informative recognition cues in ants

    DEFF Research Database (Denmark)

    Nehring, Volker; Evison, Sophie E F; Santorelli, Lorenzo A


    behaviour is thought to be rare in one of the classic examples of cooperation--social insect colonies--because the colony-level costs of individual selfishness select against cues that would allow workers to recognize their closest relatives. In accord with this, previous studies of wasps and ants have...... found little or no kin information in recognition cues. Here, we test the hypothesis that social insects do not have kin-informative recognition cues by investigating the recognition cues and relatedness of workers from four colonies of the ant Acromyrmex octospinosus. Contrary to the theoretical...... prediction, we show that the cuticular hydrocarbons of ant workers in all four colonies are informative enough to allow full-sisters to be distinguished from half-sisters with a high accuracy. These results contradict the hypothesis of non-heritable recognition cues and suggest that there is more potential...

  6. Ant parasite queens revert to mating singly

    DEFF Research Database (Denmark)

    Sumner, Seirian; Hughes, William Owen Hamar; Pedersen, Jes Søe


    quantified and they tend to be similar in related species. Here we compare the mating strategies of the leaf-cutting ant Acromyrmex echinatior and its recently derived social parasite Acromyrmex insinuator, which is also its closest relative 2 (see Fig. 1 ). We find that although the host queens mate with up......A parasitic ant has abandoned the multiple mating habit of the queens of its related host. Multiple mating (polyandry) is widespread among animal groups, particularly insects 1 . But the factors that maintain it and underlie its evolution are hard to verify because benefits and costs are not easily...... to a dozen different males, the social parasite mates only singly. This rapid and surprising reversion to single mating in a socially parasitic ant indicates that the costs of polyandry are probably specific to a free-living lifestyle....

  7. The worldwide expansion of the Argentine ant

    DEFF Research Database (Denmark)

    Vogel, Valerie; Pedersen, Jes Søe; Giraud, Tatiana


    Aim The aim of this study was to determine the number of successful establishments of the invasive Argentine ant outside native range and to see whether introduced supercolonies have resulted from single or multiple introductions. We also compared the genetic diversity of native versus introduced...... supercolonies to assess the size of the propagules (i.e. the number of founding individuals) at the origin of the introduced supercolonies. Location Global. Methods We used mitochondrial DNA (mtDNA) markers and microsatellite loci to study 39 supercolonies of the Argentine ant Linepithema humile covering both......) and secondary introductions (from sites with established invasive supercolonies) were important in the global expansion of the Argentine ant. In combination with the similar social organization of colonies in the native and introduced range, this indicates that invasiveness did not evolve recently as a unique...

  8. Desert ants learn vibration and magnetic landmarks.

    Directory of Open Access Journals (Sweden)

    Cornelia Buehlmann

    Full Text Available The desert ants Cataglyphis navigate not only by path integration but also by using visual and olfactory landmarks to pinpoint the nest entrance. Here we show that Cataglyphis noda can additionally use magnetic and vibrational landmarks as nest-defining cues. The magnetic field may typically provide directional rather than positional information, and vibrational signals so far have been shown to be involved in social behavior. Thus it remains questionable if magnetic and vibration landmarks are usually provided by the ants' habitat as nest-defining cues. However, our results point to the flexibility of the ants' navigational system, which even makes use of cues that are probably most often sensed in a different context.

  9. Ant-plants and fungi: a new threeway symbiosis. (United States)

    Defossez, Emmanuel; Selosse, Marc-André; Dubois, Marie-Pierre; Mondolot, Laurence; Faccio, Antonella; Djieto-Lordon, Champlain; McKey, Doyle; Blatrix, Rumsaïs


    Symbioses between plants and fungi, fungi and ants, and ants and plants all play important roles in ecosystems. Symbioses involving all three partners appear to be rare. Here, we describe a novel tripartite symbiosis in which ants and a fungus inhabit domatia of an ant-plant, and present evidence that such interactions are widespread. We investigated 139 individuals of the African ant-plant Leonardoxa africana for occurrence of fungus. Behaviour of mutualist ants toward the fungus within domatia was observed using a video camera fitted with an endoscope. Fungi were identified by sequencing a fragment of their ribosomal DNA. Fungi were always present in domatia occupied by mutualist ants but never in domatia occupied by opportunistic or parasitic ants. Ants appear to favour the propagation, removal and maintenance of the fungus. Similar fungi were associated with other ant-plants in Cameroon. All belong to the ascomycete order Chaetothyriales; those from L. africana formed a monophyletic clade. These new plant-ant-fungus associations seem to be specific, as demonstrated within Leonardoxa and as suggested by fungal phyletic identities. Such tripartite associations are widespread in African ant-plants but have long been overlooked. Taking fungal partners into account will greatly enhance our understanding of symbiotic ant-plant mutualisms.

  10. Ants of the Peloponnese, Greece (Hymenoptera: Formicidae

    Directory of Open Access Journals (Sweden)

    Borowiec Lech


    Full Text Available This paper relates to material obtained during two field trips to the Peloponnese in 2013 and 2016. With the inclusion of some hitherto unpublished ant material, it gives new records from a total of 92 sampling localities. 129 species (including morphospecies not attributed to any known taxon of ants have been recorded from the Peloponnese (southern Greece, 27 of which have been recorded from this region for the first time. Lasius reginae and 5 other morphospecies attributed only to species complexes are new to Greece.

  11. Image Edge Tracking via Ant Colony Optimization (United States)

    Li, Ruowei; Wu, Hongkun; Liu, Shilong; Rahman, M. A.; Liu, Sanchi; Kwok, Ngai Ming


    A good edge plot should use continuous thin lines to describe the complete contour of the captured object. However, the detection of weak edges is a challenging task because of the associated low pixel intensities. Ant Colony Optimization (ACO) has been employed by many researchers to address this problem. The algorithm is a meta-heuristic method developed by mimicking the natural behaviour of ants. It uses iterative searches to find the optimal solution that cannot be found via traditional optimization approaches. In this work, ACO is employed to track and repair broken edges obtained via conventional Sobel edge detector to produced a result with more connected edges.

  12. Oecophylla smaragdina food conversion efficiency: prospects for ant farming

    DEFF Research Database (Denmark)

    Offenberg, Hans Joachim


    can be combined with the use of the ants in biological control programmes in tropical plantations where pest insects are converted into ant biomass. To assess the cost-benefits of ant farming based on artificial feeding, food consumption and food conversion efficiency (ECI) of Oecophylla smaragdina......Oecophylla ants are sold at high prices on several commercial markets as a human delicacy, as pet food or as traditional medicine. Currently markets are supplied by ants collected from the wild; however, an increasing interest in ant farming exists as all harvest is easily sold and as ant farming...... selling prices these efficiencies led to rates of return from 1.52 to 4.56, respectively, if: (i) protein is supplied from commercial products; or (ii) alternatively supplied from free sources such as insects and kitchen waste. These results suggest that Oecophylla ant farming may become highly profitable...

  13. Hybrid Bee Ant Colony Algorithm for Effective Load Balancing And ...

    African Journals Online (AJOL)


    Ant Colony algorithm is used in this hybrid Bee Ant Colony algorithm to solve load balancing issues ... Genetic Algorithm (MO-GA) for dynamic job scheduling that .... Information Networking and Applications Workshops. [7]. M. Dorigo & T.

  14. The use of weaver ants (Oecophylla spp.) in tropical agriculture

    DEFF Research Database (Denmark)

    Offenberg, Hans Joachim


    by the consumed pest insects, can be harvested and utilised for nutrition as they are tasty and high in proteins, vitamins and minerals. Thus, plantations may function as ant farms and in addition to plant production also hosts the production of edible animal protein. In this setup harmful pest insects are turned...... farming as a way forward to solve an increasing future demand for protein. Weaver ant farming may build on natural food collected by the ants or alternatively be boosted by feeding the ant colonies actively with protein and sugar. In both cases, when ant biocontrol is combined with ant farming......, the environmental cost of protein production may fall even lower than for other insects as the ants feed on pests that would otherwise reduce the plant yield and since the farming area is simultaneously in use for plant production. In this presentation I provide data showing (i) how the harvest of ants can...

  15. Dealing with water deficit in Atta ant colonies: large ants scout for water while small ants transport it

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Da-Silva


    Leafcutter ants (Atta sexdens rubropilosa (Forel 1908 have an elaborate social organization, complete with caste divisions. Activities carried out by specialist groups contribute to the overall success and survival of the colony when it is confronted with environmental challenges such as dehydration. Ants detect variations in humidity inside the nest and react by activating several types of behavior that enhance water uptake and decrease water loss, but it is not clear whether or not a single caste collects water regardless of the cost of bringing this resource back to the colony. Accordingly, we investigated water collection activities in three colonies of Atta sexdens rubropilosa experimentally exposed to water stress. Specifically, we analyzed whether or not the same ant caste foraged for water, regardless of the absolute energetic cost (distance of transporting this resource back to the colony. Our experimental design offered water sources at 0 m, 1 m and 10 m from the nest. We studied the body size of ants near the water sources from the initial offer of water (time  =  0 to 120 min, and tested for specialization. We observed a reduction in the average size and variance of ants that corroborated the specialization hypothesis. Although the temporal course of specialization changed with distance, the final outcome was similar among distances. Thus, we conclude that, for this species, a specialist (our use of the word “specialist” does not mean exclusive task force is responsible for collecting water, regardless of the cost of transporting water back to the colony.

  16. Extended phenotype: nematodes turn ants into bird-dispersed fruits

    DEFF Research Database (Denmark)

    Hughes, D P; Kronauer, D J C; Boomsma, J J


    A recent study has discovered a novel extended phenotype of a nematode which alters its ant host to resemble ripe fruit. The infected ants are in turn eaten by frugivorous birds that disperse the nematode's eggs.......A recent study has discovered a novel extended phenotype of a nematode which alters its ant host to resemble ripe fruit. The infected ants are in turn eaten by frugivorous birds that disperse the nematode's eggs....

  17. Histrionicotoxin alkaloids finally detected in an ant

    DEFF Research Database (Denmark)

    Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.


    Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...... only an m/z 204 base peak. Found also for the first time in skin extracts from the comparison frog Oophaga granulifera of Costa Rica is a trace DHQ of MW 273. It is coded as 273F in the frog; a different isomer is found in the ant....

  18. Ants, rodents and seed predation in Proteaceae

    African Journals Online (AJOL)

    ... their nests extremely rapidly. One benefit of the ant-plant interaction may be seed escape ... (odourless to humans when dry) household glue or, b) placing seed in a Petri dish ... the layout of exclosures was completed. Response was not as.

  19. The evolution of invasiveness in garden ants

    DEFF Research Database (Denmark)

    Cremer, Sylvia; Ugelvig, Line Vej; Drijfhout, Falko P


    It is unclear why some species become successful invaders whilst others fail, and whether invasive success depends on pre-adaptations already present in the native range or on characters evolving de-novo after introduction. Ants are among the worst invasive pests, with Lasius neglectus and its ra...

  20. The ejaculatory biology of leafcutter ants

    DEFF Research Database (Denmark)

    den Boer, Susanne; Stürup, Marlene; Boomsma, Jacobus Jan


    understanding of the fundamental biology of ejaculate production, transfer and physiological function remains extremely limited. We studied the ejaculation process in the leafcutter ant Atta colombica and found that it starts with the appearance of a clear pre-ejaculatory fluid (PEF) at the tip...

  1. Mating, hybridisation and introgression in Lasius ants

    NARCIS (Netherlands)

    Have, van der T.M.; Pedersen, J.S.; Boomsma, J.J.


    Recent reviews have shown that hybridisation among ant species is likely to be more common than previously appreciated. but that documented cases of introgression remain rare. After molecular phylogenetic work had shown that European Lasius niger (LINNAEUS, 1758) and L. psammophilus SEIFERT, 1992

  2. Ants recognize foes and not friends (United States)

    Guerrieri, Fernando J.; Nehring, Volker; Jørgensen, Charlotte G.; Nielsen, John; Galizia, C. Giovanni; d'Ettorre, Patrizia


    Discriminating among individuals and rejecting non-group members is essential for the evolution and stability of animal societies. Ants are good models for studying recognition mechanisms, because they are typically very efficient in discriminating ‘friends’ (nest-mates) from ‘foes’ (non-nest-mates). Recognition in ants involves multicomponent cues encoded in cuticular hydrocarbon profiles. Here, we tested whether workers of the carpenter ant Camponotus herculeanus use the presence and/or absence of cuticular hydrocarbons to discriminate between nest-mates and non-nest-mates. We supplemented the cuticular profile with synthetic hydrocarbons mixed to liquid food and then assessed behavioural responses using two different bioassays. Our results show that (i) the presence, but not the absence, of an additional hydrocarbon elicited aggression and that (ii) among the three classes of hydrocarbons tested (unbranched, mono-methylated and dimethylated alkanes; for mono-methylated alkanes, we present a new synthetic pathway), only the dimethylated alkane was effective in eliciting aggression. Our results suggest that carpenter ants use a fundamentally different mechanism for nest-mate recognition than previously thought. They do not specifically recognize nest-mates, but rather recognize and reject non-nest-mates bearing odour cues that are novel to their own colony cuticular hydrocarbon profile. This begs for a reappraisal of the mechanisms underlying recognition systems in social insects. PMID:19364750

  3. Recognition of social identity in ants

    DEFF Research Database (Denmark)

    Bos, Nick; d'Ettorre, Patrizia


    Recognizing the identity of others, from the individual to the group level, is a hallmark of society. Ants, and other social insects, have evolved advanced societies characterized by efficient social recognition systems. Colony identity is mediated by colony specific signature mixtures, a blend...

  4. Plasmodium parasitaemia among pregnant women attending ante ...

    African Journals Online (AJOL)

    ... Ante-Natal Clinic at Military Hospital Port Harcourt, Rivers State, Nigeria using the Standard parasitological technique. Venous blood was collected from 200 pregnant women, both thick and thin blood films were made on clean greese-free glass slide and stained with 10% Giemsa stains diluted with 7.2 buffered water for ...

  5. Operant conditioning in the ant Myrmica sabuleti. (United States)

    Cammaerts, M C


    Operant conditioning could be obtained in the ant Myrmica sabuleti by presenting to the workers, during a six-day period, an apparatus containing either sugared water or meat as a reward. The conditioning obtained using sugared water as a reward was short lasting. A reconditioning was more persistent and lasted four hours. The ants' response was very precise, since they exhibited it only in front of an apparatus identical to that used during the training phase. Operant conditioning obtained using meat as a reward was more pronounced than that obtained by using sugared water, probably because meat is more valuable as a reward than sugar for the species studied, which is essentially a carnivorous one. Such a conditioning was rather persistent. Indeed, a first operant conditioning obtained by using meat as a reward could still be detected after seven hours, and a reconditioning was still significant after eight hours. One day after this eight-hour period without rewarding the ants, the response was higher again and a further day later, it was still significant. Since the operant conditioning is easy to perform and quantify and since the ants' response is very precise, such a conditioning can be used for further studying M. sabuleti workers' visual perception.

  6. A global database of ant species abundances (United States)

    Gibb, Heloise; Dunn, Rob R.; Sanders, Nathan J.; Grossman, Blair F.; Photakis, Manoli; Abril, Silvia; Agosti, Donat; Andersen, Alan N.; Angulo, Elena; Armbrecht, Ingre; Arnan, Xavier; Baccaro, Fabricio B.; Bishop, Tom R.; Boulay, Raphael; Bruhl, Carsten; Castracani, Cristina; Cerda, Xim; Del Toro, Israel; Delsinne, Thibaut; Diaz, Mireia; Donoso, David A.; Ellison, Aaron M.; Enriquez, Martha L.; Fayle, Tom M.; Feener Jr., Donald H.; Fisher, Brian L.; Fisher, Robert N.; Fitpatrick, Matthew C.; Gomez, Cristanto; Gotelli, Nicholas J.; Gove, Aaron; Grasso, Donato A.; Groc, Sarah; Guenard, Benoit; Gunawardene, Nihara; Heterick, Brian; Hoffmann, Benjamin; Janda, Milan; Jenkins, Clinton; Kaspari, Michael; Klimes, Petr; Lach, Lori; Laeger, Thomas; Lattke, John; Leponce, Maurice; Lessard, Jean-Philippe; Longino, John; Lucky, Andrea; Luke, Sarah H.; Majer, Jonathan; McGlynn, Terrence P.; Menke, Sean; Mezger, Dirk; Mori, Alessandra; Moses, Jimmy; Munyai, Thinandavha Caswell; Pacheco, Renata; Paknia, Omid; Pearce-Duvet, Jessica; Pfeiffer, Martin; Philpott, Stacy M.; Resasco, Julian; Retana, Javier; Silva, Rogerio R.; Sorger, Magdalena D.; Souza, Jorge; Suarez, Andrew V.; Tista, Melanie; Vasconcelos, Heraldo L.; Vonshak, Merav; Weiser, Michael D.; Yates, Michelle; Parr, Catherine L.


    What forces structure ecological assemblages? A key limitation to general insights about assemblage structure is the availability of data that are collected at a small spatial grain (local assemblages) and a large spatial extent (global coverage). Here, we present published and unpublished data from 51,388 ant abundance and occurrence records of more than 2693 species and 7953 morphospecies from local assemblages collected at 4212 locations around the world. Ants were selected because they are diverse and abundant globally, comprise a large fraction of animal biomass in most terrestrial communities, and are key contributors to a range of ecosystem functions. Data were collected between 1949 and 2014, and include, for each geo-referenced sampling site, both the identity of the ants collected and details of sampling design, habitat type and degree of disturbance. The aim of compiling this dataset was to provide comprehensive species abundance data in order to test relationships between assemblage structure and environmental and biogeographic factors. Data were collected using a variety of standardised methods, such as pitfall and Winkler traps, and will be valuable for studies investigating large-scale forces structuring local assemblages. Understanding such relationships is particularly critical under current rates of global change. We encourage authors holding additional data on systematically collected ant assemblages, especially those in dry and cold, and remote areas, to contact us and contribute their data to this growing dataset.

  7. Studies on the environmental implications of ants (Hymenoptera ...

    African Journals Online (AJOL)

    A study of ants associated wh two synanthropcenvironments in Awka was carried out in 2008 using pitfall and bait traps. The study yelded a total of 561 ants wth 409 obtaned from the hemisynanthrophic environment while 192 ants were collected from the endophilic environment. The percentage occurrence, total dstribution ...

  8. Dynamics of an ant-plant-pollinator model (United States)

    Wang, Yuanshi; DeAngelis, Donald L.; Nathaniel Holland, J.


    In this paper, we consider plant-pollinator-ant systems in which plant-pollinator interaction and plant-ant interaction are both mutualistic, but there also exists interference of pollinators by ants. The plant-pollinator interaction can be described by a Beddington-DeAngelis formula, so we extend the formula to characterize plant-pollinator mutualisms, including the interference by ants, and form a plant-pollinator-ant model. Using dynamical systems theory, we show uniform persistence of the model. Moreover, we demonstrate conditions under which boundary equilibria are globally asymptotically stable. The dynamics exhibit mechanisms by which the three species could coexist when ants interfere with pollinators. We define a threshold in ant interference. When ant interference is strong, it can drive plant-pollinator mutualisms to extinction. Furthermore, if the ants depend on pollination mutualism for their persistence, then sufficiently strong ant interference could lead to their own extinction as well. Yet, when ant interference is weak, plant-ant and plant-pollinator mutualisms can promote the persistence of one another.

  9. Ants Orasest ja Anne Lange monograafiast / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-


    Arvustus: Oras, Ants. Luulekool. I, Apoloogia / koostajad Hando Runnel ja Jaak Rähesoo. Tartu : Ilmamaa, 2003 ; Oras, Ants. Luulekool II, Meistriklass. Tartu : Ilmamaa, 2004 ; Lange, Anne. Ants Oras : [kirjandusteadlane, -kriitik ja tõlkija (1900-1982)]. Tartu : Ilmamaa, 2004

  10. Are ant feces nutrients for plants? A metabolomics approach to elucidate the nutritional effects on plants hosting weaver ants

    DEFF Research Database (Denmark)

    Vidkjær, Nanna Hjort; Wollenweber, Bernd; Gislum, René


    Weaver ants (genus Oecophylla) are tropical carnivorous ant species living in high numbers in the canopies of trees. The ants excrete copious amounts of fecal matter on leaf surfaces, and these feces may provide nutrients to host trees. This hypothesis is supported by studies of ant......-plant interactions involving other ant species that have demonstrated the transfer of nutrients from ants to plants. In this 7-months study, a GC–MS-based metabolomics approach along with an analysis of total nitrogen and carbon levels was used to study metabolic changes in ant-hosting Coffea arabica plants compared...... with control plants. The results showed elevated levels of total nitrogen, amino acids, fatty acids, caffeine, and secondary metabolites of the phenylpropanoid pathway in leaves from ant-hosting plants. Minor effects were observed for sugars, whereas little or no effect was observed for organic acids, despite...

  11. Plant lock and ant key: pairwise coevolution of an exclusion filter in an ant-plant mutualism. (United States)

    Brouat, C; Garcia, N; Andary, C; McKey, D


    Although observations suggest pairwise coevolution in specific ant-plant symbioses, coevolutionary processes have rarely been demonstrated. We report on, what is to the authors' knowledge, the strongest evidence yet for reciprocal adaptation of morphological characters in a species-specific ant-plant mutualism. The plant character is the prostoma, which is a small unlignified organ at the apex of the domatia in which symbiotic ants excavate an entrance hole. Each myrmecophyte in the genus Leonardoxa has evolved a prostoma with a different shape. By performing precise measurements on the prostomata of three related myrmecophytes, on their specific associated ants and on the entrance holes excavated by symbiotic ants at the prostomata, we showed that correspondence of the plant and ant traits forms a morphological and behavioural filter. We have strong evidence for coevolution between the dimensions and shape of the symbiotic ants and the prostoma in one of the three ant-Leonardoxa associations.

  12. Interactive effects of soil-dwelling ants, ant mounds and simulated grazing on local plant community composition

    NARCIS (Netherlands)

    Veen, G.F.; Olff, H.


    Interactions between aboveground vertebrate herbivores and subterranean yellow meadow ants (Lasius flavus) can drive plant community patterns in grassland ecosystems. Here, we study the relative importance of the presence of ants (L. flavus) and ant mounds under different simulated grazing regimes

  13. Edge detection in digital images using Ant Colony Optimization

    Directory of Open Access Journals (Sweden)

    Marjan Kuchaki Rafsanjani


    Full Text Available Ant Colony Optimization (ACO is an optimization algorithm inspired by the behavior of real ant colonies to approximate the solutions of difficult optimization problems. In this paper, ACO is introduced to tackle the image edge detection problem. The proposed approach is based on the distribution of ants on an image; ants try to find possible edges by using a state transition function. Experimental results show that the proposed method compared to standard edge detectors is less sensitive to Gaussian noise and gives finer details and thinner edges when compared to earlier ant-based approaches.

  14. The Pied Piper: A Parasitic Beetle's Melodies Modulate Ant Behaviours.

    Directory of Open Access Journals (Sweden)

    Andrea Di Giulio

    Full Text Available Ants use various communication channels to regulate their social organisation. The main channel that drives almost all the ants' activities and behaviours is the chemical one, but it is long acknowledged that the acoustic channel also plays an important role. However, very little is known regarding exploitation of the acoustical channel by myrmecophile parasites to infiltrate the ant society. Among social parasites, the ant nest beetles (Paussus are obligate myrmecophiles able to move throughout the colony at will and prey on the ants, surprisingly never eliciting aggression from the colonies. It has been recently postulated that stridulatory organs in Paussus might be evolved as an acoustic mechanism to interact with ants. Here, we survey the role of acoustic signals employed in the Paussus beetle-Pheidole ant system. Ants parasitised by Paussus beetles produce caste-specific stridulations. We found that Paussus can "speak" three different "languages", each similar to sounds produced by different ant castes (workers, soldiers, queen. Playback experiments were used to test how host ants respond to the sounds emitted by Paussus. Our data suggest that, by mimicking the stridulations of the queen, Paussus is able to dupe the workers of its host and to be treated as royalty. This is the first report of acoustic mimicry in a beetle parasite of ants.

  15. The interactions of ants with their biotic environment. (United States)

    Chomicki, Guillaume; Renner, Susanne S


    This s pecial feature results from the symposium 'Ants 2016: ant interactions with their biotic environments' held in Munich in May 2016 and deals with the interactions between ants and other insects, plants, microbes and fungi, studied at micro- and macroevolutionary levels with a wide range of approaches, from field ecology to next-generation sequencing, chemical ecology and molecular genetics. In this paper, we review key aspects of these biotic interactions to provide background information for the papers of this s pecial feature After listing the major types of biotic interactions that ants engage in, we present a brief overview of ant/ant communication, ant/plant interactions, ant/fungus symbioses, and recent insights about ants and their endosymbionts. Using a large molecular clock-dated Formicidae phylogeny, we map the evolutionary origins of different ant clades' interactions with plants, fungi and hemiptera. Ants' biotic interactions provide ideal systems to address fundamental ecological and evolutionary questions about mutualism, coevolution, adaptation and animal communication. © 2017 The Author(s).

  16. Ant species confer different partner benefits on two neotropical myrmecophytes. (United States)

    Frederickson, Megan E


    The dynamics of mutualistic interactions involving more than a single pair of species depend on the relative costs and benefits of interaction among alternative partners. The neotropical myrmecophytes Cordia nodosa and Duroia hirsuta associate with several species of obligately symbiotic ants. I compared the ant partners of Cordia and Duroia with respect to two benefits known to be important in ant-myrmecophyte interactions: protection against herbivores provided by ants, and protection against encroaching vegetation provided by ants. Azteca spp., Myrmelachista schumanni, and Allomerus octoarticulatus demerarae ants all provide the leaves of Cordia and Duroia some protection against herbivores. However, Azteca and Allomerus provide more protection than does Myrmelachista to the leaves of their host plants. Although Allomerus protects the leaves of its hosts, plants occupied by Allomerus suffer more attacks by herbivores to their stems than do plants occupied by other ants. Relative to Azteca or Allomerus, Myrmelachista ants provide better protection against encroaching vegetation, increasing canopy openness over their host plants. These differences in benefits among the ant partners of Cordia and Duroia are reflected in the effect of each ant species on host plant size, growth rate, and reproduction. The results of this study show how mutualistic ant partners can differ with respect to both the magnitude and type of benefits they provide to the same species of myrmecophytic host.

  17. Fast and flexible: argentine ants recruit from nearby trails.

    Directory of Open Access Journals (Sweden)

    Tatiana P Flanagan

    Full Text Available Argentine ants (Linepithema humile live in groups of nests connected by trails to each other and to stable food sources. In a field study, we investigated whether some ants recruit directly from established, persistent trails to food sources, thus accelerating food collection. Our results indicate that Argentine ants recruit nestmates to food directly from persistent trails, and that the exponential increase in the arrival rate of ants at baits is faster than would be possible if recruited ants traveled from distant nests. Once ants find a new food source, they walk back and forth between the bait and sometimes share food by trophallaxis with nestmates on the trail. Recruiting ants from nearby persistent trails creates a dynamic circuit, like those found in other distributed systems, which facilitates a quick response to changes in available resources.

  18. Host ant independent oviposition in the parasitic butterfly Maculinea alcon

    DEFF Research Database (Denmark)

    Fürst, Matthias A; Nash, David Richard


    to host-ant nests and non-host-ant nests, and the number and position of eggs attached were assessed. Our results show no evidence for host-ant-based oviposition in M. alcon, but support an oviposition strategy based on plant characteristics. This suggests that careful management of host-ant distribution......Parasitic Maculinea alcon butterflies can only develop in nests of a subset of available Myrmica ant species, so female butterflies have been hypothesized to preferentially lay eggs on plants close to colonies of the correct host ants. Previous correlational investigations of host......-ant-dependent oviposition in this and other Maculinea species have, however, shown equivocal results, leading to a long-term controversy over support for this hypothesis. We therefore conducted a controlled field experiment to study the egg-laying behaviour of M. alcon. Matched potted Gentiana plants were set out close...

  19. Exploring with PAM: Prospecting ANTS Missions for Solar System Surveys (United States)

    Clark, P. E.; Rilee, M. L.; Curtis, S. A.


    ANTS (Autonomous Nano-Technology Swarm), a large (1000 member) swarm of nano to picoclass (10 to 1 kg) totally autonomous spacecraft, are being developed as a NASA advanced mission concept. ANTS, based on a hierarchical insect social order, use an evolvable, self-similar, hierarchical neural system in which individual spacecraft represent the highest level nodes. ANTS uses swarm intelligence attained through collective, cooperative interactions of the nodes at all levels of the system. At the highest levels this can take the form of cooperative, collective behavior among the individual spacecraft in a very large constellation. The ANTS neural architecture is designed for totally autonomous operation of complex systems including spacecraft constellations. The ANTS (Autonomous Nano Technology Swarm) concept has a number of possible applications. A version of ANTS designed for surveying and determining the resource potential of the asteroid belt, called PAM (Prospecting ANTS Mission), is examined here.

  20. Fast and flexible: argentine ants recruit from nearby trails. (United States)

    Flanagan, Tatiana P; Pinter-Wollman, Noa M; Moses, Melanie E; Gordon, Deborah M


    Argentine ants (Linepithema humile) live in groups of nests connected by trails to each other and to stable food sources. In a field study, we investigated whether some ants recruit directly from established, persistent trails to food sources, thus accelerating food collection. Our results indicate that Argentine ants recruit nestmates to food directly from persistent trails, and that the exponential increase in the arrival rate of ants at baits is faster than would be possible if recruited ants traveled from distant nests. Once ants find a new food source, they walk back and forth between the bait and sometimes share food by trophallaxis with nestmates on the trail. Recruiting ants from nearby persistent trails creates a dynamic circuit, like those found in other distributed systems, which facilitates a quick response to changes in available resources.

  1. Using pleometrosis (multiple queens) and pupae transplantation to boost weaver ant (Oecophylla smaragdina) colony growth in ant nurseries

    DEFF Research Database (Denmark)

    Offenberg, Hans Joachim; Nielsen, Mogens Gissel; Peng, Renkang


    Weaver ants (Oecophylla spp.) are increasingly being used for biocontrol and are targeted for future production of insect protein in ant farms. An efficient production of live ant colonies may facilitate the utilization of these ants but the production of mature colonies is hampered by the long...... and no transplantation. Thus, in ant nurseries the use of multiple queens during nest founding as well as transplantation of pupae from foreign colonies may be utilised to decrease the time it takes to produce a colony ready for implementation....

  2. Optic disc detection using ant colony optimization (United States)

    Dias, Marcy A.; Monteiro, Fernando C.


    The retinal fundus images are used in the treatment and diagnosis of several eye diseases, such as diabetic retinopathy and glaucoma. This paper proposes a new method to detect the optic disc (OD) automatically, due to the fact that the knowledge of the OD location is essential to the automatic analysis of retinal images. Ant Colony Optimization (ACO) is an optimization algorithm inspired by the foraging behaviour of some ant species that has been applied in image processing for edge detection. Recently, the ACO was used in fundus images to detect edges, and therefore, to segment the OD and other anatomical retinal structures. We present an algorithm for the detection of OD in the retina which takes advantage of the Gabor wavelet transform, entropy and ACO algorithm. Forty images of the retina from DRIVE database were used to evaluate the performance of our method.

  3. A global database of ant species abundances

    Czech Academy of Sciences Publication Activity Database

    Gibb, H.; Dunn, R. R.; Sanders, N. J.; Grossman, B. F.; Photakis, M.; Abril, S.; Agosti, D.; Andersen, A. N.; Angulo, E.; Armbrecht, I.; Arnan, X.; Baccaro, F. B.; Bishop, T. R.; Boulay, R.; Brühl, C.; Castracani, C.; Cerdá, X.; Del Toro, I.; Delsinne, T.; Diaz, M.; Donoso, D. A.; Ellison, A. M.; Enríquez, M. L.; Fayle, Tom Maurice; Feener, D. H.; Fisher, B. L.; Fisher, R. N.; Fitzpatrick, M. C.; Gómez, C.; Gotelli, N. J.; Gove, A.; Grasso, D. A.; Groc, S.; Guenard, B.; Gunawardene, N.; Heterick, B.; Hoffmann, B.; Janda, Milan; Jenkins, C.; Kaspari, M.; Klimeš, Petr; Lach, L.; Laeger, T.; Lattke, J.; Leponce, M.; Lessard, J.-P.; Longino, J.; Lucky, A.; Luke, S. H.; Majer, J.; McGlynn, T. P.; Menke, S.; Mezger, D.; Mori, A.; Moses, Jimmy; Munyai, T. C.; Pacheco, R.; Paknia, O.; Pearce-Duvet, J.; Pfeiffer, M.; Philpott, S. M.; Resasco, J.; Retana, J.; Silva, R. R.; Sorger, M. D.; Souza, J.; Suarez, A.; Tista, M.; Vasconcelos, H. L.; Vonshak, M.; Weisser, M. D.; Yates, M.; Parr, C. L.


    Roč. 98, č. 3 (2017), s. 883-884 ISSN 0012-9658 R&D Projects: GA ČR GB14-36098G; GA ČR GAP505/12/2467; GA ČR GPP505/12/P875 Institutional support: RVO:60077344 Keywords : abundance * ants * database Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.809, year: 2016

  4. Public goods dilemma in asexual ant societies


    Dobata, Shigeto; Tsuji, Kazuki


    This study reports experimental evidence for the “public goods dilemma” between cooperators and cheaters in an asexual ant society, in which cheating is always more rewarding for individuals but cooperation at the cost of individual fitness leads to better performance of groups. Although this dilemma provides the basic principle of social evolution, its experimental demonstration with underlying genetics and fitness evaluation for both cooperators and cheaters still lacks in societies other t...

  5. Ant colony optimization and constraint programming

    CERN Document Server

    Solnon, Christine


    Ant colony optimization is a metaheuristic which has been successfully applied to a wide range of combinatorial optimization problems. The author describes this metaheuristic and studies its efficiency for solving some hard combinatorial problems, with a specific focus on constraint programming. The text is organized into three parts. The first part introduces constraint programming, which provides high level features to declaratively model problems by means of constraints. It describes the main existing approaches for solving constraint satisfaction problems, including complete tree search

  6. Precision Rescue Behavior in North American Ants

    Directory of Open Access Journals (Sweden)

    Katherine Taylor


    Full Text Available Altruistic behavior, in which one individual provides aid to another at some cost to itself, is well documented. However, some species engage in a form of altruism, called rescue, that places the altruist in immediate danger. Here we investigate one such example, namely rescuing victims captured by predators. In a field experiment with two North American ant species, Tetramorium sp. E and Prenolepis imparis, individuals were held in artificial snares simulating capture. T. sp. E, but not P. imparis, exhibited digging, pulling, and snare biting, the latter precisely targeted to the object binding the victim. These results are the first to document precision rescue in a North American ant species; moreover, unlike rescue in other ants, T. sp. E rescues conspecifics from different colonies, mirroring their atypical social behavior, namely the lack of aggression between non-nestmate (heterocolonial conspecifics. In a second, observational study designed to demonstrate rescue from an actual predator, T. sp. E victims were dropped into an antlion's pit and the behavior of a single rescuer was observed. Results showed that T. sp. E not only attempted to release the victim, but also risked attacking the predator, suggesting that precision rescue may play an important role in this species' antipredator behavior.

  7. El periodista, ante la espiral de silencio

    Directory of Open Access Journals (Sweden)

    Dr. Fermín Galindo Arranz


    Full Text Available La percepción de la profesión periodística y de su influencia cambia mucho a lo largo del tiempo, de las coyunturas históricas y de los diferentes países y sociedades en los que desempeñan su labor. En un contexto mundial, la gravedad de las situaciones de riesgo periodístico se encuadran en situaciones políticas, económicas o sociales también conflictivas; es entonces cuando se suele reproducir con facilidad en la opinión pública el fenómeno de la espiral del silencio, ante el que inevitablemente se sitúa el periodista. Por definición, el trabajo del periodista consiste en ser portavoz de las novedades que se producen, en dar informaciones y emitir opiniones en la esfera pública, se tiene que situar, por tanto, de forma individual y notoriamente pública ante los fenómenos de espiral de silencio que puedan producirse en la opinión pública. Antonio Tabucchi nos presenta en su novela "Sostiene Pereira" un ejemplo magnífico del dilema del periodista ante este tipo de situaciones.

  8. Recognition of social identity in ants

    Directory of Open Access Journals (Sweden)

    Nick eBos


    Full Text Available Recognizing the identity of others, from the individual to the group level, is a hallmark of society. Ants, and other social insects, have evolved advanced societies characterized by efficient social recognition systems. Colony identity is mediated by colony specific signature mixtures, a blend of hydrocarbons present on the cuticle of every individual (the label. Recognition occurs when an ant encounters another individual, and compares the label it perceives to an internal representation of its own colony odor (the template. A mismatch between label and template leads to rejection of the encountered individual. Although advances have been made in our understanding of how the label is produced and acquired, contradictory evidence exists about information processing of recognition cues. Here, we review the literature on template acquisition in ants and address how and when the template is formed, where in the nervous system it is localized, and the possible role of learning. We combine seemingly contradictory evidence in to a novel, parsimonious theory for the information processing of nestmate recognition cues.

  9. The invasive ant, Solenopsis invicta, reduces herpetofauna richness and abundance (United States)

    Allen, Craig R.; Birge, Hannah E.; Slater, J.; Wiggers, E.


    Amphibians and reptiles are declining globally. One potential cause of this decline includes impacts resulting from co-occurrence with non-native red imported fire ant, Solenopsis invicta. Although a growing body of anecdotal and observational evidence from laboratory experiments supports this hypothesis, there remains a lack of field scale manipulations testing the effect of fire ants on reptile and amphibian communities. We addressed this gap by measuring reptile and amphibian (“herpetofauna”) community response to successful fire ant reductions over the course of 2 years following hydramethylnon application to five 100–200 ha plots in southeastern coastal South Carolina. By assessing changes in relative abundance and species richness of herpetofauna in response to fire ant reductions, we were able to assess whether some species were particularly vulnerable to fire ant presence, and whether this sensitivity manifested at the community level. We found that herpetofauna abundance and species richness responded positively to fire ant reductions. Our results document that even moderate populations of red imported fire ants decrease both the abundance and diversity of herpetofauna. Given global herpetofauna population declines and continued spread of fire ants, there is urgency to understand the impacts of fire ants beyond anecdotal and singles species studies. Our results provides the first community level investigation addressing these dynamics, by manipulating fire ant abundance to reveal a response in herpetofauna species abundance and richness.

  10. Predaceous ants, beach replenishment, and nest placement by sea turtles. (United States)

    Wetterer, James K; Wood, Lawrence D; Johnson, Chris; Krahe, Holly; Fitchett, Stephanie


    Ants known for attacking and killing hatchling birds and reptiles include the red imported fire ant (Solenopsis invicta Buren), tropical fire ant [Solenopsis geminata (Fabr.)], and little fire ant [Wasmannia auropunctata (Roger)]. We tested whether sea turtle nest placement influenced exposure to predaceous ants. In 2000 and 2001, we surveyed ants along a Florida beach where green turtles (Chelonia mydas L.), leatherbacks (Dermochelys coriacea Vandelli), and loggerheads (Caretta caretta L.) nest. Part of the beach was artificially replenished between our two surveys. As a result, mean beach width experienced by nesting turtles differed greatly between the two nesting seasons. We surveyed 1,548 sea turtle nests (2000: 909 nests; 2001: 639 nests) and found 22 ant species. S. invicta was by far the most common species (on 431 nests); S. geminata and W. auropunctata were uncommon (on 3 and 16 nests, respectively). In 2000, 62.5% of nests had ants present (35.9% with S. invicta), but in 2001, only 30.5% of the nests had ants present (16.4% with S. invicta). Turtle nests closer to dune vegetation had significantly greater exposure to ants. Differences in ant presence on turtle nests between years and among turtle species were closely related to differences in nest placement relative to dune vegetation. Beach replenishment significantly lowered exposure of nests to ants because on the wider beaches turtles nested farther from the dune vegetation. Selective pressures on nesting sea turtles are altered both by the presence of predaceous ants and the practice of beach replenishment.

  11. Chemically armed mercenary ants protect fungus-farming societies (United States)

    Adams, Rachelle M. M.; Liberti, Joanito; Illum, Anders A.; Jones, Tappey H.; Nash, David R.; Boomsma, Jacobus J.


    The ants are extraordinary in having evolved many lineages that exploit closely related ant societies as social parasites, but social parasitism by distantly related ants is rare. Here we document the interaction dynamics among a Sericomyrmex fungus-growing ant host, a permanently associated parasitic guest ant of the genus Megalomyrmex, and a raiding agro-predator of the genus Gnamptogenys. We show experimentally that the guest ants protect their host colonies against agro-predator raids using alkaloid venom that is much more potent than the biting defenses of the host ants. Relatively few guest ants are sufficient to kill raiders that invariably exterminate host nests without a cohabiting guest ant colony. We also show that the odor of guest ants discourages raider scouts from recruiting nestmates to host colonies. Our results imply that Sericomyrmex fungus-growers obtain a net benefit from their costly guest ants behaving as a functional soldier caste to meet lethal threats from agro-predator raiders. The fundamentally different life histories of the agro-predators and guest ants appear to facilitate their coexistence in a negative frequency-dependent manner. Because a guest ant colony is committed for life to a single host colony, the guests would harm their own interests by not defending the host that they continue to exploit. This conditional mutualism is analogous to chronic sickle cell anemia enhancing the resistance to malaria and to episodes in human history when mercenary city defenders offered either net benefits or imposed net costs, depending on the level of threat from invading armies. PMID:24019482

  12. Chemically armed mercenary ants protect fungus-farming societies. (United States)

    Adams, Rachelle M M; Liberti, Joanito; Illum, Anders A; Jones, Tappey H; Nash, David R; Boomsma, Jacobus J


    The ants are extraordinary in having evolved many lineages that exploit closely related ant societies as social parasites, but social parasitism by distantly related ants is rare. Here we document the interaction dynamics among a Sericomyrmex fungus-growing ant host, a permanently associated parasitic guest ant of the genus Megalomyrmex, and a raiding agro-predator of the genus Gnamptogenys. We show experimentally that the guest ants protect their host colonies against agro-predator raids using alkaloid venom that is much more potent than the biting defenses of the host ants. Relatively few guest ants are sufficient to kill raiders that invariably exterminate host nests without a cohabiting guest ant colony. We also show that the odor of guest ants discourages raider scouts from recruiting nestmates to host colonies. Our results imply that Sericomyrmex fungus-growers obtain a net benefit from their costly guest ants behaving as a functional soldier caste to meet lethal threats from agro-predator raiders. The fundamentally different life histories of the agro-predators and guest ants appear to facilitate their coexistence in a negative frequency-dependent manner. Because a guest ant colony is committed for life to a single host colony, the guests would harm their own interests by not defending the host that they continue to exploit. This conditional mutualism is analogous to chronic sickle cell anemia enhancing the resistance to malaria and to episodes in human history when mercenary city defenders offered either net benefits or imposed net costs, depending on the level of threat from invading armies.

  13. When invasive ants meet: effects of outbreeding on queen performance in the tramp ant Cardiocondyla itsukii. (United States)

    Heinze, Jürgen; Frohschammer, Sabine; Bernadou, Abel


    Most disturbed habitats in the tropics and subtropics harbor numerous species of invasive ants, and occasionally the same species has been introduced repeatedly from multiple geographical sources. We examined how experimental crossbreeding between sexuals from different populations affects the fitness of queens of the tramp ant Cardiocondyla itsukii, which is widely distributed in Asia and the Pacific Islands. Eggs laid by queens that mated with nestmate males had a higher hatching rate than eggs laid by queens mated to males from neighboring (Hawaii × Kauai) or distant introduced populations (Hawaii/Kauai × Okinawa). Furthermore, inbreeding queens had a longer lifespan and produced a less female-biased offspring sex ratio than queens from allopatric mating. This suggests that the genetic divergence between different source populations may already be so large that in case of multiple invasions eventual crossbreeding might negatively affect the fitness of tramp ants. © 2017 Institute of Zoology, Chinese Academy of Sciences.

  14. Food source quality and ant dominance hierarchy influence the outcomes of ant-plant interactions in an arid environment (United States)

    Flores-Flores, Rocío Vianey; Aguirre, Armando; Anjos, Diego V.; Neves, Frederico S.; Campos, Ricardo I.; Dáttilo, Wesley


    In this study, we conducted a series of experiments in a population of Vachellia constricta (Fabaceae) in the arid Tehuacan-Cuicatláan valley, Mexico, in order to evaluate if the food source quality and ant dominance hierarchy influence the outcomes of ant-plant interactions. Using an experiment with artificial nectaries, we observed that ants foraging on food sources with higher concentration of sugar are quicker in finding and attacking potential herbivorous insects. More specifically, we found that the same ant species may increase their defence effectiveness according to the quality of food available. These findings indicate that ant effectiveness in plant protection is context-dependent and may vary according to specific individual characteristics of plants. In addition, we showed that competitively superior ant species tend to dominate plants in periods with high nectar activity, emphasizing the role of the dominance hierarchy structuring ant-plant interactions. However, when high sugar food sources were experimentally available ad libitum, the nocturnal and competitively superior ant species, Camponotus atriceps, did not dominate the artificial nectaries during the day possibly due to limitation of its thermal tolerance. Therefore, temporal niche partitioning may be allowing the coexistence of two dominant ant species (Camponotus rubritorax during the day and C. atriceps at night) on V. constricta. Our findings indicate that the quality of the food source, and temporal shifts in ant dominance are key factors which structure the biotic plant defences in an arid environment.

  15. Just follow your nose: homing by olfactory cues in ants. (United States)

    Steck, Kathrin


    How is an ant-equipped with a brain that barely exceeds the size of a pinhead-capable of achieving navigational marvels? Even though evidences suggest that navigation is a multimodal process, ants heavily depend on olfactory cues-of pheromonal and non-pheromonal nature-for foraging and orientation. Recent studies have directed their attention to the efficiency of pheromone trail networks. Advances in neurophysiological techniques make it possible to investigate trail pheromone processing in the ant's brain. In addition to relying on pheromone odours, ants also make use of volatiles emanating from the nest surroundings. Deposited in the vicinity of the nest, these home-range markings help the ants to home after a foraging run. Furthermore, olfactory landmarks associated with the nest enhance ants' homing abilities. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. Ant tending influences soldier production in a social aphid. (United States)

    Shingleton, A W; Foster, W A


    The aphid Pseudoregma sundanica (Van der Goot) (Homoptera: Aphididae) has two defence strategies. It is obligatorily tended by various species of ant and also produces sterile soldiers. We investigated how they allocate their investment in these two strategies. We measured the size, number of soldiers, number and species of tending ant, and number and species of predators in P. sundanica populations. We found that the level of ant tending correlated negatively with soldier investment in P. sundanica. The species of tending ant also influenced soldier investment. We excluded ants from aphid populations and recorded changes in population size and structure over four weeks. Ant exclusion led to population decline and extinction. At the same time, surviving populations showed a significant increase in soldier investment. The data demonstrate that social aphids can adjust their investment in soldiers in direct response to environmental change.

  17. Consuming fire ants reduces northern bobwhite survival and weight gain (United States)

    Myers, P.E.; Allen, Craig R.; Birge, Hannah E.


    Northern bobwhite quail, Colinus virginianus (L.) (Galliformes: Odontophoridae), population declines are well documented, but pinpointing the reasons for these decreases has proven elusive. Bobwhite population declines are attributed primarily to loss of habitat and land use changes. This, however, does not entirely explain population declines in areas intensively managed for bobwhites. Although previous research demonstrates the negative impact of red imported fire ant (Solenopsis invicta Buren) (Hymenoptera: Formicidae) on northern bobwhites, the mechanisms underlying this effect are largely unknown. To meet the protein demands of early growth and development, bobwhite chicks predominantly consume small insects, of which ants are a substantial proportion. Fire ants alter ant community dynamics by often reducing native ant diversity and abundance while concurrently increasing the abundance of individuals. Fire ants have negative effects on chicks, but they are also a large potential protein source, making it difficult to disentangle their net effect on bobwhite chicks. To help investigate these effects, we conducted a laboratory experiment to understand (1) whether or not bobwhites consume fire ants, and (2) how the benefits of this consumption compare to the deleterious impacts of bobwhite chick exposure to fire ants. Sixty bobwhite chicks were separated into two groups of 30; one group was provided with starter feed only and the second group was provided with feed and fire ants. Bobwhite chicks were observed feeding on fire ants. Chicks that fed on fire ants had reduced survival and weight gain. Our results show that, while fire ants increase potential food sources for northern bobwhite, their net effect on bobwhite chicks is deleterious. This information will help inform land managers and commercial bobwhite rearing operations.

  18. Cercomacra and related antbirds (Aves, Formicariidae as army ant followers

    Directory of Open Access Journals (Sweden)

    Edwin O. Willis


    Full Text Available Cercomacra and Schistocichla antbirds (Formicariidae favor dense foliage and seldom follow army ants for flushed prey, since the ants move through open forest understory as well as through dense zones. Two other lineages, the Drymophila-Hypocnemis lineage (of dense woodland understory and the Formicivora lineage (of dense bushes in dry or semiopen zones, also cannot follow ants regularly through open forest understory.

  19. Do herbivores eavesdrop on ant chemical communication to avoid predation?

    Directory of Open Access Journals (Sweden)

    David J Gonthier

    Full Text Available Strong effects of predator chemical cues on prey are common in aquatic and marine ecosystems, but are thought to be rare in terrestrial systems and specifically for arthropods. For ants, herbivores are hypothesized to eavesdrop on ant chemical communication and thereby avoid predation or confrontation. Here I tested the effect of ant chemical cues on herbivore choice and herbivory. Using Margaridisa sp. flea beetles and leaves from the host tree (Conostegia xalapensis, I performed paired-leaf choice feeding experiments. Coating leaves with crushed ant liquids (Azteca instabilis, exposing leaves to ant patrolling prior to choice tests (A. instabilis and Camponotus textor and comparing leaves from trees with and without A. instabilis nests resulted in more herbivores and herbivory on control (no ant-treatment relative to ant-treatment leaves. In contrast to A. instabilis and C. textor, leaves previously patrolled by Solenopsis geminata had no difference in beetle number and damage compared to control leaves. Altering the time A. instabilis patrolled treatment leaves prior to choice tests (0-, 5-, 30-, 90-, 180-min. revealed treatment effects were only statistically significant after 90- and 180-min. of prior leaf exposure. This study suggests, for two ecologically important and taxonomically diverse genera (Azteca and Camponotus, ant chemical cues have important effects on herbivores and that these effects may be widespread across the ant family. It suggests that the effect of chemical cues on herbivores may only appear after substantial previous ant activity has occurred on plant tissues. Furthermore, it supports the hypothesis that herbivores use ant chemical communication to avoid predation or confrontation with ants.

  20. A Theoretic Basis for IS? The Contribution of ANT

    Directory of Open Access Journals (Sweden)

    Jim Underwood


    Full Text Available Representation is a key issue of IS design and operation that is often ignored. Actor-network theory (ANT, a semiotic theory of stakeholders, provides a way of dealing with representation. Combining aspects of ANT and Foucault's discourse theory allows us to include concepts as actors and promises a flexible and durable foundation for IS practice, but ANT itself indicates that the search for a purely theoretical foundation for IS is misguided.

  1. Insecticide transfer efficiency and lethal load in Argentine ants

    Energy Technology Data Exchange (ETDEWEB)

    Hooper-Bui, L.M. [Department of Environmental Science, Louisiana State University, Baton Rouge, LA 70803 (United States); Department of Entomology, University of California, Riverside, CA 92521 (United States); Kwok, E.S.C. [Department of Cell Biology and Neuroscience, University of California, Riverside, CA 92521 (United States); Buchholz, B.A., E-mail: [Center for Accelerator Mass Spectrometry, Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States); Department of Environmental Toxicology, University of California, Davis, CA 95616 (United States); Rust, M.K. [Department of Entomology, University of California, Riverside, CA 92521 (United States); Eastmond, D.A. [Department of Cell Biology and Neuroscience, University of California, Riverside, CA 92521 (United States); Vogel, J.S. [Center for Accelerator Mass Spectrometry, Lawrence Livermore National Laboratory, Livermore, CA 94551 (United States)


    Trophallaxis between individual worker ants and the toxicant load in dead and live Argentine ants (Linepithema humile) in colonies exposed to fipronil and hydramethylnon experimental baits were examined using accelerator mass spectrometry (AMS). About 50% of the content of the crop containing trace levels of {sup 14}C-sucrose, {sup 14}C-hydramethylnon, and {sup 14}C-fipronil was shared between single donor and recipient ants. Dead workers and queens contained significantly more hydramethylnon (122.7 and 22.4 amol/μg ant, respectively) than did live workers and queens (96.3 and 10.4 amol/μg ant, respectively). Dead workers had significantly more fipronil (420.3 amol/μg ant) than did live workers (208.5 amol/μg ant), but dead and live queens had equal fipronil levels (59.5 and 54.3 amol/μg ant, respectively). The distribution of fipronil differed within the bodies of dead and live queens; the highest amounts of fipronil were recovered in the thorax of dead queens whereas live queens had the highest levels in the head. Resurgence of polygynous ant colonies treated with hydramethylnon baits may be explained by queen survival resulting from sublethal doses due to a slowing of trophallaxis throughout the colony. Bait strategies and dose levels for controlling insect pests need to be based on the specific toxicant properties and trophic strategies for targeting the entire colony.

  2. Improved Ant Colony Clustering Algorithm and Its Performance Study (United States)

    Gao, Wei


    Clustering analysis is used in many disciplines and applications; it is an important tool that descriptively identifies homogeneous groups of objects based on attribute values. The ant colony clustering algorithm is a swarm-intelligent method used for clustering problems that is inspired by the behavior of ant colonies that cluster their corpses and sort their larvae. A new abstraction ant colony clustering algorithm using a data combination mechanism is proposed to improve the computational efficiency and accuracy of the ant colony clustering algorithm. The abstraction ant colony clustering algorithm is used to cluster benchmark problems, and its performance is compared with the ant colony clustering algorithm and other methods used in existing literature. Based on similar computational difficulties and complexities, the results show that the abstraction ant colony clustering algorithm produces results that are not only more accurate but also more efficiently determined than the ant colony clustering algorithm and the other methods. Thus, the abstraction ant colony clustering algorithm can be used for efficient multivariate data clustering. PMID:26839533

  3. Insecticide transfer efficiency and lethal load in Argentine ants

    International Nuclear Information System (INIS)

    Hooper-Bui, L.M.; Kwok, E.S.C.; Buchholz, B.A.; Rust, M.K.; Eastmond, D.A.; Vogel, J.S.


    Trophallaxis between individual worker ants and the toxicant load in dead and live Argentine ants (Linepithema humile) in colonies exposed to fipronil and hydramethylnon experimental baits were examined using accelerator mass spectrometry (AMS). About 50% of the content of the crop containing trace levels of 14 C-sucrose, 14 C-hydramethylnon, and 14 C-fipronil was shared between single donor and recipient ants. Dead workers and queens contained significantly more hydramethylnon (122.7 and 22.4 amol/μg ant, respectively) than did live workers and queens (96.3 and 10.4 amol/μg ant, respectively). Dead workers had significantly more fipronil (420.3 amol/μg ant) than did live workers (208.5 amol/μg ant), but dead and live queens had equal fipronil levels (59.5 and 54.3 amol/μg ant, respectively). The distribution of fipronil differed within the bodies of dead and live queens; the highest amounts of fipronil were recovered in the thorax of dead queens whereas live queens had the highest levels in the head. Resurgence of polygynous ant colonies treated with hydramethylnon baits may be explained by queen survival resulting from sublethal doses due to a slowing of trophallaxis throughout the colony. Bait strategies and dose levels for controlling insect pests need to be based on the specific toxicant properties and trophic strategies for targeting the entire colony.

  4. Disease dynamics in a specialized parasite of ant societies

    DEFF Research Database (Denmark)

    Andersen, Sandra Breum; Ferrari, Matthew; Evans, Harry C.


    Coevolution between ant colonies and their rare specialized parasites are intriguing, because lethal infections of workers may correspond to tolerable chronic diseases of colonies, but the parasite adaptations that allow stable coexistence with ants are virtually unknown. We explore the trade......-offs experienced by Ophiocordyceps parasites manipulating ants into dying in nearby graveyards. We used field data from Brazil and Thailand to parameterize and fit a model for the growth rate of graveyards. We show that parasite pressure is much lower than the abundance of ant cadavers suggests...

  5. Signals can trump rewards in attracting seed-dispersing ants.

    Directory of Open Access Journals (Sweden)

    Kyle M Turner

    Full Text Available Both rewards and signals are important in mutualisms. In myrmecochory, or seed dispersal by ants, the benefits to plants are relatively well studied, but less is known about why ants pick up and move seeds. We examined seed dispersal by the ant Aphaenogaster rudis of four co-occurring species of plants, and tested whether morphology, chemical signaling, or the nutritional quality of fatty seed appendages called elaiosomes influenced dispersal rates. In removal trials, ants quickly collected diaspores (seeds plus elaiosomes of Asarum canadense, Trillium grandiflorum, and Sanguinaria canadensis, but largely neglected those of T. erectum. This discrepancy was not explained by differences in the bulk cost-benefit ratio, as assessed by the ratio of seed to elaiosome mass. We also provisioned colonies with diaspores from one of these four plant species or no diaspores as a control. Colonies performed best when fed S. canadensis diaspores, worst when fed T. grandiflorum, and intermediately when fed A. canadense, T. erectum, or no diaspores. Thus, the nutritional rewards in elaiosomes affected colony performance, but did not completely predict seed removal. Instead, high levels of oleic acid in T. grandiflorum elaiosomes may explain why ants disperse these diaspores even though they reduce ant colony performance. We show for the first time that different elaiosome-bearing plants provide rewards of different quality to ant colonies, but also that ants appear unable to accurately assess reward quality when encountering seeds. Instead, we suggest that signals can trump rewards as attractants of ants to seeds.

  6. The evolution of invasiveness in garden ants.

    Directory of Open Access Journals (Sweden)

    Sylvia Cremer

    Full Text Available It is unclear why some species become successful invaders whilst others fail, and whether invasive success depends on pre-adaptations already present in the native range or on characters evolving de-novo after introduction. Ants are among the worst invasive pests, with Lasius neglectus and its rapid spread through Europe and Asia as the most recent example of a pest ant that may become a global problem. Here, we present the first integrated study on behavior, morphology, population genetics, chemical recognition and parasite load of L. neglectus and its non-invasive sister species L. turcicus. We find that L. neglectus expresses the same supercolonial syndrome as other invasive ants, a social system that is characterized by mating without dispersal and large networks of cooperating nests rather than smaller mutually hostile colonies. We conclude that the invasive success of L. neglectus relies on a combination of parasite-release following introduction and pre-adaptations in mating system, body-size, queen number and recognition efficiency that evolved long before introduction. Our results challenge the notion that supercolonial organization is an inevitable consequence of low genetic variation for chemical recognition cues in small invasive founder populations. We infer that low variation and limited volatility in cuticular hydrocarbon profiles already existed in the native range in combination with low dispersal and a highly viscous population structure. Human transport to relatively disturbed urban areas thus became the decisive factor to induce parasite release, a well established general promoter of invasiveness in non-social animals and plants, but understudied in invasive social insects.

  7. The Evolution of Invasiveness in Garden Ants (United States)

    Cremer, Sylvia; Ugelvig, Line V.; Drijfhout, Falko P.; Schlick-Steiner, Birgit C.; Steiner, Florian M.; Seifert, Bernhard; Hughes, David P.; Schulz, Andreas; Petersen, Klaus S.; Konrad, Heino; Stauffer, Christian; Kiran, Kadri; Espadaler, Xavier; d'Ettorre, Patrizia; Aktaç, Nihat; Eilenberg, Jørgen; Jones, Graeme R.; Nash, David R.; Pedersen, Jes S.; Boomsma, Jacobus J.


    It is unclear why some species become successful invaders whilst others fail, and whether invasive success depends on pre-adaptations already present in the native range or on characters evolving de-novo after introduction. Ants are among the worst invasive pests, with Lasius neglectus and its rapid spread through Europe and Asia as the most recent example of a pest ant that may become a global problem. Here, we present the first integrated study on behavior, morphology, population genetics, chemical recognition and parasite load of L. neglectus and its non-invasive sister species L. turcicus. We find that L. neglectus expresses the same supercolonial syndrome as other invasive ants, a social system that is characterized by mating without dispersal and large networks of cooperating nests rather than smaller mutually hostile colonies. We conclude that the invasive success of L. neglectus relies on a combination of parasite-release following introduction and pre-adaptations in mating system, body-size, queen number and recognition efficiency that evolved long before introduction. Our results challenge the notion that supercolonial organization is an inevitable consequence of low genetic variation for chemical recognition cues in small invasive founder populations. We infer that low variation and limited volatility in cuticular hydrocarbon profiles already existed in the native range in combination with low dispersal and a highly viscous population structure. Human transport to relatively disturbed urban areas thus became the decisive factor to induce parasite release, a well established general promoter of invasiveness in non-social animals and plants, but understudied in invasive social insects. PMID:19050762

  8. [Syagrus romanzoffiana (Arecaceae) seed utilization by ants in a secondary forest in South Brazil]. (United States)

    Silva, Fernanda R; Begnini, Romualdo M; Klier, Vinícius A; Scherer, Karla Z; Lopes, Benedito C; Castellani, Tânia T


    Ants can nest in a wide variety of substracts. This paper shows Syagrus romanzoffiana seed utilization by ants in an Atlantic secondary forest. We report 29 seeds occupied by small-bodied ants, with 27 of them showing at least two ant development stages. Although a large number of seeds were sampled, a low level of ant occupation was observed.

  9. Relative effects of disturbance on red imported fire ants and native ant species in a longleaf pine ecosystem

    DEFF Research Database (Denmark)

    Stuble, Katharine L.; Kirkman, L. Katherine; Carroll, C. Ronald


    and cases in which non-native species become established in intact (lacking extensive anthropogenic soil disturbance) communities and subsequently diminish the abundance and richness of native species is challenging on the basis of observation alone. The red imported fire ant (Solenopsis invicta......), an invasive species that occurs throughout much of the southeastern United States, is such an example. Rather than competitively displacing native species, fire ants may become established only in disturbed areas in which native species richness and abundance are already reduced. We used insecticide to reduce......, the abundance of native ants increased to levels comparable to those in control plots after 1 year. Our findings suggest that factors other than large reductions in ant abundance and species density (number of species per unit area) may affect the establishment of fire ants and that the response of native ants...

  10. La escritura como espada ante el machismo


    Rottoli, Sofía


    Cuando se trata de expresar una postura que abarque una temática demasiado amplia o controversial, recurrir a la escritura puede ser una buena opción de abordaje. Sobre todo cuando son discusiones que llevan años de vigencia. Las luchas feministas ante la violencia de género no son una excepción. Sus discusiones siempre tuvieron presencia en diversos campos, uno de ellos es la ya mencionada escritura. Centro de Investigación en Lectura y Escritura (CILE)

  11. Ecology: 'Devil's gardens' bedevilled by ants. (United States)

    Frederickson, Megan E; Greene, Michael J; Gordon, Deborah M


    'Devil's gardens' are large stands of trees in the Amazonian rainforest that consist almost entirely of a single species, Duroia hirsuta, and, according to local legend, are cultivated by an evil forest spirit. Here we show that the ant Myrmelachista schumanni, which nests in D. hirsuta stems, creates devil's gardens by poisoning all plants except its host plants with formic acid. By killing these other plants, M. schumanni provides its colonies with abundant nest sites--a long-lasting benefit as colonies can live for 800 years.

  12. Ante-natal ionising radiation and cancer

    International Nuclear Information System (INIS)



    This editorial comments on the latest reports of the Oxford Survey of Childhood Cancer (now based on Birmingham). With 14759 pairs, the latest survey is over 10-fold larger than the 1958 report and the calculation of fatal childhood cancer rate at one case in 990 ante-natal radiographic examinations is rather larger than the early estimates, in spite of the fetal radiation dose having been halved and the cure rate for childhood leukemia being much improved. Comments are made on the comparisons with bomb survivors, and on the much increased fatal cancer incidence after first trimester radiography. (UK)

  13. Ant Systems for a Dynamic TSP - Ants Caught in a Traffic Jam

    NARCIS (Netherlands)

    Eyckelhof, C.J.; Dorigo, M.; Caro Di, G.; Snoek, M.; Sampels, M.


    In this paper we present a new Ants System approach to a dynamic Travelling Salesman Problem. Here the travel times between the cities are subject to change. To handle this dynamism several ways of adapting the pheromone matrix both locally and globally are considered. We show that the strategy of

  14. Nectar Theft and Floral Ant-Repellence: A Link between Nectar Volume and Ant-Repellent Traits? (United States)

    Ballantyne, Gavin; Willmer, Pat


    As flower visitors, ants rarely benefit a plant. They are poor pollinators, and can also disrupt pollination by deterring other flower visitors, or by stealing nectar. Some plant species therefore possess floral ant-repelling traits. But why do particular species have such traits when others do not? In a dry forest in Costa Rica, of 49 plant species around a third were ant-repellent at very close proximity to a common generalist ant species, usually via repellent pollen. Repellence was positively correlated with the presence of large nectar volumes. Repellent traits affected ant species differently, some influencing the behaviour of just a few species and others producing more generalised ant-repellence. Our results suggest that ant-repellent floral traits may often not be pleiotropic, but instead could have been selected for as a defence against ant thieves in plant species that invest in large volumes of nectar. This conclusion highlights to the importance of research into the cost of nectar production in future studies into ant-flower interactions. PMID:22952793

  15. Partial incompatibility between ants and symbiotic fungi in two sympatric species of Acromyrmex leaf-cutting ants. (United States)

    Bot, A N; Rehner, S A; Boomsma, J J


    We investigate the nature and duration of incompatibility between certain combinations of Acromyrmex leaf-cutting ants and symbiotic fungi, taken from sympatric colonies of the same or a related species. Ant-fungus incompatibility appeared to be largely independent of the ant species involved, but could be explained partly by genetic differences among the fungus cultivars. Following current theoretical considerations, we develop a hypothesis, originally proposed by S. A. Frank, that the observed incompatibilities are ultimately due to competitive interactions between genetically different fungal lineages, and we predict that the ants should have evolved mechanisms to prevent such competition between cultivars within a single garden. This requires that the ants are able to recognize unfamiliar fungi, and we show that this is indeed the case. Amplified fragment length polymorphism genotyping further shows that the two sympatric Acromyrmex species share each other's major lineages of cultivar, confirming that horizontal transfer does occasionally take place. We argue and provide some evidence that chemical substances produced by the fungus garden may mediate recognition of alien fungi by the ants. We show that incompatibility between ants and transplanted, genetically different cultivars is indeed due to active killing of the novel cultivar by the ants. This incompatibility disappears when ants are force-fed the novel cultivar for about a week, a result that is consistent with our hypothesis of recognition induced by the resident fungus and eventual replacement of incompatibility compounds during force-feeding.

  16. The importance of ants in cave ecology, with new records and behavioral observations of ants in Arizona caves

    Directory of Open Access Journals (Sweden)

    Robert B. Pape


    Full Text Available The importance of ants as elements in cave ecology has been mostly unrecognized. A global list of ant species recorded from caves, compiled from a review of existing literature, is presented. This paper also reviews what is currently known about ants occurring in Arizona (USA caves. The diversity and distribution represented in these records suggests ants are relatively common cave visitors (trogloxenes. A general utilization of caves by ants within both temperate and tropical latitudes may be inferred from this combined evidence. Observations of ant behavior in Arizona caves demonstrate a low level and sporadic, but persistent, use of these habitats and their contained resources by individual ant colonies. Documentation of Neivamyrmex sp. preying on cave-inhabiting arthropods is reported here for the first time. Observations of hypogeic army ants in caves suggests they may not penetrate to great vertical depth in search of prey, but can be persistent occupants in relatively shallow, horizontal sections of caves where they may prey on endemic cave animals. First cave records for ten ant species are reported from Arizona caves. These include two species of Neivamyrmex (N. nigrescens Cresson and Neivamyrmex sp.; Formicidae: Dorylinae, four myrmicines (Pheidole portalensis Wilson, Pheidole cf. porcula Wheeler, Solenopsis aurea Wheeler and Stenamma sp. Westwood, one dolichoderine (Forelius keiferi Wheeler and three formicines (Lasius arizonicus Wheeler, L. sitiens Wilson, and Camponotus sp. Mayr.

  17. ANT tuner retrofit for LEB cavity

    International Nuclear Information System (INIS)

    Walling, L.; Goren, Y.; Kwiatkowski, S.


    This report describes a ferrite tuner design for the LEB cavity that utilizes techniques for bonding ferrite to metallic cooling plates that is utilized in the high-power rf and microwave industry. A test tuner was designed to fit into the existing LEB-built magnet and onto the Grimm LEB Cavity. It will require a new vacuum window in order to attain maximal tuning range and high voltage capability and a new center conductor of longer length and a different vacuum window connection than the Grimm center conductor. However, the new center conductor will be essentially identical to the Grimm center conductor in its basic construction and in the way it connects to the stand for support. The tuner is mechanically very similar to high-power stacked circulators built by ANT of Germany and was designed according to ANT's established engineering and design criteria and SSC LEB tuning and power requirements. The tuner design incorporates thin tiles of ferrite glued using a high-radiation-resistance epoxy to copper-plated stainless steel cooling plates of thickness 6.5 mm with water cooling channels inside the plates. The cooling plates constitute 16 pie-shaped segments arranged in a disk. They are electrically isolated from each other to suppress eddy currents. Five of these disks are arranged in parallel with high-pressure rf contacts between the plates at the outer radius. The end walls are slotted copper-plated stainless steel of thickness 3 mm

  18. Loading pattern optimization using ant colony algorithm

    International Nuclear Information System (INIS)

    Hoareau, Fabrice


    Electricite de France (EDF) operates 58 nuclear power plants (NPP), of the Pressurized Water Reactor type. The loading pattern optimization of these NPP is currently done by EDF expert engineers. Within this framework, EDF R and D has developed automatic optimization tools that assist the experts. LOOP is an industrial tool, developed by EDF R and D and based on a simulated annealing algorithm. In order to improve the results of such automatic tools, new optimization methods have to be tested. Ant Colony Optimization (ACO) algorithms are recent methods that have given very good results on combinatorial optimization problems. In order to evaluate the performance of such methods on loading pattern optimization, direct comparisons between LOOP and a mock-up based on the Max-Min Ant System algorithm (a particular variant of ACO algorithms) were made on realistic test-cases. It is shown that the results obtained by the ACO mock-up are very similar to those of LOOP. Future research will consist in improving these encouraging results by using parallelization and by hybridizing the ACO algorithm with local search procedures. (author)

  19. Ant Foraging Behavior for Job Shop Problem

    Directory of Open Access Journals (Sweden)

    Mahad Diyana Abdul


    Full Text Available Ant Colony Optimization (ACO is a new algorithm approach, inspired by the foraging behavior of real ants. It has frequently been applied to many optimization problems and one such problem is in solving the job shop problem (JSP. The JSP is a finite set of jobs processed on a finite set of machine where once a job initiates processing on a given machine, it must complete processing and uninterrupted. In solving the Job Shop Scheduling problem, the process is measure by the amount of time required in completing a job known as a makespan and minimizing the makespan is the main objective of this study. In this paper, we developed an ACO algorithm to minimize the makespan. A real set of problems from a metal company in Johor bahru, producing 20 parts with jobs involving the process of clinching, tapping and power press respectively. The result from this study shows that the proposed ACO heuristics managed to produce a god result in a short time.

  20. The effect of diet and opponent size on aggressive interactions involving caribbean crazy ants (Nylanderia fulva.

    Directory of Open Access Journals (Sweden)

    Katherine C Horn

    Full Text Available Biotic interactions are often important in the establishment and spread of invasive species. In particular, competition between introduced and native species can strongly influence the distribution and spread of exotic species and in some cases competition among introduced species can be important. The Caribbean crazy ant, Nylanderia fulva, was recently introduced to the Gulf Coast of Texas, and appears to be spreading inland. It has been hypothesized that competition with the red imported fire ant, Solenopsis invicta, may be an important factor in the spread of crazy ants. We investigated the potential of interspecific competition among these two introduced ants by measuring interspecific aggression between Caribbean crazy ant workers and workers of Solenopsis invicta. Specifically, we examined the effect of body size and diet on individual-level aggressive interactions among crazy ant workers and fire ants. We found that differences in diet did not alter interactions between crazy ant workers from different nests, but carbohydrate level did play an important role in antagonistic interactions with fire ants: crazy ants on low sugar diets were more aggressive and less likely to be killed in aggressive encounters with fire ants. We found that large fire ants engaged in fewer fights with crazy ants than small fire ants, but fire ant size affected neither fire ant nor crazy ant mortality. Overall, crazy ants experienced higher mortality than fire ants after aggressive encounters. Our findings suggest that fire ant workers might outcompete crazy ant workers on an individual level, providing some biotic resistance to crazy ant range expansion. However, this resistance may be overcome by crazy ants that have a restricted sugar intake, which may occur when crazy ants are excluded from resources by fire ants.

  1. Aphid egg protection by ants: a novel aspect of the mutualism between the tree-feeding aphid Stomaphis hirukawai and its attendant ant Lasius productus (United States)

    Matsuura, Kenji; Yashiro, Toshihisa


    Aphids often form mutualistic associations with ants, in which the aphids provide the ants with honeydew and the ants defend the aphids from predators. In this paper, we report aphid egg protection by ants as a novel aspect of the deeply interdependent relationship between a tree-feeding aphid and its attendant ant. The ant Lasius productus harbours oviparous females, males, and eggs of the hinoki cypress-feeding aphid Stomaphis hirukawai in its nests in winter. We investigated the behaviour of ants kept with aphid eggs in petri dishes to examine whether the ants recognise the aphid eggs and tend them or only provide a refuge for the aphids. Workers carried almost all of the aphid eggs into the nest within 24 h. The ants indiscriminately tended aphid eggs collected from their own colonies and those from other ant colonies. The ants cleaned the eggs and piled them up in the nest, and egg tending by ants dramatically increased aphid egg survival rates. Starving the ants showed no significant effect on aphid egg survivorship. Without ants, aphid eggs were rapidly killed by fungi. These results suggested that grooming by the ants protected the aphid eggs, at least, against pathogenic fungi. This hygienic service afforded by the ants seems indispensable for egg survival of these aphids in an environment rich in potentially pathogenic microorganisms.

  2. Current and potential ant impacts in the Pacific region (United States)

    Loope, Lloyd L.; Krushelnycky, Paul D.


    Worldwide, ants are a powerful ecological force, and they appear to be dominant components of animal communities of many tropical and temperate ecosystems in terms of biomass and numbers of individuals (Bluthgen et al. 2000). For example, ants comprise up to 94% of arthropod individuals in fogging samples taken from diverse lowland tropical rainforest canopies, and 86% of the biomass (Davidson et al. 2003). The majority of these ant species and individuals obtain carbohydrates either from extrafloral nectaries or from sap-feeding Hemiptera that pass carbohydrate-rich “honeydew” to attending ants while concentrating nitrogen (N) from N-poor plant sap (Davidson et al. 2003). Honeydew and nectar represent key resources for arboreal ant species, although most ant species are at least partly carnivorous or scavengers (Bluthgen et al. 2004). In contrast to most of the terrestrial world, the biotas of many Pacific islands evolved without ants. Whereas endemic ant species are found in New Zealand (ca. 10 spp.), Tonga (ca. 10 spp.), and Samoa (ca. 12 spp.), other islands of Polynesia and parts of Micronesia likely lack native ants (Wilson and Taylor 1967, Wetterer 2002, Wetterer and Vargo 2003). About 20 Indo-Australian and western Pacific ant species range to the east and north of Samoa, but it is unclear how many of these were transported there by humans at some time (Wilson and Taylor 1967). Most of the remainder of the ant species currently found on Pacific islands are widespread species that fall in the category of “tramp species,” dispersed by recent human commerce and generally closely tied to human activity and urban areas (Wilson and Taylor 1967, McGlynn 1999). In Pacific island situations, some of these tramp ant species are able to thrive beyond areas of human activity. Relatively few ant species have been successful invaders of native communities on continents, and these include most of the species that pose the greatest problems for Pacific islands

  3. Descrição de injúria humana causada por falsa tocandira (Dinoponera gigantea, Perty, 1833) com revisão dos aspectos folclóricos, farmacológicos e clínicos das formigas gigantes do gênero Paraponera e Dinoponera (sub-família Ponerinae)


    Haddad Junior, Vidal; Cardoso, João Luiz Costa; Moraes, Roberto Henrique Pinto


    The authors observed an injury caused by the sting of a false tocandira ant in the hand of an amateur fisherman and they describe the clinical findings and the evolution of the envenoming, which presented an acute and violent pain, cold sweating, nausea, a vomiting episode, malaise, tachycardia and left axillary's lymphadenopathy. About three hours after the accident, still feeling intense pain in the place of the sting, he presented an episode of great amount of blood in the feces with no hi...

  4. Ultrastructure of antennal sensillae of the samsum ant ...

    African Journals Online (AJOL)

    Black ant (Samsum), Pachycodyla sennarrensis, stings and injects venom and inflicts allergy (a rare clinical problem) due to its local and systemic reaction, which is considered as a health hazard amongst Saudi society. Thus, black ant is a source of serious concern for the government and experts as well.

  5. Development of a Bait System for the Pharaoh's Ant, Monomorium ...

    African Journals Online (AJOL)

    The infestation of the Pharaoh's ant, Monomorium pharaonis L. is widespread and, sometimes, very serious in homes, hospitals, restaurants, factories, etc. People are helpless because effective baited traps are not available locally, and little has been done locally to develop effective control strategies for these ants.

  6. A preliminary checklist of the ants (Hymenoptera: Formicidae) of ...

    African Journals Online (AJOL)

    A preliminary species checklist of the ants (Hymenoptera: Formicidae) of. Kakamega Forest, Western Kenya, is presented. The species list is based on specimens sampled from 1999 until 2009, which are deposited in the ant collection of the Zoological Research Museum Koenig, Bonn, Germany, and the Natural History ...

  7. Ant species richness of fynbos and forest ecosystems in the ...

    African Journals Online (AJOL)

    The ant fauna in fynbos and forest habitats in the southern Cape are compared. There is no significant difference in ant species richness between the two undisturbed habitat types, and the only two species common to both are Acantholepis capensis and Camponotus maculatus. The degree of Hakea sericea infestation in ...

  8. Volatile chemicals in glands of the carpenter ant, Camponotus ...

    African Journals Online (AJOL)

    Volatile chemicals in glands of the carpenter ant, Camponotus arminius. J.M. Brand, L.V. Mabinya, E.D. Morgan. Abstract. Camponotus arminius is a large black carpenter ant that occurs in tropical and sub-tropical Africa and has extensive foraging trails both in trees and on the ground. Analysis of excised mandibular glands ...

  9. Novel Phialophora species from leaf-cutting ants (tribe Attini)

    NARCIS (Netherlands)

    Attili-Angelis, D.; Duarte, A.P.M.; Pagnocca, F.C.; Nagamoto, N.S.; de Vries, M.; Stielow, J.B.; de Hoog, G.S.


    Ants in the tribe Attini (Hymenoptera, Formicidae) maintain a 50 million-year-old lifestyle of co-evolution with symbiotic basidiomycetous fungi which they cultivate as essential source of nutrition. However, other microorganisms have been reported from ant habitats indicating a higher diversity of

  10. Why do house-hunting ants recruit in both directions?

    NARCIS (Netherlands)

    Planqué, R.; Dechaume-Moncharmont, F.-X.; Franks, N.R.; Kovacs, T.; Marshall, J.A.R.


    To perform tasks, organisms often use multiple procedures. Explaining the breadth of such behavioural repertoires is not always straightforward. During house hunting, colonies of Temnothorax albipennis ants use a range of behaviours to organise their emigrations. In particular, the ants use tandem

  11. Tracing the rise of ants - out of the ground.

    Directory of Open Access Journals (Sweden)

    Andrea Lucky

    Full Text Available The evolution of ants (Hymenoptera: Formicidae is increasingly well-understood due to recent phylogenetic analyses, along with estimates of divergence times and diversification rates. Yet, leading hypotheses regarding the ancestral habitat of ants conflict with new findings that early ant lineages are cryptic and subterranean. Where the ants evolved, in respect to habitat, and how habitat shifts took place over time have not been formally tested. Here, we reconstruct the habitat transitions of crown-group ants through time, focusing on where they nest and forage (in the canopy, litter, or soil. Based on ancestral character reconstructions, we show that in contrast to the current consensus based on verbal arguments that ants evolved in tropical leaf litter, the soil is supported as the ancestral stratum of all ants. We also find subsequent movements up into the litter and, in some cases, into the canopy. Given the global importance of ants, because of their diversity, ecological influence and status as the most successful eusocial lineage on Earth, understanding the early evolution of this lineage provides insight into the factors that made this group so successful today.

  12. In vitro studies of ante-mortem proliferation kinetics

    International Nuclear Information System (INIS)

    McBride, W.H.; Withers, H.R.


    Using K562 human erythroblastoid cells, it was concluded that dose fractionation has no discrepant effect on the ante-mortem proliferation kinetics of doomed cells as opposed to clonogenic cell survival and that effects on ante-mortem proliferation kinetics cannot be solely responsible for the differences in fractionation response between early and late responding tissues. (UK)

  13. Reciprocal genomic evolution in the ant-fungus agricultural symbiosis

    DEFF Research Database (Denmark)

    Nygaard, Sanne; Hu, Haofu; Li, Cai


    The attine ant-fungus agricultural symbiosis evolved over tens of millions of years, producing complex societies with industrial-scale farming analogous to that of humans. Here we document reciprocal shifts in the genomes and transcriptomes of seven fungus-farming ant species and their fungal...

  14. Life-Histories of Sub-Arctic Ants


    Heinze, Jürgen


    Ant species belonging to seven genera occur in habitats near the tree line in the Northern Hemisphere. An analysis of colony founding strategies suggests that in addition to physiological cold resistance, behavioral and sociometric adaptations might be important for survival and propagation of ants in subarctic biomes.

  15. Studies of laboulbeniales (Fungi, Ascomycota) on myrmica ants (II)

    NARCIS (Netherlands)

    Haelewaters, Danny; Boer, Peter; Gort, Gerrit; Noordijk, Jinze


    One group of important insect parasites are the Laboulbeniales (Ascomycota), microscopic fungi that live attached to the exterior of their hosts, mainly beetles, but also mites, millipedes, earwigs, and ants. Rickia wasmannii is a common fungus in Europe and is limited to the ant genus Myrmica


    Directory of Open Access Journals (Sweden)

    Febri Liantoni


    Full Text Available Ant Colony Optimization (ACO is a nature-inspired optimization algorithm which is motivated by ants foraging behavior. Due to its favorable advantages, ACO has been widely used to solve several NP-hard problems, including edge detection. Since ACO initially distributes ants at random, it may cause imbalance ant distribution which later affects path discovery process. In this paper an adaptive ACO is proposed to optimize edge detection by adaptively distributing ant according to gradient analysis. Ants are adaptively distributed according to gradient ratio of each image regions. Region which has bigger gradient ratio, will have bigger number of ant distribution. Experiments are conducted using images from various datasets. Precision and recall are used to quantitatively evaluate performance of the proposed algorithm. Precision and recall of adaptive ACO reaches 76.98 % and 96.8 %. Whereas highest precision and recall for standard ACO are 69.74 % and 74.85 %. Experimental results show that the adaptive ACO outperforms standard ACO which randomly distributes ants.

  17. Patterns of male parentage in the fungus-growing ants

    DEFF Research Database (Denmark)

    Villesen, Palle; Boomsma, JJ


    Ant queens from eight species, covering three genera of lower and two genera of higher attine ants, have exclusively or predominantly single mating. The ensuing full-sib colonies thus have a strong potential reproductive conflict between the queen and the workers over male production...

  18. Odorous house ants (Tapinoma sessile as back-seat drivers of localized ant decline in urban habitats.

    Directory of Open Access Journals (Sweden)

    Adam Salyer

    Full Text Available Invasive species and habitat disturbance threaten biodiversity worldwide by modifying ecosystem performance and displacing native organisms. Similar homogenization impacts manifest locally when urbanization forces native species to relocate or reinvade perpetually altered habitat. This study investigated correlations between ant richness and abundance in response to urbanization and the nearby presence of invasive ant species, odorous house ants (Tapinoma sessile, within its native region. Surveying localized ant composition within natural, semi-natural, and urban habitat supported efforts to determine whether T. sessile appear to be primary (drivers threats as instigators or secondary (passengers threats as inheritors of indigenous ant decline. Sampling 180 sites, evenly split between all habitats with and without T. sessile present, yielded 45 total species. Although urbanization and T. sessile presence factors were significantly linked to ant decline, their interaction correlated to the greatest reduction of total ant richness (74% and abundance (81%. Total richness appeared to decrease from 27 species to 18 when natural habitat is urbanized and from 18 species to 7 with T. sessile present in urban plots. Odorous house ant presence minimally influenced ant communities within natural and semi-natural habitat, highlighting the importance of habitat alteration and T. sessile presence interactions. Results suggest urbanization releases T. sessile from unknown constraints by decreasing ant richness and competition. Within urban environment, T. sessile are pre-adapted to quickly exploit new resources and grow to supercolony strength wherein T. sessile drive adjacent biodiversity loss. Odorous house ants act as passengers and drivers of ecological change throughout different phases of urban 'invasion'. This progression through surviving habitat alteration, exploiting new resources, thriving, and further reducing interspecific competition supports a

  19. Weaver Ants to Control Fruit Fly Damage to Tanzanian Mangoes

    DEFF Research Database (Denmark)

    Kirkegaard, Nina

    in Australia and West Africa. In this study, small scale farmers did not think weaver ants protected their mangoes from fruit flies. Observational studies confirmed the farmers’ views. No volatile compounds, likely to be responsible for the weaver ants’ deterrent effect, were identified. This study focused...... mangoes varied a lot with zero infestation in some fruits and more than 100 pupae emerging from other fruits, indicating that other factors than the presence of weaver ants affect the fruit flies’ decision on where to oviposit. It was not uncommon for farmers to place newly harvested mangoes below mango...... not shown to be effectively deterring fruit flies, there is no great motivation for farmers to adopt weaver ants. Assuming the weaver ants could be managed in a way that made weaver ants deter fruit flies effectively there are still some economic aspects which should be studied further. It is necessary...

  20. Behind every great ant, there is a great gut

    DEFF Research Database (Denmark)

    Poulsen, Michael; Sapountzis, Panagiotis


    on the potential contribution of the ants’ gut symbionts. This issue of Molecular Ecology contains a study by Anderson et al. (2012), who take a comparative approach to explore the link between trophic levels and ant microbiomes, specifically, to address three main questions: (i) Do closely related herbivorous...... conserved gut microbiomes, suggesting symbiont functions that directly relate to dietary preference of the ant host. These findings suggest an ecological role of gut symbionts in ants, for example, in metabolism and/or protection, and the comparative approach taken supports a model of co-evolution between...... ant species and specific core symbiont microbiomes. This study, thereby, highlights the omnipresence and importance of gut symbioses—also in the Hymenoptera—and suggests that these hitherto overlooked microbes likely have contributed to the ecological success of the ants....

  1. Endophytic fungi reduce leaf-cutting ant damage to seedlings (United States)

    Bittleston, L. S.; Brockmann, F.; Wcislo, W.; Van Bael, S. A.


    Our study examines how the mutualism between Atta colombica leaf-cutting ants and their cultivated fungus is influenced by the presence of diverse foliar endophytic fungi (endophytes) at high densities in tropical leaf tissues. We conducted laboratory choice trials in which ant colonies chose between Cordia alliodora seedlings with high (Ehigh) or low (Elow) densities of endophytes. The Ehigh seedlings contained 5.5 times higher endophyte content and a greater diversity of fungal morphospecies than the Elow treatment, and endophyte content was not correlated with leaf toughness or thickness. Leaf-cutting ants cut over 2.5 times the leaf area from Elow relative to Ehigh seedlings and had a tendency to recruit more ants to Elow plants. Our findings suggest that leaf-cutting ants may incur costs from cutting and processing leaves with high endophyte loads, which could impact Neotropical forests by causing variable damage rates within plant communities. PMID:20610420

  2. Egg-laying butterflies distinguish predaceous ants by sight. (United States)

    Sendoya, Sebastián F; Freitas, André V L; Oliveira, Paulo S


    Information about predation risks is critical for herbivorous insects, and natural selection favors their ability to detect predators before oviposition and to select enemy-free foliage when offspring mortality risk is high. Food plants are selected by ovipositing butterflies, and offspring survival frequently varies among plants because of variation in the presence of predators. Eunica bechina butterflies oviposit on Caryocar brasiliense, an ant-defended plant. Experiments with dried Camponotus and Cephalotes ants pinned to leaves revealed that butterflies use ant size and form as visual cues to avoid ovipositing on plant parts occupied by ants more likely to kill larval offspring. Presence of sap-sucking bugs did not affect butterfly oviposition. This is the first demonstration that visual recognition of predators can mediate egg-laying decisions by an insect herbivore and that an insect will discriminate among different species of potential predators. This unusual behavioral capability permits specialization on a risky, ant-defended food plant.

  3. ANT International chemistry update and best practices

    International Nuclear Information System (INIS)

    Nordmann, F.; Odar, S.; Venz, H.; Kysela, J.; Ruehle, W.; Riess, R.


    There is an increasing number of Nuclear Power Plants (NPP) in various countries. Their chemistry practices are different due to the variety of designs and experiences while in the past the view was more monolithic. This is allowing a very rich experience that is extremely difficult to fully be aware of. ANT International is now collecting and evaluating these data as well as related R and D Information. This allows interested parties to have an easier access to the various sources of information. The chemistry experts associated to ANT International have been gathering a comprehensive detailed view of: The numerous laboratory data gained all over the world during the past decades; The extensive plant operating experiences with various types of chemistry strategies, crosschecked for various types of reactors designs and materials; An experienced international knowledge able to give the comprehensive overview that young engineers now in charge of many other activities are unable to fully cover. This paper gives the core conclusions of the detailed ANT International reports and results that have recently been gathered in the area of chemistry. It particularly covers: The primary water chemistry and its relation with radionuclides, dose rates and fuel behaviour; The secondary water chemistry focusing on its rationale selection depending on materials, design and other constraints; The start up and shutdown chemistry with it large variety of practices hardly understandable even for some experts; and, The maintenance remedies such as decontamination, steam generator cleaning and its alternate options. Various types of Reactor designs (PWR, VVER, BWR, CANDU®) are considered. The different materials, for example the impact of steam generator tubing and its evolution on the secondary water chemistry rationale or on the radioactivity built-up in the primary coolant, are described. The ways to improve the plant operation with a long term reliability as well as the most

  4. The regulation of ant colony foraging activity without spatial information.

    Directory of Open Access Journals (Sweden)

    Balaji Prabhakar

    Full Text Available Many dynamical networks, such as the ones that produce the collective behavior of social insects, operate without any central control, instead arising from local interactions among individuals. A well-studied example is the formation of recruitment trails in ant colonies, but many ant species do not use pheromone trails. We present a model of the regulation of foraging by harvester ant (Pogonomyrmex barbatus colonies. This species forages for scattered seeds that one ant can retrieve on its own, so there is no need for spatial information such as pheromone trails that lead ants to specific locations. Previous work shows that colony foraging activity, the rate at which ants go out to search individually for seeds, is regulated in response to current food availability throughout the colony's foraging area. Ants use the rate of brief antennal contacts inside the nest between foragers returning with food and outgoing foragers available to leave the nest on the next foraging trip. Here we present a feedback-based algorithm that captures the main features of data from field experiments in which the rate of returning foragers was manipulated. The algorithm draws on our finding that the distribution of intervals between successive ants returning to the nest is a Poisson process. We fitted the parameter that estimates the effect of each returning forager on the rate at which outgoing foragers leave the nest. We found that correlations between observed rates of returning foragers and simulated rates of outgoing foragers, using our model, were similar to those in the data. Our simple stochastic model shows how the regulation of ant colony foraging can operate without spatial information, describing a process at the level of individual ants that predicts the overall foraging activity of the colony.

  5. Immune defense in leaf-cutting ants

    DEFF Research Database (Denmark)

    Armitage, Sophie A O; Broch, Jens F; Marín, Hermogenes Fernández


    To ameliorate the impact of disease, social insects combine individual innate immune defenses with collective social defenses. This implies that there are different levels of selection acting on investment in immunity, each with their own trade-offs. We present the results of a cross......-fostering experiment designed to address the influences of genotype and social rearing environment upon individual and social immune defenses. We used a multiply mating leaf-cutting ant, enabling us to test for patriline effects within a colony, as well as cross-colony matriline effects. The worker's father influenced...... both individual innate immunity (constitutive antibacterial activity) and the size of the metapleural gland, which secretes antimicrobial compounds and functions in individual and social defense, indicating multiple mating could have important consequences for both defense types. However, the primarily...

  6. Ex-ante Evaluation von Investitionsalternativen

    Directory of Open Access Journals (Sweden)

    Matthias Müller


    Full Text Available Der Beitrag zeigt, wie mit Hilfe der Methode der agentenbasierten Modellierung und Simulation (ABMS ein Beitrag zur ex-ante Policy-Beratung geleistet werden kann. Anhand eines exemplarischen Anwendungsfalls, der VISIBLE Simulationsumgebung („Virtual Simulation Lab for the Analysis of Investments in Learning and Education“, diskutieren wir die Konsequenzen unterschiedlicher Kooperationsförderinstrumente für Wissensdiffusionsprozesse in Netzwerken am Beispiel der Region Heilbronn-Franken. Die Simulationsergebnisse zeigen, dass die strukturelle Konfiguration eines regionalen Innovationssystems eine zentrale Bedeutung für die Gestaltung von Kooperationsfördermaßnahmen hat und dass Interventionen, die darauf abzielen, Wissenstransfer zwischen den Akteuren anzuregen, genau die entgegengesetzten Wirkungen entfalten können.

  7. Swarm controlled emergence for ant clustering

    DEFF Research Database (Denmark)

    Scheidler, Alexander; Merkle, Daniel; Middendorf, Martin


    .g. moving robots, and clustering algorithms. Design/methodology/approach: Different types of control agents for that ant clustering model are designed by introducing slight changes to the behavioural rules of the normal agents. The clustering behaviour of the resulting swarms is investigated by extensive...... for future research to investigate the application of the method in other swarm systems. Swarm controlled emergence might be applied to control emergent effects in computing systems that consist of many autonomous components which make decentralized decisions based on local information. Practical...... simulation studies. Findings: It is shown that complex behavior can emerge in systems with two types of agents (normal agents and control agents). For a particular behavior of the control agents, an interesting swarm size dependent effect was found. The behaviour prevents clustering when the number...

  8. Discrimination Behavior in the Supercolonial Pharaoh Ant

    DEFF Research Database (Denmark)

    Pontieri, Luigi

    The majority of eusocial insect species live in small, kin structured colonies that are mutually aggressive and rarely interact. By contrast, a restricted group of ant species show a peculiar social organization called unicoloniality, where colonies can grow to vast networks of geographically...... and genetic distance between colony pairs, further confirming the important role of endogenous cues in the nestmate recognition of this species. The third chapter presents a methodological study on the best procedures for identifying chemical compounds used for nestmate recognition in social insects. We first...... evaluated the power of different combinations of data transformation and chemical distance calculation in differentiating between true nestmate recognition (NMR) cues and other compounds. We found that particular combinations of statistical procedures are more effective in differentiating NMR cues from...

  9. Entomopathogens Isolated from Invasive Ants and Tests of Their Pathogenicity

    Directory of Open Access Journals (Sweden)

    Maria Fernanda Miori de Zarzuela


    Full Text Available Some ant species cause severe ecological and health impact in urban areas. Many attempts have been tested to control such species, although they do not always succeed. Biological control is an alternative to chemical control and has gained great prominence in research, and fungi and nematodes are among the successful organisms controlling insects. This study aimed to clarify some questions regarding the biological control of ants. Invasive ant species in Brazil had their nests evaluated for the presence of entomopathogens. Isolated entomopathogens were later applied in colonies of Monomorium floricola under laboratory conditions to evaluate their effectiveness and the behavior of the ant colonies after treatment. The entomopathogenic nematodes Heterorhabditis sp. and Steinernema sp. and the fungi Beauveria bassiana, Metarhizium anisopliae, and Paecilomyces sp. were isolated from the invasive ant nests. M. floricola colonies treated with Steinernema sp. and Heterorhabditis sp. showed a higher mortality of workers than control. The fungus Beauveria bassiana caused higher mortality of M. floricola workers. However, no colony reduction or elimination was observed in any treatment. The defensive behaviors of ants, such as grooming behavior and colony budding, must be considered when using fungi and nematodes for biological control of ants.

  10. The diversity of microorganisms associated with Acromyrmex leafcutter ants

    Directory of Open Access Journals (Sweden)

    Boomsma Jacobus J


    Full Text Available Abstract Background Molecular biological techniques are dramatically changing our view of microbial diversity in almost any environment that has so far been investigated. This study presents a systematic survey of the microbial diversity associated with a population of Acromyrmex leafcutter ants. In contrast to previous studies on social insects, which targeted specific groups of symbionts occurring in the gut (termites, Tetraponera ants or in specialised cells (Camponotus ants the objective of our present study was to do a total screening of all possible micro-organisms that can be found inside the bodies of these leafcutter ants. Results We amplified, cloned and sequenced SSU rRNA encoding gene fragments from 9 microbial groups known to have insect-associated representatives, and show that: (1 representatives of 5 out of 9 tested groups are present, (2 mostly several strains per group are present, adding up to a total of 33 different taxa. We present the microbial taxa associated with Acromymex ants in a phylogenetic context (using sequences from GenBank to assess and illustrate to which known microorganisms they are closely related. The observed microbial diversity is discussed in the light of present knowledge on the evolutionary history of Acromyrmex leafcutter ants and their known mutualistic and parasitic symbionts. Conclusions The major merits of the screening approach documented here is its high sensitivity and specificity, which allowed us to identify several microorganisms that are promising candidates for further study of their interactions with Acromyrmex leafcutter ants or their gardens.


    Energy Technology Data Exchange (ETDEWEB)

    Wike, L; Doug Martin, D; Michael Paller, M; Eric Nelson, E


    Ecosystem health with its near infinite number of variables is difficult to measure, and there are many opinions as to which variables are most important, most easily measured, and most robust, Bioassessment avoids the controversy of choosing which physical and chemical parameters to measure because it uses responses of a community of organisms that integrate all aspects of the system in question. A variety of bioassessment methods have been successfully applied to aquatic ecosystems using fish and macroinvertebrate communities. Terrestrial biotic index methods are less developed than those for aquatic systems and we are seeking to address this problem here. This study had as its objective to examine the baseline differences in ant communities at different seral stages from clear cut back to mature pine plantation as a precursor to developing a bioassessment protocol. Comparative sampling was conducted at four seral stages; clearcut, 5 year, 15 year and mature pine plantation stands. Soil and vegetation data were collected at each site. All ants collected were preserved in 70% ethyl alcohol and identified to genus. Analysis of the ant data indicates that ants respond strongly to the habitat changes that accompany ecological succession in managed pine forests and that individual genera as well as ant community structure can be used as an indicator of successional change. Ants exhibited relatively high diversity in both early and mature seral stages. High ant diversity in the mature seral stages was likely related to conditions on the forest floor which favored litter dwelling and cool climate specialists.

  12. Interactions Increase Forager Availability and Activity in Harvester Ants.

    Directory of Open Access Journals (Sweden)

    Evlyn Pless

    Full Text Available Social insect colonies use interactions among workers to regulate collective behavior. Harvester ant foragers interact in a chamber just inside the nest entrance, here called the 'entrance chamber'. Previous studies of the activation of foragers in red harvester ants show that an outgoing forager inside the nest experiences an increase in brief antennal contacts before it leaves the nest to forage. Here we compare the interaction rate experienced by foragers that left the nest and ants that did not. We found that ants in the entrance chamber that leave the nest to forage experienced more interactions than ants that descend to the deeper nest without foraging. Additionally, we found that the availability of foragers in the entrance chamber is associated with the rate of forager return. An increase in the rate of forager return leads to an increase in the rate at which ants descend to the deeper nest, which then stimulates more ants to ascend into the entrance chamber. Thus a higher rate of forager return leads to more available foragers in the entrance chamber. The highest density of interactions occurs near the nest entrance and the entrances of the tunnels from the entrance chamber to the deeper nest. Local interactions with returning foragers regulate both the activation of waiting foragers and the number of foragers available to be activated.

  13. Competitive assembly of South Pacific invasive ant communities

    Directory of Open Access Journals (Sweden)

    Sarty Megan


    Full Text Available Abstract Background The relative importance of chance and determinism in structuring ecological communities has been debated for nearly a century. Evidence for determinism or assembly rules is often evaluated with null models that randomize the occurrence of species in particular locales. However, analyses of the presence or absence of species ignores the potential influence of species abundances, which have long been considered of major importance on community structure. Here, we test for community assembly rules in ant communities on small islands of the Tokelau archipelago using both presence-absence and abundance data. We conducted three sets of analyses on two spatial scales using three years of sampling data from 39 plots on 11 islands. Results First, traditional null model tests showed support for negative species co-occurrence patterns among plots within islands, but not among islands. A plausible explanation for this result is that analyses at larger spatial scales merge heterogeneous habitats that have considerable effects on species occurrences. Second, analyses of ant abundances showed that samples with high ant abundances had fewer species than expected by chance, both within and among islands. One ant species, the invasive yellow crazy ant Anoplolepis gracilipes, appeared to have a particularly strong effect on community structure correlated with its abundance. Third, abundances of most ant species were inversely correlated with the abundances of all other ants at both spatial scales. This result is consistent with competition theory, which predicts species distributions are affected by diffuse competition with suites of co-occurring species. Conclusion Our results support a pluralistic explanation for ant species abundances and assembly. Both stochastic and deterministic processes interact to determine ant community assembly, though abundance patterns clearly drive the deterministic patterns in this community. These deterministic

  14. Evolution of Fungal enzymes in the attine ant symbiosis

    DEFF Research Database (Denmark)

    de Fine Licht, Henrik Hjarvard; Schiøtt, Morten; Boomsma, Jacobus Jan

    The attine ant symbiosis is characterized by ancient but varying degrees of diffuse co-evolution between the ants and their fungal cultivars. Domesticated fungi became dependent on vertical transmission by queens and the ant colonies came to rely on their symbiotic fungus for food and thus...... as garden substrate, whereas the more basal genera use leaf litter, insect feces and insect carcasses. We hypothesized that enzyme activity of fungal symbionts has co-evolved with substrate use and we measured enzyme activities of fungus gardens in the field to test this, focusing particularly on plant...... essential for the symbiosis in general, but have contributed specifically to the evolution of the symbiosis....

  15. Comparative studies of the secretome of fungus-growing ants

    DEFF Research Database (Denmark)

    Linde, Tore; Grell, Morten Nedergaard; Schiøtt, Morten


    Leafcutter ants of the species Acromyrmex echinatior live in symbiosis with the fungus Leucoagaricus gongylophorus. The ants harvest fragments of leaves and carry them to the nest where they place the material on the fungal colony. The fungus secretes a wide array of proteins to degrade the leaves...... into nutrients that the ants can feed on. The focus of this study is to discover, characterize and compare the secreted proteins. In order to do so cDNA libraries are constructed from mRNA extracted from the fungus material. The most efficient technology to screen cDNA libraries selectively for secreted...

  16. Warehouse stocking optimization based on dynamic ant colony genetic algorithm (United States)

    Xiao, Xiaoxu


    In view of the various orders of FAW (First Automotive Works) International Logistics Co., Ltd., the SLP method is used to optimize the layout of the warehousing units in the enterprise, thus the warehouse logistics is optimized and the external processing speed of the order is improved. In addition, the relevant intelligent algorithms for optimizing the stocking route problem are analyzed. The ant colony algorithm and genetic algorithm which have good applicability are emphatically studied. The parameters of ant colony algorithm are optimized by genetic algorithm, which improves the performance of ant colony algorithm. A typical path optimization problem model is taken as an example to prove the effectiveness of parameter optimization.

  17. Ant colony algorithm for clustering in portfolio optimization (United States)

    Subekti, R.; Sari, E. R.; Kusumawati, R.


    This research aims to describe portfolio optimization using clustering methods with ant colony approach. Two stock portfolios of LQ45 Indonesia is proposed based on the cluster results obtained from ant colony optimization (ACO). The first portfolio consists of assets with ant colony displacement opportunities beyond the defined probability limits of the researcher, where the weight of each asset is determined by mean-variance method. The second portfolio consists of two assets with the assumption that each asset is a cluster formed from ACO. The first portfolio has a better performance compared to the second portfolio seen from the Sharpe index.

  18. Automating ActionScript Projects with Eclipse and Ant

    CERN Document Server

    Koning, Sidney


    Automating repetitive programming tasks is easier than many Flash/AS3 developers think. With the Ant build tool, the Eclipse IDE, and this concise guide, you can set up your own "ultimate development machine" to code, compile, debug, and deploy projects faster. You'll also get started with versioning systems, such as Subversion and Git. Create a consistent workflow for multiple machines, or even complete departments, with the help of extensive Ant code samples. If you want to work smarter and take your skills to a new level, this book will get you on the road to automation-with Ant. Set up y

  19. The invasion biology and sociogenetics of pharaoh ants

    DEFF Research Database (Denmark)

    Schmidt, Anna Mosegaard

    Social insect colonies perform a number of tasks affecting the environments they live in. Some unintentionally introduced species have attracted the attention of scientists and general public alike when causing a number of changes to the composition and functioning of ecosystems. Such ?invaders...... laboratory lineages, thus building the foundation for future research on the species. In addition, I have started a selection experiment (still ongoing in collaboration with Dr. T. Linksvayer) using pharaoh ants, which is the first time artificial selection is attempted in an ant species. Pharaoh ants have...

  20. Symbiotic mutualism with a community of opportunistic ants: protection, competition, and ant occupancy of the myrmecophyte Barteria nigritana (Passifloraceae) (United States)

    Djiéto-Lordon, Champlain; Dejean, Alain; Gibernau, Marc; Hossaert-McKey, Martine; McKey, Doyle


    Barteria nigritana is a myrmecophyte tree of Lower Guinea coastal vegetation. Unlike the more specialised B. fistulosa, which harbours a single host-specific mutualistic ant, B. nigritana is associated with several opportunistic ants. Such symbiotic, yet opportunistic, ant-plant associations have been little studied. On 113 clumps of B. nigritana, we censused ant associates and herbivores and compared herbivory on plants occupied by different ants. In addition to these correlative data, protection conferred by different ant species was compared by herbivore-placement experiments. Identity of ant associate changed predictably over plant ontogeny. Pheidole megacephala was restricted to very small plants; saplings were occupied by either Oecophylla longinoda or Crematogaster sp., and the latter species was the sole occupant of larger trees. Damage by caterpillars of the nymphalid butterfly Acraea zetes accounted for much of the herbivory to leaves. Ant species differed in the protection provided to hosts. While P. megacephala provided no significant protection, plants occupied by O. longinoda and Crematogaster sp. suffered less damage than did unoccupied plants or those occupied by P. megacephala. Furthermore, O. longinoda provided more effective protection than did Crematogaster sp. Herbivore-placement experiments confirmed these results. Workers of O. longinoda killed or removed all larval instars of A. zetes. Crematogaster preyed on only the two first larval instars, and P. megacephala preyed mainly on eggs, only rarely attacking the two first larval instars. Opportunistic ants provided significant protection to this relatively unspecialised myrmecophyte. The usual associate of mature trees was not the species that provided most protection.

  1. Selenium exposure results in reduced reproduction in an invasive ant species and altered competitive behavior for a native ant species

    International Nuclear Information System (INIS)

    De La Riva, Deborah G.; Trumble, John T.


    Competitive ability and numerical dominance are important factors contributing to the ability of invasive ant species to establish and expand their ranges in new habitats. However, few studies have investigated the impact of environmental contamination on competitive behavior in ants as a potential factor influencing dynamics between invasive and native ant species. Here we investigated the widespread contaminant selenium to investigate its potential influence on invasion by the exotic Argentine ant, Linepithema humile, through effects on reproduction and competitive behavior. For the fecundity experiment, treatments were provided to Argentine ant colonies via to sugar water solutions containing one of three concentrations of selenium (0, 5 and 10 μg Se mL −1 ) that fall within the range found in soil and plants growing in contaminated areas. Competition experiments included both the Argentine ant and the native Dorymyrmex bicolor to determine the impact of selenium exposure (0 or 15 μg Se mL −1 ) on exploitation- and interference-competition between ant species. The results of the fecundity experiment revealed that selenium negatively impacted queen survival and brood production of Argentine ants. Viability of the developing brood was also affected in that offspring reached adulthood only in colonies that were not given selenium, whereas those in treated colonies died in their larval stages. Selenium exposure did not alter direct competitive behaviors for either species, but selenium exposure contributed to an increased bait discovery time for D. bicolor. Our results suggest that environmental toxins may not only pose problems for native ant species, but may also serve as a potential obstacle for establishment among exotic species. - Highlights: • Argentine ant colonies exposed to selenium had reduced fecundity compared to unexposed colonies. • Viability of offspring was negatively impacted by selenium. • Queen survival was reduced in colonies

  2. The introduction history of invasive garden ants in Europe: integrating genetic, chemical and behavioural approaches

    DEFF Research Database (Denmark)

    Ugelvig, Line; Drijfhout, Falko; Kronauer, Daniel


    BACKGROUND: The invasive garden ant, Lasius neglectus, is the most recently detected pest ant and the first known invasive ant able to become established and thrive in the temperate regions of Eurasia. In this study, we aim to reconstruct the invasion history of this ant in Europe analysing 14 po...

  3. Stealthy invaders: the biology of Cardiocondyla tramp ants

    DEFF Research Database (Denmark)

    Heinze, J.; Cremer, Sylvia; Eckl, N.


    Many invasive ant species, such as the Argentine ant or the red imported fire ant, have huge colonies with thousands of mass-foraging workers, which quickly monopolise resources and therefore represent a considerable threat to the native ant fauna. Cardiocondyla obscurior and several other specie...

  4. FMR measurements in fire ants: evidence of magnetic material

    Energy Technology Data Exchange (ETDEWEB)

    Esquivel, Darci M.S.; Acosta-Avalos, Daniel; El-Jaick, Lea J.; Cunha, Alexandra D.M.; Malheiros, Maria G.; Wajnberg, Eliane [Centro Brasileiro de Pesquisas Fisicas (CBPF), Rio de Janeiro, RJ (Brazil); Linhares, Marilia P. [Centro de Ciencias do Estado, do Rio de Janeiro, Rio de Janeiro, RJ (Brazil)


    Based on the behavioral and the localization of iron-containing tissue fire ants were examined by EPR for magnetic material. Results suggest the presence of magnetite particles. (author) 12 refs., 1 fig.

  5. Disease dynamics in a specialized parasite of ant societies.

    Directory of Open Access Journals (Sweden)

    Sandra B Andersen

    Full Text Available Coevolution between ant colonies and their rare specialized parasites are intriguing, because lethal infections of workers may correspond to tolerable chronic diseases of colonies, but the parasite adaptations that allow stable coexistence with ants are virtually unknown. We explore the trade-offs experienced by Ophiocordyceps parasites manipulating ants into dying in nearby graveyards. We used field data from Brazil and Thailand to parameterize and fit a model for the growth rate of graveyards. We show that parasite pressure is much lower than the abundance of ant cadavers suggests and that hyperparasites often castrate Ophiocordyceps. However, once fruiting bodies become sexually mature they appear robust. Such parasite life-history traits are consistent with iteroparity--a reproductive strategy rarely considered in fungi. We discuss how tropical habitats with high biodiversity of hyperparasites and high spore mortality has likely been crucial for the evolution and maintenance of iteroparity in parasites with low dispersal potential.

  6. Sperm length evolution in the fungus-growing ants

    DEFF Research Database (Denmark)

    Baer, B.; Dijkstra, M. B.; Mueller, U. G.


    -growing ants, representing 9 of the 12 recognized genera, and mapped these onto the ant phylogeny. We show that average sperm length across species is highly variable and decreases with mature colony size in basal genera with singly mated queens, suggesting that sperm production or storage constraints affect...... the evolution of sperm length. Sperm length does not decrease further in multiply mating leaf-cutting ants, despite substantial further increases in colony size. In a combined analysis, sexual dimorphism explained 63.1% of the variance in sperm length between species. As colony size was not a significant...... predictor in this analysis, we conclude that sperm production trade-offs in males have been the major selective force affecting sperm length across the fungus-growing ants, rather than storage constraints in females. The relationship between sperm length and sexual dimorphism remained robust...

  7. Myrmeciza and related antbirds (Aves, Formicariidae as army ant followers

    Directory of Open Access Journals (Sweden)

    Edwin O. Willis


    Full Text Available Antbirds of the genera Myrmeciza (including Sipia and Myrmoborus, Gymnocichla, and Sclateria hop near or on the ground in fairly dense vegetation, "pounding" their tails downward. Where dense understory vegetation is widespread and ants move in it for long distances, certain of these antbirds become regular ant followers: M. immaculata and M. fortis in cluttered moist foothill forest from Costa Rica to upper Amazonia; Gymnocichla nudiceps in moist cluttered second growth of Central America to Colombia. Where the forest understory is more open, Myrmeciza species follow ants mainly in cluttered patches: M. exsul in lowland forest west of the Andes, M. myotherina east of the Andes. Myrmeciza or relatives that specialize on water-edge or very dense zones rarely follow ants.

  8. Ants farm subterranean aphids mostly in single clone groups

    DEFF Research Database (Denmark)

    Ivens, Aniek B.F.; Kronauer, Daniel Jan Christoph; Pen, Ido


    mutualisms have been studied in sufficient genetic detail to address these issues, so we decided to characterize symbiont diversity in the complex mutualism between multiple root aphid species and Lasius flavus ants. After showing elsewhere that three of these aphid species have low dispersal and mostly...... if not exclusively asexual reproduction, we here investigate aphid diversity within and between ant nest mounds. Results The three focal species (Geoica utricularia, Forda marginata and Tetraneura ulmi) had considerable clonal diversity at the population level. Yet more than half of the ant mounds contained just....... The ants appear to eat most of the early instar aphids, so that adult aphids are unlikely to face limited phloem resources and scramble competition with other aphids. We suggest that such culling of carbohydrate-providing symbionts for protein ingestion may maintain maximal host yield per aphid while also...

  9. Ant groups optimally amplify the effect of transiently informed individuals (United States)

    Gelblum, Aviram; Pinkoviezky, Itai; Fonio, Ehud; Ghosh, Abhijit; Gov, Nir; Feinerman, Ofer


    To cooperatively transport a large load, it is important that carriers conform in their efforts and align their forces. A downside of behavioural conformism is that it may decrease the group's responsiveness to external information. Combining experiment and theory, we show how ants optimize collective transport. On the single-ant scale, optimization stems from decision rules that balance individuality and compliance. Macroscopically, these rules poise the system at the transition between random walk and ballistic motion where the collective response to the steering of a single informed ant is maximized. We relate this peak in response to the divergence of susceptibility at a phase transition. Our theoretical models predict that the ant-load system can be transitioned through the critical point of this mesoscopic system by varying its size; we present experiments supporting these predictions. Our findings show that efficient group-level processes can arise from transient amplification of individual-based knowledge.

  10. Florida alternative NTCIP testing software (ANTS) for actuated signal controllers. (United States)


    The scope of this research project did include the development of a software tool to test devices for NTCIP compliance. Development of the Florida Alternative NTCIP Testing Software (ANTS) was developed by the research team due to limitations found w...

  11. Novel fungal disease in complex leaf-cutting ant societies

    DEFF Research Database (Denmark)

    Hughes, David Peter; Evans, Harry C.; Hywel-Jones, Nigel


    1. The leaf-cutting ants practise an advanced system of mycophagy where they grow a fungus as a food source. As a consequence of parasite threats to their crops, they have evolved a system of morphological, behavioural, and chemical defences, particularly against fungal pathogens (mycopathogens). 2....... Specific fungal diseases of the leaf-cutting ants themselves have not been described, possibly because broad spectrum anti-fungal defences against mycopathogens have reduced their susceptibility to entomopathogens. 3. Using morphological and molecular tools, the present study documents three rare infection...... events of Acromyrmex and Atta leaf-cutting ants by Ophiocordyceps fungi, agenus of entomopathogens that is normally highly specific in its host choice. 4. As leaf-cutting ants have been intensively studied, the absence of prior records of Ophiocordyceps suggests that these infections may be a novel event...

  12. Heavy metal pollution disturbs immune response in wild ant populations

    International Nuclear Information System (INIS)

    Sorvari, Jouni; Rantala, Liisa M.; Rantala, Markus J.; Hakkarainen, Harri; Eeva, Tapio


    Concern about the effects of environmental contaminants on immune function in both humans and wildlife is growing and practically nothing is known about this impact on terrestrial invertebrates, even though they are known to easily accumulate pollutants. We studied the effect of industrial heavy metal contamination on immune defense of a free-living wood ant (Formica aquilonia). To find out whether ants show an adapted immune function in a polluted environment, we compared encapsulation responses between local and translocated colonies. Local colonies showed higher heavy metal levels than the translocated ones but the encapsulation response was similar between the two groups, indicating that the immune system of local ants has not adapted to high contamination level. The encapsulation response was elevated in moderate whereas suppressed in high heavy metal levels suggesting higher risk for infections in heavily polluted areas. - Heavy metal pollution affects immune function in ants

  13. Ant colony search algorithm for optimal reactive power optimization

    Directory of Open Access Journals (Sweden)

    Lenin K.


    Full Text Available The paper presents an (ACSA Ant colony search Algorithm for Optimal Reactive Power Optimization and voltage control of power systems. ACSA is a new co-operative agents’ approach, which is inspired by the observation of the behavior of real ant colonies on the topic of ant trial formation and foraging methods. Hence, in the ACSA a set of co-operative agents called "Ants" co-operates to find good solution for Reactive Power Optimization problem. The ACSA is applied for optimal reactive power optimization is evaluated on standard IEEE, 30, 57, 191 (practical test bus system. The proposed approach is tested and compared to genetic algorithm (GA, Adaptive Genetic Algorithm (AGA.

  14. application of ant colony optimisation in distribution transformer sizing

    African Journals Online (AJOL)


    Keywords: ant colony, optimization, transformer sizing, distribution transformer. 1. INTRODUCTION ... more intensive pheromone and higher probability to be chosen [12]. ..... pp.29-41, 1996. [7] EC global market place, “Technical Parameters”,.

  15. Fluid intake rates in ants correlate with their feeding habits. (United States)

    Paul, J; Roces, F


    This study investigates the techniques of nectar feeding in 11 different ant species, and quantitatively compares fluid intake rates over a wide range of nectar concentrations in four species that largely differ in their feeding habits. Ants were observed to employ two different techniques for liquid food intake, in which the glossa works either as a passive duct-like structure (sucking), or as an up- and downwards moving shovel (licking). The technique employed for collecting fluids at ad libitum food sources was observed to be species-specific and to correlate with the presence or absence of a well-developed crop in the species under scrutiny. Workers of ponerine ants licked fluid food during foraging and transported it as a droplet between their mandibles, whereas workers of species belonging to phylogenetically more advanced subfamilies, with a crop capable of storing liquids, sucked the fluid food, such as formicine ants of the genus Camponotus. In order to evaluate the performance of fluid collection during foraging, intake rates for sucrose solutions of different concentrations were measured in four ant species that differ in their foraging ecology. Scaling functions between fluid intake rates and ant size were first established for the polymorphic species, so as to compare ants of different size across species. Results showed that fluid intake rate depended, as expected and previously reported in the literature, on sugar concentration and the associated fluid viscosity. It also depended on both the species-specific feeding technique and the extent of specialization on foraging on liquid food. For similarly-sized ants, workers of two nectar-feeding ant species, Camponotus rufipes (Formicinae) and Pachycondyla villosa (Ponerinae), collected fluids with the highest intake rates, while workers of the leaf-cutting ant Atta sexdens (Myrmicinae) and a predatory ant from the Rhytidoponera impressa-complex (Ponerinae) did so with the lowest rate. Calculating the

  16. Climatic warming destabilizes forest ant communities. (United States)

    Diamond, Sarah E; Nichols, Lauren M; Pelini, Shannon L; Penick, Clint A; Barber, Grace W; Cahan, Sara Helms; Dunn, Robert R; Ellison, Aaron M; Sanders, Nathan J; Gotelli, Nicholas J


    How will ecological communities change in response to climate warming? Direct effects of temperature and indirect cascading effects of species interactions are already altering the structure of local communities, but the dynamics of community change are still poorly understood. We explore the cumulative effects of warming on the dynamics and turnover of forest ant communities that were warmed as part of a 5-year climate manipulation experiment at two sites in eastern North America. At the community level, warming consistently increased occupancy of nests and decreased extinction and nest abandonment. This consistency was largely driven by strong responses of a subset of thermophilic species at each site. As colonies of thermophilic species persisted in nests for longer periods of time under warmer temperatures, turnover was diminished, and species interactions were likely altered. We found that dynamical (Lyapunov) community stability decreased with warming both within and between sites. These results refute null expectations of simple temperature-driven increases in the activity and movement of thermophilic ectotherms. The reduction in stability under warming contrasts with the findings of previous studies that suggest resilience of species interactions to experimental and natural warming. In the face of warmer, no-analog climates, communities of the future may become increasingly fragile and unstable.

  17. Recognition in ants: social origin matters.

    Directory of Open Access Journals (Sweden)

    Joël Meunier

    Full Text Available The ability of group members to discriminate against foreigners is a keystone in the evolution of sociality. In social insects, colony social structure (number of queens is generally thought to influence abilities of resident workers to discriminate between nestmates and non-nestmates. However, whether social origin of introduced individuals has an effect on their acceptance in conspecific colonies remains poorly explored. Using egg-acceptance bioassays, we tested the influence of social origin of queen-laid eggs on their acceptance by foreign workers in the ant Formica selysi. We showed that workers from both single- and multiple-queen colonies discriminated against foreign eggs from single-queen colonies, whereas they surprisingly accepted foreign eggs from multiple-queen colonies. Chemical analyses then demonstrated that social origins of eggs and workers could be discriminated on the basis of their chemical profiles, a signal generally involved in nestmate discrimination. These findings provide the first evidence in social insects that social origins of eggs interfere with nestmate discrimination and are encoded by chemical signatures.

  18. Nasa's Ant-Inspired Swarmie Robots (United States)

    Leucht, Kurt W.


    As humans push further beyond the grasp of earth, robotic missions in advance of human missions will play an increasingly important role. These robotic systems will find and retrieve valuable resources as part of an in-situ resource utilization (ISRU) strategy. They will need to be highly autonomous while maintaining high task performance levels. NASA Kennedy Space Center has teamed up with the Biological Computation Lab at the University of New Mexico to create a swarm of small, low-cost, autonomous robots to be used as a ground-based research platform for ISRU missions. The behavior of the robot swarm mimics the central-place foraging strategy of ants to find and collect resources in a previously unmapped environment and return those resources to a central site. This talk will guide the audience through the Swarmie robot project from its conception by students in a New Mexico research lab to its robot trials in an outdoor parking lot at NASA. The software technologies and techniques used on the project will be discussed, as well as various challenges and solutions that were encountered by the development team along the way.

  19. Carbohydrate supply limits invasion of natural communities by Argentine ants. (United States)

    Rowles, Alexei D; Silverman, Jules


    The ability of species to invade new habitats is often limited by various biotic and physical factors or interactions between the two. Invasive ants, frequently associated with human activities, flourish in disturbed urban and agricultural environments. However, their ability to invade and establish in natural habitats is more variable. This is particularly so for the invasive Argentine ant (Linepithema humile). While biotic resistance and low soil moisture limits their invasion of natural habitats in some instances, the effect of food availability has been poorly explored. We conducted field experiments to determine if resource availability limits the spread and persistence of Argentine ants in remnant natural forest in North Carolina. Replicated transects paired with and without sucrose solution feeding stations were run from invaded urban edges into forest remnants and compared over time using baits and direct counts at feeding stations. Repeated under different timing regimes in 2006 and 2007, access to sucrose increased local Argentine ant abundances (1.6-2.5 fold) and facilitated their progression into the forest up to 73 +/- 21% of 50-m transects. Resource removal caused an expected decrease in Argentine ant densities in 2006, in conjunction with their retreat to the urban/forest boundary. However, in 2007, Argentine ant numbers unexpectedly continued to increase in the absence of sugar stations, possibly through access to alternative resources or conditions not available the previous year such as honeydew-excreting Hemiptera. Our results showed that supplementing carbohydrate supply facilitates invasion of natural habitat by Argentine ants. This is particularly evident where Argentine ants continued to thrive following sugar station removal.

  20. Hybridization in East African swarm-raiding army ants

    DEFF Research Database (Denmark)

    Kronauer, Daniel Jc; Peters, Marcell K; Schöning, Caspar


    Hybridization can have complex effects on evolutionary dynamics in ants because of the combination of haplodiploid sex-determination and eusociality. While hybrid non-reproductive workers have been found in a range of species, examples of gene-flow via hybrid queens and males are rare. We studied...... hybridization in East African army ants (Dorylus subgenus Anomma) using morphology, mitochondrial DNA sequences, and nuclear microsatellites....

  1. An Improved Ant Colony Matching by Using Discrete Curve Evolution


    Saadi, Younes; Sari, Eka,; Herawan, Tutut


    Part 1: Information & Communication Technology-EurAsia Conference 2014, ICT-EurAsia 2014; International audience; In this paper we present an improved Ant Colony Optimization (ACO) for contour matching, which can be used to match 2D shapes. Discrete Curve Evolution (DCE) technique is used to simplify the extracted contour. In order to find the best correspondence between shapes, the match process is formulated as a Quadratic Assignment Problem (QAP) and resolved by using Ant Colony Optimizati...

  2. Behavior of ergatoid males in the ant, Cardiocondyla nuda


    Heinze, Jürgen; Künholz, S.; Schilder, K.; Hölldobler, B.


    Ergatoid males of the ant, Cardiocondyla nuda, attack and frequently kill young males during or shortly after eclosion. Smaller colonies therefore contain typically only one adult male, which may inseminate all alate queens which are reared in the colony over a few weeks. In larger colonies, several males may be present, however, fighting among adult males was not observed. We discuss the significance of male fighting behavior in ants.

  3. Trail Pheromone Disruption of Argentine Ant Trail Formation and Foraging (United States)

    Suckling, D.M.; Peck, R.W.; Stringer, L.D.; Snook, K.; Banko, P.C.


    Trail pheromone disruption of invasive ants is a novel tactic that builds on the development of pheromone-based pest management in other insects. Argentine ant trail pheromone, (Z)-9-hexadecenal, was formulated as a micro-encapsulated sprayable particle and applied against Argentine ant populations in 400 m2 field plots in Hawai'i Volcanoes National Park. A widely dispersed point source strategy for trail pheromone disruption was used. Traffic rates of ants in bioassays of treated filter paper, protected from rainfall and sunlight, indicated the presence of behaviorally significant quantities of pheromone being released from the formulation for up to 59 days. The proportion of plots, under trade wind conditions (2-3 m s-1), with visible trails was reduced for up to 14 days following treatment, and the number of foraging ants at randomly placed tuna-bait cards was similarly reduced. The success of these trail pheromone disruption trials in a natural ecosystem highlights the potential of this method for control of invasive ant species in this and other environments. ?? Springer Science+Business Media, LLC 2010.

  4. No sex in fungus-farming ants or their crops. (United States)

    Himler, Anna G; Caldera, Eric J; Baer, Boris C; Fernández-Marín, Hermógenes; Mueller, Ulrich G


    Asexual reproduction imposes evolutionary handicaps on asexual species, rendering them prone to extinction, because asexual reproduction generates novel genotypes and purges deleterious mutations at lower rates than sexual reproduction. Here, we report the first case of complete asexuality in ants, the fungus-growing ant Mycocepurus smithii, where queens reproduce asexually but workers are sterile, which is doubly enigmatic because the clonal colonies of M. smithii also depend on clonal fungi for food. Degenerate female mating anatomy, extensive field and laboratory surveys, and DNA fingerprinting implicate complete asexuality in this widespread ant species. Maternally inherited bacteria (e.g. Wolbachia, Cardinium) and the fungal cultivars can be ruled out as agents inducing asexuality. M. smithii societies of clonal females provide a unique system to test theories of parent-offspring conflict and reproductive policing in social insects. Asexuality of both ant farmer and fungal crop challenges traditional views proposing that sexual farmer ants outpace coevolving sexual crop pathogens, and thus compensate for vulnerabilities of their asexual crops. Either the double asexuality of both farmer and crop may permit the host to fully exploit advantages of asexuality for unknown reasons or frequent switching between crops (symbiont reassociation) generates novel ant-fungus combinations, which may compensate for any evolutionary handicaps of asexuality in M. smithii.

  5. [Ants as carriers of microorganisms in hospital environments]. (United States)

    Pereira, Rogério Dos Santos; Ueno, Mariko


    Concern exists regarding the real possibility of public health threats caused by pathogenic agents that are carried by urban ants. The present study had the objective of isolating and identifying the microorganisms that are associated with ants in hospital environments. One hundred and twenty-five ants of the same species were collected from different units of a university hospital. Each ant was collected using a swab soaked with physiological solution and was transferred to a tube containing brain heart infusion broth and incubated at 35 degrees C for 24 hours. From each tube, with growth, inoculations were made into specific culturing media, to isolate any microorganisms. The ants presented a high capacity for carrying microorganism groups: spore-producing Gram-positive bacilli 63.5%, Gram-negative bacilli 6.3%, Gram-positive cocci 23.1%, filamentous fungi 6.7% and yeast 0.5%. Thus, it can be inferred that ants may be one of the agents responsible for disseminating microorganisms in hospital environments.

  6. Species-Specific Effects of Ant Inhabitants on Bromeliad Nutrition.

    Directory of Open Access Journals (Sweden)

    Ana Z Gonçalves

    Full Text Available Predator activities may lead to the accumulation of nutrients in specific areas of terrestrial habitats where they dispose of prey carcasses. In their feeding sites, predators may increase nutrient availability in the soil and favor plant nutrition and growth. However, the translocation of nutrients from one habitat to another may depend on predator identity and diet, as well as on the amount of prey intake. Here we used isotopic (15N and physiological methods in greenhouse experiments to evaluate the effects of the identity of predatory ants (i.e., the consumption of prey and nest sites on the nutrition and growth of the bromeliad Quesnelia arvensis. We showed that predatory ants with protein-based nutrition (i.e., Odontomachus hastatus, Gnamptogenys moelleri improved the performance of their host bromeliads (i.e., increased foliar N, production of soluble proteins and growth. On the other hand, the contribution of Camponotus crassus for the nutritional status of bromeliads did not differ from bromeliads without ants, possibly because this ant does not have arthropod prey as a preferred food source. Our results show, for the first time, that predatory ants can translocate nutrients from one habitat to another within forests, accumulating nutrients in their feeding sites that become available to bromeliads. Additionally, we highlight that ant contribution to plant nutrition may depend on predator identity and its dietary requirements. Nest debris may be especially important for epiphytic and terrestrial bromeliads in nutrient-poor environments.

  7. Reaction of mutualistic and granivorous ants to ulex elaiosome chemicals. (United States)

    Gammans, Nicola; Bullock, James M; Gibbons, Hannah; Schönrogge, Karsten


    It has been proposed that chemicals on plant elaiosomes aid seed detection by seed-dispersing ants. We hypothesized that the chemical interaction between ants and elaiosomes is more intimate than a generic attraction, and that elaiosome chemicals will attract mutualistic but not granivorous ant species. We investigated this by using two gorse species, Ulex minor and U. europaeus, and two associated ant species from European heathlands, the mutualist Myrmica ruginodis and the granivore Tetramorium caespitum. Behavioral studies were conducted with laboratory nests and foraging arenas. Both ants will take Ulex seeds, but while M. ruginodis showed increased antennation toward ether extracts of elaiosome surface chemicals compared with controls, T. caespitum showed no response. Elaiosome extracts were separated into seven lipid fractions. M. ruginodis showed increased antennation only toward the diglyceride fractions of both Ulex species, whereas T. caespitum showed no consistent reaction. This indicates that M. ruginodis can detect the elaiosome by responding to its surface chemicals, but T. caespitum is unresponsive to these chemicals. Responses to surface chemicals could increase the rate of seed detection in the field, and so these results suggest that Ulex elaiosomes produce chemicals that facilitate attraction of mutualistic rather than granivorous ant species. This could reduce seed predation and increase Ulex fitness.

  8. Aversive learning of odor-heat associations in ants. (United States)

    Desmedt, Lucie; Baracchi, David; Devaud, Jean-Marc; Giurfa, Martin; d'Ettorre, Patrizia


    Ants have recently emerged as useful models for the study of olfactory learning. In this framework, the development of a protocol for the appetitive conditioning of the maxilla-labium extension response (MaLER) provided the possibility of studying Pavlovian odor-food learning in a controlled environment. Here we extend these studies by introducing the first Pavlovian aversive learning protocol for harnessed ants in the laboratory. We worked with carpenter ants Camponotus aethiops and first determined the capacity of different temperatures applied to the body surface to elicit the typical aversive mandible opening response (MOR). We determined that 75°C is the optimal temperature to induce MOR and chose the hind legs as the stimulated body region because of their high sensitivity. We then studied the ability of ants to learn and remember odor-heat associations using 75°C as the unconditioned stimulus. We studied learning and short-term retention after absolute (one odor paired with heat) and differential conditioning (a punished odor versus an unpunished odor). Our results show that ants successfully learn the odor-heat association under a differential-conditioning regime and thus exhibit a conditioned MOR to the punished odor. Yet, their performance under an absolute-conditioning regime is poor. These results demonstrate that ants are capable of aversive learning and confirm previous findings about the different attentional resources solicited by differential and absolute conditioning in general. © 2017. Published by The Company of Biologists Ltd.

  9. Competence of Litter Ants for Rapid Biodiversity Assessments

    Directory of Open Access Journals (Sweden)

    T. H. Saumya E. Silva


    Full Text Available Rapid Biodiversity Assessment approaches associated with focusing taxa have overcome many of the problems related to large scale surveys. This study examined the suitability of litter ants as a focusing taxon by checking whether diversity and species assemblages of litter ants reflect the overall picture of arthropod diversity and assemblages in leaf litter in two vegetation types: secondary forest and pine plantation in Upper Hanthana forest reserve, Sri Lanka. In each vegetation type, arthropods were sampled using three sampling methods (Winkler extraction, hand collection, and pitfall traps along three 100 m line transects. From the two sites, 1887 litter ants (34 species and 3488 litter arthropods (52 species were collected. Species assemblages composition of both ants and other arthropods differed significantly between the two sites (ANOSIM, p=0.001 with both groups generating distinct clusters for the two sites (SIMPROF, p=0.001. But there was no significant correlation (p>0.05 between abundance and richness of litter ants and those of other arthropods in both vegetation types. The overall finding suggests that the litter ants do not reflect the holistic picture of arthropod diversity and assemblages in leaf litter, but the quality of the habitat for the survival of all litter arthropods.

  10. Water stress strengthens mutualism among ants, trees, and scale insects.

    Directory of Open Access Journals (Sweden)

    Elizabeth G Pringle


    Full Text Available Abiotic environmental variables strongly affect the outcomes of species interactions. For example, mutualistic interactions between species are often stronger when resources are limited. The effect might be indirect: water stress on plants can lead to carbon stress, which could alter carbon-mediated plant mutualisms. In mutualistic ant-plant symbioses, plants host ant colonies that defend them against herbivores. Here we show that the partners' investments in a widespread ant-plant symbiosis increase with water stress across 26 sites along a Mesoamerican precipitation gradient. At lower precipitation levels, Cordia alliodora trees invest more carbon in Azteca ants via phloem-feeding scale insects that provide the ants with sugars, and the ants provide better defense of the carbon-producing leaves. Under water stress, the trees have smaller carbon pools. A model of the carbon trade-offs for the mutualistic partners shows that the observed strategies can arise from the carbon costs of rare but extreme events of herbivory in the rainy season. Thus, water limitation, together with the risk of herbivory, increases the strength of a carbon-based mutualism.

  11. An invasive slug exploits an ant-seed dispersal mutualism. (United States)

    Meadley Dunphy, Shannon A; Prior, Kirsten M; Frederickson, Megan E


    Plant-animal mutualisms, such as seed dispersal, are often vulnerable to disruption by invasive species. Here, we show for the first time how a non-ant invasive species negatively affects seed dispersal by ants. We examined the effects of several animal species that co-occur in a temperate deciduous forest-including native and invasive seed-dispersing ants (Aphaenogaster rudis and Myrmica rubra, respectively), an invasive slug (Arion subfuscus), and native rodents-on a native myrmecochorous plant, Asarum canadense. We experimentally manipulated ant, slug, and rodent access to seed depots and measured seed removal. We also video-recorded depots to determine which other taxa interact with seeds. We found that A. rudis was the main disperser of seeds and that A. subfuscus consumed elaiosomes without dispersing seeds. Rodent visitation was rare, and rodent exclusion had no significant effect on seed or elaiosome removal. We then used data obtained from laboratory and field mesocosm experiments to determine how elaiosome robbing by A. subfuscus affects seed dispersal by A. rudis and M. rubra. We found that elaiosome robbing by slugs reduced seed dispersal by ants, especially in mesocosms with A. rudis, which picks up seeds more slowly than M. rubra. Taken together, our results show that elaiosome robbing by an invasive slug reduces seed dispersal by ants, suggesting that invasive slugs can have profound negative effects on seed dispersal mutualisms.

  12. Water stress strengthens mutualism among ants, trees, and scale insects. (United States)

    Pringle, Elizabeth G; Akçay, Erol; Raab, Ted K; Dirzo, Rodolfo; Gordon, Deborah M


    Abiotic environmental variables strongly affect the outcomes of species interactions. For example, mutualistic interactions between species are often stronger when resources are limited. The effect might be indirect: water stress on plants can lead to carbon stress, which could alter carbon-mediated plant mutualisms. In mutualistic ant-plant symbioses, plants host ant colonies that defend them against herbivores. Here we show that the partners' investments in a widespread ant-plant symbiosis increase with water stress across 26 sites along a Mesoamerican precipitation gradient. At lower precipitation levels, Cordia alliodora trees invest more carbon in Azteca ants via phloem-feeding scale insects that provide the ants with sugars, and the ants provide better defense of the carbon-producing leaves. Under water stress, the trees have smaller carbon pools. A model of the carbon trade-offs for the mutualistic partners shows that the observed strategies can arise from the carbon costs of rare but extreme events of herbivory in the rainy season. Thus, water limitation, together with the risk of herbivory, increases the strength of a carbon-based mutualism.

  13. CO2 efflux from subterranean nests of ant communities in a seasonal tropical forest, Thailand


    Hasin, Sasitorn; Ohashi, Mizue; Yamada, Akinori; Hashimoto, Yoshiaki; Tasen, Wattanachai; Kume, Tomonori; Yamane, Seiki


    Many ant species construct subterranean nests. The presence of their nests may explain soil respiration “hot spots”, an important factor in the high CO2 efflux from tropical forests. However, no studies have directly measured CO2 efflux from ant nests. We established 61 experimental plots containing 13 subterranean ant species to evaluate the CO2 efflux from subterranean ant nests in a tropical seasonal forest, Thailand. We examined differences in nest CO2 efflux among ant species. We determi...

  14. Using ant-behavior-based simulation model AntWeb to improve website organization (United States)

    Li, Weigang; Pinheiro Dib, Marcos V.; Teles, Wesley M.; Morais de Andrade, Vlaudemir; Alves de Melo, Alba C. M.; Cariolano, Judas T.


    Some web usage mining algorithms showed the potential application to find the difference among the organizations expected by visitors to the website. However, there are still no efficient method and criterion for a web administrator to measure the performance of the modification. In this paper, we developed an AntWeb, a model inspired by ants' behavior to simulate the sequence of visiting the website, in order to measure the efficient of the web structure. We implemented a web usage mining algorithm using backtrack to the intranet website of the Politec Informatic Ltd., Brazil. We defined throughput (the number of visitors to reach their target pages per time unit relates to the total number of visitors) as an index to measure the website's performance. We also used the link in a web page to represent the effect of visitors' pheromone trails. For every modification in the website organization, for example, putting a link from the expected location to the target object, the simulation reported the value of throughput as a quick answer about this modification. The experiment showed the stability of our simulation model, and a positive modification to the intranet website of the Politec.

  15. Population Development of Several Species of Ants on the Cocoa Trees in South Sulawesi

    Directory of Open Access Journals (Sweden)

    Fatahuddin Fatahuddin


    Full Text Available Several species of ants with different behavior have been found in cocoa plantations and their behavior is important to be considered because it might be correlated with the degree of protection of cocoa plant from cocoa pests. The aim of this research is to manipulate and to develop ants population in environment, so they are able to establish permanently in cocoa trees. This research was conducted in Papakaju Regions Luwu Regency in Juli to November 2009. In this study, 10 cocoa trees with ants were sampled (each species of ant in 10 cocoa trees. A control of 10 tree samples without ant was also taken. In order to assess the abundance of ant population, it was grouped based on scoring, which score 1 for less than 20 ants, score 2 for 21–50 ants, score 3 for 51–200 ants, score 4 for 201–1000 ants, and score 5 for more than 1000 per tree. The results indicated that average of population score of the three ants species reached the highest population for the Oecophylla. smaragdina with average score 4.85 (>1000 ants, Dolichoderus thoracicus, with average score 3.90 (> 200 ants and Crematogaster. difformis with average score 3.10 (>200 ants. This research indicated that three species of ants, Oecophylla smaragdina (weaver ant, Dolichoderus thoracicus (cocoa black ant and Crematogaster difformis (cracking ant. in farmer cocoa plantations in South Sulawesi giving better performance against major pests of cocoa in particular cocoa pod borer (CPB. Key words: Ant Population, Oecophylla smaragdina, Dolichoderus thoracicus, Crematogaster difformis, artificial nest, cocoa.

  16. Graveyards on the Move: The Spatio-Temporal Distribution of Dead Ophiocordyceps-Infected Ants

    DEFF Research Database (Denmark)

    Pontoppidan, Maj-Britt; Himaman, Winanda; Hywel-Jones, Nigel L.


    rainforest. We established that high density aggregations exist (up to 26 dead ants/m2), which we coined graveyards. We further established that graveyards are patchily distributed in a landscape with no or very few O. unilateralis-killed ants. At some, but not all, spatial scales of analysis the density...... unilateralis, which is pan-tropical in distribution, causes infected worker ants to leave their nest and die under leaves in the understory of tropical rainforests. Working in a forest dynamic plot in Southern Thailand we mapped the occurrence of these dead ants by examining every leaf in 1,360 m2 of primary...... of dead ants correlated with temperature, humidity and vegetation cover. Remarkably, having found 2243 dead ants inside graveyards we only found 2 live ants of the principal host, ant Camponotus leonardi, suggesting that foraging host ants actively avoid graveyards. We discovered that the principal host...

  17. Various chemical strategies to deceive ants in three Arhopala species (lepidoptera: Lycaenidae exploiting Macaranga myrmecophytes.

    Directory of Open Access Journals (Sweden)

    Yoko Inui

    Full Text Available Macaranga myrmecophytes (ant-plants are generally well protected from herbivore attacks by their symbiotic ants (plant-ants. However, larvae of Arhopala (Lepidoptera: Lycaenidae species survive and develop on specific Macaranga ant-plant species without being attacked by the plant-ants of their host species. We hypothesized that Arhopala larvae chemically mimic or camouflage themselves with the ants on their host plant so that the larvae are accepted by the plant-ant species of their host. Chemical analyses of cuticular hydrocarbons showed that chemical congruency varied among Arhopala species; A. dajagaka matched well the host plant-ants, A. amphimuta did not match, and unexpectedly, A. zylda lacked hydrocarbons. Behaviorally, the larvae and dummies coated with cuticular chemicals of A. dajagaka were well attended by the plant-ants, especially by those of the host. A. amphimuta was often attacked by all plant-ants except for the host plant-ants toward the larvae, and those of A. zylda were ignored by all plant-ants. Our results suggested that conspicuous variations exist in the chemical strategies used by the myrmecophilous butterflies that allow them to avoid ant attack and be accepted by the plant-ant colonies.

  18. Neuromodulation of Nestmate Recognition Decisions by Pavement Ants.

    Directory of Open Access Journals (Sweden)

    Andrew N Bubak

    Full Text Available Ant colonies are distributed systems that are regulated in a non-hierarchical manner. Without a central authority, individuals inform their decisions by comparing information in local cues to a set of inherent behavioral rules. Individual behavioral decisions collectively change colony behavior and lead to self-organization capable of solving complex problems such as the decision to engage in aggressive societal conflicts with neighbors. Despite the relevance to colony fitness, the mechanisms that drive individual decisions leading to cooperative behavior are not well understood. Here we show how sensory information, both tactile and chemical, and social context-isolation, nestmate interaction, or fighting non-nestmates-affects brain monoamine levels in pavement ants (Tetramorium caespitum. Our results provide evidence that changes in octopamine and serotonin in the brains of individuals are sufficient to alter the decision by pavement ants to be aggressive towards non-nestmate ants whereas increased brain levels of dopamine correlate to physical fighting. We propose a model in which the changes in brain states of many workers collectively lead to the self-organization of societal aggression between neighboring colonies of pavement ants.

  19. Neuromodulation of Nestmate Recognition Decisions by Pavement Ants. (United States)

    Bubak, Andrew N; Yaeger, Jazmine D W; Renner, Kenneth J; Swallow, John G; Greene, Michael J


    Ant colonies are distributed systems that are regulated in a non-hierarchical manner. Without a central authority, individuals inform their decisions by comparing information in local cues to a set of inherent behavioral rules. Individual behavioral decisions collectively change colony behavior and lead to self-organization capable of solving complex problems such as the decision to engage in aggressive societal conflicts with neighbors. Despite the relevance to colony fitness, the mechanisms that drive individual decisions leading to cooperative behavior are not well understood. Here we show how sensory information, both tactile and chemical, and social context-isolation, nestmate interaction, or fighting non-nestmates-affects brain monoamine levels in pavement ants (Tetramorium caespitum). Our results provide evidence that changes in octopamine and serotonin in the brains of individuals are sufficient to alter the decision by pavement ants to be aggressive towards non-nestmate ants whereas increased brain levels of dopamine correlate to physical fighting. We propose a model in which the changes in brain states of many workers collectively lead to the self-organization of societal aggression between neighboring colonies of pavement ants.

  20. Ants avoid superinfections by performing risk-adjusted sanitary care. (United States)

    Konrad, Matthias; Pull, Christopher D; Metzler, Sina; Seif, Katharina; Naderlinger, Elisabeth; Grasse, Anna V; Cremer, Sylvia


    Being cared for when sick is a benefit of sociality that can reduce disease and improve survival of group members. However, individuals providing care risk contracting infectious diseases themselves. If they contract a low pathogen dose, they may develop low-level infections that do not cause disease but still affect host immunity by either decreasing or increasing the host's vulnerability to subsequent infections. Caring for contagious individuals can thus significantly alter the future disease susceptibility of caregivers. Using ants and their fungal pathogens as a model system, we tested if the altered disease susceptibility of experienced caregivers, in turn, affects their expression of sanitary care behavior. We found that low-level infections contracted during sanitary care had protective or neutral effects on secondary exposure to the same (homologous) pathogen but consistently caused high mortality on superinfection with a different (heterologous) pathogen. In response to this risk, the ants selectively adjusted the expression of their sanitary care. Specifically, the ants performed less grooming and more antimicrobial disinfection when caring for nestmates contaminated with heterologous pathogens compared with homologous ones. By modulating the components of sanitary care in this way the ants acquired less infectious particles of the heterologous pathogens, resulting in reduced superinfection. The performance of risk-adjusted sanitary care reveals the remarkable capacity of ants to react to changes in their disease susceptibility, according to their own infection history and to flexibly adjust collective care to individual risk.


    Directory of Open Access Journals (Sweden)

    S. Kalaivani


    Full Text Available In this paper, a procedure for quantifying valve stiction in control loops based on ant colony optimization has been proposed. Pneumatic control valves are widely used in the process industry. The control valve contains non-linearities such as stiction, backlash, and deadband that in turn cause oscillations in the process output. Stiction is one of the long-standing problems and it is the most severe problem in the control valves. Thus the measurement data from an oscillating control loop can be used as a possible diagnostic signal to provide an estimate of the stiction magnitude. Quantification of control valve stiction is still a challenging issue. Prior to doing stiction detection and quantification, it is necessary to choose a suitable model structure to describe control-valve stiction. To understand the stiction phenomenon, the Stenman model is used. Ant Colony Optimization (ACO, an intelligent swarm algorithm, proves effective in various fields. The ACO algorithm is inspired from the natural trail following behaviour of ants. The parameters of the Stenman model are estimated using ant colony optimization, from the input-output data by minimizing the error between the actual stiction model output and the simulated stiction model output. Using ant colony optimization, Stenman model with known nonlinear structure and unknown parameters can be estimated.

  2. New fossil ants in French Cretaceous amber (Hymenoptera: Formicidae) (United States)

    Perrichot, Vincent; Nel, André; Néraudeau, Didier; Lacau, Sébastien; Guyot, Thierry


    Recent studies on the ant phylogeny are mainly based on the molecular analyses of extant subfamilies and do not include the extinct, only Cretaceous subfamily Sphecomyrminae. However, the latter is of major importance for ant relationships, as it is considered the most basal subfamily. Therefore, each new discovery of a Mesozoic ant is of high interest for improving our understanding of their early history and basal relationships. In this paper, a new sphecomyrmine ant, allied to the Burmese amber genus Haidomyrmex, is described from mid-Cretaceous amber of France as Haidomyrmodes mammuthus gen. and sp. n. The diagnosis of the tribe Haidomyrmecini is emended based on the new type material, which includes a gyne (alate female) and two incomplete workers. The genus Sphecomyrmodes, hitherto known by a single species from Burmese amber, is also reported and a new species described as S. occidentalis sp. n. after two workers remarkably preserved in a single piece of Early Cenomanian French amber. The new fossils provide additional information on early ant diversity and relationships and demonstrate that the monophyly of the Sphecomyrminae, as currently defined, is still weakly supported.

  3. The cavity-nest ant Temnothorax crassispinus prefers larger nests. (United States)

    Mitrus, S

    Colonies of the ant Temnothorax crassispinus inhabit mostly cavities in wood and hollow acorns. Typically in the field, nest sites that can be used by the ant are a limited resource. In a field experiment, it was investigated whether the ants prefer a specific size of nest, when different ones are available. In July 2011, a total of 160 artificial nests were placed in a beech-pine forest. Four artificial nests (pieces of wood with volume cavities, ca 415, 605, 730, and 980 mm 3 , respectively) were located on each square meter of the experimental plot. One year later, shortly before the emergence of new sexuals, the nests were collected. In July 2012, colonies inhabited more frequently bigger nests. Among queenright colonies, the ones which inhabited bigger nests had more workers. However, there was no relationship between volume of nest and number of workers for queenless colonies. Queenright colonies from bigger nests produced more sexual individuals, but there was no correlation between number of workers and sex allocation ratio, or between volume of nest and sex allocation ratio. In a laboratory experiment where ant colonies were kept in 470 and 860 mm 3 nests, larger colonies allocated more energy to produce sexual individuals. The results of this study show the selectivity of T. crassispinus ants regarding the size of nest cavity, and that the nest volume has an impact on life history parameters.

  4. Polarized light use in the nocturnal bull ant, Myrmecia midas. (United States)

    Freas, Cody A; Narendra, Ajay; Lemesle, Corentin; Cheng, Ken


    Solitary foraging ants have a navigational toolkit, which includes the use of both terrestrial and celestial visual cues, allowing individuals to successfully pilot between food sources and their nest. One such celestial cue is the polarization pattern in the overhead sky. Here, we explore the use of polarized light during outbound and inbound journeys and with different home vectors in the nocturnal bull ant, Myrmecia midas . We tested foragers on both portions of the foraging trip by rotating the overhead polarization pattern by ±45°. Both outbound and inbound foragers responded to the polarized light change, but the extent to which they responded to the rotation varied. Outbound ants, both close to and further from the nest, compensated for the change in the overhead e-vector by about half of the manipulation, suggesting that outbound ants choose a compromise heading between the celestial and terrestrial compass cues. However, ants returning home compensated for the change in the e-vector by about half of the manipulation when the remaining home vector was short (1-2 m) and by more than half of the manipulation when the remaining vector was long (more than 4 m). We report these findings and discuss why weighting on polarization cues change in different contexts.

  5. Stigmergic construction and topochemical information shape ant nest architecture. (United States)

    Khuong, Anaïs; Gautrais, Jacques; Perna, Andrea; Sbaï, Chaker; Combe, Maud; Kuntz, Pascale; Jost, Christian; Theraulaz, Guy


    The nests of social insects are not only impressive because of their sheer complexity but also because they are built from individuals whose work is not centrally coordinated. A key question is how groups of insects coordinate their building actions. Here, we use a combination of experimental and modeling approaches to investigate nest construction in the ant Lasius niger. We quantify the construction dynamics and the 3D structures built by ants. Then, we characterize individual behaviors and the interactions of ants with the structures they build. We show that two main interactions are involved in the coordination of building actions: (i) a stigmergic-based interaction that controls the amplification of depositions at some locations and is attributable to a pheromone added by ants to the building material; and (ii) a template-based interaction in which ants use their body size as a cue to control the height at which they start to build a roof from existing pillars. We then develop a 3D stochastic model based on these individual behaviors to analyze the effect of pheromone presence and strength on construction dynamics. We show that the model can quantitatively reproduce key features of construction dynamics, including a large-scale pattern of regularly spaced pillars, the formation and merging of caps over the pillars, and the remodeling of built structures. Finally, our model suggests that the lifetime of the pheromone is a highly influential parameter that controls the growth and form of nest architecture.


    Directory of Open Access Journals (Sweden)

    Maulani Kapiudin


    Full Text Available In this research the system for potentially customer classification is designed by extracting rule based classification from raw data with certain criteria. The searching process uses customer database from a bank with data mining technic by using ant colony optimization. A test based on min_case_per_rule variety and phenomene updating were done on a certain period of time. The result are group of customer class which base on rules built by ant and by modifying the pheromone updating, the area of the case is getting bigger. Prototype of the software is coded with C++ 6 version. The customer database master is created by using Microsoft Access. This paper gives information about potential customer of bank that can be classified by prototype of the software. Abstract in Bahasa Indonesia : Pada penelitian untuk sistem klasifikasi potensial customer ini didesain dengan melakukan ekstrak rule berdasarkan klasifikasi dari data mentah dengan kriteria tertentu. Proses pencarian menggunakan database pelanggan dari suatu bank dengan teknik data mining dengan ant colony optimization. Dilakukan percobaan dengan min_case_per_rule variety dan phenomene updating pada periode waktu tertentu. Hasilnya adalah sekelompok class pelanggan yang didasarkan dari rules yang dibangun dengan ant dan dengan dimodifikasi dengan pheromone updating, area permasalahan menjadi lebih melebar. Prototype dari software ini menggunakan C++ versi 6. Database pelanggan dibangun dengan Microsoft Access. Paper ini memberikan informasi mengenai potensi pelanggan dari bank, sehingga dapat diklasifikasikan dengan prototype dari software. Kata kunci: ant colony optimization, classification, min_case_per_rule, term, pheromone updating

  7. Channeler Ant Model: 3 D segmentation of medical images through ant colonies

    International Nuclear Information System (INIS)

    Fiorina, E.; Valzano, S.; Arteche Diaz, R.; Bosco, P.; Gargano, G.; Megna, R.; Oppedisano, C.; Massafra, A.


    In this paper the Channeler Ant Model (CAM) and some results of its application to the analysis of medical images are described. The CAM is an algorithm able to segment 3 D structures with different shapes, intensity and background. It makes use of virtual and colonies and exploits their natural capabilities to modify the environment and communicate with each other by pheromone deposition. Its performance has been validated with the segmentation of 3 D artificial objects and it has been already used successfully in lung nodules detection on Computer Tomography images. This work tries to evaluate the CAM as a candidate to solve the quantitative segmentation problem in Magnetic Resonance brain images: to evaluate the percentage of white matter, gray matter and cerebrospinal fluid in each voxel.

  8. Regulation and specificity of antifungal metapleural gland secretion in leaf-cutting ants

    DEFF Research Database (Denmark)

    Yek, Sze Huei; Nash, David Richard; Jensen, Annette Bruun


    significantly larger for ants challenged with virulent and mild pathogens/weeds than for controls and Escovopsis-challenged ants. We conclude that the MG defence system of leaf-cutting ants has characteristics reminiscent of an additional cuticular immune system, with specific and non-specific components......Ants have paired metapleural glands (MGs) to produce secretions for prophylactic hygiene. These exocrine glands are particularly well developed in leaf-cutting ants, but whether the ants can actively regulate MG secretion is unknown. In a set of controlled experiments using conidia of five fungi...

  9. Application of chaotic ant swarm optimization in electric load forecasting

    International Nuclear Information System (INIS)

    Hong, W.-C.


    Support vector regression (SVR) had revealed strong potential in accurate electric load forecasting, particularly by employing effective evolutionary algorithms to determine suitable values of its three parameters. Based on previous research results, however, these employed evolutionary algorithms themselves have several drawbacks, such as converging prematurely, reaching slowly the global optimal solution, and trapping into a local optimum. This investigation presents an SVR-based electric load forecasting model that applied a novel algorithm, namely chaotic ant swarm optimization (CAS), to improve the forecasting performance by searching its suitable parameters combination. The proposed CAS combines with the chaotic behavior of single ant and self-organization behavior of ant colony in the foraging process to overcome premature local optimum. The empirical results indicate that the SVR model with CAS (SVRCAS) results in better forecasting performance than the other alternative methods, namely SVRCPSO (SVR with chaotic PSO), SVRCGA (SVR with chaotic GA), regression model, and ANN model.

  10. Social isolation and brain development in the ant Camponotus floridanus. (United States)

    Seid, Marc A; Junge, Erich


    Social interactions play a key role in the healthy development of social animals and are most pronounced in species with complex social networks. When developing offspring do not receive proper social interaction, they show developmental impairments. This effect is well documented in mammalian species but controversial in social insects. It has been hypothesized that the enlargement of the mushroom bodies, responsible for learning and memory, observed in social insects is needed for maintaining the large social networks and/or task allocation. This study examines the impact of social isolation on the development of mushroom bodies of the ant Camponotus floridanus. Ants raised in isolation were shown to exhibit impairment in the growth of the mushroom bodies as well as behavioral differences when compared to ants raised in social groups. These results indicate that social interaction is necessary for the proper development of C. floridanus mushroom bodies.

  11. Antígonas. Una visión intertextual

    Directory of Open Access Journals (Sweden)

    Elena Cano Turrión


    Full Text Available In this article and from an intertextual point of view, we will try to examine how theSophoclean hypotext has generated three very different hypertexts. The first one is the short story“Antígona o la elección” by M. Yourcenar, which goes further the religious motivation in the originaltext; then, there is an essay written as a dialogue by Maria Zambrano, entitled La tumba de Antígonawhich main topics are confrontation against power, lack of freedom and destiny and faith in humanconscience. Finally, Luis Riaza’s Antígona…¡Cerda! Appears closer to its hypotext but at the same timesemantic deviation becomes more relevant.

  12. Effective ANT based Routing Algorithm for Data Replication in MANETs

    Directory of Open Access Journals (Sweden)

    N.J. Nithya Nandhini


    Full Text Available In mobile ad hoc network, the nodes often move and keep on change its topology. Data packets can be forwarded from one node to another on demand. To increase the data accessibility data are replicated at nodes and made as sharable to other nodes. Assuming that all mobile host cooperative to share their memory and allow forwarding the data packets. But in reality, all nodes do not share the resources for the benefits of others. These nodes may act selfishly to share memory and to forward the data packets. This paper focuses on selfishness of mobile nodes in replica allocation and routing protocol based on Ant colony algorithm to improve the efficiency. The Ant colony algorithm is used to reduce the overhead in the mobile network, so that it is more efficient to access the data than with other routing protocols. This result shows the efficiency of ant based routing algorithm in the replication allocation.

  13. Mating, hybridisation and introgression in Lasius ants (Hymenoptera: Formicidae)

    DEFF Research Database (Denmark)

    Van der Have, Tom; Pedersen, Jes Søe; Boomsma, Jacobus Jan


    Recent reviews have shown that hybridisation among ant species is likely to be more common than previously appreci-ated, but that documented cases of introgression remain rare. After molecular phylogenetic work had shown that Euro-pean Lasius niger (LINNAEUS, 1758) and L. psammophilus SEIFERT, 1992...... (formerly L. alienus (FOERSTER, 1850)) are unlikely to be very closely related, we decided to analyse an old data set confirming the conclusion by PEARSON (1983) that these two ants can indeed form viable hybrids. We show that signatures of introgression can be detected in a Danish site...... sympatrically. This would imply that multiple accessible field sites are available to study the molecular details of hybridisation and in-trogression between two ant species that have variable degrees of sympatry throughout their distributional ranges...

  14. Evolutionary patterns of proteinase activity in attine ant fungus gardens

    DEFF Research Database (Denmark)

    Semenova, Tatyana; Hughes, David Peter; Boomsma, Jacobus Jan


    hypothesized that fungal proteinase activity may have been under selection for efficiency and that different classes of proteinases might be involved. Results: We determined proteinase activity profiles across a wide pH range for fungus gardens of 14 Panamanian species of fungus-growing ants, representing...... classes. Remarkably, the single symbiont that is shared by species of the crown group of Atta and Acromyrmex leaf-cutting ants mostly showed metalloproteinase activity, suggesting that recurrent changes in enzyme production may have occurred throughout the domestication history of fungus-garden symbionts......Background: Attine ants live in symbiosis with a basidiomycetous fungus that they rear on a substrate of plant material. This indirect herbivory implies that the symbiosis is likely to be nitrogen deprived, so that specific mechanisms may have evolved to enhance protein availability. We therefore...

  15. Comparative Immature Morphology of Brazilian Fire Ants (Hymenoptera: Formicidae: Solenopsis

    Directory of Open Access Journals (Sweden)

    Eduardo Gonçalves Paterson Fox


    Full Text Available Although common in Brazil, the biology of the fire ant Solenopsis saevissima (Smith is still poorly studied. Larval descriptions are useful to genus-level ant systematics and sometimes to species-level taxonomy. This study presents a detailed description of juveniles of S. saevissima from Brazil, which were compared with Brazilian specimens of Solenopsis invicta Buren, Solenopsis geminata (Fabricius, and Solenopsis altipunctata Pitts. Different larval instars were separated by diagnostic morphological traits which were confirmed by observing moults. Reproductive larvae could be easily sorted by their distinctive body dimensions and shape. Contrary to previous reports on this species, the larvae of S. saevissima proved to be generally identical to those of S. invicta, while a few specimens resembled those of other close species, such as Solenopsis megergates Trager. Mature larvae thus presented considerable intraspecific variation in some characters recently proposed to aid fire ant species separation (morphology of head hairs.

  16. Social context predicts recognition systems in ant queens

    DEFF Research Database (Denmark)

    Dreier, Stéphanie Agnès Jeanine; d'Ettorre, Patrizia


    Recognition of group-members is a key feature of sociality. Ants use chemical communication to discriminate nestmates from intruders, enhancing kin cooperation and preventing parasitism. The recognition code is embedded in their cuticular chemical profile, which typically varies between colonies....... We predicted that ants might be capable of accurate recognition in unusual situations when few individuals interact repeatedly, as new colonies started by two to three queens. Individual recognition would be favoured by selection when queens establish dominance hierarchies, because repeated fights...... for dominance are costly; but it would not evolve in absence of hierarchies. We previously showed that Pachycondyla co-founding queens, which form dominance hierarchies, have accurate individual recognition based on chemical cues. Here, we used the ant Lasius niger to test the null hypothesis that individual...

  17. Natural selection drives the evolution of ant life cycles. (United States)

    Wilson, Edward O; Nowak, Martin A


    The genetic origin of advanced social organization has long been one of the outstanding problems of evolutionary biology. Here we present an analysis of the major steps in ant evolution, based for the first time, to our knowledge, on combined recent advances in paleontology, phylogeny, and the study of contemporary life histories. We provide evidence of the causal forces of natural selection shaping several key phenomena: (i) the relative lateness and rarity in geological time of the emergence of eusociality in ants and other animal phylads; (ii) the prevalence of monogamy at the time of evolutionary origin; and (iii) the female-biased sex allocation observed in many ant species. We argue that a clear understanding of the evolution of social insects can emerge if, in addition to relatedness-based arguments, we take into account key factors of natural history and study how natural selection acts on alleles that modify social behavior.

  18. Native supercolonies of unrelated individuals in the invasive Argentine ant

    DEFF Research Database (Denmark)

    Pedersen, Jes Søe; Krieger, Michael J. B.; Vogel, Valérie


    organization is not only a key attribute responsible for the ecological dominance of these ants, but also an evolutionary paradox because relatedness between nestmates is effectively zero. Recently, it has been proposed that, in the Argentine ant, unicoloniality is a derived trait that evolved after its......Kinship among group members has long been recognized as a main factor promoting the evolution of sociality and reproductive altruism, yet some ants have an extraordinary social organization, called unicoloniality, whereby individuals mix freely among physically separated nests. This type of social...... with related individuals who are aggressive toward members of other colonies, we found that native populations also form supercolonies, and are effectively unicolonial. Moreover, just as in introduced populations, the relatedness between nestmates is not distinguishable from zero in these native range...

  19. Ants at Ton Nga Chang Wildlife Sanctuary, Songkhla

    Directory of Open Access Journals (Sweden)

    Watanasit, S.


    Full Text Available The aim of this study was to investigate diversity of ant at Ton Nga Chang Wildlife Sanctuary, Hat Yai, Songkhla. Three line transects (100 m each were randomly set up in 2 types of forest area, disturbed and undisturbed. Hand collecting (HC and leaf litter sampling (LL were applied for ant collection within a time limit of 30 minutes for each method. This study was carried out every month during Febuary 2002- Febuary 2003. The results showed that 206 species were placed under 8 subfamilies: Aenictinae, Cerapachyinae, Dolichoderinae, Formicinae, Leptanillinae, Myrmicinae, Ponerinae and Pseudomyrmecinae. Study sites and collection methods could divide ant species into 2 groups, whereas seasonal change could not distinguish the groups by DCA of multivariate analysis.

  20. Social isolation and brain development in the ant Camponotus floridanus (United States)

    Seid, Marc A.; Junge, Erich


    Social interactions play a key role in the healthy development of social animals and are most pronounced in species with complex social networks. When developing offspring do not receive proper social interaction, they show developmental impairments. This effect is well documented in mammalian species but controversial in social insects. It has been hypothesized that the enlargement of the mushroom bodies, responsible for learning and memory, observed in social insects is needed for maintaining the large social networks and/or task allocation. This study examines the impact of social isolation on the development of mushroom bodies of the ant Camponotus floridanus. Ants raised in isolation were shown to exhibit impairment in the growth of the mushroom bodies as well as behavioral differences when compared to ants raised in social groups. These results indicate that social interaction is necessary for the proper development of C. floridanus mushroom bodies.

  1. Ant colonies prefer infected over uninfected nest sites

    DEFF Research Database (Denmark)

    Pontieri, Luigi; Vojvodic, Svjetlana; Graham, Riley


    with sporulating mycelium of the entomopathogenic fungus Metarhizium brunneum (infected nests), nests containing nestmates killed by freezing (uninfected nests), and empty nests. In contrast to the expectation pharaoh ant colonies preferentially (84%) moved into the infected nest when presented with the choice...... the high risk of epidemics in group-living animals. Choosing nest sites free of pathogens is hypothesized to be highly efficient in invasive ants as each of their introduced populations is often an open network of nests exchanging individuals (unicolonial) with frequent relocation into new nest sites...... and low genetic diversity, likely making these species particularly vulnerable to parasites and diseases. We investigated the nest site preference of the invasive pharaoh ant, Monomorium pharaonis, through binary choice tests between three nest types: nests containing dead nestmates overgrown...


    DEFF Research Database (Denmark)

    De Fine Licht, Henrik H; Schiøtt, Morten; Mueller, Ulrich G


    an association with a monophyletic clade of specialized symbionts. In conjunction with the transition to specialized symbionts, the ants advanced in colony size and social complexity. Here we provide a comparative study of the functional specialization in extracellular enzyme activities in fungus gardens across...... the attine phylogeny. We show that, relative to sister clades, gardens of higher-attine ants have enhanced activity of protein-digesting enzymes, whereas gardens of leaf-cutting ants also have increased activity of starch-digesting enzymes. However, the enzyme activities of lower-attine fungus gardens...... are targeted primarily towards partial degradation of plant cell walls, reflecting a plesiomorphic state of non-domesticated fungi. The enzyme profiles of the higher-attine and leaf-cutting gardens appear particularly suited to digest fresh plant materials and to access nutrients from live cells without major...

  3. Distribución espacial de Cordyceps spp. (Ascomycotina: Clavicipitaceae y su impacto sobre las hormigas en selvas del piedemonte amazónico de Colombia

    Directory of Open Access Journals (Sweden)

    Sanjuán Tatiana


    hormiga influenciando sus códigos feromonalesEntomopathogenic fungi of the genus Cordyceps were sampled in the foothills of the Colombian Amazon region (450 - 600 msnm altitude, January and May, 1998, i.e. dry and wet seasons, respectively. Healthy and Cordyceps-parasitized ants from a nearly pristine, a naturally disturbed and a human-disturbed forests were collected on 100 quadrants (1 m² per forest. Litter, shrubs and trunks were explored as substrates, and samples were gathered in vertical strata from 50 cm to 2 m high. Aztec was the predominant ant genus in near pristine forest whereas Camponotus, Pheidole and Crematogaster were dominant in disturbed forests. In the naturally disturbed forest we found 759 individuals of Cordyceps unilateralis and 69 of C. lloydii var. binata parasitizing Camponotus spp (Formicidae: Formicinae, whereas C. kniphofioides var. ponerinarum and C. australis were found only in six cases infecting the ants Paraponera clavata and Pachycondila crassinoda (Formicidae: Ponerinae. In the human disturbed forest it were found 34 individuals of C. unilateralis on Camponotus. In the near pristine forest we did not find parasitized ants. The Camponotus spp ants parasitized by C. unilateralis and C. lloydii var binata were found predominantly in the substratum foliage up to 1 m. It was concluded that the incidence of Cordyceps-ant interactions is not influenced by the conservation status of the forest. Instead, relative humidity and presence/absence of host ants appear to be key factors. Also, the micro-spatial distribution of the interactions seems to follow a definite pattern. This work observations support the hypothesis on coevolution of dispersion mechanisms in Cordyceps and ant feromonal codes

  4. Pericarpial nectary-visiting ants do not provide fruit protection against pre-dispersal seed predators regardless of ant species composition and resource availability.

    Directory of Open Access Journals (Sweden)

    Priscila Andre Sanz-Veiga

    Full Text Available Extrafloral nectaries can occur in both vegetative and reproductive plant structures. In many Rubiaceae species in the Brazilian Cerrado, after corolla abscission, the floral nectary continues to secret nectar throughout fruit development originating post-floral pericarpial nectaries which commonly attract many ant species. The occurrence of such nectar secreting structures might be strategic for fruit protection against seed predators, as plants are expected to invest higher on more valuable and vulnerable parts. Here, we performed ant exclusion experiments to investigate whether the interaction with ants mediated by the pericarpial nectaries of Tocoyena formosa affects plant reproductive success by reducing the number of pre-dispersal seed predators. We also assessed whether ant protection was dependent on ant species composition and resource availability. Although most of the plants were visited by large and aggressive ant species, such as Ectatomma tuberculatum and species of the genus Camponotus, ants did not protect fruits against seed predators. Furthermore, the result of the interaction was neither related to ant species composition nor to the availability of resources. We suggest that these results may be related to the nature and behavior of the most important seed predators, like Hemicolpus abdominalis weevil which the exoskeleton toughness prevent it from being predated by most ant species. On the other hand, not explored factors, such as reward quality, local ant abundance, ant colony characteristics and/or the presence of alternative energetic sources could also account for variations in ant frequency, composition, and finally ant protective effects, highlighting the conditionality of facultative plant-ant mutualisms.

  5. Agricultural matrices affect ground ant assemblage composition inside forest fragments.

    Directory of Open Access Journals (Sweden)

    Diego Santana Assis

    Full Text Available The establishment of agricultural matrices generally involves deforestation, which leads to fragmentation of the remaining forest. This fragmentation can affect forest dynamics both positively and negatively. Since most animal species are affected, certain groups can be used to measure the impact of such fragmentation. This study aimed to measure the impacts of agricultural crops (matrices on ant communities of adjacent lower montane Atlantic rainforest fragments. We sampled nine forest fragments at locations surrounded by different agricultural matrices, namely: coffee (3 replicates; sugarcane (3; and pasture (3. At each site we installed pitfall traps along a 500 m transect from the interior of the matrix to the interior of the fragment (20 pitfall traps ~25 m apart. Each transect was partitioned into four categories: interior of the matrix; edge of the matrix; edge of the fragment; and interior of the fragment. For each sample site, we measured ant species richness and ant community composition within each transect category. Ant richness and composition differed between fragments and matrices. Each sample location had a specific composition of ants, probably because of the influence of the nature and management of the agricultural matrices. Species composition in the coffee matrix had the highest similarity to its corresponding fragment. The variability in species composition within forest fragments surrounded by pasture was greatest when compared with forest fragments surrounded by sugarcane or, to a lesser extent, coffee. Functional guild composition differed between locations, but the most representative guild was 'generalist' both in the agricultural matrices and forest fragments. Our results are important for understanding how agricultural matrices act on ant communities, and also, how these isolated forest fragments could act as an island of biodiversity in an 'ocean of crops'.

  6. Agricultural matrices affect ground ant assemblage composition inside forest fragments. (United States)

    Assis, Diego Santana; Dos Santos, Iracenir Andrade; Ramos, Flavio Nunes; Barrios-Rojas, Katty Elena; Majer, Jonathan David; Vilela, Evaldo Ferreira


    The establishment of agricultural matrices generally involves deforestation, which leads to fragmentation of the remaining forest. This fragmentation can affect forest dynamics both positively and negatively. Since most animal species are affected, certain groups can be used to measure the impact of such fragmentation. This study aimed to measure the impacts of agricultural crops (matrices) on ant communities of adjacent lower montane Atlantic rainforest fragments. We sampled nine forest fragments at locations surrounded by different agricultural matrices, namely: coffee (3 replicates); sugarcane (3); and pasture (3). At each site we installed pitfall traps along a 500 m transect from the interior of the matrix to the interior of the fragment (20 pitfall traps ~25 m apart). Each transect was partitioned into four categories: interior of the matrix; edge of the matrix; edge of the fragment; and interior of the fragment. For each sample site, we measured ant species richness and ant community composition within each transect category. Ant richness and composition differed between fragments and matrices. Each sample location had a specific composition of ants, probably because of the influence of the nature and management of the agricultural matrices. Species composition in the coffee matrix had the highest similarity to its corresponding fragment. The variability in species composition within forest fragments surrounded by pasture was greatest when compared with forest fragments surrounded by sugarcane or, to a lesser extent, coffee. Functional guild composition differed between locations, but the most representative guild was 'generalist' both in the agricultural matrices and forest fragments. Our results are important for understanding how agricultural matrices act on ant communities, and also, how these isolated forest fragments could act as an island of biodiversity in an 'ocean of crops'.

  7. Characterization of actinobacteria associated with three ant-plant mutualisms. (United States)

    Hanshew, Alissa S; McDonald, Bradon R; Díaz Díaz, Carol; Djiéto-Lordon, Champlain; Blatrix, Rumsaïs; Currie, Cameron R


    Ant-plant mutualisms are conspicuous and ecologically important components of tropical ecosystems that remain largely unexplored in terms of insect-associated microbial communities. Recent work has revealed that ants in some ant-plant systems cultivate fungi (Chaetothyriales) within their domatia, which are fed to larvae. Using Pseudomyrmex penetrator/Tachigali sp. from French Guiana and Petalomyrmex phylax/Leonardoxa africana and Crematogaster margaritae/Keetia hispida, both from Cameroon, as models, we tested the hypothesis that ant-plant-fungus mutualisms co-occur with culturable Actinobacteria. Using selective media, we isolated 861 putative Actinobacteria from the three systems. All C. margaritae/K. hispida samples had culturable Actinobacteria with a mean of 10.0 colony forming units (CFUs) per sample, while 26 % of P. penetrator/Tachigali samples (mean CFUs 1.3) and 67 % of P. phylax/L. africana samples (mean CFUs 3.6) yielded Actinobacteria. The largest number of CFUs was obtained from P. penetrator workers, P. phylax alates, and C. margaritae pupae. 16S rRNA gene sequencing and phylogenetic analysis revealed the presence of four main clades of Streptomyces and one clade of Nocardioides within these three ant-plant mutualisms. Streptomyces with antifungal properties were isolated from all three systems, suggesting that they could serve as protective symbionts, as found in other insects. In addition, a number of isolates from a clade of Streptomyces associated with P. phylax/L. africana and C. margaritae/K. hispida were capable of degrading cellulose, suggesting that Streptomyces in these systems may serve a nutritional role. Repeated isolation of particular clades of Actinobacteria from two geographically distant locations supports these isolates as residents in ant-plant-fungi niches.

  8. Plant genotype shapes ant-aphid interactions: implications for community structure and indirect plant defense. (United States)

    Mooney, Kailen A; Agrawal, Anurag A


    Little is known about the mechanisms by which plant genotype shapes arthropod community structure. In a field experiment, we measured the effects of milkweed (Asclepias syriaca) genotype and ants on milkweed arthropods. Populations of the ant-tended aphid Aphis asclepiadis and the untended aphid Myzocallis asclepiadis varied eight- to 18-fold among milkweed genotypes, depending on aphid species and whether ants were present. There was no milkweed effect on predatory arthropods. Ants increased Aphis abundance 59%, decreased Myzocallis abundance 52%, and decreased predator abundance 56%. Milkweed genotype indirectly influenced ants via direct effects on Aphis and Myzocallis abundance. Milkweed genotype also modified ant-aphid interactions, influencing the number of ants attracted per Aphis and Myzocallis. While ant effects on Myzocallis were consistently negative, effects on Aphis ranged from antagonistic to mutualistic among milkweed genotypes. As a consequence of milkweed effects on ant-aphid interactions, ant abundance varied 13-fold among milkweed genotypes, and monarch caterpillar survival was negatively correlated with genetic variation in ant abundance. We speculate that heritable variation in milkweed phloem sap drives these effects on aphids, ants, and caterpillars. In summary, milkweed exerts genetic control over the interactions between aphids and an ant that provides defense against foliage-feeding caterpillars.

  9. Intrapopulation differences in ant eating in the mountain gorillas of Bwindi Impenetrable National Park, Uganda. (United States)

    Ganas, Jessica; Robbins, Martha M


    Variability in ant eating has been observed in several populations of eastern and western gorillas. We investigated the occurrence of ant (Dorylus sp.) eating in two groups of mountain gorillas (Gorilla beringei beringei) with overlapping home ranges within Bwindi Impenetrable National Park, Uganda from September 2001 to August 2002. We calculated the frequency of ant eating by an indirect method of analyzing fecal samples from silverbacks, adult females, and juveniles. One group consumed ants significantly more often than the other (3.3 vs 17.6% of days sampled). Furthermore, the group that consumed ants more often also consumed them on a seasonal basis (September-February monthly range: 0-8%; March-August monthly range: 30-42.9%). Finally, females and juveniles of this group consumed ants significantly more often than did the silverback (total samples containing ants: silverback, 2.1%; adult female, 13.2%; juvenile, 11.2%). Differences in ant eating between groups are likely due to variability in use of habitats where ants occur (particularly secondary forests). Surveys of ant densities in differing habitats, nutritional analysis of ants, and quantification of the amount of ants in their diets are necessary to understand if ant consumption is due to availability, nutritional value, group traditions, or taste preference.

  10. Five new records of ants (Hymenoptera: Formicidae) from Morocco. (United States)

    Taheri, Ahmed; Reyes-López, Joaquin L


    A recent catalogue of the rich ant fauna of Morocco included 214 species, with later studies adding an additional 12 species. Following recent fieldwork in the north of Morocco, we report five new records for the country (Plagiolepis pygmaea Latreille, 1798, Ponera testacea Emery, 1895, Strumigenys tenuipilis Emery, 1915, Temnothorax pardoi Tinaut, 1987, and Tetramorium parvioculum Guillem & Bensusan, 2009) and we present new data on the distribution and natural history of six additional species. This work brings the total number of ants known from Morocco to 233, taking into account two species which were omitted in the list of Cagniant. © Crown copyright 2015.

  11. Core Business Selection Based on Ant Colony Clustering Algorithm

    Directory of Open Access Journals (Sweden)

    Yu Lan


    Full Text Available Core business is the most important business to the enterprise in diversified business. In this paper, we first introduce the definition and characteristics of the core business and then descript the ant colony clustering algorithm. In order to test the effectiveness of the proposed method, Tianjin Port Logistics Development Co., Ltd. is selected as the research object. Based on the current situation of the development of the company, the core business of the company can be acquired by ant colony clustering algorithm. Thus, the results indicate that the proposed method is an effective way to determine the core business for company.

  12. Significance of chemical recognition cues is context dependent in ants

    DEFF Research Database (Denmark)

    Bos, N.; Guerrieri, F.J.; d'Ettorre, P.


    signatures, composed primarily of long-chain cuticular hydrocarbons. These signatures are colony specific and allow discrimination between nestmates and non-nestmates. Nevertheless, the mechanisms underlying detection, perception and information processing of chemical signatures are poorly understood. It has...... context, affects aggression against non-nestmates carrying the hydrocarbon profile associated with food. Individual ant workers were able to associate the non-nestmate chemical profile with food. However, conditioned ants were still aggressive when encountering a non-nestmate carrying the odour profile...

  13. Mutualistic fungi control crop diversity in fungus-growing ants

    DEFF Research Database (Denmark)

    Poulsen, Michael; Boomsma, Jacobus J


    Leaf-cutting ants rear clonal fungi for food and transmit the fungi from mother to daughter colonies so that symbiont mixing and conflict, which result from competition between genetically different clones, are avoided. Here we show that despite millions of years of predominantly vertical...... transmission, the domesticated fungi actively reject mycelial fragments from neighboring colonies, and that the strength of these reactions are in proportion to the overall genetic difference between these symbionts. Fungal incompatibility compounds remain intact during ant digestion, so that fecal droplets...

  14. Are queen ants inhibited by their own pheromone?

    DEFF Research Database (Denmark)

    Holman, L.; Leroy, C.; Jørgensen, Charlotte


    . Communication in social insects is predominantly chemical, and the mechanisms regulating processes such as reproductive division of labor are becoming increasingly well understood. Recently, a queen cuticular hydrocarbon (3-MeC31) that inhibits worker reproduction and aggression was isolated in the ant Lasius...... niger. Here, we find that this pheromone also has a weak negative effect on queen productivity and oogenesis. Because 3-MeC31 is present on both queens and their brood, we suggest that it is used by ants of both castes to adjust their fecundity to the amount of developing brood and the presence of other...

  15. Sperm storage induces an immunity cost in ants

    DEFF Research Database (Denmark)

    Baer, Boris; Armitage, Sophie A O; Boomsma, Jacobus J


    Ant queens are among the most long-lived insects known. They mate early in adult life and maintain millions of viable sperm in their sperm storage organ until they die many years later. Because they never re-mate, the reproductive success of queens is ultimately sperm-limited, but it is not known...... what selective forces determine the upper limit to sperm storage. Here we show that sperm storage carries a significant cost of reduced immunity during colony founding. Newly mated queens of the leaf-cutting ant Atta colombica upregulate their immune response shortly after completing their nest burrow...

  16. The search rate of the African weaver ant in cashew

    DEFF Research Database (Denmark)

    Henriksen, Signe; Axelsen, Jørgen Aagaard; Lemming, Katrine Hansen


    Oecophylla longinoda is a species of eusocial colony living ants that prey upon other insects to feed their larva. Many of these insects are considered pests. An ecosystem model of the interactions between an O. longinoda colony and its potential prey is under construction by the team behind...... this article, and it is unknown which functional response equations are useful for eusocial insect colonies. We investigated the search rate of O. longinoda using artificial feeding experiments in a Tanzanian cashew (Anacardium occidentale L.) orchard to determine the search efficiency of the ants...

  17. Application of ant colony optimization in NPP classification fault location

    International Nuclear Information System (INIS)

    Xie Chunli; Liu Yongkuo; Xia Hong


    Nuclear Power Plant is a highly complex structural system with high safety requirements. Fault location appears to be particularly important to enhance its safety. Ant Colony Optimization is a new type of optimization algorithm, which is used in the fault location and classification of nuclear power plants in this paper. Taking the main coolant system of the first loop as the study object, using VB6.0 programming technology, the NPP fault location system is designed, and is tested against the related data in the literature. Test results show that the ant colony optimization can be used in the accurate classification fault location in the nuclear power plants. (authors)

  18. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano


    . To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

  19. Conflict over reproduction in an ant-plant symbiosis: why Allomerus octoarticulatus ants sterilize Cordia nodosa trees. (United States)

    Frederickson, Megan E


    The evolutionary stability of mutualism is thought to depend on how well the fitness interests of partners are aligned. Because most ant-myrmecophyte mutualisms are persistent and horizontally transmitted, partners share an interest in growth but not in reproduction. Resources invested in reproduction are unavailable for growth, giving rise to a conflict of interest between partners. I investigated whether this explains why Allomerus octoarticulatus ants sterilize Cordia nodosa trees. Allomerus octoarticulatus nests in the hollow stem domatia of C. nodosa. Workers protect C. nodosa leaves against herbivores but destroy inflorescences. Using C. nodosa trees with Azteca ants, which do not sterilize their hosts, I cut inflorescences off trees to simulate sterilization by A. octoarticulatus. Sterilized C. nodosa grew faster than control trees, providing evidence for a trade-off between growth and reproduction. Allomerus octoarticulatus manipulates this trade-off to its advantage; sterilized trees produce more domatia and can house larger, more fecund colonies.

  20. The genomic impact of 100 million years of social evolution in seven ant species

    DEFF Research Database (Denmark)

    Gadau, Jürgen; Helmkampf, Martin; Nygaard, Sanne


    Ants (Hymenoptera, Formicidae) represent one of the most successful eusocial taxa in terms of both their geographic distribution and species number. The publication of seven ant genomes within the past year was a quantum leap for socio- and ant genomics. The diversity of social organization in ants...... between social and solitary insects, as well as among ant species. Altogether, these seven ant genomes open exciting new research avenues and opportunities for understanding the genetic basis and regulation of social species, and adaptive complex systems in general....... makes them excellent model organisms to study the evolution of social systems. Comparing the ant genomes with those of the honeybee, a lineage that evolved eusociality independently from ants, and solitary insects suggests that there are significant differences in key aspects of genome organization...

  1. Impact of imidacloprid on new queens of imported fire ants, Solenopsis invicta (Hymenoptera: Formicidae) (United States)

    Neonicotinoid insecticides are commonly used in managing pest ants, including the imported fire ant, Solenopsis invicta Buren. There is increasing evidence that neonicotinoid insecticides at sublethal concentrations have profound effects on social insects. However, the sublethal effect of neonicot...

  2. Live and let die: why fighter males of the ant Cardiocondyla kill each other but tolerate their winged rivals

    DEFF Research Database (Denmark)

    Anderson, Carl; Cremer, Sylvia Maria; Heinze, Jürgen


    alternative dispersal tactics, ants, Cardiocondyla, ergatoid males, fighting, male dimorphism, toleration......alternative dispersal tactics, ants, Cardiocondyla, ergatoid males, fighting, male dimorphism, toleration...

  3. Olfactory memory established during trophallaxis affects food search behaviour in ants


    Provecho, Y.; Josens, R.


    Camponotus mus ants can associate sucrose and odour at the source during successive foraging cycles and use this memory to locate the nectar in the absence of other cues. These ants perform conspicuous trophallactic behaviour during recruitment while foraging for nectar. In this work, we studied whether Camponotus mus ants are able to establish this odour-sucrose association in the social context of trophallaxis and we evaluated this memory in another context previously experienced by the ant...

  4. Individual Rules for Trail Pattern Formation in Argentine Ants (Linepithema humile)


    Perna, Andrea; Granovskiy, Boris; Garnier, Simon; Nicolis, Stamatios C.; Labédan, Marjorie; Theraulaz, Guy; Fourcassié, Vincent; Sumpter, David J. T.


    We studied the formation of trail patterns by Argentine ants exploring an empty arena. Using a novel imaging and analysis technique we estimated pheromone concentrations at all spatial positions in the experimental arena and at different times. Then we derived the response function of individual ants to pheromone concentrations by looking at correlations between concentrations and changes in speed or direction of the ants. Ants were found to turn in response to local pheromone concentrations,...

  5. 9 CFR 381.71 - Condemnation on ante mortem inspection. (United States)


    ... dressed, nor shall they be conveyed into any department of the official establishment where poultry... AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Ante Mortem Inspection § 381.71...

  6. Application of ant colony optimisation in distribution transformer sizing

    African Journals Online (AJOL)

    This study proposes an optimisation method for transformer sizing in power system using ant colony optimisation and a verification of the process by MATLAB software. The aim is to address the issue of transformer sizing which is a major challenge affecting its effective performance, longevity, huge capital cost and power ...

  7. Formulation des betons autopla~ants : Optimisation du squelette ...

    African Journals Online (AJOL)

    Formulation des betons autopla~ants : Optimisation du squelette granulaire par la methode graphique de Dreux - Gorisse. Fatiha Boumaza - Zeraoulia* & Mourad Behim. Laboratoire Materiaux, Geo - Materiaux et Environnement - Departement de Genie Civil. Universite Badji Mokhtar Annaba - BP 12, 23000 Annaba - ...

  8. Ant and rattan associations in forest of tropical Africa | Sunderland ...

    African Journals Online (AJOL)

    Recent fieldwork aimed at increasing our knowledge of the taxonomy and ecology of African rattans has indicated that there is a significant relationship between these climbing palms and a number of ant species. A closer investigation into this relationship has found that the morphology of rattan palms is particularly ...

  9. Are workers of Atta leafcutter ants capable of reproduction?

    DEFF Research Database (Denmark)

    Dijkstra, Michiel Bendert; Boomsma, Jacobus Jan


    ovaries. Workers of Atta leafcutter ants only lay trophic eggs in queenright colonies. Although Atta colonies are commonly kept at universities, museums, and zoos, no reports of worker sons in orphaned colonies exist, suggesting that Atta workers are infertile. To explicitly test this, we created eleven...

  10. Does the afrotropical army ant Dorylus (Anomma) molestus go ...

    African Journals Online (AJOL)

    Swarm-raiding army ants are extremely polyphagous nomadic predators inhabiting tropical forests. They are considered keystone species because their raids can regulate the population dynamics of their prey and because a plethora of both invertebrate and vertebrate species are obligatorily or facultatively associated with ...

  11. Biogeography of Puerto Rican ants: a non-equilibrium case? (United States)

    J.A. Torres; R.R. Snelling


    Ants were studied on Puerto Rico and 44 islands surrounding Puerto Rico. Habitat diversity was the best predictor of the number of species per island and the distributions of species followed a nested subset pattern. The number of extinctions per island was low, approximately 1 to 2 extinctions per island in a period of 18 years, and the rates of colonization seem to...

  12. Recurrent bridgehead effects accelerate global alien ant spread (United States)

    Cleo Bertelsmeier; Sébastien Ollier; Andrew M. Liebhold; Eckehard G. Brockerhoff; Darren Ward; Laurent Keller


    Biological invasions are a major threat to biological diversity, agriculture, and human health. To predict and prevent new invasions, it is crucial to develop a better understanding of the drivers of the invasion process. The analysis of 4,533 border interception events revealed that at least 51 different alien ant species were intercepted at US ports over a period of...

  13. Ultrastructure of antennal sensillae of the samsum ant ...

    African Journals Online (AJOL)



    Oct 11, 2010 ... subsequently may form the basis in producing its effective control measure in future. ... persons that may deteriorate into serious health condi- tions. ... with the behavioral ecology of ants (Faucheux et al.,. 2006) ... Basiconic type acts as food and CO2 receptor, trichoids ..... Sex pheromone perception in male.

  14. Energy Efficient Routing in Wireless Sensor Networks based on Ant ...

    African Journals Online (AJOL)



    Sep 1, 2013 ... improved Ant System and their application in WSN routing process. The simulation results show ... and Mobile ad-hoc networks (MANETs) are inappropriate for ... Dorigo in 1992 in his PhD thesis, the first algorithm was aiming ...

  15. Urban physiology: city ants possess high heat tolerance.

    Directory of Open Access Journals (Sweden)

    Michael J Angilletta

    Full Text Available Urbanization has caused regional increases in temperature that exceed those measured on a global scale, leading to urban heat islands as much as 12 degrees C hotter than their surroundings. Optimality models predict ectotherms in urban areas should tolerate heat better and cold worse than ectotherms in rural areas. We tested these predications by measuring heat and cold tolerances of leaf-cutter ants from South America's largest city (São Paulo, Brazil. Specifically, we compared thermal tolerances of ants from inside and outside of the city. Knock-down resistance and chill-coma recovery were used as indicators of heat and cold tolerances, respectively. Ants from within the city took 20% longer to lose mobility at 42 degrees C than ants from outside the city. Interestingly, greater heat tolerance came at no obvious expense of cold tolerance; hence, our observations only partially support current theory. Our results indicate that thermal tolerances of some organisms can respond to rapid changes in climate. Predictive models should account for acclimatory and evolutionary responses during climate change.

  16. Irving Babbitti humanismi põhijooned / Ants Oras

    Index Scriptorium Estoniae

    Oras, Ants


    Varem ilmunud: rmt.: "Kultuuri ja teaduse teilt: mõtteid ja uurimusi Tartu Ülikooli 300-nda mälestusaasta puhuks". Tartu : Loodus, 1932, lk. 144-153 ; Ants Oras, "Irving Babbitt' i humanismi põhijooned: äratrükk koguteosest "Kultuuri ja teaduse teilt"". Tartu, 1932

  17. Ant-egg cataract. An electron microscopic study

    DEFF Research Database (Denmark)

    Schrøder, H D; Nissen, S H


    an intermittent growth of the structure. In the ant-eggs, as well as in some areas separate from these, membrane limited cytoplasmic bodies could be seen in many cases, the membranes of which were partly joint and partly separated by an electron dense material. It is suggested that the calcifications seen...

  18. Compass cues used by a nocturnal bull ant, Myrmecia midas. (United States)

    Freas, Cody A; Narendra, Ajay; Cheng, Ken


    Ants use both terrestrial landmarks and celestial cues to navigate to and from their nest location. These cues persist even as light levels drop during the twilight/night. Here, we determined the compass cues used by a nocturnal bull ant, Myrmecia midas , in which the majority of individuals begin foraging during the evening twilight period. Myrmecia midas foragers with vectors of ≤5   m when displaced to unfamiliar locations did not follow the home vector, but instead showed random heading directions. Foragers with larger home vectors (≥10   m) oriented towards the fictive nest, indicating a possible increase in cue strength with vector length. When the ants were displaced locally to create a conflict between the home direction indicated by the path integrator and terrestrial landmarks, foragers oriented using landmark information exclusively and ignored any accumulated home vector regardless of vector length. When the visual landmarks at the local displacement site were blocked, foragers were unable to orient to the nest direction and their heading directions were randomly distributed. Myrmecia midas ants typically nest at the base of the tree and some individuals forage on the same tree. Foragers collected on the nest tree during evening twilight were unable to orient towards the nest after small lateral displacements away from the nest. This suggests the possibility of high tree fidelity and an inability to extrapolate landmark compass cues from information collected on the tree and at the nest site to close displacement sites. © 2017. Published by The Company of Biologists Ltd.

  19. Variability in individual activity bursts improves ant foraging success. (United States)

    Campos, Daniel; Bartumeus, Frederic; Méndez, Vicenç; Andrade, José S; Espadaler, Xavier


    Using experimental and computational methods, we study the role of behavioural variability in activity bursts (or temporal activity patterns) for individual and collective regulation of foraging in A. senilis ants. First, foraging experiments were carried out under special conditions (low densities of ants and food and absence of external cues or stimuli) where individual-based strategies are most prevalent. By using marked individuals and recording all foraging trajectories, we were then able to precisely quantify behavioural variability among individuals. Our main conclusions are that (i) variability of ant trajectories (turning angles, speed, etc.) is low compared with variability of temporal activity profiles, and (ii) this variability seems to be driven by plasticity of individual behaviour through time, rather than the presence of fixed behavioural stereotypes or specialists within the group. The statistical measures obtained from these experimental foraging patterns are then used to build a general agent-based model (ABM) which includes the most relevant properties of ant foraging under natural conditions, including recruitment through pheromone communication. Using the ABM, we are able to provide computational evidence that the characteristics of individual variability observed in our experiments can provide a functional advantage (in terms of foraging success) to the group; thus, we propose the biological basis underpinning our observations. Altogether, our study reveals the potential utility of experiments under simplified (laboratory) conditions for understanding information-gathering in biological systems. © 2016 The Author(s).

  20. Ant Colony Optimization and the Minimum Cut Problem

    DEFF Research Database (Denmark)

    Kötzing, Timo; Lehre, Per Kristian; Neumann, Frank


    Ant Colony Optimization (ACO) is a powerful metaheuristic for solving combinatorial optimization problems. With this paper we contribute to the theoretical understanding of this kind of algorithm by investigating the classical minimum cut problem. An ACO algorithm similar to the one that was prov...

  1. Evolutionary transitions in enzyme activity of ant fungus gardens. (United States)

    De Fine Licht, Henrik H; Schiøtt, Morten; Mueller, Ulrich G; Boomsma, Jacobus J


    Fungus-growing (attine) ants and their fungal symbionts passed through several evolutionary transitions during their 50 million year old evolutionary history. The basal attine lineages often shifted between two main cultivar clades, whereas the derived higher-attine lineages maintained an association with a monophyletic clade of specialized symbionts. In conjunction with the transition to specialized symbionts, the ants advanced in colony size and social complexity. Here we provide a comparative study of the functional specialization in extracellular enzyme activities in fungus gardens across the attine phylogeny. We show that, relative to sister clades, gardens of higher-attine ants have enhanced activity of protein-digesting enzymes, whereas gardens of leaf-cutting ants also have increased activity of starch-digesting enzymes. However, the enzyme activities of lower-attine fungus gardens are targeted primarily toward partial degradation of plant cell walls, reflecting a plesiomorphic state of nondomesticated fungi. The enzyme profiles of the higher-attine and leaf-cutting gardens appear particularly suited to digest fresh plant materials and to access nutrients from live cells without major breakdown of cell walls. The adaptive significance of the lower-attine symbiont shifts remains unclear. One of these shifts was obligate, but digestive advantages remained ambiguous, whereas the other remained facultative despite providing greater digestive efficiency.

  2. An object-oriented model for ex ante accounting information

    NARCIS (Netherlands)

    Verdaasdonk, P.J.A.


    Present accounting data models such as the Research-Event-Agent (REA) model merely focus on the modeling of static accounting phenomena. In this paper, it is argued that these models are not able to provide relevant ex ante accounting data for operations management decisions. These decisions require

  3. A model of ant route navigation driven by scene familiarity.

    Directory of Open Access Journals (Sweden)

    Bart Baddeley


    Full Text Available In this paper we propose a model of visually guided route navigation in ants that captures the known properties of real behaviour whilst retaining mechanistic simplicity and thus biological plausibility. For an ant, the coupling of movement and viewing direction means that a familiar view specifies a familiar direction of movement. Since the views experienced along a habitual route will be more familiar, route navigation can be re-cast as a search for familiar views. This search can be performed with a simple scanning routine, a behaviour that ants have been observed to perform. We test this proposed route navigation strategy in simulation, by learning a series of routes through visually cluttered environments consisting of objects that are only distinguishable as silhouettes against the sky. In the first instance we determine view familiarity by exhaustive comparison with the set of views experienced during training. In further experiments we train an artificial neural network to perform familiarity discrimination using the training views. Our results indicate that, not only is the approach successful, but also that the routes that are learnt show many of the characteristics of the routes of desert ants. As such, we believe the model represents the only detailed and complete model of insect route guidance to date. What is more, the model provides a general demonstration that visually guided routes can be produced with parsimonious mechanisms that do not specify when or what to learn, nor separate routes into sequences of waypoints.

  4. Rethinking crop-disease management in fungus-growing ants

    NARCIS (Netherlands)

    Boomsma, J.J.; Aanen, D.K.


    Ant fungus farming has become a prominent model for studying the evolution of mutualistic cooperation, with recent advances in reconstructing the evolutionary origin and elaborations of the symbiosis (1, 2), discovering additional partners and clarifying their interactions (3, 4), and analyzing

  5. Water Stress Strengthens Mutualism Among Ants, Trees, and Scale Insects (United States)

    Pringle, Elizabeth G.; Akçay, Erol; Raab, Ted K.; Dirzo, Rodolfo; Gordon, Deborah M.


    Abiotic environmental variables strongly affect the outcomes of species interactions. For example, mutualistic interactions between species are often stronger when resources are limited. The effect might be indirect: water stress on plants can lead to carbon stress, which could alter carbon-mediated plant mutualisms. In mutualistic ant–plant symbioses, plants host ant colonies that defend them against herbivores. Here we show that the partners' investments in a widespread ant–plant symbiosis increase with water stress across 26 sites along a Mesoamerican precipitation gradient. At lower precipitation levels, Cordia alliodora trees invest more carbon in Azteca ants via phloem-feeding scale insects that provide the ants with sugars, and the ants provide better defense of the carbon-producing leaves. Under water stress, the trees have smaller carbon pools. A model of the carbon trade-offs for the mutualistic partners shows that the observed strategies can arise from the carbon costs of rare but extreme events of herbivory in the rainy season. Thus, water limitation, together with the risk of herbivory, increases the strength of a carbon-based mutualism. PMID:24223521

  6. Ant-inspired density estimation via random walks. (United States)

    Musco, Cameron; Su, Hsin-Hao; Lynch, Nancy A


    Many ant species use distributed population density estimation in applications ranging from quorum sensing, to task allocation, to appraisal of enemy colony strength. It has been shown that ants estimate local population density by tracking encounter rates: The higher the density, the more often the ants bump into each other. We study distributed density estimation from a theoretical perspective. We prove that a group of anonymous agents randomly walking on a grid are able to estimate their density within a small multiplicative error in few steps by measuring their rates of encounter with other agents. Despite dependencies inherent in the fact that nearby agents may collide repeatedly (and, worse, cannot recognize when this happens), our bound nearly matches what would be required to estimate density by independently sampling grid locations. From a biological perspective, our work helps shed light on how ants and other social insects can obtain relatively accurate density estimates via encounter rates. From a technical perspective, our analysis provides tools for understanding complex dependencies in the collision probabilities of multiple random walks. We bound the strength of these dependencies using local mixing properties of the underlying graph. Our results extend beyond the grid to more general graphs, and we discuss applications to size estimation for social networks, density estimation for robot swarms, and random walk-based sampling for sensor networks.

  7. Ants Oras ja eesti Shakespeare'i-kultuur / Evelin Banhard

    Index Scriptorium Estoniae

    Banhard, Evelin


    Artikkel käsitleb Ants Orase rolli William Shakespeare'i pärandi tõlkija ja tutvustajana. Analüüsitakse Orase töid eesti kultuuriajakirjanduses 1920. ja 1930. aastatel ning tema hilisemaid, paguluses kirjutatud arvustusi

  8. INTRODUCTION The tailor or weaver ants of genus Oecophylla ...

    African Journals Online (AJOL)

    smaragdina which is a sister species and ecological equivalent of ... Stability in population of Oecophylla in BSP and PG over 13 years suggests that weaver ant .... between the two years were significant at 95% confidence ..... over time is dependent on the nature of the perturbation. ... longinoda in relation to territorility and.

  9. Dentigerumycin: a bacterial mediator of an ant-fungus symbiosis

    DEFF Research Database (Denmark)

    Oh, Dong-Chan; Poulsen, Michael; Currie, Cameron R


    Fungus-growing ants engage in mutualistic associations with both the fungus they cultivate for food and actinobacteria (Pseudonocardia spp.) that produce selective antibiotics to defend that fungus from specialized fungal parasites. We have analyzed one such system at the molecular level and found...


    The responses of ant communities to structural change (removal of an invasive were studied in a replicated experiment in a Chihuahuan Desert grassland. The results from sampling of ant communities by pit-fall trapping were validated by mapping ant colonies on the experimental plo...

  11. Advances in Research on the Venom Chemistry of Imported Fire Ants (United States)

    Workers of the imported fire ants, including red imported fire ants, Solenopsis invicta Buren, black imported fire ants, S. richteri Forel, and their hybrid (S. invicta × S. richteri), are vicious stingers. Since the venomous sting is a significant medical problem to humans, the chemistry of import...

  12. Dispersal for survival: some observations on the trunk ant (Formica truncorum Fabricius)

    NARCIS (Netherlands)

    Mabelis, A.A.; Korczynska, J.


    The survival chance of the trunk ant (Formica truncorum) is compared with the survival chance of two other species of red wood ants: F.rufa and F.polyctena. Nest populations of F.truncorum are much smaller than nest populations of the other red wood ant species, which makes the species a weaker

  13. The genome of the fire ant Solenopsis invicta

    DEFF Research Database (Denmark)

    Wurm, Yannick; Wang, John; Riba-Grognuz, Oksana


    Ants have evolved very complex societies and are key ecosystem members. Some ants, such as the fire ant Solenopsis invicta, are also major pests. Here, we present a draft genome of S. invicta, assembled from Roche 454 and Illumina sequencing reads obtained from a focal haploid male and his brothe...

  14. The effects of age and social interactions on innate immunity in a leaf-cutting ant

    DEFF Research Database (Denmark)

    Armitage, S.A.O.; Boomsma, J.J.


    defence is affected by both age and the short-term presence or absence of nestmates in the leaf-cutting ant Acromyrmex octospinosus. We predicted that older ants would show immune senescence and that group living may result in prophylactic differences in immune defence compared to solitarily kept ants. We...

  15. The effectiveness of weaver ant (Oecophylla smaragdina) biocontrol in Southeast Asian citrus and mango

    DEFF Research Database (Denmark)

    Offenberg, Joachim; Cuc, Nguyen Thi Thu; Wiwatwitaya, Decha


    Oecophylla ants may protect tropical plantation crops against pests. Cost-benefit studies comparing ant-based protection with conventional methods are needed to assess whether it is economically viable. Here we contrast profits in ant and chemically protected plots in a Thai and a Vietnamese citrus...

  16. Towards a better understanding of the evolution of specialized parasites of fungus-growing ant crops

    DEFF Research Database (Denmark)

    Yek, Sze Huei; Boomsma, Jacobus Jan; Poulsen, Michael


    Fungus-growing ants have interacted and partly coevolved with specialised microfungal parasites of the genus Escovopsis since the origin of ant fungiculture about 50 million years ago. Here, we review the recent progress in understanding the patterns of specificity of this ant-parasite associatio...

  17. Ant-Related Oviposition and Larval Performance in a Myrmecophilous Lycaenid

    Directory of Open Access Journals (Sweden)

    Matthew D. Trager


    Full Text Available We experimentally assessed ant-related oviposition and larval performance in the Miami blue butterfly (Cyclargus thomasi bethunebakeri. Ant tending had sex-dependent effects on most measures of larval growth: female larvae generally benefitted from increased tending frequency whereas male larvae were usually unaffected. The larger size of female larvae tended by ants resulted in a substantial predicted increase in lifetime egg production. Oviposition by adult females that were tended by C. floridanus ants as larvae was similar between host plants with or without ants. However, they laid relatively more eggs on plants with ants than did females raised without ants, which laid less than a third of their eggs on plants with ants present. In summary, we found conditional benefits for larvae tended by ants that were not accompanied by oviposition preference for plants with ants present, which is a reasonable result for a system in which ant presence at the time of oviposition is not a reliable indicator of future ant presence. More broadly, our results emphasize the importance of considering the consequences of variation in interspecific interactions, life history traits, and multiple measures of performance when evaluating the costs and benefits of mutualistic relationships.

  18. Drowning out the protection racket: partner manipulation or drought can strengthen ant-plant mutualism. (United States)

    Denison, R Ford


    Two recent reports discuss interactions between plants and ants that defend them from herbivores. Acacia trees provide their ant bodyguards with a diet that reduces their ability to benefit from alternate hosts. Provisioning of ants by Cordia trees during drought may buy insurance against extreme defoliation events, not just average-year benefits. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. The interplay between scent trails and group-mass recruitment systems in ants

    NARCIS (Netherlands)

    Planque, R.; van den Berg, G.J.B.; Franks, N.R.


    Large ant colonies invariably use effective scent trails to guide copious ant numbers to food sources. The success of mass recruitment hinges on the involvement of many colony members to lay powerful trails. However, many ant colonies start off as single queens. How do these same colonies forage

  20. Temperature limits trail following behaviour through pheromone decay in ants (United States)

    van Oudenhove, Louise; Billoir, Elise; Boulay, Raphaël; Bernstein, Carlos; Cerdá, Xim


    In Mediterranean habitats, temperature affects both ant foraging behaviour and community structure. Many studies have shown that dominant species often forage at lower temperature than subordinates. Yet, the factors that constrain dominant species foraging activity in hot environments are still elusive. We used the dominant ant Tapinoma nigerrimum as a model species to test the hypothesis that high temperatures hinder trail following behaviour by accelerating pheromone degradation. First, field observations showed that high temperatures (> 30°C) reduce the foraging activity of T. nigerrimum independently of the daily and seasonal rhythms of this species. Second, we isolated the effect of high temperatures on pheromone trail efficacy from its effect on worker physiology. A marked substrate was heated during 10 min (five temperature treatments from 25°C to 60°C), cooled down to 25°C, and offered in a test choice to workers. At hot temperature treatments (>40°C), workers did not discriminate the previously marked substrate. High temperatures appeared therefore to accelerate pheromone degradation. Third, we assessed the pheromone decay dynamics by a mechanistic model fitted with Bayesian inference. The model predicted ant choice through the evolution of pheromone concentration on trails as a function of both temperature and time since pheromone deposition. Overall, our results highlighted that the effect of high temperatures on recruitment intensity was partly due to pheromone evaporation. In the Mediterranean ant communities, this might affect dominant species relying on chemical recruitment, more than subordinate ant species, less dependent on chemical communication and less sensitive to high temperatures.

  1. Ants can learn to forage on one-way trails.

    Directory of Open Access Journals (Sweden)

    Pedro Leite Ribeiro

    Full Text Available The trails formed by many ant species between nest and food source are two-way roads on which outgoing and returning workers meet and touch each other all along. The way to get back home, after grasping a food load, is to take the same route on which they have arrived from the nest. In many species such trails are chemically marked by pheromones providing orientation cues for the ants to find their way. Other species rely on their vision and use landmarks as cues. We have developed a method to stop foraging ants from shuttling on two-way trails. The only way to forage is to take two separate roads, as they cannot go back on their steps after arriving at the food or at the nest. The condition qualifies as a problem because all their orientation cues -- chemical, visual or any other -- are disrupted, as all of them cannot but lead the ants back to the route on which they arrived. We have found that workers of the leaf-cutting ant Atta sexdens rubropilosa can solve the problem. They could not only find the alternative way, but also used the unidirectional traffic system to forage effectively. We suggest that their ability is an evolutionary consequence of the need to deal with environmental irregularities that cannot be negotiated by means of excessively stereotyped behavior, and that it is but an example of a widespread phenomenon. We also suggest that our method can be adapted to other species, invertebrate and vertebrate, in the study of orientation, memory, perception, learning and communication.

  2. Elevated atmospheric carbon dioxide concentrations promote ant tending of aphids. (United States)

    Kremer, Jenni M M; Nooten, Sabine S; Cook, James M; Ryalls, James M W; Barton, Craig V M; Johnson, Scott N


    Animal mutualisms, which involve beneficial interactions between individuals of different species, are common in nature. Insect-insect mutualism, for example, is widely regarded as a keystone ecological interaction. Some mutualisms are anticipated to be modified by climate change, but the focus has largely been on plant-microbe and plant-animal mutualisms rather than those between animals. Ant-aphid mutualisms, whereby ants tend aphids to harvest their honeydew excretions and, in return, provide protection for the aphids, are widespread. The mutualism is heavily influenced by the quality and quantity of honeydew produced by aphids, which is directly affected by host plant quality. As predicted increases in concentrations of atmospheric carbon dioxide (eCO 2 ) are widely reported to affect plant nutritional chemistry, this may also alter honeydew quality and hence the nature of ant-aphid mutualisms. Using glasshouse chambers and field-based open-top chambers, we determined the effect of eCO 2 on the growth and nutritional quality (foliar amino acids) of lucerne (Medicago sativa). We determined how cowpea aphid (Aphis craccivora) populations and honeydew production were impacted when feeding on such plants and how this affected the tending behaviour of ants (Iridomyrmex sp.). eCO 2 stimulated plant growth but decreased concentrations of foliar amino acids by 29% and 14% on aphid-infested plants and aphid-free plants, respectively. Despite the deterioration in host plant quality under eCO 2 , aphids maintained performance and populations were unchanged by eCO 2 . Aphids induced higher concentrations of amino acids (glutamine, asparagine, glutamic acid and aspartic acid) important for endosymbiont-mediated synthesis of essential amino acids. Aphids feeding under eCO 2 also produced over three times more honeydew than aphids feeding under ambient CO 2 , suggesting they were imbibing more phloem sap at eCO 2 . The frequency of ant tending of aphids more than doubled in

  3. A phylogenetic perspective on the association between ants (Hymenoptera: Formicidae) and black yeasts (Ascomycota: Chaetothyriales). (United States)

    Vasse, Marie; Voglmayr, Hermann; Mayer, Veronika; Gueidan, Cécile; Nepel, Maximilian; Moreno, Leandro; de Hoog, Sybren; Selosse, Marc-André; McKey, Doyle; Blatrix, Rumsaïs


    The frequency and the geographical extent of symbiotic associations between ants and fungi of the order Chaetothyriales have been highlighted only recently. Using a phylogenetic approach based on seven molecular markers, we showed that ant-associated Chaetothyriales are scattered through the phylogeny of this order. There was no clustering according to geographical origin or to the taxonomy of the ant host. However, strains tended to be clustered according to the type of association with ants: strains from ant-made carton and strains from plant cavities occupied by ants ('domatia') rarely clustered together. Defining molecular operational taxonomic units (MOTUs) with an internal transcribed spacer sequence similarity cut-off of 99% revealed that a single MOTU could be composed of strains collected from various ant species and from several continents. Some ant-associated MOTUs also contained strains isolated from habitats other than ant-associated structures. Altogether, our results suggest that the degree of specialization of the interactions between ants and their fungal partners is highly variable. A better knowledge of the ecology of these interactions and a more comprehensive sampling of the fungal order are needed to elucidate the evolutionary history of mutualistic symbioses between ants and Chaetothyriales. © 2017 The Author(s).

  4. Plant-ants feed their host plant, but above all a fungal symbiont to recycle nitrogen. (United States)

    Defossez, Emmanuel; Djiéto-Lordon, Champlain; McKey, Doyle; Selosse, Marc-André; Blatrix, Rumsaïs


    In ant-plant symbioses, plants provide symbiotic ants with food and specialized nesting cavities (called domatia). In many ant-plant symbioses, a fungal patch grows within each domatium. The symbiotic nature of the fungal association has been shown in the ant-plant Leonardoxa africana and its protective mutualist ant Petalomyrmex phylax. To decipher trophic fluxes among the three partners, food enriched in (13)C and (15)N was given to the ants and tracked in the different parts of the symbiosis up to 660 days later. The plant received a small, but significant, amount of nitrogen from the ants. However, the ants fed more intensively the fungus. The pattern of isotope enrichment in the system indicated an ant behaviour that functions specifically to feed the fungus. After 660 days, the introduced nitrogen was still present in the system and homogeneously distributed among ant, plant and fungal compartments, indicating efficient recycling within the symbiosis. Another experiment showed that the plant surface absorbed nutrients (in the form of simple molecules) whether or not it is coated by fungus. Our study provides arguments for a mutualistic status of the fungal associate and a framework for investigating the previously unsuspected complexity of food webs in ant-plant mutualisms.

  5. Heat-induced symmetry breaking in ant (Hymenoptera: Formicidae escape behavior.

    Directory of Open Access Journals (Sweden)

    Yuan-Kai Chung

    Full Text Available The collective egress of social insects is important in dangerous situations such as natural disasters or enemy attacks. Some studies have described the phenomenon of symmetry breaking in ants, with two exits induced by a repellent. However, whether symmetry breaking occurs under high temperature conditions, which are a common abiotic stress, remains unknown. In our study, we deposited a group of Polyrhachis dives ants on a heated platform and counted the number of escaping ants with two identical exits. We discovered that ants asymmetrically escaped through two exits when the temperature of the heated platform was >32.75°C. The degree of asymmetry increased linearly with the temperature of the platform. Furthermore, the higher the temperature of heated platform was, the more ants escaped from the heated platform. However, the number of escaping ants decreased for 3 min when the temperature was higher than the critical thermal limit (39.46°C, which is the threshold for ants to endure high temperature without a loss of performance. Moreover, the ants tended to form small groups to escape from the thermal stress. A preparatory formation of ant grouping was observed before they reached the exit, indicating that the ants actively clustered rather than accidentally gathered at the exits to escape. We suggest that a combination of individual and grouping ants may help to optimize the likelihood of survival during evacuation.

  6. Uni-directional trail sharing by two species of ants a Monte Carlo study

    International Nuclear Information System (INIS)

    Kunduraci, T; Kayacan, O


    We study insect traffic, specifically ant traffic on a uni-directional trail which is shared by two species of ants, one of which is ‘good’ at smelling and the other ‘poor’. The two distinct species of ants are placed mixed on the same trail and individuals of both are permitted to make a U-turn when they encounter another ant in front of them. The theoretical scheme for the ant traffic is based on an asymmetric simple exclusion model. The ant traffic on the uni-directional trail is studied as a function of the number of ‘good-smelling’ ants and the evaporation probability of pheromones by keeping the number of ‘poor-smelling ants’ constant during Monte Carlo simulations. (paper)

  7. Ant-mediated effects on spruce litter decomposition, solution chemistry, and microbial activity

    DEFF Research Database (Denmark)

    Stadler, B.; Schramm, Andreas; Kalbitz, K.


    the effects of ants and aphid honeydew on litter solution of Norway spruce, microbial enzyme activities, and needle decomposition in a field and greenhouse experiment during summer 2003. In the field, low ant densities had relatively little effects on litter solution 30 cm away from a tree trunk...... and %N were not affected by ants or honeydew. Our results suggest that ants have a distinct and immediate effect on solution composition and microbial activity in the litter layer indicating accelerated litter decay whereas the effect of honeydew was insignificant. Keywords: Ants; Decomposition; Formica......Forest management practices often generate clear-cut patches, which may be colonized by ants not present in the same densities in mature forests. In addition to the associated changes in abiotic conditions ants can initiate processes, which do not occur in old-growth stands. Here, we analyse...

  8. Absence of jamming in ant trails: feedback control of self-propulsion and noise. (United States)

    Chaudhuri, Debasish; Nagar, Apoorva


    We present a model of ant traffic considering individual ants as self-propelled particles undergoing single-file motion on a one-dimensional trail. Recent experiments on unidirectional ant traffic in well-formed natural trails showed that the collective velocity of ants remains approximately unchanged, leading to the absence of jamming even at very high densities [John et al., Phys. Rev. Lett. 102, 108001 (2009)]. Assuming a feedback control mechanism of self-propulsion force generated by each ant using information about the distance from the ant in front, our model captures all the main features observed in the experiment. The distance headway distribution shows a maximum corresponding to separations within clusters. The position of this maximum remains independent of average number density. We find a non-equilibrium first-order transition, with the formation of an infinite cluster at a threshold density where all the ants in the system suddenly become part of a single cluster.

  9. Temporal Variation in the Abundance and Richness of Foliage-Dwelling Ants Mediated by Extrafloral Nectar. (United States)

    Belchior, Ceres; Sendoya, Sebastián F; Del-Claro, Kleber


    Plants bearing extrafloral nectaries (EFNs) are common in the Brazilian cerrado savanna, where climatic conditions having marked seasonality influence arboreal ant fauna organization. These ant-plant interactions have rarely been studied at community level. Here, we tested whether: 1) EFN-bearing plants are more visited by ants than EFN-lacking plants; 2) ant visitation is higher in the rainy season than in dry season; 3) plants producing young leaves are more visited than those lacking young leaves in the rainy season; 4) during the dry season, plants with old leaves and flowers are more visited than plants with young leaves and bare of leaves or flowers; 5) the composition of visiting ant fauna differs between plants with and without EFNs. Field work was done in a cerrado reserve near Uberlândia, MG State, Brazil, along ten transects (total area 3,000 m2), in the rainy (October-January) and dry seasons (April-July) of 2010-2011. Plants (72 species; 762 individuals) were checked three times per season for ant presence. Results showed that 21 species (29%) and 266 individuals (35%) possessed EFNs. These plants attracted 38 ant species (36 in rainy, 26 in dry season). In the rainy season, plants with EFNs had higher ant abundance/richness than plants without EFNs, but in the dry season, EFN presence did not influence ant visitation. Plant phenology affected ant richness and abundance in different ways: plants with young leaves possessed higher ant richness in the rainy season, but in the dry season ant abundance was higher on plants possessing old leaves or flowers. The species composition of plant-associated ant communities, however, did not differ between plants with and without EFNs in either season. These findings suggest that the effect of EFN presence on a community of plant-visiting ants is context dependent, being conditioned to seasonal variation.

  10. Species diversity and distribution patterns of the ants of Amazonian Ecuador.

    Directory of Open Access Journals (Sweden)

    Kari T Ryder Wilkie


    Full Text Available Ants are among the most diverse, abundant and ecologically significant organisms on earth. Although their species richness appears to be greatest in the New World tropics, global patterns of ant diversity and distribution are not well understood. We comprehensively surveyed ant diversity in a lowland primary rainforest in Western Amazonia, Ecuador using canopy fogging, pitfall traps, baits, hand collecting, mini-Winkler devices and subterranean probes to sample ants. A total of 489 ant species comprising 64 genera in nine subfamilies were identified from samples collected in only 0.16 square kilometers. The most species-rich genera were Camponotus, Pheidole, Pseudomyrmex, Pachycondyla, Brachymyrmex, and Crematogaster. Camponotus and Pseudomyrmex were most diverse in the canopy, while Pheidole was most diverse on the ground. The three most abundant ground-dwelling ant genera were Pheidole, Solenopsis and Pyramica. Crematogaster carinata was the most abundant ant species in the canopy; Wasmannia auropunctata was most abundant on the ground, and the army ant Labidus coecus was the most abundant subterranean species. Ant species composition among strata was significantly different: 80% of species were found in only one stratum, 17% in two strata, and 3% in all three strata. Elevation and the number of logs and twigs available as nest sites were significant predictors of ground-dwelling ant species richness. Canopy species richness was not correlated with any ecological variable measured. Subterranean species richness was negatively correlated with depth in the soil. When ant species were categorized using a functional group matrix based on diet, nest-site preference and foraging ecology, the greatest diversity was found in Omnivorous Canopy Nesters. Our study indicates ant species richness is exceptionally high at Tiputini. We project 647-736 ant species in this global hotspot of biodiversity. Considering the relatively small area surveyed, this

  11. Temporal Variation in the Abundance and Richness of Foliage-Dwelling Ants Mediated by Extrafloral Nectar.

    Directory of Open Access Journals (Sweden)

    Ceres Belchior

    Full Text Available Plants bearing extrafloral nectaries (EFNs are common in the Brazilian cerrado savanna, where climatic conditions having marked seasonality influence arboreal ant fauna organization. These ant-plant interactions have rarely been studied at community level. Here, we tested whether: 1 EFN-bearing plants are more visited by ants than EFN-lacking plants; 2 ant visitation is higher in the rainy season than in dry season; 3 plants producing young leaves are more visited than those lacking young leaves in the rainy season; 4 during the dry season, plants with old leaves and flowers are more visited than plants with young leaves and bare of leaves or flowers; 5 the composition of visiting ant fauna differs between plants with and without EFNs. Field work was done in a cerrado reserve near Uberlândia, MG State, Brazil, along ten transects (total area 3,000 m2, in the rainy (October-January and dry seasons (April-July of 2010-2011. Plants (72 species; 762 individuals were checked three times per season for ant presence. Results showed that 21 species (29% and 266 individuals (35% possessed EFNs. These plants attracted 38 ant species (36 in rainy, 26 in dry season. In the rainy season, plants with EFNs had higher ant abundance/richness than plants without EFNs, but in the dry season, EFN presence did not influence ant visitation. Plant phenology affected ant richness and abundance in different ways: plants with young leaves possessed higher ant richness in the rainy season, but in the dry season ant abundance was higher on plants possessing old leaves or flowers. The species composition of plant-associated ant communities, however, did not differ between plants with and without EFNs in either season. These findings suggest that the effect of EFN presence on a community of plant-visiting ants is context dependent, being conditioned to seasonal variation.

  12. Urban habitat complexity affects species richness but not environmental filtering of morphologically-diverse ants

    Directory of Open Access Journals (Sweden)

    Alessandro Ossola


    Full Text Available Habitat complexity is a major determinant of structure and diversity of ant assemblages. Following the size-grain hypothesis, smaller ant species are likely to be advantaged in more complex habitats compared to larger species. Habitat complexity can act as an environmental filter based on species size and morphological traits, therefore affecting the overall structure and diversity of ant assemblages. In natural and semi-natural ecosystems, habitat complexity is principally regulated by ecological successions or disturbance such as fire and grazing. Urban ecosystems provide an opportunity to test relationships between habitat, ant assemblage structure and ant traits using novel combinations of habitat complexity generated and sustained by human management. We sampled ant assemblages in low-complexity and high-complexity parks, and high-complexity woodland remnants, hypothesizing that (i ant abundance and species richness would be higher in high-complexity urban habitats, (ii ant assemblages would differ between low- and high-complexity habitats and (iii ants living in high-complexity habitats would be smaller than those living in low-complexity habitats. Contrary to our hypothesis, ant species richness was higher in low-complexity habitats compared to high-complexity habitats. Overall, ant assemblages were significantly different among the habitat complexity types investigated, although ant size and morphology remained the same. Habitat complexity appears to affect the structure of ant assemblages in urban ecosystems as previously observed in natural and semi-natural ecosystems. However, the habitat complexity filter does not seem to be linked to ant morphological traits related to body size.

  13. Urban habitat complexity affects species richness but not environmental filtering of morphologically-diverse ants (United States)

    Nash, Michael A.; Christie, Fiona J.; Hahs, Amy K.; Livesley, Stephen J.


    Habitat complexity is a major determinant of structure and diversity of ant assemblages. Following the size-grain hypothesis, smaller ant species are likely to be advantaged in more complex habitats compared to larger species. Habitat complexity can act as an environmental filter based on species size and morphological traits, therefore affecting the overall structure and diversity of ant assemblages. In natural and semi-natural ecosystems, habitat complexity is principally regulated by ecological successions or disturbance such as fire and grazing. Urban ecosystems provide an opportunity to test relationships between habitat, ant assemblage structure and ant traits using novel combinations of habitat complexity generated and sustained by human management. We sampled ant assemblages in low-complexity and high-complexity parks, and high-complexity woodland remnants, hypothesizing that (i) ant abundance and species richness would be higher in high-complexity urban habitats, (ii) ant assemblages would differ between low- and high-complexity habitats and (iii) ants living in high-complexity habitats would be smaller than those living in low-complexity habitats. Contrary to our hypothesis, ant species richness was higher in low-complexity habitats compared to high-complexity habitats. Overall, ant assemblages were significantly different among the habitat complexity types investigated, although ant size and morphology remained the same. Habitat complexity appears to affect the structure of ant assemblages in urban ecosystems as previously observed in natural and semi-natural ecosystems. However, the habitat complexity filter does not seem to be linked to ant morphological traits related to body size. PMID:26528416

  14. Ant-plant-homopteran mutualism: how the third partner affects the interaction between a plant-specialist ant and its myrmecophyte host (United States)

    Gaume, L.; McKey, D.; Terrin, S.


    By estimating relative costs and benefits, we explored the role of the homopteran partner in the protection mutualism between the myrmecophyte Leonardoxa africana T3, the ant Aphomomyrmex afer, and sap-sucking homopterans tended by ants in the tree's swollen hollow twigs. The ants obtain nest sites and food from their host-plant (food is obtained either directly by extrafloral nectar or indirectly via homopterans). Aphomomyrmex workers patrol the young leaves of L. africana T3 and protect them against phytophagous insects. Because ants tended, either solely or primarily, coccids in some trees and pseudococcids in others, we were able to study whether the nature of the interaction was dependent on the identity of the third partner. First, the type of homopteran affects the benefits to the tree of maintaining a large ant colony. Larger colony size (relative to tree size) confers greater protection against herbivory; this relationship is more pronounced for trees whose ants tend pseudococcids than for those in which ants tend coccids. Second, for trees (and associated ant colonies) of comparable size, homopteran biomass was much larger in trees harbouring coccids than in trees with pseudococcids. Thus, the cost to the tree of maintaining ants may be greater when ants are associated with coccids. The net benefits to the plant of maintaining ants appear to be much greater with pseudococcids as the third partner. To explore how the type of homopteran affects functioning of the system, we attempted to determine which of the resources (nest sites, extrafloral nectar, and homopterans) is likely to limit ant colony size. In trees where ants tended coccids, ant-colony biomass was strongly dependent on the number of extrafloral nectaries. In contrast, in trees whose ants tended only pseudococcids, colony biomass was not related to the number of nectaries and was most strongly determined by the volume of available nest sites. We present hypotheses to explain how the type of

  15. Arboreal ant colonies as 'hot-points' of cryptic diversity for myrmecophiles: the weaver ant Camponotus sp. aff. textor and its interaction network with its associates.

    Directory of Open Access Journals (Sweden)

    Gabriela Pérez-Lachaud

    Full Text Available INTRODUCTION: Systematic surveys of macrofaunal diversity within ant colonies are lacking, particularly for ants nesting in microhabitats that are difficult to sample. Species associated with ants are generally small and rarely collected organisms, which makes them more likely to be unnoticed. We assumed that this tendency is greater for arthropod communities in microhabitats with low accessibility, such as those found in the nests of arboreal ants that may constitute a source of cryptic biodiversity. MATERIALS AND METHODS: We investigated the invertebrate diversity associated with an undescribed, but already threatened, Neotropical Camponotus weaver ant. As most of the common sampling methods used in studies of ant diversity are not suited for evaluating myrmecophile diversity within ant nests, we evaluated the macrofauna within ant nests through exhaustive colony sampling of three nests and examination of more than 80,000 individuals. RESULTS: We identified invertebrates from three classes belonging to 18 taxa, some of which were new to science, and recorded the first instance of the co-occurrence of two brood parasitoid wasp families attacking the same ant host colony. This diversity of ant associates corresponded to a highly complex interaction network. Agonistic interactions prevailed, but the prevalence of myrmecophiles was remarkably low. CONCLUSIONS: Our data support the hypothesis of the evolution of low virulence in a variety of symbionts associated with large insect societies. Because most myrmecophiles found in this work are rare, strictly specific, and exhibit highly specialized biology, the risk of extinction for these hitherto unknown invertebrates and their natural enemies is high. The cryptic, far unappreciated diversity within arboreal ant nests in areas at high risk of habitat loss qualifies these nests as 'hot-points' of biodiversity that urgently require special attention as a component of conservation and management

  16. Arboreal ant colonies as 'hot-points' of cryptic diversity for myrmecophiles: the weaver ant Camponotus sp. aff. textor and its interaction network with its associates. (United States)

    Pérez-Lachaud, Gabriela; Lachaud, Jean-Paul


    Systematic surveys of macrofaunal diversity within ant colonies are lacking, particularly for ants nesting in microhabitats that are difficult to sample. Species associated with ants are generally small and rarely collected organisms, which makes them more likely to be unnoticed. We assumed that this tendency is greater for arthropod communities in microhabitats with low accessibility, such as those found in the nests of arboreal ants that may constitute a source of cryptic biodiversity. We investigated the invertebrate diversity associated with an undescribed, but already threatened, Neotropical Camponotus weaver ant. As most of the common sampling methods used in studies of ant diversity are not suited for evaluating myrmecophile diversity within ant nests, we evaluated the macrofauna within ant nests through exhaustive colony sampling of three nests and examination of more than 80,000 individuals. We identified invertebrates from three classes belonging to 18 taxa, some of which were new to science, and recorded the first instance of the co-occurrence of two brood parasitoid wasp families attacking the same ant host colony. This diversity of ant associates corresponded to a highly complex interaction network. Agonistic interactions prevailed, but the prevalence of myrmecophiles was remarkably low. Our data support the hypothesis of the evolution of low virulence in a variety of symbionts associated with large insect societies. Because most myrmecophiles found in this work are rare, strictly specific, and exhibit highly specialized biology, the risk of extinction for these hitherto unknown invertebrates and their natural enemies is high. The cryptic, far unappreciated diversity within arboreal ant nests in areas at high risk of habitat loss qualifies these nests as 'hot-points' of biodiversity that urgently require special attention as a component of conservation and management programs.

  17. Arboreal Ant Colonies as ‘Hot-Points’ of Cryptic Diversity for Myrmecophiles: The Weaver Ant Camponotus sp. aff. textor and Its Interaction Network with Its Associates (United States)

    Pérez-Lachaud, Gabriela; Lachaud, Jean-Paul


    Introduction Systematic surveys of macrofaunal diversity within ant colonies are lacking, particularly for ants nesting in microhabitats that are difficult to sample. Species associated with ants are generally small and rarely collected organisms, which makes them more likely to be unnoticed. We assumed that this tendency is greater for arthropod communities in microhabitats with low accessibility, such as those found in the nests of arboreal ants that may constitute a source of cryptic biodiversity. Materials and Methods We investigated the invertebrate diversity associated with an undescribed, but already threatened, Neotropical Camponotus weaver ant. As most of the common sampling methods used in studies of ant diversity are not suited for evaluating myrmecophile diversity within ant nests, we evaluated the macrofauna within ant nests through exhaustive colony sampling of three nests and examination of more than 80,000 individuals. Results We identified invertebrates from three classes belonging to 18 taxa, some of which were new to science, and recorded the first instance of the co-occurrence of two brood parasitoid wasp families attacking the same ant host colony. This diversity of ant associates corresponded to a highly complex interaction network. Agonistic interactions prevailed, but the prevalence of myrmecophiles was remarkably low. Conclusions Our data support the hypothesis of the evolution of low virulence in a variety of symbionts associated with large insect societies. Because most myrmecophiles found in this work are rare, strictly specific, and exhibit highly specialized biology, the risk of extinction for these hitherto unknown invertebrates and their natural enemies is high. The cryptic, far unappreciated diversity within arboreal ant nests in areas at high risk of habitat loss qualifies these nests as ‘hot-points’ of biodiversity that urgently require special attention as a component of conservation and management programs. PMID:24941047

  18. Phengaris (Maculinea) teleius butterflies select host plants close to Myrmica ants for oviposition, but P. nausithous do not

    NARCIS (Netherlands)

    Wynhoff, Irma; Langevelde, van Frank


    Many lycaenid butterfly species have interactions with ants, with 12% obligatorily depending on two sequential sources of larval food, namely host plants and host ants. When host plants are abundant but the density of host ant nests is relatively low, most host plants have no host ant nest in their

  19. Actitudes europeos ante el envejecimiento y los personas mayores

    Directory of Open Access Journals (Sweden)



    Full Text Available n este artículo se realiza un análisis comparativo de las actitudes ante el envejecimiento y las personas mayores en los doce estados miembros de la unión europea. Está basado en datos originales de encuesta y se centra en la relación entre las personas mayores y los jovenes, la jubilación y las pensiones, los trabajadores de edad y el empleo, la atención social a las personas mayores y la política de la vejez. Por lo tanto, el artículo intenta proporcionar un resumen de las principales dimensiones de las actitudes publicas ante el envejecimiento en la union europea.

  20. Multi-objective ant algorithm for wireless sensor network positioning

    International Nuclear Information System (INIS)

    Fidanova, S.; Shindarov, M.; Marinov, P.


    It is impossible to imagine our modern life without telecommunications. Wireless networks are a part of telecommunications. Wireless sensor networks (WSN) consist of spatially distributed sensors, which communicate in wireless way. This network monitors physical or environmental conditions. The objective is the full coverage of the monitoring region and less energy consumption of the network. The most appropriate approach to solve the problem is metaheuristics. In this paper the full coverage of the area is treated as a constrain. The objectives which are optimized are a minimal number of sensors and energy (lifetime) of the network. We apply multi-objective Ant Colony Optimization to solve this important telecommunication problem. We chose MAX-MIN Ant System approach, because it is proven to converge to the global optima

  1. Sexual Cooperation: Mating Increases Longevity in Ant Queens

    DEFF Research Database (Denmark)

    Schrempf, Alexandra; Heinze, Jürgen; Cremer, Sylvia


    Divergent reproductive interests of males and females often cause sexual conflict [1] and [2] . Males of many species manipulate females by transferring seminal fluids that boost female short-term fecundity while decreasing their life expectancy and future reproductivity [3] and [4] . The life...... history of ants, however, is expected to reduce sexual conflict; whereas most insect females show repeated phases of mating and reproduction, ant queens mate only during a short period early in life and undergo a lifelong commitment to their mates by storing sperm [5] . Furthermore, sexual offspring can...... sterilized male lived considerably longer and started laying eggs earlier than virgin queens. Only queens that received viable sperm from fertile males showed increased fecundity. The lack of a trade-off between fecundity and longevity is unexpected, given evolutionary theories of aging [6] . Our data...

  2. The Müller-Lyer illusion in ant foraging.

    Directory of Open Access Journals (Sweden)

    Tomoko Sakiyama

    Full Text Available The Müller-Lyer illusion is a classical geometric illusion in which the apparent (perceived length of a line depends on whether the line terminates in an arrow tail or arrowhead. This effect may be caused by economic compensation for the gap between the physical stimulus and visual fields. Here, we show that the Müller-Lyer illusion can also be produced by the foraging patterns of garden ants (Lasius niger and that the pattern obtained can be explained by a simple, asynchronously updated foraging ant model. Our results suggest that the geometric illusion may be a byproduct of the foraging process, in which local interactions underlying efficient exploitation can also give rise to global exploration, and that visual information processing in human could implement similar modulation between local efficient processing and widespread computation.

  3. Evolutionarily advanced ant farmers rear polyploid fungal crops

    DEFF Research Database (Denmark)

    Kooij, Pepijn Wilhelmus; Aanen, D.K.; Schiøtt, Morten


    to be lowly and facultatively polyploid (just over two haplotypes on average), whereas Atta and Acromyrmex symbionts are highly and obligatorily polyploid (ca. 5-7 haplotypes on average). This stepwise transition appears analogous to ploidy variation in plants and fungi domesticated by humans and in fungi...... the number of nuclei per fungal cell for 42 symbionts reared by 14 species of Panamanian fungus-growing ants. This showed that domesticated symbionts of higher attine ants are polykaryotic with 7-17 nuclei per cell, whereas nonspecialized crops of lower attines are dikaryotic similar to most free...... domesticated by termites and plants, where gene or genome duplications were typically associated with selection for higher productivity, but allopolyploid chimerism was incompatible with sexual reproduction....

  4. Study on bi-directional pedestrian movement using ant algorithms

    International Nuclear Information System (INIS)

    Gokce, Sibel; Kayacan, Ozhan


    A cellular automata model is proposed to simulate bi-directional pedestrian flow. Pedestrian movement is investigated by using ant algorithms. Ants communicate with each other by dropping a chemical, called a pheromone, on the substrate while crawling forward. Similarly, it is considered that oppositely moving pedestrians drop ‘visual pheromones’ on their way and the visual pheromones might cause attractive or repulsive interactions. This pheromenon is introduced into modelling the pedestrians’ walking preference. In this way, the decision-making process of pedestrians will be based on ‘the instinct of following’. At some densities, the relationships of velocity–density and flux–density are analyzed for different evaporation rates of visual pheromones. Lane formation and phase transition are observed for certain evaporation rates of visual pheromones. (paper)

  5. Response Ant Colony Optimization of End Milling Surface Roughness

    Directory of Open Access Journals (Sweden)

    Ahmed N. Abd Alla


    Full Text Available Metal cutting processes are important due to increased consumer demands for quality metal cutting related products (more precise tolerances and better product surface roughness that has driven the metal cutting industry to continuously improve quality control of metal cutting processes. This paper presents optimum surface roughness by using milling mould aluminium alloys (AA6061-T6 with Response Ant Colony Optimization (RACO. The approach is based on Response Surface Method (RSM and Ant Colony Optimization (ACO. The main objectives to find the optimized parameters and the most dominant variables (cutting speed, feedrate, axial depth and radial depth. The first order model indicates that the feedrate is the most significant factor affecting surface roughness.

  6. How many gamergates is an ant queen worth? (United States)

    Monnin, Thibaud; Peeters, Christian


    Ant reproductives exhibit different morphological adaptations linked to dispersal and fertility. By reviewing the literature on taxa where workers can reproduce sexually (i.e. become gamergates) we show that (1) species with a single gamergate generally have lost the winged queen caste, whereas only half of the species with several gamergates have, and (2) single-gamergate species have smaller colonies than multiple-gamergate species. Comparison with “classical” ants without gamergates, where having one vs having several winged queens are two distinct syndromes, suggests that having one vs having several gamergates are not. Gamergate number does not affect the success of colony fission, but retention of the queen caste permits the option of independent foundation.

  7. ANTS/PAM: Future Exploration of the Asteroid Belt (United States)

    Clark, P. E.; Curtis, S. A.; Rilee, M. L.; Cheung, C. Y.


    The Autonomous Nano-Technology Swarm (ANTS) is applied to the Prospecting Asteroid Mission (PAM) concept, as part of a NASA RASC study. The ANTS architecture is inspired by success of social insect colonies, based on the division of labor within the colonies: 1) within their specialties, individual specialists generally outperform general-ists, and 2) with sufficiently efficient social interaction and coordination, the group of specialists generally outper-forms the group of generalists. ANTS as applied to PAM involves a thousand individual specialist `sciencecraft', one subswarm per target, in an environment where detection and tracking of irregular, infrequent targets is a major chal-lenge. Workers, carry and operate eight to nine different scientific instruments, including spectrometers, ranging and radio science devices, imagers. The remaining specialists, Messenger/Rulers, provide communication and coordina-tion. The non-expendable propulsion system is based on autonomously deployable and configurable solar sails, a system suitable to a low gravity environment. The design of the neural basis function requires a minimum of 4 or 5 specialists for collective decision making. Allowing for ten instrument specialist teams and compensating for antici-pated high attrition, we calculate an initial minimum of 100 per subswarm should allow characterization of hundreds of asteroids. The difficulty in observing irregular, rapidly moving, poorly illuminated objects is largely overcome by the ANT sciencecraft capability to optimize conditions for each instrument. Components are composed of carbon nanotubules reversibly deployable from NEMS nodes, allowing 100 times decrease in packaging volume. 1000 smart 10 centimeter, 1 kg cubic boxes create a 1000 kg 1 meter cube.

  8. A new carpenter ant, Camponotus parabarbatus (Hymenoptera: Formicidae from India

    Directory of Open Access Journals (Sweden)

    Himender Bharti


    Full Text Available A new species of carpenter ant, collected in the Shivalik range of Himalaya is described and illustrated based on the worker and gyne castes under the name Camponotus parabarbatus sp. n. Presence of dense, short setae on gena and ventral surface of head resembles it most to Camponotus barbatus Roger, 1863 distributed in Southeast Asia. A regional identification key of Camponotus species is provided from the Shivalik hills of Indian Himalaya.

  9. Subterranean ant nests: Trace fossils past and future?


    Tschinkel, Walter R.


    Many species of ants excavate complex, species-typical nests in soil. The basic structural units of many nests are descending tunnels connecting flattened, generally horizontal chambers of oval to lobed outline. The species-typical structure of many nests results from variation in the size, shape, number and arrangement of these basic elements. Nest architecture can be rendered by filling subterranean nests with a thin slurry of orthodontal plaster, then excavating and reconstructing the hard...

  10. António Reis and Margarida Cordeiro, eccentric filmmakers

    Directory of Open Access Journals (Sweden)

    Lucas Tavares Neves


    Full Text Available The international symposium "António Reis and Margarida Cordeiro, eccentric filmmakers" took place in Paris between the 3rd and the 4th of June, 2015. Speakers exchanged on the political, social and poetical aspects of the duo's cinematography, as well as on the reverberations of titles such as Jaime (1974 and Trás-os-montes (1976 on the Portuguese filmic landscape of the decades that followed.

  11. How lost "passenger" ants find their way home. (United States)

    Srinivasan, Mandyam V


    Animal navigation has fascinated biologists and engineers for centuries, and some of the most illuminating discoveries have come from the study of creatures with a brain no larger than a sesame seed. In an elegant recent study, Pfeiffer and Wittlinger (Science, 353, 1155-1157, 2016) have shown the means by which desert ants, carried from one nest to another by a relative, find their own way back home if they are accidentally dropped en route.

  12. Timing of dispersal: effect of ants on aphids

    Czech Academy of Sciences Publication Activity Database

    Kindlmann, Pavel; Hullé, M.; Stadler, B.


    Roč. 152, č. 4 (2007), s. 625-631 ISSN 0029-8549 R&D Projects: GA AV ČR IAA6087301; GA MŠk LC06073; GA ČR(CZ) GEDIV/06/E013 Grant - others:-(DE) BMBF No. PT BEO 51-0339476D Institutional research plan: CEZ:AV0Z60870520 Keywords : Ant attendance * Dispersal * Mutualistic systems * Suction traps Subject RIV: EH - Ecology, Behaviour Impact factor: 2.973, year: 2007

  13. Competition can lead to unexpected patterns in tropical ant communities

    Czech Academy of Sciences Publication Activity Database

    Ellwood, M. D. F.; Blüthgen, N.; Fayle, Tom Maurice; Foster, W. A.; Menzel, F.


    Roč. 75, AUG 01 (2016), s. 24-34 ISSN 1146-609X R&D Projects: GA ČR GA14-32302S; GA ČR(CZ) GA16-09427S Institutional support: RVO:60077344 Keywords : ant mosaics * assembly rules * competitive exclusion Subject RIV: EH - Ecology, Behaviour Impact factor: 1.652, year: 2016

  14. Egg-Laying Butterflies Distinguish Predaceous Ants by Sight


    Sendoya, SF; Freitas, AVL; Oliveira, PS


    Information about predation risks is critical for herbivorous insects, and natural selection favors their ability to detect predators before oviposition and to select enemy-free foliage when offspring mortality risk is high. Food plants are selected by ovipositing butterflies, and offspring survival frequently varies among plants because of variation in the presence of predators. Eunica bechina butterflies oviposit on Caryocar brasiliense, an ant-defended plant. Experiments with dried Campono...

  15. Estimating the Ex Ante Expected Returns to College


    Andrew J. Hussey; Omari H. Swinton


    Rather than estimating the returns to obtaining a college degree, this paper treats the college education decision as an uncertain investment involving varying likelihoods of successful graduation. We predict earnings conditional on both graduating and not graduating from both selective and non-selective institutions, and incorporate estimated individual-specific graduation rates in calculating the ex ante expected returns from college attendance for individuals across the ability distributio...

  16. Nest etiquette--where ants go when nature calls.

    Directory of Open Access Journals (Sweden)

    Tomer J Czaczkes

    Full Text Available Sanitary behaviour is an important, but seldom studied, aspect of social living. Social insects have developed several strategies for dealing with waste and faecal matter, including dumping waste outside the nest and forming specialised waste-storage chambers. In some cases waste material and faeces are put to use, either as a construction material or as a long-lasting signal, suggesting that faeces and waste may not always be dangerous. Here we examine a previously undescribed behaviour in ants - the formation of well-defined faecal patches. Lasius niger ants were housed in plaster nests and provided with coloured sucrose solution. After two months, 1-4 well defined dark patches, the colour of the sucrose solution, formed within each of the plaster nests. These patches never contained other waste material such as uneaten food items, or nestmate corpses. Such waste was collected in waste piles outside the nest. The coloured patches were thus distinct from previously described 'kitchen middens' in ants, and are best described as 'toilets'. Why faeces is not removed with other waste materials is unclear. The presence of the toilets inside the nest suggests that they may not be an important source of pathogens, and may have a beneficial role.

  17. Ants sow the seeds of global diversification in flowering plants. (United States)

    Lengyel, Szabolcs; Gove, Aaron D; Latimer, Andrew M; Majer, Jonathan D; Dunn, Robert R


    The extraordinary diversification of angiosperm plants in the Cretaceous and Tertiary periods has produced an estimated 250,000-300,000 living angiosperm species and has fundamentally altered terrestrial ecosystems. Interactions with animals as pollinators or seed dispersers have long been suspected as drivers of angiosperm diversification, yet empirical examples remain sparse or inconclusive. Seed dispersal by ants (myrmecochory) may drive diversification as it can reduce extinction by providing selective advantages to plants and can increase speciation by enhancing geographical isolation by extremely limited dispersal distances. Using the most comprehensive sister-group comparison to date, we tested the hypothesis that myrmecochory leads to higher diversification rates in angiosperm plants. As predicted, diversification rates were substantially higher in ant-dispersed plants than in their non-myrmecochorous relatives. Data from 101 angiosperm lineages in 241 genera from all continents except Antarctica revealed that ant-dispersed lineages contained on average more than twice as many species as did their non-myrmecochorous sister groups. Contrasts in species diversity between sister groups demonstrated that diversification rates did not depend on seed dispersal mode in the sister group and were higher in myrmecochorous lineages in most biogeographic regions. Myrmecochory, which has evolved independently at least 100 times in angiosperms and is estimated to be present in at least 77 families and 11 000 species, is a key evolutionary innovation and a globally important driver of plant diversity. Myrmecochory provides the best example to date for a consistent effect of any mutualism on large-scale diversification.

  18. Foraging strategies of the ant Ectatomma vizottoi (Hymenoptera, Formicidae

    Directory of Open Access Journals (Sweden)

    Luan D. Lima


    Full Text Available Foraging strategies of the ant Ectatomma vizottoi (Hymenoptera, Formicidae. Foraging activity may be limited by temperature, humidity, radiation, wind, and other abiotic factors, all of which can affect energy costs during foraging. Ectatomma vizottoi's biology has only recently been studied, and no detailed information is available on its foraging patterns or diet in the field. For this reason, and because foraging activity is an important part of the ecological success of social insects, the present study aimed to investigate E. vizottoi's foraging strategies and dietary habits. First, we determined how abiotic factors constrained E. vizottoi's foraging patterns in the field by monitoring the foraging activity of 16 colonies on eight different days across two seasons. Second, we characterized E. vizottoi's diet by monitoring another set of 26 colonies during peak foraging activity. Our results show that E. vizottoi has foraging strategies that are similar to those of congeneric species. In spite of having a low efficiency index, colonies adopted strategies that allowed them to successfully obtain food resources while avoiding adverse conditions. These strategies included preying on other ant species, a foraging tactic that could arise if a wide variety of food items are not available in the environment or if E. vizottoi simply prefers, regardless of resource availability, to prey on other invertebrates and especially on other ant species.

  19. Nutritional composition of Polyrhachis vicina Roger (Edible Chinese black ant

    Directory of Open Access Journals (Sweden)

    Yucui Ren


    Full Text Available Edible black ant (Polyrhachis vicina Roger is a traditional edible insect species in China. It has been used as a functional ingredient in various tonics or health foods. This study determined the nutritional composition of the black ant, which included minerals, amino acids, superoxide dismutase (SOD, Vitamin E, and total acid. Supercritical CO2 fluid extraction was used to extract the organic compounds. The compounds were identified and quantified by GC-MS. Results showed that the ant powder contained 77000 IU/100g of SOD, 56.6g/100g protein, 9.0g/100g fat, 13.2g/100g volatile oil, 6.0g/100g moisture, 1.6g/100g total acid and 6.3g/100g ash. There were 18 amino acids, of which, glutamic acid, glycine, aspartic acid, alanine, leucine, proline and tyrosine were predominant. Among the 16 minerals, K, Ca, P, Mg, Fe, Mn and Zn were predominant. More than 20 organic components were identified, the main ones were 9-octadecenoic acid, ethyl oleate, cholesterol and n-hexadecanoic acid. Six of the compounds found, i.e. hexadecanoic acid, ethyl ester, linoleic acid, ethyl oleate, oleic acid and cholesta-3, 5-diene, have not been reported previously. The results indicate that P. vicina Roger is rich in nutrients and is a potential ingredient for health food.

  20. Solenopsis ant magnetic material: statistical and seasonal studies

    International Nuclear Information System (INIS)

    Abraçado, Leida G; Esquivel, Darci M S; Wajnberg, Eliane


    In this paper, we quantify the magnetic material amount in Solenopsis ants using ferromagnetic resonance (FMR) at room temperature. We sampled S. interrupta workers from several morphologically indistinguishable castes. Twenty-five oriented samples of each body part of S. interrupta (20 units each) showed that FMR line shapes are reproducible. The relative magnetic material amount was 31 ± 12% (mean ± SD) in the antennae, 27 ± 13% in the head, 21 ± 12% in the thorax and 20 ± 10% in the abdomen. In order to measure variation in the magnetic material from late summer to early winter, ants were collected each month between March and July. The amount of magnetic material was greatest in all four body parts in March and least in all four body parts in June. In addition, S. richteri majors presented more magnetic material than minor workers. Extending these findings to the genera Solenopsis, the reduction in magnetic material found in winter could be explained by our sampling fewer foraging major ants

  1. Ants visiting inflorescences of Actinocephalus polyanthus (Bong. Sano (Eriocaulaceae

    Directory of Open Access Journals (Sweden)

    Tânia Tarabini Castellani


    Full Text Available Plants from the family Eriocaulaceae have a secretion of nectar in floral structures which promotes insect visitation, including ants. This study evaluated the ant species visiting inflorescences of Actinocephalus polyanthus in coastal dunes in southern Brazil and it checked whether the richness and composition of the visiting assemblies differed between the female and male flowering phenophases, due to the greater supply of resources by male flowers. Comments on the resources used and the visiting behavior were also investigated. We found 15 ant species, belonging to 8 genera and 4 subfamilies. There was no difference with regard to richness and diversity of visiting species associated to the male or female flowering phenophase. However, there was a difference with regard to the similarity of these assemblies, due to the higher occurrence of Camponotus fastigatus in the female flowering. Most species registered belong to genera which, typically, use floral and extrafloral nectar as food resource or they are generalist. Brachymyrmex sp.1, Camponotus fastigatus, and Dorymyrmex sp. were observed with pollen stuck to their body, something which suggests a potential transportation of this pollen between flowers.

  2. Rationality in collective decision-making by ant colonies. (United States)

    Edwards, Susan C; Pratt, Stephen C


    Economic models of animal behaviour assume that decision-makers are rational, meaning that they assess options according to intrinsic fitness value and not by comparison with available alternatives. This expectation is frequently violated, but the significance of irrational behaviour remains controversial. One possibility is that irrationality arises from cognitive constraints that necessitate short cuts like comparative evaluation. If so, the study of whether and when irrationality occurs can illuminate cognitive mechanisms. We applied this logic in a novel setting: the collective decisions of insect societies. We tested for irrationality in colonies of Temnothorax ants choosing between two nest sites that varied in multiple attributes, such that neither site was clearly superior. In similar situations, individual animals show irrational changes in preference when a third relatively unattractive option is introduced. In contrast, we found no such effect in colonies. We suggest that immunity to irrationality in this case may result from the ants' decentralized decision mechanism. A colony's choice does not depend on site comparison by individuals, but instead self-organizes from the interactions of multiple ants, most of which are aware of only a single site. This strategy may filter out comparative effects, preventing systematic errors that would otherwise arise from the cognitive limitations of individuals.

  3. A seismic fault recognition method based on ant colony optimization (United States)

    Chen, Lei; Xiao, Chuangbai; Li, Xueliang; Wang, Zhenli; Huo, Shoudong


    Fault recognition is an important section in seismic interpretation and there are many methods for this technology, but no one can recognize fault exactly enough. For this problem, we proposed a new fault recognition method based on ant colony optimization which can locate fault precisely and extract fault from the seismic section. Firstly, seismic horizons are extracted by the connected component labeling algorithm; secondly, the fault location are decided according to the horizontal endpoints of each horizon; thirdly, the whole seismic section is divided into several rectangular blocks and the top and bottom endpoints of each rectangular block are considered as the nest and food respectively for the ant colony optimization algorithm. Besides that, the positive section is taken as an actual three dimensional terrain by using the seismic amplitude as a height. After that, the optimal route from nest to food calculated by the ant colony in each block is judged as a fault. Finally, extensive comparative tests were performed on the real seismic data. Availability and advancement of the proposed method were validated by the experimental results.

  4. Bioturbation by the Fungus-Gardening Ant, Trachymyrmex septentrionalis.

    Directory of Open Access Journals (Sweden)

    Walter R Tschinkel

    Full Text Available Soil invertebrates such as ants are thought to be important manipulators of soils in temperate and tropical ecosystems. The fungus gardening ant, Trachymyrmex septentrionalis, is an important agent of biomantling, that is, of depositing soil excavated from below onto the surface, and has been suggested as an agent of bioturbation (moving soil below ground as well. The amount of bioturbation by this ant was quantified by planting queenright colonies in sand columns consisting of 5 layers of different colored sand. The amount of each color of sand deposited on the surface was determined from April to November 2015. In November, colonies were excavated and the color and amount of sand deposited below ground (mostly as backfill in chambers was determined. Extrapolated to one ha, T. septentrionalis deposited 800 kg of sand per annum on the surface, and an additional 200 kg (17% of the total excavated below ground. On average, this mixes 1.3% of the sand from other layers within the top meter of soil per millennium, but this mixing is unlikely to be homogeneous, and probably occurs as "hotspots" in both horizontal and vertical space. Such mixing is discussed as a challenge to sediment dating by optically stimulated luminescence (OSL.

  5. Emergent oscillations assist obstacle negotiation during ant cooperative transport (United States)

    Gelblum, Aviram; Pinkoviezky, Itai; Fonio, Ehud; Gov, Nir S.; Feinerman, Ofer


    Collective motion by animal groups is affected by internal interactions, external constraints, and the influx of information. A quantitative understanding of how these different factors give rise to different modes of collective motion is, at present, lacking. Here, we study how ants that cooperatively transport a large food item react to an obstacle blocking their path. Combining experiments with a statistical physics model of mechanically coupled active agents, we show that the constraint induces a deterministic collective oscillatory mode that facilitates obstacle circumvention. We provide direct experimental evidence, backed by theory, that this motion is an emergent group effect that does not require any behavioral changes at the individual level. We trace these relaxation oscillations to the interplay between two forces; informed ants pull the load toward the nest whereas uninformed ants contribute to the motion’s persistence along the tangential direction. The model’s predictions that oscillations appear above a critical system size, that the group can spontaneously transition into its ordered phase, and that the system can exhibit complete rotations are all verified experimentally. We expect that similar oscillatory modes emerge in collective motion scenarios where the structure of the environment imposes conflicts between individually held information and the group’s tendency for cohesiveness. PMID:27930304

  6. Ant brood function as life preservers during floods.

    Directory of Open Access Journals (Sweden)

    Jessica Purcell

    Full Text Available Social organisms can surmount many ecological challenges by working collectively. An impressive example of such collective behavior occurs when ants physically link together into floating 'rafts' to escape from flooded habitat. However, raft formation may represent a social dilemma, with some positions posing greater individual risks than others. Here, we investigate the position and function of different colony members, and the costs and benefits of this functional geometry in rafts of the floodplain-dwelling ant Formica selysi. By causing groups of ants to raft in the laboratory, we observe that workers are distributed throughout the raft, queens are always in the center, and 100% of brood items are placed on the base. Through a series of experiments, we show that workers and brood are extremely resistant to submersion. Both workers and brood exhibit high survival rates after they have rafted, suggesting that occupying the base of the raft is not as costly as expected. The placement of all brood on the base of one cohesive raft confers several benefits: it preserves colony integrity, takes advantage of brood buoyancy, and increases the proportion of workers that immediately recover after rafting.

  7. Improved Ant Colony Optimization for Seafood Product Delivery Routing Problem

    Directory of Open Access Journals (Sweden)

    Baozhen Yao


    Full Text Available This paper deals with a real-life vehicle delivery routing problem, which is a seafood product delivery routing problem. Considering the features of the seafood product delivery routing problem, this paper formulated this problem as a multi-depot open vehicle routing problem. Since the multi-depot open vehicle routing problem is a very complex problem, a method is used to reduce the complexity of the problem by changing the multi-depot open vehicle routing problem into an open vehicle routing problem with a dummy central depot in this paper. Then, ant colony optimization is used to solve the problem. To improve the performance of the algorithm, crossover operation and some adaptive strategies are used. Finally, the computational results for the benchmark problems of the multi-depot vehicle routing problem indicate that the proposed ant colony optimization is an effective method to solve the multi-depot vehicle routing problem. Furthermore, the computation results of the seafood product delivery problem from Dalian, China also suggest that the proposed ant colony optimization is feasible to solve the seafood product delivery routing problem.

  8. Effect of irradiation on queen survivorship and reproduction in the invasive fire ant Solenopsis invicta,(Hymenoptera: Formicidae) and a generic phytosanitary irradiation treatment for ants (United States)

    Ants are common hitchhiker pests on traded agricultural commodities that could be controlled by postharvest irradiation treatment. We studied radiation tolerance in queens of the red imported fire ant Solenopsis invicta Buren to determine the dose sufficient for its control. Virgin or fertile queens...

  9. The effects of ant nests on soil fertility and plant performance: a meta-analysis. (United States)

    Farji-Brener, Alejandro G; Werenkraut, Victoria


    Ants are recognized as one of the major sources of soil disturbance world-wide. However, this view is largely based on isolated studies and qualitative reviews. Here, for the first time, we quantitatively determined whether ant nests affect soil fertility and plant performance, and identified the possible sources of variation of these effects. Using Bayesian mixed-models meta-analysis, we tested the hypotheses that ant effects on soil fertility and plant performance depend on the substrate sampled, ant feeding type, latitude, habitat and the plant response variable measured. Ant nests showed higher nutrient and cation content than adjacent non-nest soil samples, but similar pH. Nutrient content was higher in ant refuse materials than in nest soils. The fertilizer effect of ant nests was also higher in dry habitats than in grasslands or savannas. Cation content was higher in nests of plant-feeding ants than in nests of omnivorous species, and lower in nests from agro-ecosystems than in nests from any other habitat. Plants showed higher green/root biomass and fitness on ant nests soils than in adjacent, non-nest sites; but plant density and diversity were unaffected by the presence of ant nests. Root growth was particularly higher in refuse materials than in ant nest soils, in leaf-cutting ant nests and in deserts habitats. Our results confirm the major role of ant nests in influencing soil fertility and vegetation patterns and provide information about the factors that mediate these effects. First, ant nests improve soil fertility mainly through the accumulation of refuse materials. Thus, different refuse dump locations (external or in underground nest chambers) could benefit different vegetation life-forms. Second, ant nests could increase plant diversity at larger spatial scales only if the identity of favoured plants changes along environmental gradients (i.e. enhancing β-diversity). Third, ant species that feed on plants play a relevant role fertilizing soils

  10. Red imported fire ant impacts on upland arthropods in Southern Mississippi (United States)

    Epperson, D.M.; Allen, Craig R.


    Red imported fire ants (Solenopsis invicta) have negative impacts on a broad array of invertebrate species. We investigated the impacts of fire ants on the upland arthropod community on 20???40 ha study sites in southern Mississippi. Study sites were sampled from 19972000 before, during, and after fire ant bait treatments to reduce fire ant populations. Fire ant abundance was assessed with bait transects on all sites, and fire ant population indices were estimated on a subset of study sites. Species richness and diversity of other ant species was also assessed from bait transects. Insect biomass and diversity was determined from light trap samples. Following treatments, fire ant abundance and population indices were significantly reduced, and ant species diversity and richness were greater on treated sites. Arthropod biomass, species diversity and species richness estimated from light trap samples were negatively correlated with fire ant abundance, but there were no observable treatment effects. Solenopsis invicta has the potential to negatively impact native arthropod communities resulting in a potential loss of both species and function.

  11. Diversity of Species and Behavior of Hymenopteran Parasitoids of Ants: A Review

    Directory of Open Access Journals (Sweden)

    Jean-Paul Lachaud


    Full Text Available Reports of hymenopterans associated with ants involve more than 500 species, but only a fraction unambiguously pertain to actual parasitoids. In this paper, we attempt to provide an overview of both the diversity of these parasitoid wasps and the diversity of the types of interactions they have formed with their ant hosts. The reliable list of parasitoid wasps using ants as primary hosts includes at least 138 species, reported between 1852 and 2011, distributed among 9 families from 3 superfamilies. These parasitoids exhibit a wide array of biologies and developmental strategies: ecto- or endoparasitism, solitary or gregarious, and idio- or koinobiosis. All castes of ants and all developmental stages, excepting eggs, are possible targets. Some species parasitize adult worker ants while foraging or performing other activities outside the nest; however, in most cases, parasitoids attack ant larvae either inside or outside their nests. Based on their abundance and success in attacking ants, some parasitoid wasps like diapriids and eucharitids seem excellent potential models to explore how parasitoids impact ant colony demography, population biology, and ant community structure. Despite a significant increase in our knowledge of hymenopteran parasitoids of ants, most of them remain to be discovered.

  12. Current issues in the evolutionary ecology of ant-plant symbioses. (United States)

    Mayer, Veronika E; Frederickson, Megan E; McKey, Doyle; Blatrix, Rumsaïs


    Ant-plant symbioses involve plants that provide hollow structures specialized for housing ants and often food to ants. In return, the inhabiting ants protect plants against herbivores and sometimes provide them with nutrients. Here, we review recent advances in ant-plant symbioses, focusing on three areas. First, the nutritional ecology of plant-ants, which is based not only on plant-derived food rewards, but also on inputs from other symbiotic partners, in particular fungi and possibly bacteria. Food and protection are the most important 'currencies' exchanged between partners and they drive the nature and evolution of the relationships. Secondly, studies of conflict and cooperation in ant-plant symbioses have contributed key insights into the evolution and maintenance of mutualism, particularly how partner-mediated feedbacks affect the specificity and stability of mutualisms. There is little evidence that mutualistic ants or plants are under selection to cheat, but the costs and benefits of ant-plant interactions do vary with environmental factors, making them vulnerable to natural or anthropogenic environmental change. Thus, thirdly, ant-plant symbioses should be considered good models for investigating the effects of global change on the outcome of mutualistic interactions. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.

  13. Application of an Image Tracking Algorithm in Fire Ant Motion Experiment

    Directory of Open Access Journals (Sweden)

    Lichuan Gui


    Full Text Available An image tracking algorithm, which was originally used with the particle image velocimetry (PIV to determine velocities of buoyant solid particles in water, is modified and applied in the presented work to detect motion of fire ant on a planar surface. A group of fire ant workers are put to the bottom of a tub and excited with vibration of selected frequency and intensity. The moving fire ants are captured with an image system that successively acquires image frames of high digital resolution. The background noise in the imaging recordings is extracted by averaging hundreds of frames and removed from each frame. The individual fire ant images are identified with a recursive digital filter, and then they are tracked between frames according to the size, brightness, shape, and orientation angle of the ant image. The speed of an individual ant is determined with the displacement of its images and the time interval between frames. The trail of the individual fire ant is determined with the image tracking results, and a statistical analysis is conducted for all the fire ants in the group. The purpose of the experiment is to investigate the response of fire ants to the substrate vibration. Test results indicate that the fire ants move faster after being excited, but the number of active ones are not increased even after a strong excitation.

  14. Individual-based ant-plant networks: diurnal-nocturnal structure and species-area relationship.

    Directory of Open Access Journals (Sweden)

    Wesley Dáttilo

    Full Text Available Despite the importance and increasing knowledge of ecological networks, sampling effort and intrapopulation variation has been widely overlooked. Using continuous daily sampling of ants visiting three plant species in the Brazilian Neotropical savanna, we evaluated for the first time the topological structure over 24 h and species-area relationships (based on the number of extrafloral nectaries available in individual-based ant-plant networks. We observed that diurnal and nocturnal ant-plant networks exhibited the same pattern of interactions: a nested and non-modular pattern and an average level of network specialization. Despite the high similarity in the ants' composition between the two collection periods, ant species found in the central core of highly interacting species totally changed between diurnal and nocturnal sampling for all plant species. In other words, this "night-turnover" suggests that the ecological dynamics of these ant-plant interactions can be temporally partitioned (day and night at a small spatial scale. Thus, it is possible that in some cases processes shaping mutualistic networks formed by protective ants and plants may be underestimated by diurnal sampling alone. Moreover, we did not observe any effect of the number of extrafloral nectaries on ant richness and their foraging on such plants in any of the studied ant-plant networks. We hypothesize that competitively superior ants could monopolize individual plants and allow the coexistence of only a few other ant species, however, other alternative hypotheses are also discussed. Thus, sampling period and species-area relationship produces basic information that increases our confidence in how individual-based ant-plant networks are structured, and the need to consider nocturnal records in ant-plant network sampling design so as to decrease inappropriate inferences.

  15. [Behavioral mechanisms of spatial competition between red wood ants (Formica aquilonia) and ground beetles (Carabidae)]. (United States)

    Dorosheva, E A; Reznikova, Zh I


    Behavioral aspects of spatial competition between red wood ants (Formica aquilonia) and six mass species of Carabidae were studied in field and laboratory experiments. We showed that red wood ants essentially influence spatial distribution of ground beetles on their common territories. Transplantation experiments suggest that in newly established ants' settlements stronger forms of interrelations arise than in old stable colony. To examine the ability of beetles to avoid collisions with ants we used two experimental techniques. In laboratory, we tested carabids ability to avoid a clash in a Y-shaped labyrinth containing an active tethered ant in one section. In field experiments we compared quantitative characteristics of movements (such as crookedness of individual trajectories, speed of movement, the time spent on stops) for beetles placed close to ants foraging routes and on ant-free plots. All beetles studied displayed a clear tendency to learn, that is, to modity their behavior in order to avoid collisions with ants. Species that exhibited best parameters of learning were closer to ants by their size and characteristic movement, namely, Pterostichus oblogopunctatus and P. magus. Beetles' stereotyped behavioral tactics can be considered universal for avoiding collisions with any subject (for instance, with an ant) of a certain size and speed of movements. A set of tactics in the labyrinth included: (1) attempts to round the ant; (2) turns away after touching the ant with antennae; (3) turns away without a contact; (4) avoidances of a dangerous section; (5) stops near the ant with the antennae hidden. Comparing pairwise difference between four species shows that beetles use species-specific preference for definite combinations of tactics. Effective learning allows carabids to penetrate into ant foraging territory and partly avoide interference competition. It seems that red wood ants are not inclined to learn to avoid collisions with competing carabid species

  16. Protection of Vochysia elliptica (Vochysiaceae by a nectar-thieving ant

    Directory of Open Access Journals (Sweden)

    G. Q. ROMERO

    Full Text Available Vochysia elliptica (Vochysiaceae is a shrubby plant, which does not have EFNs. Camponotus ants thieve nectar, and can decrease plant fitness by making flowers less attractive to pollinators. However, ants remove herbivores, wich can be beneficial. Results show that plants from which ants were excluded had lower rates of termite (simulated herbivore removal than did plants visited by ants. Plants accessible to ants showed higher rates of termite removal in the base of leaves and in the inflorescence, than in the tip of leaves. This occurs because ants must pass through the principal axis to reach the inflorescence. Conclusive results of this cost/benefit analysis of the Camponotus sp. presence for V. elliptica can be obtained, with experimental manipulations.

  17. Ants use partner specific odors to learn to recognize a mutualistic partner.

    Directory of Open Access Journals (Sweden)

    Masaru K Hojo

    Full Text Available Regulation via interspecific communication is an important for the maintenance of many mutualisms. However, mechanisms underlying the evolution of partner communication are poorly understood for many mutualisms. Here we show, in an ant-lycaenid butterfly mutualism, that attendant ants selectively learn to recognize and interact cooperatively with a partner. Workers of the ant Pristomyrmex punctatus learn to associate cuticular hydrocarbons of mutualistic Narathura japonica caterpillars with food rewards and, as a result, are more likely to tend the caterpillars. However, the workers do not learn to associate the cuticular hydrocarbons of caterpillars of a non-ant-associated lycaenid, Lycaena phlaeas, with artificial food rewards. Chemical analysis revealed cuticular hydrocarbon profiles of the mutualistic caterpillars were complex compared with those of non-ant-associated caterpillars. Our results suggest that partner-recognition based on partner-specific chemical signals and cognitive abilities of workers are important mechanisms underlying the evolution and maintenance of mutualism with ants.

  18. Tree-Dwelling Ants: Contrasting Two Brazilian Cerrado Plant Species without Extrafloral Nectaries

    Directory of Open Access Journals (Sweden)

    Jonas Maravalhas


    Full Text Available Ants dominate vegetation stratum, exploiting resources like extrafloral nectaries (EFNs and insect honeydew. These interactions are frequent in Brazilian cerrado and are well known, but few studies compare ant fauna and explored resources between plant species. We surveyed two cerrado plants without EFNs, Roupala montana (found on preserved environments of our study area and Solanum lycocarpum (disturbed ones. Ants were collected and identified, and resources on each plant noted. Ant frequency and richness were higher on R. montana (67%; 35 spp than S. lycocarpum (52%; 26, the occurrence of the common ant species varied between them, and similarity was low. Resources were explored mainly by Camponotus crassus and consisted of scale insects, aphids, and floral nectaries on R. montana and two treehopper species on S. lycocarpum. Ants have a high diversity on cerrado plants, exploring liquid and prey-based resources that vary in time and space and affect their presence on plants.

  19. Reducing losses inflicted by insect pests on cashew, using weaver ants as a biological control agent

    DEFF Research Database (Denmark)

    Anato, Florence; Wargui, Rosine; Sinzogan, Antonio


    BACKGROUND: Cashew (Anacardium occidentale Linnaeus) is the largest agricultural export product in Benin. However, yields and quality are lost due to inefficient pest control. Weaver ants (Oecophylla spp.) may control pests in this crop as they eat and deter pests. In Benin, cashew pest damages......, nut quality and yield were compared among: (i) trees with weaver ant (Oecophylla longinoda Latreille), (ii) trees where weaver ants were fed sugar, (iii) IPM trees with weaver ants combined with GF-120 (a natural insecticide), and (iv) control trees receiving no control measures. RESULTS: Thrips...... damages on nuts were higher than other damage symptoms and significantly lower on control trees compared to other treatments. Percentage of first quality nuts was higher in the control compared to ants treatments, but not different from the IPM-treatment. However, compared to the control treatment, ants...

  20. A diverse ant fauna from the mid-cretaceous of Myanmar (Hymenoptera: Formicidae.

    Directory of Open Access Journals (Sweden)

    Phillip Barden

    Full Text Available A new collection of 24 wingless ant specimens from mid-Cretaceous Burmese amber (Albian-Cenomanian, 99 Ma comprises nine new species belonging to the genus Sphecomyrmodes Engel and Grimaldi. Described taxa vary considerably with regard to total size, head and body proportion, cuticular sculpturing, and petiole structure while all species are unified by a distinct shared character. The assemblage represents the largest known diversification of closely related Cretaceous ants with respect to species number. These stem-group ants exhibit some characteristics previously known only from their extant counterparts along with presumed plesiomorphic morphology. Consequently, their morphology may inform hypotheses relating to basal relationships and general patterns of ant evolution. These and other uncovered Cretaceous species indicate that stem-group ants are not simply wasp-like, transitional formicids, but rather a group of considerable adaptive diversity, exhibiting innovations analogous to what crown-group ants would echo 100 million years later.

  1. Comparing different methods to assess weaver ant abundance in plantation trees

    DEFF Research Database (Denmark)

    Wargui, Rosine; Offenberg, Joachim; Sinzogan, Antonio


    Weaver ants (Oecophylla spp.) are widely used as effective biological control agents. In order to optimize their use, ant abundance needs to be tracked. As several methods have been used to estimate ant abundance on plantation trees, abundances are not comparable between studies and no guideline...... is available on which method to apply in a particular study. This study compared four existing methods: three methods based on the number of ant trails on the main branches of a tree (called the Peng 1, Peng 2 and Offenberg index) and one method based on the number of ant nests per tree. Branch indices did...... not produce equal scores and cannot be compared directly. The Peng 1 index was the fastest to assess, but showed only limited seasonal fluctuations when ant abundance was high, because it approached its upper limit. The Peng 2 and Offenberg indices were lower and not close to the upper limit and therefore...

  2. Attracting predators without falling prey: chemical camouflage protects honeydew-producing treehoppers from ant predation. (United States)

    Silveira, Henrique C P; Oliveira, Paulo S; Trigo, José R


    Predaceous ants are dominant organisms on foliage and represent a constant threat to herbivorous insects. The honeydew of sap-feeding hemipterans has been suggested to appease aggressive ants, which then begin tending activities. Here, we manipulated the cuticular chemical profiles of freeze-dried insect prey to show that chemical background matching with the host plant protects Guayaquila xiphias treehoppers against predaceous Camponotus crassus ants, regardless of honeydew supply. Ant predation is increased when treehoppers are transferred to a nonhost plant with which they have low chemical similarity. Palatable moth larvae manipulated to match the chemical background of Guayaquila's host plant attracted lower numbers of predatory ants than unchanged controls. Although aggressive tending ants can protect honeydew-producing hemipterans from natural enemies, they may prey on the trophobionts under shortage of alternative food resources. Thus chemical camouflage in G. xiphias allows the trophobiont to attract predaceous bodyguards at reduced risk of falling prey itself.

  3. Growing Industries, Growing Invasions? The Case of the Argentine Ant in Vineyards of Northern Argentina


    Maria Schulze-Sylvester; José A. Corronca; Carolina I. Paris


    The invasive Argentine ant causes ecological and economic damage worldwide. In 2011, this species was reported in vineyards of Cafayate, a wine-producing town in the Andes, Argentina. While the local xeric climate is unsuitable for Argentine ants, populations could establish in association with vineyards where human activity and irrigation facilitate propagule introduction and survival. In 2013–2014, we combined extensive sampling of the area using ant-baits with monitoring of the change in l...

  4. The Use of Weaver Ants in the Management of Fruit Flies in Africa

    DEFF Research Database (Denmark)

    Vayssières, Jean-François; Offenberg, Hans Joachim; Sinzogan, Antonio


    Generalist predators such as the weaver ant, Oecophylla longinoda (Latreille), play an important role as biological control agents in West African orchards and, by extension, also in forest and savanna ecosystems within sub-Saharan Africa. These weaver ants are one of the most effective and effi...... an interest in the use of weaver ants. Protection of tropical forests and savannas is ecologically and environmentally crucial and also essential for the protection of O. longinoda....

  5. Diapriinae Wasps (Hymenoptera: Diaprioidea: Diapriidae Associated with Ants (Hymenoptera: Formicidae in Argentina

    Directory of Open Access Journals (Sweden)

    Marta S. Loiácono


    Full Text Available We provide an overview of diapriid wasps associated with ants in Argentina and the diversity of interactions they have developed with their hosts. As a result, we report 16 species of nine genera of Diapriinae, two new geographic distributions, three new association records, illustrations, and photographs. We highlight myrmecophile symphylic species, with a high degree of integration with the host ants, adaptation being morphological and behavioral. A table with diapriid species and ant hosts is given.

  6. The Antsy Social Network: Determinants of Nest Structure and Arrangement in Asian Weaver Ants


    Devarajan, Kadambari


    Asian weaver ants (Oecophylla smaragdina) are arboreal ants that are known to form mutualistic complexes with their host trees. They are eusocial ants that build elaborate nests in the canopy in tropical areas. A colony comprises of multiple nests, usually on multiple trees, and the boundaries of the colony may be difficult to identify. However, they provide the ideal model for studying group living in invertebrates since there are a definite number of nests for a given substrate, the tree. H...

  7. Can anthropic fires affect epigaeic and hypogaeic Cerrado ant (Hymenoptera: Formicidae) communities in the same way? (United States)

    Canedo-Júnior, Ernesto de Oliveira; Cuissi, Rafael Gonçalves; Nelson Henrique de Almeida, Curi; Demetrio, Guilherme Ramos; Lasmar, Chaim José; Malves, Kira


    Fire occurrences are a common perturbation in Cerrado ecosystems, and may differently impact the local biodiversity. Arthropods are one of the taxa affected by fires, and among them, ants are known as good bioindicators. We aimed to evaluate the effect of anthropic fires on epigaeic and hypogaeic ant communities (species richness and composition) in Cerrado areas with different post-fire event recovery periods. We conducted the study in four Cerrado areas during two weeks of 2012 dry season: one unburned and three at different post-fire times (one month, one and two years). We sampled ants with pitfall traps in epigaeic and hypogaeic microhabitats. We collected 71 ant morpho-species from 25 genera. In the epigaeic microhabitat we sampled 56 morpho-species and 42 in the hypogaeic microhabitat. The area with the shortest recovery time presented lower epigaeic ant species richness (4.3 ± 2.00) in comparison to the other areas (8.1 ± 2.68 species on one year area; 10.3 ± 2.66 species on two years area; 10.4 ± 2.31 species on control area), but recovery time did not affect hypogaeic ant species richness. Regarding ant species composition, fire did not directly affect hypogaeic ant species, which remained the same even one month after fire event. However, two years were not enough to reestablish ant species composition in both microhabitats in relation to our control group samples. Our study is the first to assess anthropic fire effects upon epigaeic and hypogaeic ants communities; highlighting the importance of evaluating different microhabitats, to more accurately detect the effects of anthropic disturbances in biological communities. We concluded that ant communities are just partially affected by fire occurrences, and epigaeic assemblages are the most affected ones in comparison to hypogaeic ants. Furthermore the study provides knowledge to aid in the creation of vegetation management programs that allow Cerrado conservation.

  8. Density-dependent benefits in ant-hemipteran mutualism? The case of the ghost ant Tapinoma melanocephalum (Hymenoptera: Formicidae and the invasive mealybug Phenacoccus solenopsis (Hemiptera: Pseudococcidae.

    Directory of Open Access Journals (Sweden)

    Aiming Zhou

    Full Text Available Although density-dependent benefits to hemipterans from ant tending have been measured many times, few studies have focused on integrated effects such as interactions between ant tending, natural enemy density, and hemipteran density. In this study, we tested whether the invasive mealybug Phenacoccus solenopsis is affected by tending by ghost ants (Tapinoma melanocephalum, the presence of parasitoids, mealybug density, parasitoid density and interactions among these factors. Our results showed that mealybug colony growth rate and percentage parasitism were significantly affected by ant tending, parasitoid presence, and initial mealybug density separately. However, there were no interactions among the independent factors. There were also no significant interactions between ant tending and parasitoid density on either mealybug colony growth rate or percentage parasitism. Mealybug colony growth rate showed a negative linear relationship with initial mealybug density but a positive linear relationship with the level of ant tending. These results suggest that benefits to mealybugs are density-independent and are affected by ant tending level.

  9. Benefits conferred by "timid" ants: active anti-herbivore protection of the rainforest tree Leonardoxa africana by the minute ant Petalomyrmex phylax. (United States)

    Gaume, Laurence; McKey, Doyle; Anstett, Marie-Charlotte


    In this study, we demonstrate that an important benefit provided by the small host-specific ant Petalomyrmex phylax to its host plant Leonardoxa africana is efficient protection against herbivores. We estimate that in the absence of ants, insect herbivory would reduce the leaf area by about one-third. This contributes considerably to the fitness of the plant. Our estimates take into account not only direct damage, such as removal of leaf surface by chewing insects, but also the effects of sucking insects on leaf growth and expansion. Sucking insects are numerically predominant in this system, and the hitherto cryptic effects of ant protection against the growth-reducing effects of sucking insects accounted for half of the total estimated benefit of ant protection. We propose that the small size of workers confers a distinct advantage in this system. Assuming that resource limitation implies a trade off between size and number of ants, and given the small size of phytophagous insects that attack Leonardoxa, we conclude that fine-grained patrolling by a large number of small workers maximises protection of young leaves of this plant. Since herbivores are small and must complete their development on the young leaves of Leonardoxa, and since a high patrolling density is required for a fine-grained search for these enemies, numerous small ants should provide the most effective protection of young leaves of Leonardoxa. We also discuss other factors that may have influenced worker size in this ant.

  10. Plant-ants use symbiotic fungi as a food source: new insight into the nutritional ecology of ant-plant interactions. (United States)

    Blatrix, Rumsaïs; Djiéto-Lordon, Champlain; Mondolot, Laurence; La Fisca, Philippe; Voglmayr, Hermann; McKey, Doyle


    Usually studied as pairwise interactions, mutualisms often involve networks of interacting species. Numerous tropical arboreal ants are specialist inhabitants of myrmecophytes (plants bearing domatia, i.e. hollow structures specialized to host ants) and are thought to rely almost exclusively on resources derived from the host plant. Recent studies, following up on century-old reports, have shown that fungi of the ascomycete order Chaetothyriales live in symbiosis with plant-ants within domatia. We tested the hypothesis that ants use domatia-inhabiting fungi as food in three ant-plant symbioses: Petalomyrmex phylax/Leonardoxa africana, Tetraponera aethiops/Barteria fistulosa and Pseudomyrmex penetrator/Tachigali sp. Labelling domatia fungal patches in the field with either a fluorescent dye or (15)N showed that larvae ingested domatia fungi. Furthermore, when the natural fungal patch was replaced with a piece of a (15)N-labelled pure culture of either of two Chaetothyriales strains isolated from T. aethiops colonies, these fungi were also consumed. These two fungi often co-occur in the same ant colony. Interestingly, T. aethiops workers and larvae ingested preferentially one of the two strains. Our results add a new piece in the puzzle of the nutritional ecology of plant-ants.

  11. Ant exclusion in citrus over an 8-year period reveals a pervasive yet changing effect of ants on a Mediterranean spider assemblage. (United States)

    Mestre, L; Piñol, J; Barrientos, J A; Espadaler, X


    Ants and spiders are ubiquitous generalist predators that exert top-down control on herbivore populations. Research shows that intraguild interactions between ants and spiders can negatively affect spider populations, but there is a lack of long-term research documenting the strength of such interactions and the potentially different effects of ants on the diverse array of species in a spider assemblage. Similarly, the suitability of family-level surrogates for finding patterns revealed by species-level data (taxonomic sufficiency) has almost never been tested in spider assemblages. We present a long-term study in which we tested the impact of ants on the spider assemblage of a Mediterranean citrus grove by performing sequential 1-year experimental exclusions on tree canopies for 8 years. We found that ants had a widespread influence on the spider assemblage, although the effect was only evident in the last 5 years of the study. During those years, ants negatively affected many spiders, and effects were especially strong for sedentary spiders. Analyses at the family level also detected assemblage differences between treatments, but they concealed the different responses to ant exclusion shown by some related spider species. Our findings show that the effects of experimental manipulations in ecology can vary greatly over time and highlight the need for long-term studies to document species interactions.

  12. The role of ant-tended extrafloral nectaries in the protection and benefit of a Neotropical rainforest tree. (United States)

    de la Fuente, Marie Ann S; Marquis, Robert J


    One possible function of extrafloral nectaries is to attract insects, particularly ants, which defend plants from herbivores. We determined whether ants visiting saplings of the tree Stryphnodendronmicrostachyum (Leguminosae) provide protection (decreased plant damage due to ant molestation or killing of herbivores) and benefit (increased plant growth and reproduction associated with ant presence) to the plant. We compared ant and herbivore abundance, herbivore damage and growth of ant-visited plants and ant-excluded plants grown in sun and shade microhabitats of a 6-ha plantation in Costa Rica over a 7-month period. Results show that ants provided protection to plants not by reducing herbivore numbers but by molesting herbivores. Ants also reduced the incidence of pathogen attack on leaves. Protection was greater in the shade than in the sun, probably due to lower herbivore attack in the sun. Protection was also variable within sun and shade habitats, and this variability appeared to be related to variable ant visitation. Results also indicate that ant presence benefits the plant: ant-visited plants grew significantly more in height than ant-excluded plants. The cultivation of ants may serve as an important natural biological control in tropical forestry and agroforestry systems, where increased plant density can otherwise lead to increased herbivore attack.

  13. Influence of toxic bait type and starvation on worker and queen mortality in laboratory colonies of Argentine ant (Hymenoptera: Formicidae). (United States)

    Mathieson, Melissa; Toft, Richard; Lester, Philip J


    The efficacy of toxic baits should be judged by their ability to kill entire ant colonies, including the colony queen or queens. We studied the efficacy of four toxic baits to the Argentine ant, Linepithema humile (Mayr) (Hymenoptera: Formicidae). These baits were Xstinguish that has the toxicant fipronil, Exterm-an-Ant that contains both boric acid and sodium borate, and Advion ant gel and Advion ant bait arena that both have indoxacarb. Experimental nests contained 300 workers and 10 queen ants that were starved for either 24 or 48 h before toxic bait exposure. The efficacy of the toxic baits was strongly influenced by starvation. In no treatment with 24-h starvation did we observe 100% worker death. After 24-h starvation three of the baits did not result in any queen deaths, with only Exterm-an-Ant producing an average of 25% mortality. In contrast, 100% queen and worker mortality was observed in colonies starved for 48 h and given Xstinguish or Exterm-an-Ant. The baits Advion ant gel and Advion ant bait arena were not effective against Argentine ants in these trials, resulting in ants are likely to be starved. Our results suggest queen mortality must be assessed in tests for toxic bait efficacy. Our data indicate that of these four baits, Xstinguish and Exterm-an-Ant are the best options for control of Argentine ants in New Zealand.

  14. Specialized Fungal Parasites and Opportunistic Fungi in Gardens of Attine Ants

    Directory of Open Access Journals (Sweden)

    Fernando C. Pagnocca


    Full Text Available Ants in the tribe Attini (Hymenoptera: Formicidae comprise about 230 described species that share the same characteristic: all coevolved in an ancient mutualism with basidiomycetous fungi cultivated for food. In this paper we focused on fungi other than the mutualistic cultivar and their roles in the attine ant symbiosis. Specialized fungal parasites in the genus Escovopsis negatively impact the fungus gardens. Many fungal parasites may have small impacts on the ants' fungal colony when the colony is balanced, but then may opportunistically shift to having large impacts if the ants' colony becomes unbalanced.

  15. Coevolved crypts and exocrine glands support mutualistic bacteria in fungus-growing ants

    DEFF Research Database (Denmark)

    Currie, Cameron R; Poulsen, Michael; Mendenhall, John


    Attine ants engage in a quadripartite symbiosis with fungi they cultivate for food, specialized garden parasites, and parasite-inhibiting bacteria. Molecular phylogenetic evidence supports an ancient host-pathogen association between the ant-cultivar mutualism and the garden parasite. Here we show...... that ants rear the antibiotic-producing bacteria in elaborate cuticular crypts, supported by unique exocrine glands, and that these structures have been highly modified across the ants' evolutionary history. This specialized structural evolution, together with the absence of these bacteria and modifications...

  16. Edge Effects on Community and Social Structure of Northern Temperate Deciduous Forest Ants

    Directory of Open Access Journals (Sweden)

    Valerie S. Banschbach


    Full Text Available Determining how ant communities are impacted by challenges from habitat fragmentation, such as edge effects, will help us understand how ants may be used as a bioindicator taxon. To assess the impacts of edge effects upon the ant community in a northern temperate deciduous forest, we studied edge and interior sites in Jericho, VT, USA. The edges we focused upon were created by recreational trails. We censused the ants at these sites for two consecutive growing seasons using pitfall traps and litter plot excavations. We also collected nests of the most common ant species at our study sites, Aphaenogaster rudis, for study of colony demography. Significantly greater total numbers of ants and ant nests were found in the edge sites compared to the interior sites but rarefaction analysis showed no significant difference in species richness. Aphaenogaster rudis was the numerically dominant ant in the habitats sampled but had a greater relative abundance in the interior sites than in the edge sites both in pitfall and litter plot data. Queen number of A. rudis significantly differed between the nests collected in the edge versus the interior sites. Habitat-dependent changes in social structure of ants represent another possible indicator of ecosystem health.

  17. Effects of invasive European fire ants (Myrmica rubra on herring gull (Larus argentatus reproduction.

    Directory of Open Access Journals (Sweden)

    Luke E DeFisher

    Full Text Available Various invasive ant species have negatively affected reproductive success in birds by disrupting nest site selection, incubation patterns, food supply, and by direct predation on nestlings. Impacts can be particularly severe when non-native ants colonize seabird nesting islands where thousands of birds may nest in high densities on the ground or in burrows or crevices. Here we report on the first documented effects of Myrmica rubra, the European fire ant, on the reproduction of birds in its non-native range. We documented herring gulls (Larus argentatus on Appledore Island, Maine, engaging in more erratic incubation behaviors at nests infested by the ants. Newly-hatched chicks in some nests were swarmed by ants, leading to rapid chick death. Due to high overall rates of chick mortality, survival probabilities did not vary between nests with and without ant activity, however chick growth rates were slower at nests with ants than at ant-free nests. Ant infestation likely leads to longer-term fitness consequences because slower growth rates early in life may ultimately lead to lower post-fledging survival probabilities.

  18. Bacteria may contribute to distant species recognition in ant-aphid mutualistic relationships. (United States)

    Fischer, Christophe Y; Detrain, Claire; Thonart, Philippe; Haubruge, Eric; Francis, Frédéric; Verheggen, François J; Lognay, Georges C


    Mutualistic interactions between ant and aphid species have been the subject of considerable historical and contemporary investigations, the primary benefits being cleaning and protection for the aphids and carbohydrate-rich honeydew for the ants. Questions remained, however, as to the volatile semiochemical factor influencing this relationship. A recent study highlighted the role of bacterial honeydew volatile compounds in ant attraction. Here, ant's ability to distantly discriminate 2 aphid species was investigated based on bacterial honeydew semiochemicals emissions using a two-way olfactometer. Both the mutualistic aphid Aphis fabae L. and the nonmyrmecophilous aphid Acyrthosiphon pisum Harris were found to be attractive for the ant Lasius niger L. The level of attraction was similar in both assays (control vs. one of the aphid species). However, when given a choice between these 2 aphid species, ants showed a significant preference for Aphis fabae. Honeydew volatiles, mostly from bacterial origins, are known to be a key element in ant attraction. Using the same olfactometry protocol, the relative attractiveness of volatiles emitted by honeydews collected from each aphid species and by bacteria isolated from each honeydew was investigated. Again, ants significantly preferred volatiles released by Aphis fabae honeydew and bacteria. This information suggests that microbial honeydew volatiles enable ants to distantly discriminate aphid species. These results strengthen the interest of studying the occurrence and potential impact of microorganisms in insect symbioses. © 2015 Institute of Zoology, Chinese Academy of Sciences.

  19. Visual cues for the retrieval of landmark memories by navigating wood ants. (United States)

    Harris, Robert A; Graham, Paul; Collett, Thomas S


    Even on short routes, ants can be guided by multiple visual memories. We investigate here the cues controlling memory retrieval as wood ants approach a one- or two-edged landmark to collect sucrose at a point along its base. In such tasks, ants store the desired retinal position of landmark edges at several points along their route. They guide subsequent trips by retrieving the appropriate memory and moving to bring the edges in the scene toward the stored positions. The apparent width of the landmark turns out to be a powerful cue for retrieving the desired retinal position of a landmark edge. Two other potential cues, the landmark's apparent height and the distance that the ant walks, have little effect on memory retrieval. A simple model encapsulates these conclusions and reproduces the ants' routes in several conditions. According to this model, the ant stores a look-up table. Each entry contains the apparent width of the landmark and the desired retinal position of vertical edges. The currently perceived width provides an index for retrieving the associated stored edge positions. The model accounts for the population behavior of ants and the idiosyncratic training routes of individual ants. Our results imply binding between the edge of a shape and its width and, further, imply that assessing the width of a shape does not depend on the presence of any particular local feature, such as a landmark edge. This property makes the ant's retrieval and guidance system relatively robust to edge occlusions.

  20. Pupae transplantation to boost early colony growth in the weaver ant Oecophylla longinoda Latreille (Hymenoptera: Formicidae)

    DEFF Research Database (Denmark)

    Ouagoussounon, Issa; Sinzogan, Antonio; Offenberg, Joachim


    Oecophylla ants are currently used for biological control in fruit plantations in Australia, Asia and Africa and for protein production in Asia. To further improve the technology and implement it on a large scale, effective and fast production of live colonies is desirable. Early colony development...... capita brood production by the resident queen, triggered by the adopted pupae. Thus pupae transplantation may be used to shorten the time it takes to produce weaver ant colonies in ant nurseries, and may in this way facilitate the implementation of weaver ant biocontrol in West Africa....

  1. Harnessing ant defence at fruits reduces bruchid seed predation in a symbiotic ant–plant mutualism (United States)

    Pringle, Elizabeth G.


    In horizontally transmitted mutualisms, mutualists disperse separately and reassemble in each generation with partners genetically unrelated to those in the previous generation. Because of this, there should be no selection on either partner to enhance the other's reproductive output directly. In symbiotic ant–plant mutualisms, myrmecophytic plants host defensive ant colonies, and ants defend the plants from herbivores. Plants and ants disperse separately, and, although ant defence can indirectly increase plant reproduction by reducing folivory, it is unclear whether ants can also directly increase plant reproduction by defending seeds. The neotropical tree Cordia alliodora hosts colonies of Azteca pittieri ants. The trees produce domatia where ants nest at stem nodes and also at the node between the peduncle and the rachides of the infloresence. Unlike the stem domatia, these reproductive domatia senesce after the tree fruits each year. In this study, I show that the tree's resident ant colony moves into these ephemeral reproductive domatia, where they tend honeydew-producing scale insects and patrol the nearby developing fruits. The presence of ants significantly reduced pre-dispersal seed predation by Amblycerus bruchid beetles, thereby directly increasing plant reproductive output. PMID:24807259

  2. Development of virtual bait stations to control Argentine ants (Hymenoptera: Formicidae) in environmentally sensitive habitats. (United States)

    Choe, Dong-Hwan; Vetter, Richard S; Rust, Michael K


    A novel bait station referred to as a virtual bait station was developed and tested against field populations of the invasive Argentine ant, Linepithema humile (Mayr) (Hymenoptera: Formicidae), at White Beach, Camp Pendleton, in Oceanside, CA. White Beach is a nesting habitat for an endangered seabird, the California least tern (Sterna antillarum browni Mearns). The beach is heavily infested with Argentine ants, one of the threats for the California least tern chicks. Conventional pest control strategies are prohibited because of the existence of the protected bird species and the site's proximity to the ocean. The bait station consisted of a polyvinyl chloride pipe that was treated on the inside with fipronil insecticide at low concentrations to obtain delayed toxicity against ants. The pipe was provisioned with an inverted bottle of 25% sucrose solution, then capped, and buried in the sand. Foraging ants crossed the treated surface to consume the sucrose solution. The delayed toxicity of fipronil deposits allowed the ants to continue foraging on the sucrose solution and to interact with their nestmates, killing them within 3-5 d after exposure. Further modification of the bait station design minimized the accumulation of dead ants in the sucrose solution, significantly improving the longevity and efficacy of the bait station. The virtual bait station exploits the foraging behavior of the ants and provides a low impact approach to control ants in environmentally sensitive habitats. It excluded all insects except ants, required only milligram quantities of toxicant, and eliminated the problem of formulating toxicants into aqueous sugar baits.

  3. The direct and ecological costs of an ant-plant symbiosis. (United States)

    Frederickson, Megan E; Ravenscraft, Alison; Miller, Gabriel A; Arcila Hernández, Lina M; Booth, Gregory; Pierce, Naomi E


    How strong is selection for cheating in mutualisms? The answer depends on the type and magnitude of the costs of the mutualism. Here we investigated the direct and ecological costs of plant defense by ants in the association between Cordia nodosa, a myrmecophytic plant, and Allomerus octoarticulatus, a phytoecious ant. Cordia nodosa trees produce food and housing to reward ants that protect them against herbivores. For nearly 1 year, we manipulated the presence of A. octoarticulatus ants and most insect herbivores on C. nodosa in a full-factorial experiment. Ants increased plant growth when herbivores were present but decreased plant growth when herbivores were absent, indicating that hosting ants can be costly to plants. However, we did not detect a cost to ant colonies of defending host plants against herbivores. Although this asymmetry in costs suggests that the plants may be under stronger selection than the ants to cheat by withholding investment in their partner, the costs to C. nodosa are probably at least partly ecological, arising because ants tend scale insects on their host plants. We argue that ecological costs should favor resistance or traits other than cheating and thus that neither partner may face much temptation to cheat.

  4. Social coercion of larval development in an ant species. (United States)

    Villalta, Irene; Amor, Fernando; Cerdá, Xim; Boulay, Raphaël


    Ants provide one of the best examples of the division of labor in animal societies. While the queens reproduce, workers generally refrain from laying eggs and dedicate themselves exclusively to domestic tasks. In many species, the small diploid larvae are bipotent and can develop either into workers or queens depending mostly on environmental cues. This generates a conflicting situation between the adults that tend to rear a majority of larvae into workers and the larvae whose individual interest may be to develop into reproductive queens. We tested the social regulation of larval caste fate in the fission-performing ant Aphaenogaster senilis. We first observed interactions between resident workers and queen- and worker-destined larvae in presence/absence of the queen. The results show that workers tend to specifically eliminate queen-destined larvae when the queen is present but not when she is absent or imprisoned in a small cage allowing for volatile pheromone exchanges. In addition, we found that the presence of already developed queen-destined larvae does not inhibit the development of younger still bipotent larvae into queens. Finally, we analyzed the cuticular hydrocarbon profiles of queen- and worker-destined larvae and found no significant quantitative or qualitative difference. Interestingly, the total amount of hydrocarbons on both larval castes is extremely low, which lends credence on the chemical insignificance hypothesis of larval ants. Overall, our results suggest that workers control larval development and police larvae that would develop into queens instead of workers. Such policing behavior is similar in many aspects to what is known of worker policing among adults.

  5. Social coercion of larval development in an ant species (United States)

    Villalta, Irene; Amor, Fernando; Cerdá, Xim; Boulay, Raphaël


    Ants provide one of the best examples of the division of labor in animal societies. While the queens reproduce, workers generally refrain from laying eggs and dedicate themselves exclusively to domestic tasks. In many species, the small diploid larvae are bipotent and can develop either into workers or queens depending mostly on environmental cues. This generates a conflicting situation between the adults that tend to rear a majority of larvae into workers and the larvae whose individual interest may be to develop into reproductive queens. We tested the social regulation of larval caste fate in the fission-performing ant Aphaenogaster senilis. We first observed interactions between resident workers and queen- and worker-destined larvae in presence/absence of the queen. The results show that workers tend to specifically eliminate queen-destined larvae when the queen is present but not when she is absent or imprisoned in a small cage allowing for volatile pheromone exchanges. In addition, we found that the presence of already developed queen-destined larvae does not inhibit the development of younger still bipotent larvae into queens. Finally, we analyzed the cuticular hydrocarbon profiles of queen- and worker-destined larvae and found no significant quantitative or qualitative difference. Interestingly, the total amount of hydrocarbons on both larval castes is extremely low, which lends credence on the chemical insignificance hypothesis of larval ants. Overall, our results suggest that workers control larval development and police larvae that would develop into queens instead of workers. Such policing behavior is similar in many aspects to what is known of worker policing among adults.

  6. Ants sow the seeds of global diversification in flowering plants.

    Directory of Open Access Journals (Sweden)

    Szabolcs Lengyel

    Full Text Available The extraordinary diversification of angiosperm plants in the Cretaceous and Tertiary periods has produced an estimated 250,000-300,000 living angiosperm species and has fundamentally altered terrestrial ecosystems. Interactions with animals as pollinators or seed dispersers have long been suspected as drivers of angiosperm diversification, yet empirical examples remain sparse or inconclusive. Seed dispersal by ants (myrmecochory may drive diversification as it can reduce extinction by providing selective advantages to plants and can increase speciation by enhancing geographical isolation by extremely limited dispersal distances.Using the most comprehensive sister-group comparison to date, we tested the hypothesis that myrmecochory leads to higher diversification rates in angiosperm plants. As predicted, diversification rates were substantially higher in ant-dispersed plants than in their non-myrmecochorous relatives. Data from 101 angiosperm lineages in 241 genera from all continents except Antarctica revealed that ant-dispersed lineages contained on average more than twice as many species as did their non-myrmecochorous sister groups. Contrasts in species diversity between sister groups demonstrated that diversification rates did not depend on seed dispersal mode in the sister group and were higher in myrmecochorous lineages in most biogeographic regions.Myrmecochory, which has evolved independently at least 100 times in angiosperms and is estimated to be present in at least 77 families and 11 000 species, is a key evolutionary innovation and a globally important driver of plant diversity. Myrmecochory provides the best example to date for a consistent effect of any mutualism on large-scale diversification.

  7. The Evolutionary Ecology of Multi-Queen Breeding in Ants

    DEFF Research Database (Denmark)

    Huszár, Dóra Borbála

    on other ant species to better understand the social syndromes and how supercolonies function. Foremost, this would help to manage invasive supercolonies that harm humans and biodiversity, but could also provide contribution to our general understanding on how ecology, especially demography impacts upon......). Multi-queen breeding requires both social and life-history adaptations from individuals to decrease intra-colony conflicts and to ensure that sterile workers receive inclusive fitness benefits despite lowered relatedness. However, it remains unclear exactly what ecological and life-history covariates...

  8. Genetic royal cheats in leaf-cutting ant societies

    DEFF Research Database (Denmark)

    Hughes, William O H; Boomsma, Jacobus J


    of the former. The most significant potential conflict in social insect colonies is over which individuals become reproductive queens rather than sterile workers. This reproductive division of labor is a defining characteristic of eusocial societies, but individual larvae will maximize their fitness by becoming...... queens whereas their nestmates will generally maximize fitness by forcing larvae to become workers. However, evolutionary constraints are thought to prevent cheating by removing genetic variation in caste propensity. Here, we show that one-fifth of leaf-cutting ant patrilines cheat their nestmates...

  9. Précis of The Ant Trap

    Directory of Open Access Journals (Sweden)

    Epstein Brian


    Full Text Available This article summarizes The Ant Trap: Rebuilding the Foundations of the Social Sciences. The book develops a new model for social ontology, applies it to groups and collective intentionality, and criticizes various forms of individualism. Part One of the book presents two traditional approaches to social ontology and unifies them into the “grounding–anchoring model” for the building of the social world. Part Two shows that individualism is mistaken even for basic facts about groups of people, challenges prevailing views of group intention and action, and illustrates how to approach facts about groups in general.


    Directory of Open Access Journals (Sweden)



    Full Text Available The purpose of this study is to reduce the total process time (Makespan and to increase the machines working time, in a job shop environment, using a heuristic based on ant colony optimization. This work is developed in two phases: The first stage describes the identification and definition of heuristics for the sequential processes in the job shop. The second stage shows the effectiveness of the system in the traditional programming of production. A good solution, with 99% efficiency is found using this technique.

  11. Estilos de afrontamiento ante eventos estresantes en la infancia


    Hernández Altamirano,Sheila Viridiana; Gutiérrez Lara,Mariana


    El afrontamiento es una variable mediadora de la adaptación y de los eventos estresantes de la vida diaria de un individuo. En el caso del infante le permite lidiar con los cambios físicos, psicológicos, familiares, sociales y académicos típicos de su edad. El objetivo de esta investigación fue identificar los estilos de afrontamiento utilizados por niños de 10 a 13 años de edad ante eventos estresantes. Para ello se realizó un estudio descriptivo en el cual los estilos de afrontamiento fuero...

  12. Prudent sperm use by leaf-cutter ant queens

    DEFF Research Database (Denmark)

    Den Boer, Susanne Petronella A; Baer, Boris; Dreier, Stéphanie Agnès Jeanine


    are able to fertilize close to 100 per cent of the eggs and that the average sperm use per egg is very low, but increases with queen age. The robustness of stored sperm was found to decrease with years of storage, signifying that senescence affects sperm either directly or indirectly via the declining...... glandular secretions or deteriorating sperm-storage organs. We evaluate our findings with a heuristic model, which suggests that the average queen has sperm for almost 9 years of normal colony development. We discuss the extent to which leaf-cutter ant queens have been able to optimize their sperm...

  13. Eavesdropping on cooperative communication within an ant-butterfly mutualism

    DEFF Research Database (Denmark)

    Elgar, Mark A.; Nash, David Richard; Pierce, Naomi E.


    Signalling is necessary for the maintenance of inter-specific mutualisms but is vulnerable to exploitation by eavesdropping. While eavesdropping of intra-specific signals has been studied extensively, such exploitation of inter-specific signals has not been widely documented. The juvenile stages...... for oviposition and mate searching respectively. Our experiments reveal that two natural enemies of J. evagoras, araneid spiders and braconid parasitoid wasps, exploit ant signals as cues for increasing their foraging and oviposition success respectively. Intriguingly, selection through eavesdropping is unlikely...

  14. Sintese formal do adoçante natural (-)-monatina


    Davi de Jesus Oliveira


    Resumo: Nesse trabalho descreveremos a síntese formal assimétrica da (-)-monatina,(3-indolil)-2-amino-4-carboxi-4-hidroxipentanóico), um potente adoçante natural presente nas raízes da planta africana Schlerochiton ilicifolius, que apresenta um teor dulcifico 1400 vezes mais doce do que a sacarose. A (-)-monatina contém dois centros estereogênicos, 2S e 4S. O centro 2S veio da conservação do centro estereogênico do derivado piroglutamato e centro quaternário 4S foi gerado de uma oxidação e al...

  15. Tropical and Holarctic Ants in Late Eocene Ambers

    Directory of Open Access Journals (Sweden)

    Perkovsky E. E.


    Full Text Available Based on representative collections, the ratio of tropical and Holarctic ant species in Priabonian (Late Eocene Baltic, Bitterfeld (Saxonian, Danish and Rovno ambers is analyzed for the first time. In surveyed representative collections of Baltic amber, the ratios of Holarctic and tropical ant species are from 1.1 to 1.5; with 10 Holarctic and 9 tropical species (out of 31 in the PIN-964 collection, and 9 and 5 species (out of 29 in the Giecewicz collection; the ratio in the representative collection of Saxonian amber is 0.9, 11 Holarctic species vs. 12 tropical species (out of 55; in the representative collection of Rovno amber it is 0.65, 15 vs. 23 species (out of 79; and in the representative collection of Danish amber it is 0.64, 7 vs. 11 species (out of 36. Hence, in representative collections of Baltic amber, Holarctic species clearly prevail not just in terms of the share of their specimens (by 9.8 to 19.6 times, but also by the number of species. In Bitterfeld amber, Holarctic species are somewhat less numerous than tropical ones, but their specimens are 6 times greater. In representative collections of Rovno and Danish ambers, the number of Holarctic species is 1.5 to 1.7 times smaller than that of tropical species, but the number of their specimens is 4.9 to 6.9 times greater. The numbers of tropical and Holarctic species represented by more than one specimen is similar in Priabonian ambers, 25 versus 22, but Holarctic species include four dominants or subdominants. The abundance of temperate elements in the Priabonian amber ant fauna along with the relatively small number of tropical elements greatly distinguishes it from the Middle European Lutetian ant faunas of Messel and Eckfeld in shale, which do not have temperate elements at all. Formica phaethusa Wheeler, Glaphyromyrmex oligocenicus Wheeler, Plagiolepis squamifera Mayr, Proceratium eocenicum Dlussky, Hypoponera atavia (Mayr, Ponera lobulifera Dlussky, Aphaenogaster mersa

  16. Ant-caterpillar antagonism at the community level: interhabitat variation of tritrophic interactions in a neotropical savanna. (United States)

    Sendoya, Sebastián F; Oliveira, Paulo S


    Ant foraging on foliage can substantially affect how phytophagous insects use host plants and represents a high predation risk for caterpillars, which are important folivores. Ant-plant-herbivore interactions are especially pervasive in cerrado savanna due to continuous ant visitation to liquid food sources on foliage (extrafloral nectaries, insect honeydew). While searching for liquid rewards on plants, aggressive ants frequently attack or kill insect herbivores, decreasing their numbers. Because ants vary in diet and aggressiveness, their effect on herbivores also varies. Additionally, the differential occurrence of ant attractants (plant and insect exudates) on foliage produces variable levels of ant foraging within local floras and among localities. Here, we investigate how variation of ant communities and of traits among host plant species (presence or absence of ant attractants) can change the effect of carnivores (predatory ants) on herbivore communities (caterpillars) in a cerrado savanna landscape. We sampled caterpillars and foliage-foraging ants in four cerrado localities (70-460 km apart). We found that: (i) caterpillar infestation was negatively related with ant visitation to plants; (ii) this relationship depended on local ant abundance and species composition, and on local preference by ants for plants with liquid attractants; (iii) this was not related to local plant richness or plant size; (iv) the relationship between the presence of ant attractants and caterpillar abundance varied among sites from negative to neutral; and (v) caterpillars feeding on plants with ant attractants are more resistant to ant predation than those feeding on plants lacking attractants. Liquid food on foliage mediates host plant quality for lepidopterans by promoting generalized ant-caterpillar antagonism. Our study in cerrado shows that the negative effects of generalist predatory ants on herbivores are detectable at a community level, affecting patterns of abundance and

  17. Efforts to eradicate yellow crazy ants on Johnston Atoll: Results from Crazy Ant Strike Team IX, December 2014-June 2015 (United States)

    Banko, Paul C.; Peck, Robert W.; Donmoyer, Kevin; Kropidlowski, Stephan; Pollock, Amanda


    The ecologically destructive yellow crazy ant (YCA; Anoplolepis gracilipes) was first detected on Johnston Atoll in January 2010. Within eight months, the U.S. Fish and Wildlife Service had mobilized its first crazy ant strike team (CAST), a group of biologists dedicated to testing and identifying insecticidal baits to be used to eradicate the ant on the atoll. During December 2014‒May 2015 CAST IX focused on testing hydrogel crystals saturated with sucrose solution (25%) carrying the insecticides thiamethoxam and dinotefuran against YCA. A series of experiments, including artificial nest box trials, and field-based palatability trials and eradication tests on small (500 m2 or 0.05 ha) and large plots (2500 m2 or 0.25 ha), were conducted to test concentrations of thiamethoxam ranging from 0.0005% to 0.01%, and dinotefuran at 0.05%. Additionally, the cat food-based matrix containing dinotefuran (0.05%), the standard bait used to suppress YCA on Johnston since 2011, and textured vegetable protein (TVP) carrying dinotefuran at 0.1% and 0.05% were included in large plot tests. Nest box trials were inconclusive due to a consistent loss of queen and worker ants in control boxes, so they were discontinued. Palatability trials suggested higher dosages of thiamethoxam (0.005 and 0.01%) were less attractive than lower dosages (0.0005 and 0.001%) and controls (sucrose only), but small and large plot experiments failed to identify a thiamethoxam concentration that was consistently effective at killing YCA. In contrast, hydrogel containing dinotefuran was consistently effective, killing >95% of YCA on small and large plots. As expected, the cat food bait effectively reduced YCA abundances, but was slightly less effective than hydrogel containing dinotefuran over time. Three successive, approximately weekly treatments of large plots with hydrogel bait, or other baits followed by hydrogel bait, suggest an increasing overall effectiveness, with no aversion of YCA to the bait

  18. Asymmetric dispersal and colonization success of Amazonian plant-ants queens.

    Directory of Open Access Journals (Sweden)

    Emilio M Bruna

    Full Text Available The dispersal ability of queens is central to understanding ant life-history evolution, and plays a fundamental role in ant population and community dynamics, the maintenance of genetic diversity, and the spread of invasive ants. In tropical ecosystems, species from over 40 genera of ants establish colonies in the stems, hollow thorns, or leaf pouches of specialized plants. However, little is known about the relative dispersal ability of queens competing for access to the same host plants.We used empirical data and inverse modeling--a technique developed by plant ecologists to model seed dispersal--to quantify and compare the dispersal kernels of queens from three Amazonian ant species that compete for access to host-plants. We found that the modal colonization distance of queens varied 8-fold, with the generalist ant species (Crematogaster laevis having a greater modal distance than two specialists (Pheidole minutula, Azteca sp. that use the same host-plants. However, our results also suggest that queens of Azteca sp. have maximal distances that are four-sixteen times greater than those of its competitors.We found large differences between ant species in both the modal and maximal distance ant queens disperse to find vacant seedlings used to found new colonies. These differences could result from interspecific differences in queen body size, and hence wing musculature, or because queens differ in their ability to identify potential host plants while in flight. Our results provide support for one of the necessary conditions underlying several of the hypothesized mechanisms promoting coexistence in tropical plant-ants. They also suggest that for some ant species limited dispersal capability could pose a significant barrier to the rescue of populations in isolated forest fragments. Finally, we demonstrate that inverse models parameterized with field data are an excellent means of quantifying the dispersal of ant queens.

  19. Leaf-cutting ant fungi produce cell wall degrading pectinase complexes reminiscent of phytopathogenic fungi. (United States)

    Schiøtt, Morten; Rogowska-Wrzesinska, Adelina; Roepstorff, Peter; Boomsma, Jacobus J


    Leaf-cutting (attine) ants use their own fecal material to manure fungus gardens, which consist of leaf material overgrown by hyphal threads of the basidiomycete fungus Leucocoprinus gongylophorus that lives in symbiosis with the ants. Previous studies have suggested that the fecal droplets contain proteins that are produced by the fungal symbiont to pass unharmed through the digestive system of the ants, so they can enhance new fungus garden growth. We tested this hypothesis by using proteomics methods to determine the gene sequences of fecal proteins in Acromyrmex echinatior leaf-cutting ants. Seven (21%) of the 33 identified proteins were pectinolytic enzymes that originated from the fungal symbiont and which were still active in the fecal droplets produced by the ants. We show that these enzymes are found in the fecal material only when the ants had access to fungus garden food, and we used quantitative polymerase chain reaction analysis to show that the expression of six of these enzyme genes was substantially upregulated in the fungal gongylidia. These unique structures serve as food for the ants and are produced only by the evolutionarily advanced garden symbionts of higher attine ants, but not by the fungi reared by the basal lineages of this ant clade. Pectinolytic enzymes produced in the gongylidia of the fungal symbiont are ingested but not digested by Acromyrmex leaf-cutting ants so that they end up in the fecal fluid and become mixed with new garden substrate. Substantial quantities of pectinolytic enzymes are typically found in pathogenic fungi that attack live plant tissue, where they are known to breach the cell walls to allow the fungal mycelium access to the cell contents. As the leaf-cutting ant symbionts are derived from fungal clades that decompose dead plant material, our results suggest that their pectinolytic enzymes represent secondarily evolved adaptations that are convergent to those normally found in phytopathogens.

  20. Leaf-cutting ant fungi produce cell wall degrading pectinase complexes reminiscent of phytopathogenic fungi

    Directory of Open Access Journals (Sweden)

    Boomsma Jacobus J


    Full Text Available Abstract Background Leaf-cutting (attine ants use their own fecal material to manure fungus gardens, which consist of leaf material overgrown by hyphal threads of the basidiomycete fungus Leucocoprinus gongylophorus that lives in symbiosis with the ants. Previous studies have suggested that the fecal droplets contain proteins that are produced by the fungal symbiont to pass unharmed through the digestive system of the ants, so they can enhance new fungus garden growth. Results We tested this hypothesis by using proteomics methods to determine the gene sequences of fecal proteins in Acromyrmex echinatior leaf-cutting ants. Seven (21% of the 33 identified proteins were pectinolytic enzymes that originated from the fungal symbiont and which were still active in the fecal droplets produced by the ants. We show that these enzymes are found in the fecal material only when the ants had access to fungus garden food, and we used quantitative polymerase chain reaction analysis to show that the expression of six of these enzyme genes was substantially upregulated in the fungal gongylidia. These unique structures serve as food for the ants and are produced only by the evolutionarily advanced garden symbionts of higher attine ants, but not by the fungi reared by the basal lineages of this ant clade. Conclusions Pectinolytic enzymes produced in the gongylidia of the fungal symbiont are ingested but not digested by Acromyrmex leaf-cutting ants so that they end up in the fecal fluid and become mixed with new garden substrate. Substantial quantities of pectinolytic enzymes are typically found in pathogenic fungi that attack live plant tissue, where they are known to breach the cell walls to allow the fungal mycelium access to the cell contents. As the leaf-cutting ant symbionts are derived from fungal clades that decompose dead plant material, our results suggest that their pectinolytic enzymes represent secondarily evolved adaptations that are convergent to

  1. Dynamic Vehicle Routing Problems with Enhanced Ant Colony Optimization

    Directory of Open Access Journals (Sweden)

    Haitao Xu


    Full Text Available As we all know, there are a great number of optimization problems in the world. One of the relatively complicated and high-level problems is the vehicle routing problem (VRP. Dynamic vehicle routing problem (DVRP is a major variant of VRP, and it is closer to real logistic scene. In DVRP, the customers’ demands appear with time, and the unserved customers’ points must be updated and rearranged while carrying out the programming paths. Owing to the complexity and significance of the problem, DVRP applications have grabbed the attention of researchers in the past two decades. In this paper, we have two main contributions to solving DVRP. Firstly, DVRP is solved with enhanced Ant Colony Optimization (E-ACO, which is the traditional Ant Colony Optimization (ACO fusing improved K-means and crossover operation. K-means can divide the region with the most reasonable distance, while ACO using crossover is applied to extend search space and avoid falling into local optimum prematurely. Secondly, several new evaluation benchmarks are proposed, which can objectively and comprehensively estimate the proposed method. In the experiment, the results for different scale problems are compared to those of previously published papers. Experimental results show that the algorithm is feasible and efficient.

  2. Observations of the "egg white injury" in ants.

    Directory of Open Access Journals (Sweden)

    Laure-Anne Poissonnier

    Full Text Available A key determinant of the relationship between diet and longevity is the balance of protein to carbohydrate in the diet. Eating excess protein relative to carbohydrate shortens lifespan in solitary and social insects. Here we explored how lifespan and behavior in ants was affected by the quality of protein ingested and the presence of associated antinutrients (i.e. compounds that interfere with the absorption of nutrients. We tested diets prepared with either egg white protein only or a protein mixture. Egg white contains an anti-nutrient called avidin. Avidin binds to the B vitamin biotin, preventing its absorption. First, we demonstrate that an egg-white diet was twice as deleterious as a protein-mixture diet. Second, we show that ingestion of egg-white diet drastically affected social behavior, triggering elevated levels of aggression within the colony. Lastly, we reveal that by adding biotin to the egg white diet we were able to lessen its detrimental effects. This latest result suggests that ants suffered biotin deficiency when fed the egg white diet. In conclusion, anti-nutrients were known to affect health and performance of animals, but this is the first study showing that anti-nutrients also lead to severe changes in behavior.

  3. Efficient distribution of toy products using ant colony optimization algorithm (United States)

    Hidayat, S.; Nurpraja, C. A.


    CV Atham Toys (CVAT) produces wooden toys and furniture, comprises 13 small and medium industries. CVAT always attempt to deliver customer orders on time but delivery costs are high. This is because of inadequate infrastructure such that delivery routes are long, car maintenance costs are high, while fuel subsidy by the government is still temporary. This study seeks to minimize the cost of product distribution based on the shortest route using one of five Ant Colony Optimization (ACO) algorithms to solve the Vehicle Routing Problem (VRP). This study concludes that the best of the five is the Ant Colony System (ACS) algorithm. The best route in 1st week gave a total distance of 124.11 km at a cost of Rp 66,703.75. The 2nd week route gave a total distance of 132.27 km at a cost of Rp 71,095.13. The 3rd week best route gave a total distance of 122.70 km with a cost of Rp 65,951.25. While the 4th week gave a total distance of 132.27 km at a cost of Rp 74,083.63. Prior to this study there was no effort to calculate these figures.

  4. Study of heuristics in ant system for nuclear reload optimisation

    International Nuclear Information System (INIS)

    Lima, Alan M.M. de; Schirru, Roberto; Silva, Fernando C. da; Machado, Marcelo D.; Medeiros, Jose A.C.C.


    A Pressurized Water Reactor core must be reloaded every time the fuel burnup reaches a level when it is not possible to sustain nominal power operation. The nuclear core fuel reload optimization consists in finding a burned-up and fresh-fuel-assembly loading pattern that maximizes the number of effective full power days, minimizing the relationship cost/benefit. This problem is NP-hard, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Besides that, the problem is non-linear and its search space is highly discontinual and multimodal. In this work a parallel computational system based on Ant Colony System (ACS) called Artificial-Ant-Colony Networks is used to solve the nuclear reactor core fuel reload optimization problem, with compatibles heuristics. ACS is a system based on artificial agents that uses the reinforcement learning technique and was originally developed to solve the Traveling Salesman Problem, which is conceptually similar to the nuclear fuel reload problem. (author)

  5. El docente ante el oficio de investigar en el aula

    Directory of Open Access Journals (Sweden)

    José Ignacio Bolaños Motta


    Full Text Available El presente escrito está inspirado en la canción titulada La fábula de los tres hermanos, del cantautor cubano Silvio Rodríguez Domínguez. Se espera que a través de estos tres apartes de la letra de esta canción, consecuentemente seleccionados, se genere una reflexión en torno a la actividad de generar proyectos de investigación en la escuela secundaria, o como se suele denominar actualmente investigación en el aula, al respecto se abordan las complicaciones, tópicos y demás problemáticas que eventualmente se pueden presentar en la multiplicidad de compromisos cotidianos ante los cuales se ve enfrentado el docente, al momento de desarrollar un proyecto de investigación en una comunidad educativa desde la metodología de la etnografía, hoy usada en los modelos de investigación en educación y pedagogía. Este documento tiene por objetivo generar una reflexión en torno a la mirada del maestro de escuela secundaria, ante el acto de investigar su contexto escolar de trabajo, y el papel de las universidades, en lo que concierne a la formación de licenciados con competencias en investigación educativa.

  6. Energy gradients and the geographic distribution of local ant diversity. (United States)

    Kaspari, Michael; Ward, Philip S; Yuan, May


    Geographical diversity gradients, even among local communities, can ultimately arise from geographical differences in speciation and extinction rates. We evaluated three models--energy-speciation, energy-abundance, and area--that predict how geographic trends in net diversification rates generate trends in diversity. We sampled 96 litter ant communities from four provinces: Australia, Madagascar, North America, and South America. The energy-speciation hypothesis best predicted ant species richness by accurately predicting the slope of the temperature diversity curve, and accounting for most of the variation in diversity. The communities showed a strong latitudinal gradient in species richness as well as inter-province differences in diversity. The former vanished in the temperature-diversity residuals, suggesting that the latitudinal gradient arises primarily from higher diversification rates in the tropics. However, inter-province differences in diversity persisted in those residuals--South American communities remained more diverse than those in North America and Australia even after the effects of temperature were removed.

  7. Pseudacteon decapitating flies: Potential vectors of a fire ant virus?

    International Nuclear Information System (INIS)

    Valles, S.M.; Porter, S.D.


    Solenopsis invicta virus (SINV-1) is a positive-stranded RNA virus recently found to infect all stages of the red imported fire ant, Solenopsis invicta (Valles et al. 2004; Valles and Strong 2005). SINV-1 and a second genotype have been tentatively assigned to the Dicistroviridae (Mayo 2002). Infected individuals or colonies did not exhibit any immediate, discernible symptoms in the field. However, under stress from introduction into the laboratory, brood death was often observed among infected colonies, ultimately leading to the death of the entire colony (Valles et al. 2004). These characteristics are consistent with other insect-infecting positive-stranded RNA viruses. They often persist as inapparent, asymptomatic infections that, under certain conditions, induce replication within the host, resulting in observable symptoms and often death (Christian and Scotti 1998; Fernandez et al. 2002). The SINV infection rate among colonies was reported to be around 25% in Gainesville, Florida (Valles et al. 2004; Valles and Strong 2005). SINV vertical and horizontal transmission were inferred based on RT-PCR detection of virus genome in eggs and successful colony to colony transfer under lab conditions (Valles et al. 2004). However, the exact mechanisms by which the virus is spread from nest to nest in the field are unknown. Our results indicate that SINV does not replicate within Pseudacteon decapitating flies that parasitize S. invicta. Flies appeared to develop normally from SINV-infected S. invicta workers. Mechanical transmission of SINV to uninfected ants by oviposition appears unlikely

  8. Occurrence and abundance of ants, reptiles, and mammals: Chapter 7 (United States)


    Sagebrush (Artemisia spp.)- associated wildlife are threatened by habitat loss and fragmentation and by impacts associated with anthropogenic disturbances, including energy development. Understanding how species of concern as well as other wildlife including insects, reptiles, and mammals respond to type and spatial scale of disturbance is critical to managing future land uses and identifying sites that are important for conservation. We developed statistical models to describe species occurrence or abundance, based on area searches in 7.29-ha survey blocks, across the Wyoming Basins Ecoregional Assessment (WBEA) area for six shrub steppe-associated species: harvester ant (Pogonomyrmex spp.), thatch ant (Formica spp.), short-horned lizard (Phrynosoma hernandesi), white-tailed jackrabbit (Lepus townsendii), cottontail (Sylvilagus spp.) and least chipmunk (Tamius minimus). We modeled patterns in occupancy or abundance relative to multi-scale measures of vegetation type and pattern, abiotic site characteristics, and anthropogenic disturbance factors. Sagebrush habitat was a strong predictor of occurrence for shorthorned lizards and white-tailed jackrabbits, but weak for the other four species. Vegetation and abiotic characteristics were strong determinants of species occurrence, although the scale of response was not consistent among species. All species, with the exception of the short-horned lizard, responded to anthropogenic disturbance, although responses again varied as a function of scale and direction (negative and positive influences). Our results improve our understanding of how environmental and anthropogenic factors affect species distributions across the WBEA area and facilitate a multi-species approach to management of this sagebrush ecosystem.

  9. Analysis of ante-partum maternal morbidity in rural Bangladesh. (United States)

    Chakraborty, Nitai; Islam, M Ataharul; Chowdhury, Rafiqul Islam; Bari, Wasimul


    This paper presents the results of a prospective study of maternal morbidity during the ante-partum period in rural areas of Bangladesh. The data came from a survey of Maternal Morbidity in Bangladesh, conducted by the Bangladesh Institute of Research for Promotion of Essential and Reproductive Health and Technologies (BIRPERHT) during the period from November 1992 to December 1993. Since then no such national level survey has been conducted in Bangladesh. This paper employs multiple-decrement life table technique, a convenient way of analysing the risks of different types of disease conditions that women experience during the antenatal period for different age categories. The high-risk complications such as ante-partum haemorrhage, excessive vomiting, fits/convulsion and oedema were considered in this study. In this study a cause specific model was applied to explore the differences in the risks exerted at different ages of reproductive life attributable to some selected complications of pregnancy. The results of this study indicate that women of age 25-29 years are less susceptible to most of the selected life-threatening and high-risk complications during pregnancy such as haemorrhage, fits/convulsion and oedema. However, younger women (age or = 30 years) are at greater risk of haemorrhage, fits/convulsion and oedema.

  10. Dual ant colony operational modal analysis parameter estimation method (United States)

    Sitarz, Piotr; Powałka, Bartosz


    Operational Modal Analysis (OMA) is a common technique used to examine the dynamic properties of a system. Contrary to experimental modal analysis, the input signal is generated in object ambient environment. Operational modal analysis mainly aims at determining the number of pole pairs and at estimating modal parameters. Many methods are used for parameter identification. Some methods operate in time while others in frequency domain. The former use correlation functions, the latter - spectral density functions. However, while some methods require the user to select poles from a stabilisation diagram, others try to automate the selection process. Dual ant colony operational modal analysis parameter estimation method (DAC-OMA) presents a new approach to the problem, avoiding issues involved in the stabilisation diagram. The presented algorithm is fully automated. It uses deterministic methods to define the interval of estimated parameters, thus reducing the problem to optimisation task which is conducted with dedicated software based on ant colony optimisation algorithm. The combination of deterministic methods restricting parameter intervals and artificial intelligence yields very good results, also for closely spaced modes and significantly varied mode shapes within one measurement point.

  11. Energy Aware Simple Ant Routing Algorithm for Wireless Sensor Networks

    Directory of Open Access Journals (Sweden)

    Sohail Jabbar


    Full Text Available Network lifetime is one of the most prominent barriers in deploying wireless sensor networks for large-scale applications because these networks employ sensors with nonrenewable scarce energy resources. Sensor nodes dissipate most of their energy in complex routing mechanisms. To cope with limited energy problem, we present EASARA, an energy aware simple ant routing algorithm based on ant colony optimization. Unlike most algorithms, EASARA strives to avoid low energy routes and optimizes the routing process through selection of least hop count path with more energy. It consists of three phases, that is, route discovery, forwarding node, and route selection. We have improved the route discovery procedure and mainly concentrate on energy efficient forwarding node and route selection, so that the network lifetime can be prolonged. The four possible cases of forwarding node and route selection are presented. The performance of EASARA is validated through simulation. Simulation results demonstrate the performance supremacy of EASARA over contemporary scheme in terms of various metrics.

  12. The expression and impact of antifungal grooming in ants. (United States)

    Reber, A; Purcell, J; Buechel, S D; Buri, P; Chapuisat, M


    Parasites can cause extensive damage to animal societies in which many related individuals frequently interact. In response, social animals have evolved diverse individual and collective defences. Here, we measured the expression and efficiency of self-grooming and allo-grooming when workers of the ant Formica selysi were contaminated with spores of the fungal entomopathogen Metarhizium anisopliae. The amount of self-grooming increased in the presence of fungal spores, which shows that the ants are able to detect the risk of infection. In contrast, the amount of allo-grooming did not depend on fungal contamination. Workers groomed all nestmate workers that were re-introduced into their groups. The amount of allo-grooming towards noncontaminated individuals was higher when the group had been previously exposed to the pathogen. Allo-grooming decreased the number of fungal spores on the surface of contaminated workers, but did not prevent infection in the conditions tested (high dose of spores and late allo-grooming). The rate of disease transmission to groomers and other nestmates was extremely low. The systematic allo-grooming of all individuals returning to the colony, be they contaminated or not, is probably a simple but robust prophylactic defence preventing the spread of fungal diseases in insect societies. © 2011 The Authors. Journal of Evolutionary Biology © 2011 European Society For Evolutionary Biology.

  13. Sex ratio and Wolbachia infection in the ant Formica exsecta. (United States)

    Keller, L; Liautard, C; Reuter, M; Brown, W D; Sundström, L; Chapuisat, M


    Sex allocation data in social Hymenoptera provide some of the best tests of kin selection, parent-offspring conflict and sex ratio theories. However, these studies critically depend on controlling for confounding ecological factors and on identifying all parties that potentially manipulate colony sex ratio. It has been suggested that maternally inherited parasites may influence sex allocation in social Hymenoptera. If the parasites can influence sex allocation, infected colonies are predicted to invest more resources in females than non-infected colonies, because the parasites are transmitted through females but not males. Prime candidates for such sex ratio manipulation are Wolbachia, because these cytoplasmically transmitted bacteria have been shown to affect the sex ratio of host arthropods by cytoplasmic incompatibility, parthenogenesis, male-killing and feminization. In this study, we tested whether Wolbachia infection is associated with colony sex ratio in two populations of the ant Formica exsecta that have been the subject of extensive sex ratio studies. In these populations colonies specialize in the production of one sex or the other. We found that almost all F. exsecta colonies in both populations are infected with Wolbachia. However, in neither population did we find a significant association in the predicted direction between the prevalence of Wolbachia and colony sex ratio. In particular, colonies with a higher proportion of infected workers did not produce more females. Hence, we conclude that Wolbachia does not seem to alter the sex ratio of its hosts as a means to increase transmission rate in these two populations of ants.

  14. Study of heuristics in ant system for nuclear reload optimisation

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Alan M.M. de; Schirru, Roberto; Silva, Fernando C. da; Machado, Marcelo D.; Medeiros, Jose A.C.C. [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia (COPPE). Programa de Engenharia Nuclear]. E-mail:;;;;


    A Pressurized Water Reactor core must be reloaded every time the fuel burnup reaches a level when it is not possible to sustain nominal power operation. The nuclear core fuel reload optimization consists in finding a burned-up and fresh-fuel-assembly loading pattern that maximizes the number of effective full power days, minimizing the relationship cost/benefit. This problem is NP-hard, meaning that complexity grows exponentially with the number of fuel assemblies in the core. Besides that, the problem is non-linear and its search space is highly discontinual and multimodal. In this work a parallel computational system based on Ant Colony System (ACS) called Artificial-Ant-Colony Networks is used to solve the nuclear reactor core fuel reload optimization problem, with compatibles heuristics. ACS is a system based on artificial agents that uses the reinforcement learning technique and was originally developed to solve the Traveling Salesman Problem, which is conceptually similar to the nuclear fuel reload problem. (author)

  15. Calibration of Water Supply Systems Based on Ant Colony Optimization

    Directory of Open Access Journals (Sweden)

    Mahmoud Faghfoor Maghrebi


    Full Text Available Leakage is one of the main problems in the water supply systems and due to the limitations in water supply and its costly process, reduction of leak in water distribution networks can be considered as one of the main goals of the water supply authorities. One of the leak detection techniques in water distribution system is the usage of the recorded node pressures at some locations to calibrate the whole system node pressures. Calibration process is accomplished by the optimization of a constrained objective function. Therefore, in addition to performing a hydraulic analysis of the network, application of an optimization technique is needed. In the current paper, a comparsion between the ant colony and genetic algorithm methodes, in calibration of the node pressures and leak detections was investigated. To examine the workability and the way of leak detection, analysis of the network with an assumed leak was carried out. The results showed that the effectiveness of the ant colony optimization in the detection of the position and magnitude of leak in a water network.

  16. A Culture-Sensitive Agent in Kirman's Ant Model (United States)

    Chen, Shu-Heng; Liou, Wen-Ching; Chen, Ting-Yu

    The global financial crisis brought a serious collapse involving a "systemic" meltdown. Internet technology and globalization have increased the chances for interaction between countries and people. The global economy has become more complex than ever before. Mark Buchanan [12] indicated that agent-based computer models will prevent another financial crisis and has been particularly influential in contributing insights. There are two reasons why culture-sensitive agent on the financial market has become so important. Therefore, the aim of this article is to establish a culture-sensitive agent and forecast the process of change regarding herding behavior in the financial market. We based our study on the Kirman's Ant Model[4,5] and Hofstede's Natational Culture[11] to establish our culture-sensitive agent based model. Kirman's Ant Model is quite famous and describes financial market herding behavior from the expectations of the future of financial investors. Hofstede's cultural consequence used the staff of IBM in 72 different countries to understand the cultural difference. As a result, this paper focuses on one of the five dimensions of culture from Hofstede: individualism versus collectivism and creates a culture-sensitive agent and predicts the process of change regarding herding behavior in the financial market. To conclude, this study will be of importance in explaining the herding behavior with cultural factors, as well as in providing researchers with a clearer understanding of how herding beliefs of people about different cultures relate to their finance market strategies.

  17. Automatic optimization of a nuclear reactor reload using the algorithm Ant-Q; A otimizacao automatica da recarga nuclear utilizando o algoritmo Ant-Q

    Energy Technology Data Exchange (ETDEWEB)

    Machado, Liana; Schirru, Roberto [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia. Programa de Engenharia Nuclear


    The nuclear fuel reload optimization is a NP-Complete combinatorial optimization problem. For decades this problem was solved using an expert's knowledge. From the eighties, however there have been efforts to automatic fuel reload and the more recent ones show the Genetic Algorithm's (GA) efficiency on this problem. Following this trend, our aim is to optimization nuclear fuel reload using Ant-Q, artificial theory based algorithms. Ant-Q's results on the Traveling salesman Problem, which is conceptuality similar to fuel reload, are better than GA's. Ant-Q was tested in real application on the cycle 7 reload of Angra I. Comparing Ant-Q result with the GA's, it can be verified that, even without a local heuristics, the former algorithm, as it superiority comparing the GA in Angra I show. Is a valid technique to solve the nuclear fuel reload problem. (author)

  18. Genome-wide and caste-specific DNA methylomes of the ants Camponotus floridanus and Harpegnathos saltator

    DEFF Research Database (Denmark)

    Bonasio, Roberto; Li, Qiye; Lian, Jinmin


    Ant societies comprise individuals belonging to different castes characterized by specialized morphologies and behaviors. Because ant embryos can follow different developmental trajectories, epigenetic mechanisms must play a role in caste determination. Ants have a full set of DNA methyltransfera...

  19. Ant-egg cataract. A study of a family with dominantly inherited congenital (ant-egg) cataract, including a histological examination of the formed elements

    DEFF Research Database (Denmark)

    Nissen, Steffen; Schrøder, H D


    A family with "ant-egg" cataract in three generations is described. The cataract is congenital, probably of autosomal dominant inheritance. Light microscopy of the ant-eggs showed that they are made up of a peripheral zone of lens material and a large almost homogenous centre. Element analysis by......-ray spectrophotometry showed a high content of calcium and phosphorus in the centre. The cataract has been easy to operate on and the postoperative visual results have been good....

  20. Tritrophic effects of birds and ants on a canopy food web, tree growth, and phytochemistry (United States)

    Kailen A. Mooney


    Insectivorous birds and ants co-occur in most terrestrial communities, and theory predicts that emergent properties (i.e., nonadditive effects) can determine their combined influence on arthropods and plants. In a three-year factorial experiment, I investigated whether the effects of birds on pine and its arthropods differed based on the presence of ants that were...

  1. Leaf-cutting ant fungi produce cell wall degrading pectinase complexes reminiscent of phytopathogenic fungi

    DEFF Research Database (Denmark)

    Schiøtt, Morten; Rogowska-Wrzesinska, Adelina; Roepstorff, Peter


    Leaf-cutting (attine) ants use their own fecal material to manure fungus gardens, which consist of leaf material overgrown by hyphal threads of the basidiomycete fungus Leucocoprinus gongylophorus that lives in symbiosis with the ants. Previous studies have suggested that the fecal droplets conta...

  2. Weaver ants convert pest insects into food — prospects for the rural poor

    DEFF Research Database (Denmark)

    Offenberg, Hans Joachim; Wiwatwitaya, Decha


    harvested and eaten. In this way harmful pests are turned into valuable protein food and crops are protected without chemicals. As the weaver ant distribution envelops most of the worlds hunger hot spots this double utilization of ants for increased food production may benefit the people most in ...

  3. Serpentine soils affect heavy metal tolerance but not genetic diversity in a common Mediterranean ant. (United States)

    Frizzi, Filippo; Masoni, Alberto; Çelikkol, Mine; Palchetti, Enrico; Ciofi, Claudio; Chelazzi, Guido; Santini, Giacomo


    Natural habitats with serpentine soils are rich in heavy metal ions, which may significantly affect ecological communities. Exposure to metal pollutants results, for instance, in a reduction of population genetic diversity and a diffused higher tolerance towards heavy metals. In this study, we investigated whether chronic exposure to metals in serpentine soils affect accumulation patterns, tolerance towards metal pollutants, and genetic diversity in ants. In particular, we studied colonies of the common Mediterranean ant, Crematogaster scutellaris, along a contamination gradient consisting of two differently contaminated forests and a reference soil with no geogenic contamination. We first evaluated the metal content in both soil and ants' body. Then, we tested for tolerance towards metal pollutants by evaluating the mortality of ants fed with nickel (Ni) solutions of increasing concentrations. Finally, differences in genetic diversity among ants from different areas were assessed using eight microsatellite loci. Interestingly, a higher tolerance to nickel solutions was found in ants sampled in sites with intermediate levels of heavy metals. This may occur, because ants inhabiting strongly contaminated areas tend to accumulate higher amounts of contaminants. Additional ingestion of toxicants beyond the saturation threshold would lead to death. There was no difference in the genetic diversity among ant colonies sampled in different sites. This was probably the result of queen mediated gene flow during nuptial flights across uncontaminated and contaminated areas of limited geographical extent. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Identifying the Transition between Single and Multiple Mating of Queens in Fungus-Growing Ants

    DEFF Research Database (Denmark)

    Villesen, Palle; Murakami, Takahiro; Schultz, Ted R.


    Obligate mating of females (queens) with multiple males has evolved only rarely in social Hymenoptera (ants, social bees, social wasps) and for reasons that are fundamentally different from those underlying multiple mating in other animals. The monophyletic tribe of ('attine') fungus-growing ants...

  5. The impact of ants on mineral soil properties and processes at different spatial scales

    NARCIS (Netherlands)

    Cammeraat, E.L.H.; Risch, A.C.


    Soil dwelling ants are important soil engineers that have a large impact on the soil ecosystem. This is reflected in the alteration of soil properties by ants due to burrowing activities, the accumulation of organic matter and other nutrients in the soil, which, in turn, alters soil physical,

  6. Ex-Ante Impact Assessment & Value Network Analysis for SI: SIMPACT Working Paper 2

    NARCIS (Netherlands)

    Dhondt, S.; Ven, H. van de; Ziauberyte, R.; Torre, W. van der; Cressey, P.; Kaderabkova, A.; Luna, Á.; Moghadam Saman, S.; Castro Spila, J.; Terstriep, J.


    In this paper, a conceptual framework is presented to conduct an ex-ante impact assessment for social innovation. The building blocks for an ex-ante impact assessment are goal formulation; developing the relationships between inputs, outputs and outcomes; determining the role of stakeholders to

  7. Evaluation Toolbox: Ex-Ante Impact Assessment and Value Network Analysis for SI

    NARCIS (Netherlands)

    Dhondt, S.; Ven, H. van de; Cressey, P.; Kaderabkova, A.; Luna, Á.; Moghadam Saman, S.; Castro Spila, J.; Ziauberyte, R.; Torre, W. van der; Terstriep, J.


    This report contains a toolbox for use with the Ex-Ante Impact Assessment for social innovations as was developed in the report D7.1. This toolbox proposes a series of convenient and useful tools to apply in an ex-ante assessment of social innovation within SIMPACT's policy areas unemployment,

  8. Ex-Ante Impact Assessment & Value Network Analysis for SI: Report Task 7.1

    NARCIS (Netherlands)

    Dhondt, S.; Ven, H. van de; Ziauberyte, R.; Torre, W. van der; Cressey, P.; Kaderabkova, A.; Luna, Á.; Moghadam Saman, S.; Castro Spila, J.; Terstriep, J.


    In this report, a conceptual framework is presented to conduct an ex-ante impact assessment for social innovation. The building blocks for an ex-ante impact assessment are goal formulation; developing the relationships between inputs, outputs and outcomes; determining the role of stakeholders to

  9. Ex-Ante Impact Assessment & Value Network Analysis for SI: SIMPACT Policy Brief 1

    NARCIS (Netherlands)

    Dhondt, S.; Ven, H. van de; Cressey, P.; Kaderabkova, A.; Luna, Á.; Moghadam Saman, S.; Castro Spila, J.; Terstriep, J.


    In this Policy Brief, a conceptual framework is presented to conduct an ex-ante impact assessment for social innovation. The building blocks for an ex-ante impact assessment are goal formulation; developing the relationships between inputs, outputs and outcomes; determining the role of stakeholders

  10. Improved phylogenetic analyses corroborate a plausible position of Martialis heureka in the ant tree of life.

    Directory of Open Access Journals (Sweden)

    Patrick Kück

    Full Text Available Martialinae are pale, eyeless and probably hypogaeic predatory ants. Morphological character sets suggest a close relationship to the ant subfamily Leptanillinae. Recent analyses based on molecular sequence data suggest that Martialinae are the sister group to all extant ants. However, by comparing molecular studies and different reconstruction methods, the position of Martialinae remains ambiguous. While this sister group relationship was well supported by Bayesian partitioned analyses, Maximum Likelihood approaches could not unequivocally resolve the position of Martialinae. By re-analysing a previous published molecular data set, we show that the Maximum Likelihood approach is highly appropriate to resolve deep ant relationships, especially between Leptanillinae, Martialinae and the remaining ant subfamilies. Based on improved alignments, alignment masking, and tree reconstructions with a sufficient number of bootstrap replicates, our results strongly reject a placement of Martialinae at the first split within the ant tree of life. Instead, we suggest that Leptanillinae are a sister group to all other extant ant subfamilies, whereas Martialinae branch off as a second lineage. This assumption is backed by approximately unbiased (AU tests, additional Bayesian analyses and split networks. Our results demonstrate clear effects of improved alignment approaches, alignment masking and data partitioning. We hope that our study illustrates the importance of thorough, comprehensible phylogenetic analyses using the example of ant relationships.

  11. Reduced biological control and enhanced chemical pest management in the evolution of fungus farming in ants

    DEFF Research Database (Denmark)

    Fernández-Marín, Hermógenes; Zimmerman, Jess K; Nash, David R


    To combat disease, most fungus-growing ants (Attini) use antibiotics from mutualistic bacteria (Pseudonocardia) that are cultured on the ants' exoskeletons and chemical cocktails from exocrine glands, especially the metapleural glands (MG). Previous work has hypothesized that (i) Pseudonocardia a...

  12. Low levels of nestmate discrimination despite high genetic differentiation in the invasive pharaoh ant

    DEFF Research Database (Denmark)

    Schmidt, Anna M; d'Ettorre, Patrizia; Pedersen, Jes Søe


    Background Ants typically distinguish nestmates from non-nestmates based on the perception of colony-specific chemicals, particularly cuticular hydrocarbons present on the surface of the ants' exoskeleton. These recognition cues are believed to play an important role in the formation of vast so...

  13. Isolation of a pyrazine alarm pheromone component from the fire ant, Solenopsis invicta. (United States)

    Vander Meer, Robert K; Preston, Catherine A; Choi, Man-Yeon


    Alarm pheromones in social insects are an essential part of a complex of pheromone interactions that contribute to the maintenance of colony integrity and sociality. The alarm pheromones of ants were among the first examples of animal pheromones identified, primarily because of the large amount of chemical produced and the distinctive responses of ants to the pheromone. However, the alarm pheromone of the fire ant, Solenopsis invicta, eluded identification for over four decades. We identified 2-ethyl-3,6-dimethylpyrazine as an alarm pheromone component of S. invicta. Worker fire ants detect the pyrazine alarm pheromone at 30 pg/ml, which is comparable to alarm pheromone sensitivities reported for other ant species. The source of this alarm pheromone are the mandibular glands, which, in fire ants, are not well developed and contain only about 300 pg of the compound, much less than the microgram quantities of alarm pheromones reported for several other ant species. Female and male sexuals and workers produce the pyrazine, which suggests that it may be involved in fire ant mating flight initiation, as well as the typical worker alarm response. This is the first report of 2-ethyl-3,6-dimethylpyrazine from a Solenopsis species and the first example of this alkaloid functioning as an alarm pheromone.

  14. The demographic consequences of mutualism: ants increase host-plant fruit production but not population growth. (United States)

    Ford, Kevin R; Ness, Joshua H; Bronstein, Judith L; Morris, William F


    The impact of mutualists on a partner's demography depends on how they affect the partner's multiple vital rates and how those vital rates, in turn, affect population growth. However, mutualism studies rarely measure effects on multiple vital rates or integrate them to assess the ultimate impact on population growth. We used vital rate data, population models and simulations of long-term population dynamics to quantify the demographic impact of a guild of ant species on the plant Ferocactus wislizeni. The ants feed at the plant's extrafloral nectaries and attack herbivores attempting to consume reproductive organs. Ant-guarded plants produced significantly more fruit, but ants had no significant effect on individual growth or survival. After integrating ant effects across these vital rates, we found that projected population growth was not significantly different between unguarded and ant-guarded plants because population growth was only weakly influenced by differences in fruit production (though strongly influenced by differences in individual growth and survival). However, simulations showed that ants could positively affect long-term plant population dynamics through services provided during rare but important events (herbivore outbreaks that reduce survival or years of high seedling recruitment associated with abundant precipitation). Thus, in this seemingly clear example of mutualism, the interaction may actually yield no clear benefit to plant population growth, or if it does, may only do so through the actions of the ants during rare events. These insights demonstrate the value of taking a demographic approach to studying the consequences of mutualism.

  15. Quantification of ant manure deposition in a tropical agroecosystem: Implications for host plant nitrogen acquisition

    DEFF Research Database (Denmark)

    Pinkalski, Christian Alexander Stidsen; Damgaard, Christian; Jensen, Karl-Martin Vagn


    of ant manure may augment the host plants’ acquisition of nitrogen. In this study, we quantified the manure deposited by colonies of the Asian weaver ant Oecophylla smaragdina. We developed a method to estimate the amount of manure deposited in host trees (Mangifera indica) based on the trail activity...

  16. Ants: Major Functional Elements in Fruit Agro-Ecosystems and Biological Control Agents

    Directory of Open Access Journals (Sweden)

    Lamine Diamé


    Full Text Available Ants are a very diverse taxonomic group. They display remarkable social organization that has enabled them to be ubiquitous throughout the world. They make up approximately 10% of the world’s animal biomass. Ants provide ecosystem services in agrosystems by playing a major role in plant pollination, soil bioturbation, bioindication, and the regulation of crop-damaging insects. Over recent decades, there have been numerous studies in ant ecology and the focus on tree cropping systems has given added importance to ant ecology knowledge. The only missing point in this knowledge is the reasons underlying difference between the positive and negative effects of ants in tree cropping systems. This review article provides an overview of knowledge of the roles played by ants in orchards as functional elements, and on the potential of Oecophylla weaver ants as biological control agents. It also shows the potential and relevance of using ants as an agro-ecological diagnosis tool in orchards. Lastly, it demonstrates the potential elements which may determine the divergent negative and positive of their effects on cropping systems.

  17. CO2 efflux from subterranean nests of ant communities in a seasonal tropical forest, Thailand. (United States)

    Hasin, Sasitorn; Ohashi, Mizue; Yamada, Akinori; Hashimoto, Yoshiaki; Tasen, Wattanachai; Kume, Tomonori; Yamane, Seiki


    Many ant species construct subterranean nests. The presence of their nests may explain soil respiration "hot spots", an important factor in the high CO2 efflux from tropical forests. However, no studies have directly measured CO2 efflux from ant nests. We established 61 experimental plots containing 13 subterranean ant species to evaluate the CO2 efflux from subterranean ant nests in a tropical seasonal forest, Thailand. We examined differences in nest CO2 efflux among ant species. We determined the effects of environmental factors on nest CO2 efflux and calculated an index of nest structure. The mean CO2 efflux from nests was significantly higher than those from the surrounding soil in the wet and dry seasons. The CO2 efflux was species-specific, showing significant differences among the 13 ant species. The soil moisture content significantly affected nest CO2 efflux, but there was no clear relationship between nest CO2 efflux and nest soil temperature. The diameter of the nest entrance hole affected CO2 efflux. However, there was no significant difference in CO2 efflux rates between single-hole and multiple-hole nests. Our results suggest that in a tropical forest ecosystem the increase in CO2 efflux from subterranean ant nests is caused by species-specific activity of ants, the nest soil environment, and nest structure.

  18. Landscape position moderates how ant nests affect hydrology and soil chemistry across a Chihuahuan Desert watershed (United States)

    Ants moderate the supply of critical resources such as water and nutrients in desert environments by changing the physical arrangement of soils during nest construction. We measured water infiltration and soil physical and chemical properties on and off the nests of two ant species (Pogonomyrmex rug...

  19. Accumulation of phosphorus in nests of red wood ants .i.Formica s. str../i

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Kalčík, Jiří; Cudlín, Pavel


    Roč. 42, - (2005), s. 269-275 ISSN 0003-455X Institutional research plan: CEZ:AV0Z60660521; CEZ:AV0Z6087904 Keywords : accumulation of phosphorus * nests of ants * red wood ants Subject RIV: EH - Ecology, Behaviour Impact factor: 0.992, year: 2005

  20. Canopy cover negatively affects arboreal ant species richness in a tropical open habitat

    Directory of Open Access Journals (Sweden)

    A. C. M. Queiroz

    Full Text Available Abstract We tested the hypothesis of a negative relationship between vegetation characteristics and ant species richness in a Brazilian open vegetation habitat, called candeial. We set up arboreal pitfalls to sample arboreal ants and measured the following environmental variables, which were used as surrogate of environmental heterogeneity: tree richness, tree density, tree height, circumference at the base of the plants, and canopy cover. Only canopy cover had a negative effect on the arboreal ant species richness. Vegetation characteristics and plant species composition are probably homogeneous in candeial, which explains the lack of relationship between other environmental variables and ant richness. Open vegetation habitats harbor a large number of opportunistic and generalist species, besides specialist ants from habitats with high temperatures. An increase in canopy cover decreases sunlight incidence and may cause local microclimatic differences, which negatively affect the species richness of specialist ants from open areas. Canopy cover regulates the richness of arboreal ants in open areas, since only few ant species are able to colonize sites with dense vegetation; most species are present in sites with high temperature and luminosity. Within open vegetation habitats the relationship between vegetation characteristics and species richness seems to be the opposite from closed vegetation areas, like forests.

  1. The use of artificial nests by weaver ants: a preliminary field observation

    DEFF Research Database (Denmark)

    Offenberg, Joachim


    of the plantation. This suggests that exposure to harsh weather triggered the use of artificial nests. It was also found that ants preferred to nest in bottles covered with aluminum foil compared to transparent bottles. These findings document an opportunistic nesting behavior of weaver ants and suggest...

  2. The congenital "ant-egg" cataract phenotype is caused by a missense mutation in connexin46

    DEFF Research Database (Denmark)

    Hansen, Lars; Yao, Wenliang; Eiberg, Hans


    "Ant-egg" cataract is a rare, distinct variety of congenital/infantile cataract that was reported in a large Danish family in 1967. This cataract phenotype is characterized by ant-egg-like bodies embedded in the lens in a laminar configuration and is inherited as an autosomal dominant trait. We r...

  3. Identifying the transition between single and multiple mating of queens in fungus-growing ants

    DEFF Research Database (Denmark)

    Villesen, Palle; Murakami, Takahiro; Schultz, Ted R


    Obligate mating of females (queens) with multiple males has evolved only rarely in social Hymenoptera (ants, social bees, social wasps) and for reasons that are fundamentally different from those underlying multiple mating in other animals. The monophyletic tribe of ('attine') fungus-growing ants...

  4. Evolutionary transition from single to multiple mating in fungus-growing ants

    DEFF Research Database (Denmark)

    Villesen, P.; Gertsch, Pia J.; Frydenberg, J.


    Queens of leafcutter ants exhibit the highest known levels of multiple mating (up to 10 mates per queen) among ants. Multiple mating may have been selected to increase genetic diversity among nestmate workers, which is hypothesized to be critical in social systems with large, long-lived colonies ...

  5. Antimicrobial defense shows an abrupt evolutionary transition in the fungus-growing ants

    DEFF Research Database (Denmark)

    Hughes, William O H; Pagliarini, Roberta; Madsen, Henning Bang


    of the reservoir did not relate with the evolutionary transition from lower to higher attines and correlated at most only slightly with colony size. The results thus suggest that the relationship between leaf-cutting ants and their parasites is distinctly different from that for other attine ants, in accord...

  6. The Life of a Dead Ant : The Expression of an Adaptive Extended Phenotype

    NARCIS (Netherlands)

    Andersen, Sandra B.; Gerritsma, Sylvia; Yusah, Kalsum M.; Mayntz, David; Hywel-Jones, Nigel L.; Billen, Johan; Boomsma, Jacobus J.; Hughes, David P.

    Specialized parasites are expected to express complex adaptations to their hosts. Manipulation of host behavior is such an adaptation. We studied the fungus Ophiocordyceps unilateralis, a locally specialized parasite of arboreal Camponotus leonardi ants. Ant-infecting Ophiocordyceps are known to

  7. A mutualism without honeydew: what benefits for Melissotarsus emeryi ants and armored scale insects (Diaspididae?

    Directory of Open Access Journals (Sweden)

    Christian Peeters


    Full Text Available Mutualisms between ants and sap-sucking insects generally involve clear benefits for both partners: the ants provide protection in exchange for honeydew. However, a single ant genus associates with armoured scale insects (Diaspididae that do not excrete honeydew. We studied three colonies of Melissotarsus emeryi ants from two localities in Mozambique. Vast numbers of the diaspidid Morganella conspicua occupied galleries dug by the ants under the bark of living trees. Unlike free-living M. conspicua and other diaspidids, M. conspicua living with ants are known to lack shields, likely because they gain protection against enemies and desiccation. Nevertheless, we documented the occurrence of rare individuals with shields inside ant galleries, indicating that their glands continue to secrete wax and proteins as building material. This is likely to constitute a significant portion of the ants’ diet, in addition to diaspidid exuviae and excretions from the Malpighian tubules. Indeed, Melissotarsus workers cannot walk outside the galleries due to modified middle legs, forcing them to obtain all nourishment within the tree. Melissotarsus founding queens, however, must locate a suitable host tree while flying, and acquire diaspidid crawlers. This mutualism involves ants that are highly specialised to chew through living wood, and diaspidids that can also live freely outside the bark. It is extremely widespread in Africa and Madagascar, recorded from 20 tree families, and harmful effects on plant hosts require rapid study.

  8. The dynamics of plant cell-wall polysaccharide decomposition in leaf-cutting ant fungus gardens.

    Directory of Open Access Journals (Sweden)

    Isabel E Moller

    Full Text Available The degradation of live plant biomass in fungus gardens of leaf-cutting ants is poorly characterised but fundamental for understanding the mutual advantages and efficiency of this obligate nutritional symbiosis. Controversies about the extent to which the garden-symbiont Leucocoprinus gongylophorus degrades cellulose have hampered our understanding of the selection forces that induced large scale herbivory and of the ensuing ecological footprint of these ants. Here we use a recently established technique, based on polysaccharide microarrays probed with antibodies and carbohydrate binding modules, to map the occurrence of cell wall polymers in consecutive sections of the fungus garden of the leaf-cutting ant Acromyrmex echinatior. We show that pectin, xyloglucan and some xylan epitopes are degraded, whereas more highly substituted xylan and cellulose epitopes remain as residuals in the waste material that the ants remove from their fungus garden. These results demonstrate that biomass entering leaf-cutting ant fungus gardens is only partially utilized and explain why disproportionally large amounts of plant material are needed to sustain colony growth. They also explain why substantial communities of microbial and invertebrate symbionts have evolved associations with the dump material from leaf-cutting ant nests, to exploit decomposition niches that the ant garden-fungus does not utilize. Our approach thus provides detailed insight into the nutritional benefits and shortcomings associated with fungus-farming in ants.

  9. Symbiont recognition of mutualistic bacteria by Acromyrmex leaf-cutting ants

    DEFF Research Database (Denmark)

    Zhang, Mingzi; Poulsen, Michael; Currie, Cameron R


    Symbiont choice has been proposed to play an important role in shaping many symbiotic relationships, including the fungus-growing ant-microbe mutualism. Over millions of years, fungus-growing ants have defended their fungus gardens from specialized parasites with antibiotics produced...

  10. Not only the butterflies: managing ants on road verges to benefit Phengaris (Maculinea) butterflies

    NARCIS (Netherlands)

    Wynhoff, I.; Gestel, van R.; Swaay, van C.; Langevelde, van F.


    Obligate myrmecophilic butterfly species, such as Phengaris (Maculinea) teleius and P. nausithous, have narrow habitat requirements. Living as a caterpillar in the nests of the ant species Myrmica scabrinodis and M. rubra, respectively, they can only survive on sites with both host ants and the host

  11. Salticid predation as one potential driving force of ant mimicry in jumping spiders (United States)

    Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min


    Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

  12. How ants find each other; temporal and spatial patterns in nuptial flights

    NARCIS (Netherlands)

    Noordijk, J.; Morssinkhof, R.; Boer, P.; Schaffers, A.P.; Heijerman, Th.; Sykora, K.V.


    Reproduction is a key factor in understanding population ecology and therefore species occurrence. However, patterns in reproductive behaviour for distinct ant species remain insufficiently known. In this paper strategies in mate finding are studied for six ant species (Lasius niger, Lasius

  13. Effects of urban development on ant communities: implications for ecosystem services and management (United States)

    M.P. Sanford; Patricia N. Manley; Dennis D. Murphy


    Research that connects the effects of urbanization on biodiversity and ecosystem services is lacking. Ants perform multifarious ecological functions that stabilize ecosystems and contribute to a number of ecosystem services. We studied responses of ant communities to urbanization in the Lake Tahoe basin by sampling sites along a gradient...

  14. Interaction specificity between leaf-cutting ants and vertically transmitted Pseudonocardia bacteria

    DEFF Research Database (Denmark)

    Breum Andersen, Sandra; Yek, Sze Huei; Nash, David R.


    Background: The obligate mutualism between fungus-growing ants and microbial symbionts offers excellent opportunities to study the specificity and stability of multi-species interactions. In addition to cultivating fungus gardens, these ants have domesticated actinomycete bacteria to defend garde...

  15. Insect symbioses: a case study of past, present, and future fungus-growing ant research

    DEFF Research Database (Denmark)

    Caldera, Eric J; Poulsen, Michael; Suen, Garret


    's fungus garden, antibiotic-producing actinobacteria that help protect the fungus garden from the parasite, and a black yeast that parasitizes the ant-actinobacteria mutualism. The fungus-growing ant symbiosis serves as a particularly useful model system for studying insect-microbe symbioses, because...

  16. Variation in fungal enzyme spectra may affect mutualistic division of labour between ants and fungus gardens

    DEFF Research Database (Denmark)

    de Fine Licht, Henrik Hjarvard; Boomsma, Jacobus Jan

    partners vary in metabolic performance, division of labour may not always be optimized and co-evolutionary trajectories become less predictable. The higher fungus-growing (attine) ants consist of the leafcutter ants (Acromyrmex and Atta), which rear a single fungal species throughout their Latin American...

  17. Ant-Based Phylogenetic Reconstruction (ABPR: A new distance algorithm for phylogenetic estimation based on ant colony optimization

    Directory of Open Access Journals (Sweden)

    Karla Vittori


    Full Text Available We propose a new distance algorithm for phylogenetic estimation based on Ant Colony Optimization (ACO, named Ant-Based Phylogenetic Reconstruction (ABPR. ABPR joins two taxa iteratively based on evolutionary distance among sequences, while also accounting for the quality of the phylogenetic tree built according to the total length of the tree. Similar to optimization algorithms for phylogenetic estimation, the algorithm allows exploration of a larger set of nearly optimal solutions. We applied the algorithm to four empirical data sets of mitochondrial DNA ranging from 12 to 186 sequences, and from 898 to 16,608 base pairs, and covering taxonomic levels from populations to orders. We show that ABPR performs better than the commonly used Neighbor-Joining algorithm, except when sequences are too closely related (e.g., population-level sequences. The phylogenetic relationships recovered at and above species level by ABPR agree with conventional views. However, like other algorithms of phylogenetic estimation, the proposed algorithm failed to recover expected relationships when distances are too similar or when rates of evolution are very variable, leading to the problem of long-branch attraction. ABPR, as well as other ACO-based algorithms, is emerging as a fast and accurate alternative method of phylogenetic estimation for large data sets.

  18. Using Ant Communities For Rapid Assessment Of Terrestrial Ecosystem Health

    Energy Technology Data Exchange (ETDEWEB)

    Wike, L


    relative health of the ecosystem. The IBI, though originally for Midwestern streams, has been successfully adapted to other ecoregions and taxa (macroinvertebrates, Lombard and Goldstein, 2004) and has become an important tool for scientists and regulatory agencies alike in determining health of stream ecosystems. The IBI is a specific type of a larger group of methods and procedures referred to as Rapid Bioassessment (RBA). These protocols have the advantage of directly measuring the organisms affected by system perturbations, thus providing an integrated evaluation of system health because the organisms themselves integrate all aspects of their environment and its condition. In addition to the IBI, the RBA concept has also been applied to seep wetlands (Paller et al. 2005) and terrestrial systems (O'Connell et al. 1998, Kremen et al. 1993, Rodriguez et al. 1998, Rosenberg et al. 1986). Terrestrial RBA methods have lagged somewhat behind those for aquatic systems because terrestrial systems are less distinctly defined and seem to have a less universal distribution of an all-inclusive taxon, such as fish in the IBI, upon which to base an RBA. In the last decade, primarily in Australia, extensive development of an RBA using ant communities has shown great promise. Ants have the same advantage for terrestrial RBAs that fish do for aquatic systems in that they are an essential and ubiquitous component of virtually all terrestrial ecosystems. They occupy a broad range of niches, functional groups, and trophic levels and they possess one very important characteristic that makes them ideal for RBA because, similar to the fishes, there is a wide range of tolerance to conditions within the larger taxa. Within ant communities there are certain groups, genera, or species that may be very robust and abundant under even the harshest impacts. There are also taxa that are very sensitive to disturbance and change and their presence or absence is also indicative of the local

  19. Foraging of Psilocybe basidiocarps by the leaf-cutting ant Acromyrmex lobicornis in Santa Fé, Argentina. (United States)

    Masiulionis, Virginia E; Weber, Roland Ws; Pagnocca, Fernando C


    It is generally accepted that material collected by leaf-cutting ants of the genus Acromyrmex consists solely of plant matter, which is used in the nest as substrate for a symbiotic fungus providing nutrition to the ants. There is only one previous report of any leaf-cutting ant foraging directly on fungal basidiocarps. Basidiocarps of Psilocybe coprophila growing on cow dung were actively collected by workers of Acromyrmex lobicornis in Santa Fé province, Argentina. During this behaviour the ants displayed typical signals of recognition and continuously recruited other foragers to the task. Basidiocarps of different stages of maturity were being transported into the nest by particular groups of workers, while other workers collected plant material. The collection of mature basidiocarps with viable spores by leaf-cutting ants in nature adds substance to theories relating to the origin of fungiculture in these highly specialized social insects.

  20. Nine novel microsatellite markers for the army ant Simopelta pergandei (subfamily Ponerinae)

    DEFF Research Database (Denmark)

    Kronauer, D.J.C.; Boomsma, J.J.; Pierce, N.E.


    Simopelta (subfamily Ponerinae) army ants are specialized predators of other ants in New World tropical forests. Although they show a striking convergence in overall life-history with the well known army ants of the subfamilies Aenictinae, Dorylinae, and Ecitoninae, the genus has been little...... studied. We developed and characterized nine novel microsatellite loci for S. pergandei with 2-8 observed alleles (mean: 5.2) and expected heterozygosities between 0.16 and 0.87 (mean: 0.68). Three of these loci reliably cross-amplified in a second species, S. pentadentata, with 4-8 alleles (mean: 8.......0) and expected heterozygosities between 0.32 and 0.85 (mean: 0.65). These genetic markers will be useful in studying the sociobiology and molecular ecology of Simopelta army ants and in elucidating convergent evolutionary trajectories that have culminated in the army ant lifestyle...