Two new species of the Liolaemus elongatus-kriegi complex (Iguania, Liolaemidae) from Andean highlands of southern Chile

Science.gov (United States)

Troncoso-Palacios, Jaime; Díaz, Hugo A.; Esquerré, Damien; Urra, Felix A.

2015-01-01

Abstract The elongatus-kriegi complex is one of the most diverse clades of the Liolaemus (sensu stricto) subgenus of lizards. There are currently 29 species recognized in this group distributed between Chile and Argentina. Based on molecular evidence, there seem to be five main clades nested within this complex: the elongatus, leopardinus, kriegi, petrophilus and punmahuida clades. Liolaemus buergeri and Liolaemus kriegi, both of the kriegi clade, were believed to inhabit the surroundings of the Laja Lagoon, in the Biobío Region of Chile. Moreover, this Chilean population of Liolaemus kriegi was recently recognized as an undescribed taxon called “Liolaemus sp. A” based on molecular phylogenetics. In this work, we studied these two populations of the Laja Lagoon and provided the morphological diagnosis to describe them as two new species: Liolaemus scorialis sp. n. and Liolaemus zabalai sp. n., previously considered Liolaemus buergeri and “Liolaemus kriegi/Liolaemus sp. A” respectively. Additionally, we identified another population of Liolaemus scorialis in the vicinity of La Mula Lagoon in the Araucanía Region of Chile. Liolaemus scorialis differs from almost all of the species of the elongatus-kriegi complex by its considerably smaller size. Nevertheless, without molecular data we cannot assign it to any particular subclade. Liolaemus zabalai belongs to the kriegi clade based on published molecular phylogenies. Finally, we provide some natural history data on both species and we document for the first time the presence of Liolaemus neuquensis in Chile from a museum specimen from La Mula Lagoon. PMID:25987873

Seasonal changes in food quantity and quality of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus: a bioassay approach

DEFF Research Database (Denmark)

Koski, Marja; Dutz, Jörg; Klein Breteler, W.

2010-01-01

We evaluated the food quantity and quality over a seasonal cycle for the development and egg production of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus, using a bioassay approach. Seston was sampled from December to October from a well-mixed water column of the Mar......We evaluated the food quantity and quality over a seasonal cycle for the development and egg production of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus, using a bioassay approach. Seston was sampled from December to October from a well-mixed water column...... with the seston from the spring bloom in March-April. The juveniles of both species were able to complete their development only in spring experiments. A multiple regression analyses and comparison to a good-quality standard food of the same concentration suggested that, in an annual scale, the egg production...

A new species of Leporinus Agassiz, 1829 from the upper Rio Paraná basin (Characiformes, Anostomidae with redescription of L. elongatus Valenciennes, 1850 and L. obtusidens (Valenciennes, 1837

Directory of Open Access Journals (Sweden)

Heraldo A. Britski

2012-01-01

Full Text Available Leporinus obtusidens Valenciennes, 1837 and L. elongatus Valenciennes, 1850 are redescribed based on the type specimens, including those of their junior synonyms, and recently collected specimens. Leporinus obtusidens is considered to be widespread, occuring in the river drainages of La Plata, São Francisco, and Parnaíba. Leporinus aguapeiensis Campos, 1945, described from the upper Rio Paraná, and L. silvestrii Boulenger, 1902, described from the Rio Paraguay, are considered junior synonyms of L. obtusidens. Leporinus elongatus is endemic to the Rio Jequitinhonha and Rio Pardo, two eastern Brazilian river basins, and the locality cited for the lectotype, Rio São Fransico, likely to be erroneous. Leporinus crassilabris Borodin, 1929, and L. crassilabris breviceps Borodin, 1929, both described from the Rio Jequitinhonha, are considered junior synynoms of L. elongatus. A new species of Leporinus, endemic to the upper Rio Paraná, very similar and sometimes mistaken with L. obtusidens, is formally described. In addition, comments on Leporinus pachyurus Valenciennes, 1850 and on L. bimaculatus Castelnau, 1855 are provided, and a lectotype for L. bimaculatus is selected.

Morphology, chemistry and function of the postpharyngeal gland in the South American digger wasps Trachypus boharti and Trachypus elongatus.

Directory of Open Access Journals (Sweden)

Gudrun Herzner

Full Text Available Microbes pose severe threats to animals as competitors or pathogens and strongly affect the evolution of life history traits like parental care. Females of the European beewolf Philanthus triangulum, a solitary digger wasp, provision their offspring with paralyzed honeybees and embalm them with the secretion from large postpharyngeal glands (PPG that contain mainly unsaturated hydrocarbons. This coating changes the physico-chemical properties of the prey surface, causes a reduction of water condensation and retards growth of mold fungi. Here we examined the closely related South American genus Trachypus, which shows a life-history similar to Philanthus. We investigated whether Trachypus spp. also possess PPGs and embalm larval provisions. Using histological methods and 3D reconstructions we show that Trachypus boharti and T. elongatus possess PPGs that are similar to P. triangulum but somewhat smaller. The ultrastructure of the gland epithelium suggests that the gland content is at least partly sequestered from the hemolymph. Chemical analyses using gas chromatography / mass spectrometry revealed that both the cuticle and PPGs of Trachypus contain mainly unsaturated long-chain hydrocarbons. The gland of T. boharti additionally contains long-chain ketones. The hydrocarbons from the PPG of T. elongatus occurred on prey bees excavated from nests in the field but not on conspecific control bees. While the embalming only slightly elevated the amount of hydrocarbons on prey bees, the proportion of unsaturated hydrocarbons, which is crucial for the antifungal effect, was significantly increased. The Trachypus species under study possess PPGs that are very similar to the PPG of P. triangulum with regard to morphology, ultrastructure and chemistry. Moreover, we provide clear evidence that T. elongatus females embalm their prey, presumably as a means of prey preservation. The observed differences among Trachypus and Philanthus in gland size and prey

The structure of allophycocyanin from Thermosynechococcus elongatus at 3.5 Å resolution

Energy Technology Data Exchange (ETDEWEB)

Murray, James William; Maghlaoui, Karim; Barber, James, E-mail: j.barber@imperial.ac.uk [Division of Molecular Biosciences, Imperial College, Exhibition Road, London SW7 2AZ (United Kingdom)

2007-12-01

The crystal structure of a light-harvesting protein that interacts with photosystem II is reported. Cyanobacteria and red algae use light-harvesting pigments bound by proteins to capture solar radiation and to channel excitation energy into their reaction centres. In most cyanobacteria, a multi-megadalton soluble structure known as the phycobilisome is a major light-harvesting system. Allophycocyanin is the main component of the phycobilisome core, forming a link between the rest of the phycobilisome and the reaction-centre core. The crystal structure of allophycocyanin from Thermosynechococcus elongatus (TeAPC) has been determined and refined at 3.5 Å resolution to a crystallographic R value of 26.0% (R{sub free} = 28.5%). The structure was solved by molecular replacement using the allophycocyanin structure from Spirulina platensis as the search model. The asymmetric unit contains an (αβ) monomer which is expanded by symmetry to a crystallographic trimer.

Spatial genetic structure and mitochondrial DNA phylogeography of Argentinean populations of the grasshopper Dichroplus elongatus.

Directory of Open Access Journals (Sweden)

Natalia Rosetti

Full Text Available Many grasshopper species are considered of agronomical importance because they cause damage to pastures and crops. Comprehension of pest population dynamics requires a clear understanding of the genetic diversity and spatial structure of populations. In this study we report on patterns of genetic variation in the South American grasshopper Dichroplus elongatus which is an agricultural pest of crops and forage grasses of great economic significance in Argentina. We use Direct Amplification of Minisatellite Regions (DAMD and partial sequences of the cytochrome oxydase 1 (COI mitochondrial gene to investigate intraspecific structure, demographic history and gene flow patterns in twenty Argentinean populations of this species belonging to different geographic and biogeographic regions. DAMD data suggest that, although genetic drift and migration occur within and between populations, measurable relatedness among neighbouring populations declines with distance and dispersal over distances greater than 200 km is not typical, whereas effective gene flow may occur for populations separated by less than 100 km. Landscape analysis was useful to detect genetic discontinuities associated with environmental heterogeneity reflecting the changing agroecosystem. The COI results indicate the existence of strong genetic differentiation between two groups of populations located at both margins of the Paraná River which became separated during climate oscillations of the Middle Pleistocene, suggesting a significant restriction in effective dispersion mediated by females and large scale geographic differentiation. The number of migrants between populations estimated through mitochondrial and DAMD markers suggest that gene flow is low prompting a non-homogeneous spatial structure and justifying the variation through space. Moreover, the genetic analysis of both markers allows us to conclude that males appear to disperse more than females, reducing the chance of the

The study of desiccation-tolerance in drying leaves of the desiccation-tolerant grass Sporobolus elongatus and the desiccation-sensitive grass Sporobolus pyramidalis.

Science.gov (United States)

Ghasempour, Hamid Reza; Kianian, Jahanbakheshe

2007-03-01

Hydrated leaves of the resurrection grass Sporobolus elongatus are not desiccation tolerant (DT), but moderate to severe drought stress can induce their DT with the leaves remain attach to drying intact plants. In vivo protein synthesis was studied with SDS-page of extracts of leaves of intact drying plants of S. elongatus (a desiccation-Tolerant grass (DT)) and S. pyramidalis (a desiccation-sensitive species (DS)). Free proline increased in drying leaves. Soluble sugar contents also increased with drying but were less than fully hydrated leaves at 8% RWC. Total protein also showed an increase with an exception at 8% RWC which showed a decrease. SDS-page of extracts of drying leaves of both DT and DS plants were studied as relative water contents (RWC) decreased. In first phase, DT species at 58% RWC (80-51% RWC range), two proteins increased in contents. In the second phase, at 8% (35-4% RWC range) two new bands increased and two bands decreased. In leaves of DS species some bands decreased as drying progressed. Also, as drying advanced free proline increased in DT species. Total protein increased as drying increased but at 8% RWC decreased. All data of results are consistent with current views about studied factors and their roles during drying and induction of desiccation tolerance in DT plants.

Distribución geográfica, prevalencia e intensidad de las infecciones de Gregarina ronderosi (Eugregarinorida: Gregarinidae en Dichroplus elongatus (Orthoptera: Acrididae

Directory of Open Access Journals (Sweden)

Christian Bardi

2016-01-01

Full Text Available regarina ronderosi es un parásito obligado del tracto digestivo del acrídido plaga Dichroplus elongatus y una de las únicas dos eugregarinas de acrídidos argentinos descriptas con su ciclo de vida completo. Dada la falta de conocimiento acerca de aspectos epizootiológicos fundamentales de las infecci- ones causadas por eugregarinas en acrídidos de Argentina, el objetivo de esta contribución es iniciar el registro de la distribución geográfica de G. ronderosi en la región Pampeana, su prevalencia natural y la intensidad de las infecciones en condiciones naturales. Para ello, se colectaron ejemplares de D. elongatus (2008 – 2012 en distintos puntos de la región Pampeana. Se obtuvieron y analizaron un total de 4084 ejemplares provenientes de cuarenta y dos localidades. La prevalen- cia promedio de G. ronderosi para el total de localidades con presencia (diecisiete localidades fue de 29,7 ± EE 6,6% (n = 1071. El total de individuos infectados (n = 396 fue categorizado respecto de la intensidad de las infecciones: tres (0,8% presentaron infecciones muy fuertes, ochenta (20% fuerte, doscientos diez (53% moderadas y ciento tres (26% infecciones leves. Se ha ampliado la distribución ge- ográfica conocida, se han registrado prevalencias elevadas que sugieren la ocur - rencia de epizootias y se han registrado por primera vez en condiciones naturales infecciones de G. ronderosi categorizadas como Fuertes y Muy Fuertes.

Photoautotrophic production of polyhydroxyalkanoates in a synthetic mixed culture of Synechococcus elongatus cscB and Pseudomonas putida cscAB.

Science.gov (United States)

Löwe, Hannes; Hobmeier, Karina; Moos, Manuel; Kremling, Andreas; Pflüger-Grau, Katharina

2017-01-01

One of the major challenges for the present and future generations is to find suitable substitutes for the fossil resources we rely on today. Cyanobacterial carbohydrates have been discussed as an emerging renewable feedstock in industrial biotechnology for the production of fuels and chemicals, showing promising production rates when compared to crop-based feedstock. However, intrinsic capacities of cyanobacteria to produce biotechnological compounds are limited and yields are low. Here, we present an approach to circumvent these problems by employing a synthetic bacterial co-culture for the carbon-neutral production of polyhydroxyalkanoates (PHAs) from CO 2 . The co-culture consists of two bio - modules : Bio - module I , in which the cyanobacterial strain Synechococcus elongatus cscB fixes CO 2 , converts it to sucrose, and exports it into the culture supernatant; and bio - module II , where this sugar serves as C-source for Pseudomonas putida cscAB and is converted to PHAs that are accumulated in the cytoplasm. By applying a nitrogen-limited process, we achieved a maximal PHA production rate of 23.8 mg/(L day) and a maximal titer of 156 mg/L. We will discuss the present shortcomings of the process and show the potential for future improvement. These results demonstrate the feasibility of mixed cultures of S. elongatus cscB and P. putida cscAB for PHA production, making room for the cornucopia of possible products that are described for P. putida . The construction of more efficient sucrose-utilizing P. putida phenotypes and the optimization of process conditions will increase yields and productivities and eventually close the gap in the contemporary process. In the long term, the co-culture may serve as a platform process, in which P. putida is used as a chassis for the implementation of synthetic metabolic pathways for biotechnological production of value-added products.

ppGpp Controls Global Gene Expression in Light and in Darkness in S. elongatus

Directory of Open Access Journals (Sweden)

Anna M. Puszynska

2017-12-01

Full Text Available The bacterial and plant stringent response involves production of the signaling molecules guanosine tetraphosphate and guanosine pentaphosphate ((pppGpp, leading to global reorganization of gene expression. The function of the stringent response has been well characterized in stress conditions, but its regulatory role during unstressed growth is less studied. Here, we demonstrate that (pppGpp-deficient strains of S. elongatus have globally deregulated biosynthetic capacity, with increased transcription rate, translation rate, and cell size in unstressed conditions in light and impaired viability in darkness. Synthetic restoration of basal guanosine tetraphosphate (ppGpp levels is sufficient to recover transcriptional balance and appropriate cell size in light and to rescue viability in light/dark conditions, but it is insufficient to enable efficient dark-induced transcriptional shutdown. Our work underscores the importance of basal ppGpp signaling for regulation of cyanobacterial physiology in the absence of stress and for viability in energy-limiting conditions, highlighting that basal (pppGpp level is essential in cyanobacteria in the environmental light/dark cycle.

The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

Science.gov (United States)

Danchin, Etienne G.J.; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Da Rocha, Martine; Bajew, Simon; Neilson, Roy; Sokolova (Guzeeva), Elena; Da Silva, Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Johannes; Jones, John T.

2017-01-01

Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq) to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus, representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus, respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum. PMID:29065523

The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes.

Science.gov (United States)

Danchin, Etienne G J; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Da Rocha, Martine; Bajew, Simon; Neilson, Roy; Guzeeva, Elena Sokolova; Da Silva, Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Johannes; Jones, John T; den Akker, Sebastian Eves-van

2017-10-23

Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq) to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus , representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus , respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum.

The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

Directory of Open Access Journals (Sweden)

Etienne G.J. Danchin

2017-10-01

Full Text Available Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus, representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus, respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum.

Proximate composition, mineral content and fatty acid profile of two marine fishes from Cameroonian coast: Pseudotolithus typus (Bleeker, 1863 and Pseudotolithus elongatus (Bowdich, 1825

Directory of Open Access Journals (Sweden)

J.M. Njinkoue

2016-10-01

Full Text Available Background: Knowledge of chemical composition of fish from Cameroon is poor. The genera Pseudotolithus are nutritionally and economically important in Cameroon. Thus the knowledge on their chemical composition could help in functional food elaboration. Purpose: In this study, Proximate composition, fatty acid profiles and mineral composition were determined in two fish species, Pseudotolithus typus and Pseudotolithus elongatus from Cameroonian coasts. Basic procedure: AOAC standard method was used. Fatty acids were identified by GC/MS as N-acylpyrolidides. Mineral compositions were determined by atomic absorption spectrophotometry for Ca, Na, K, Mg, Fe, Zn, Cu, Mn, and by UV spectrophotometry for phosphorus (P. Main finding: Results indicated that chemical composition was not similar in the two fish species. Results also showed that water is the main constituent in the edible parts and in the bones with 76.17% to 78.24% and 51.21% to 55.28% respectively. Pseudotolithus typus and Pseudotolithus elongatus were good sources of proteins with 16.17% and 13.4% respectively. All the fish analyzed for fat were lean with fat contents less than 0.5%. These species of fish were poor in ω6PUFA and were rich in ω3PUFA with about one third of total fatty acids. The main ω3 fatty acids were eicosapentaenoic acid (EPA and docosahexaenoic acid (DHA. The most abundant main elements were the potassium in the edible parts (1.39% and calcium in the bones (18.26%. The most abundant trace elements were Zn and Fe in the edible parts and in the bones. Principal conclusion: The Na/K ratio values and ω3 fatty acids contents suggest that consumption of these two fish species could be recommended to prevent cardiovascular diseases. Keywords: Proximal composition, Mineral content, Fatty acid profiles, Pseudotolithus typus, Pseudotolithus elongates

CRISPR/Cas9 mediated targeted mutagenesis of the fast growing cyanobacterium Synechococcus elongatus UTEX 2973.

Science.gov (United States)

Wendt, Kristen E; Ungerer, Justin; Cobb, Ryan E; Zhao, Huimin; Pakrasi, Himadri B

2016-06-23

As autotrophic prokaryotes, cyanobacteria are ideal chassis organisms for sustainable production of various useful compounds. The newly characterized cyanobacterium Synechococcus elongatus UTEX 2973 is a promising candidate for serving as a microbial cell factory because of its unusually rapid growth rate. Here, we seek to develop a genetic toolkit that enables extensive genomic engineering of Synechococcus 2973 by implementing a CRISPR/Cas9 editing system. We targeted the nblA gene because of its important role in biological response to nitrogen deprivation conditions. First, we determined that the Streptococcus pyogenes Cas9 enzyme is toxic in cyanobacteria, and conjugational transfer of stable, replicating constructs containing the cas9 gene resulted in lethality. However, after switching to a vector that permitted transient expression of the cas9 gene, we achieved markerless editing in 100 % of cyanobacterial exconjugants after the first patch. Moreover, we could readily cure the organisms of antibiotic resistance, resulting in a markerless deletion strain. High expression levels of the Cas9 protein in Synechococcus 2973 appear to be toxic and result in cell death. However, introduction of a CRISPR/Cas9 genome editing system on a plasmid backbone that leads to transient cas9 expression allowed for efficient markerless genome editing in a wild type genetic background.

Modelling Pseudocalanus elongatus stage-structured population dynamics embedded in a water column ecosystem model for the northern North Sea

Science.gov (United States)

Moll, Andreas; Stegert, Christoph

2007-01-01

This paper outlines an approach to couple a structured zooplankton population model with state variables for eggs, nauplii, two copepodites stages and adults adapted to Pseudocalanus elongatus into the complex marine ecosystem model ECOHAM2 with 13 state variables resolving the carbon and nitrogen cycle. Different temperature and food scenarios derived from laboratory culture studies were examined to improve the process parameterisation for copepod stage dependent development processes. To study annual cycles under realistic weather and hydrographic conditions, the coupled ecosystem-zooplankton model is applied to a water column in the northern North Sea. The main ecosystem state variables were validated against observed monthly mean values. Then vertical profiles of selected state variables were compared to the physical forcing to study differences between zooplankton as one biomass state variable or partitioned into five population state variables. Simulated generation times are more affected by temperature than food conditions except during the spring phytoplankton bloom. Up to six generations within the annual cycle can be discerned in the simulation.

Diversidade genética de três estoques de piapara (Leporinus elongatus, utilizando RAPD = Genetic diversity of three stocks of piapara (Leporinus elongatus, using RAPD

Directory of Open Access Journals (Sweden)

Patrícia Cristina Gomes

2008-04-01

Full Text Available Recentemente a produção aquícola brasileira tem apresentado grandeprogresso. Dentre as espécies nativas cultivadas no Brasil, a piapara (Leporinus elongatus tem sido amplamente preconizada. Com objetivo de avaliar os programas de repovoamento, foram analisadas a variabilidade e a divergência genética de três estoques de piapara com a técnica de RAPD (Random Amplified Polymorphic. O primeiro estoque pertence à Estação de Aquicultura e Hidrologia da Duke Energy International (A; o segundo, à piscicultura de Rolândia (B e o terceiro, ao Programa de Repovoamento dos Rios do Paraná (C. Os dezprimers para RAPD utilizados produziram 105 fragmentos polimórficos, conferindo um polimorfismo de 98,1% para os três estoques avaliados. A porcentagem de locos polimórficos e índice de Shannon foi superior para o estoque A. Porém, todos valores foram elevados, indicando alta diversidade intrapopulacional. Os valores de Gst indicam que houvebaixa diferenciação genética entre os estoques A x B e moderada diferenciação entre os demais. O Nm foi maior entre os estoques A x B. A distância genética e o dendrograma indicam que os estoques A x B são menos distantes geneticamente.Latelly, aquiculture production in Brazil has made great strides. Among the native species cultivated in Brazil, piapara (Leporinus elogatus has been widely praised. With the objective of evaluating restocking programs, the variability and genetic divergence ofthree piapara stocks were analyzed using the RAPD (Random Amplified Polymorphic DNA technique. The first stock belongs to the Aquiculture and Hydrology Station of Duke Energy International (A; the second one belongs to a fish farm in the city of Rolândia(B; and the third to the River Restocking Program of Paraná (C. The ten primers used for RAPD produced 105 polymorphic loci, conferring a polymorphism of 98.1% for the three evaluated stocks. Polymorphic loci percentage and Shannon index were higher for stock A

Alcohol-tolerant mutants of cyanobacterium Synechococcus elongatus PCC 7942 obtained by single-cell mutant screening system.

Science.gov (United States)

Arai, Sayuri; Hayashihara, Kayoko; Kanamoto, Yuki; Shimizu, Kazunori; Hirokawa, Yasutaka; Hanai, Taizo; Murakami, Akio; Honda, Hiroyuki

2017-08-01

Enhancement of alcohol tolerance in microorganisms is an important strategy for improving bioalcohol productivity. Although cyanobacteria can be used as a promising biocatalyst to produce various alcohols directly from CO 2 , low productivity, and low tolerance against alcohols are the main issues to be resolved. Nevertheless, to date, a mutant with increasing alcohol tolerance has rarely been reported. In this study, we attempted to select isopropanol (IPA)-tolerant mutants of Synechococcus elongatus PCC 7942 using UV-C-induced random mutagenesis, followed by enrichment of the tolerant candidates in medium containing 10 g/L IPA and screening of the cells with a high growth rate in the single cell culture system in liquid medium containing 10 g/L IPA. We successfully acquired the most tolerant strain, SY1043, which maintains the ability to grow in medium containing 30 g/L IPA. The photosynthetic oxygen-evolving activities of SY1043 were almost same in cells after 72 h incubation under light with or without 10 g/L IPA, while the activity of the wild-type was remarkably decreased after the incubation with IPA. SY1043 also showed higher tolerance to ethanol, 1-butanol, isobutanol, and 1-pentanol than the wild type. These results suggest that SY1043 would be a promising candidate to improve alcohol production using cyanobacteria. Biotechnol. Bioeng. 2017;114: 1771-1778. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

The NADPH thioredoxin reductase C functions as an electron donor to 2-Cys peroxiredoxin in a thermophilic cyanobacterium Thermosynechococcus elongatus BP-1

International Nuclear Information System (INIS)

Sueoka, Keigo; Yamazaki, Teruaki; Hiyama, Tetsuo; Nakamoto, Hitoshi

2009-01-01

An NADPH thioredoxin reductase C was co-purified with a 2-Cys peroxiredoxin by the combination of anion exchange chromatography and electroelution from gel slices after native PAGE from a thermophilic cyanobacterium Thermosynechococcus elongatus as an NAD(P)H oxidase complex induced by oxidative stress. The result provided a strong evidence that the NADPH thioredoxin reductase C interacts with the 2-Cys peroxiredoxin in vivo. An in vitro reconstitution assay with purified recombinant proteins revealed that both proteins were essential for an NADPH-dependent reduction of H 2 O 2 . These results suggest that the reductase transfers the reducing power from NADPH to the peroxiredoxin, which reduces peroxides in the cyanobacterium under oxidative stress. In contrast with other NADPH thioredoxin reductases, the NADPH thioredoxin reductase C contains a thioredoxin-like domain in addition to an NADPH thioredoxin reductase domain in the same polypeptide. Each domain contains a conserved CXYC motif. A point mutation at the CXYC motif in the NADPH thioredoxin reductase domain resulted in loss of the NADPH oxidation activity, while a mutation at the CXYC motif in the thioredoxin-like domain did not affect the electron transfer, indicating that this motif is not essential in the electron transport from NADPH to the 2-Cys peroxiredoxin.

Isolation, one-step affinity purification, and characterization of a polyextremotolerant laccase from the halophilic bacterium Aquisalibacillus elongatus and its application in the delignification of sugar beet pulp.

Science.gov (United States)

Rezaei, Shahla; Shahverdi, Ahmad Reza; Faramarzi, Mohammad Ali

2017-04-01

The aim of the present work was to study the ability of a halophilic bacterial laccase to efficient delignification in extreme conditions. Here, a highly stable extracellular laccase showing ligninolytic activity from halophilic Aquisalibacillus elongatus is described. The laccase production was strongly influenced by NaCl and CuSO 4 and under optimal conditions reached 4.8UmL -1 . The monomeric enzyme of 75kDa was purified by a synthetic affinity column with 68.2% yield and 99.8-fold purification. The enzyme showed some valuable features viz. stability against a wide range of organic solvents, salts, metals, inhibitors, and surfactants and specificity to a wide spectrum of substrates diverse in structure and redox potential. It retained more than 50% of the original activity at 25-75°C and pH 5.0-10.0. Furthermore, the enzyme was found to be effective in the delignification of sugar beet pulp in an ionic liquid that makes it useful for industrial applications. Copyright © 2017 Elsevier Ltd. All rights reserved.

Distribución del género Diplodon (Mollusca: Bivalvia: Hyriidae en territorio Argentino mediante el uso de Colecciones Biológicas

Directory of Open Access Journals (Sweden)

Santiago Hernán Torres

2013-10-01

Full Text Available Los bivalvos nacaríferos dulciacuícolas (“náyades”, son especies infaunales, endémicas de la RegiónNeotropical, pertenecientes a las familias Hyriidae (Swaison, 1840 y Etheriidae (Swaison, 1840. La alteración del ambiente y la competencia con especies invasoras como Corbicula fluminea (Müller, 1774 y Limnoperna fortunei (Dunker, 1857, impactan sobre las poblaciones naturales. En esta comunicación, se presenta el inicio de un Proyecto de investigación sobre la distribución geográfica de las especies del género Diplodon en la Argentina. Estas especies son un componente importante de la infauna de los cuerpos lóticos y lénticos, viviendo en fondos limosos, limo-arenosos, excepcionalmente en sustratos duros, con un régimen nutricio filtrador, teniendo un papel importante como recicladores de materia orgánica. Conocer la distribución de los bivalvos pertenecientes al género Diplodon en el territorio Argentino permitirá el reconocimiento de potenciales áreas prioritarias para su conservación. Sobre la base de la bibliografía disponible y los ejemplares de las especies del genero Diplodon depositados en la Colección Malacológica del Museo de La Plata (FCNyM-UNLP, se confeccionó una matriz de datos que incluye la identificación del ejemplar, la colección en que se encuentra depositado, el número de catálogo, la localidad y la fecha de colecta. Cada localidad fue ubicada mediante el uso de cartas geográficas de Argentina y revisiones bibliográficas en imágenes satelitales de GoogleEarth, asignando las coordenadas para cada punto. Como resultado del trabajo se obtiene la distribución de estas especies nativas y se discute el grado de solapamiento con las dos especies de bivalvos invasores y el impacto de actividades humanas. 

Development of a high-frequency in vivo transposon mutagenesis system for Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942.

Science.gov (United States)

Watabe, Kazuyuki; Mimuro, Mamoru; Tsuchiya, Tohru

2014-11-01

Synechocystis sp. PCC 6803 (Synechocystis) is the first sequenced photosynthetic organism and has two advantages: natural transformation and light-activated heterotrophic growth. Such characteristics have mainly promoted reverse genetic analysis in this organism, however, to date approximately 50% of genes are still annotated as 'unknown protein' or 'hypothetical protein'. Therefore, forward genetic analysis is required for the identification of significant genes responsible for photosynthesis and other physiological phenomena among the genes of unknown function. The in vivo transposon mutagenesis system is one of the major methods for random mutagenesis. However, present in vivo transposon mutagenesis systems for cyanobacteria face problems such as relatively low frequency of transposition and repeated transposition in the host cells. In this study, we constructed vectors based on a mini-Tn5-derived vector that was designed to prevent repeated transposition. Our vectors carry a hyperactive transposase and optimized recognition sequence of transposase, which were reported to enhance frequency of transposition. Using the vector, we succeeded in highly frequent transposition (9×10(-3) per recipient cell) in Synechocystis. Transposon insertion sites of 10 randomly selected mutants indicated that the insertion sites spread throughout the genome with low sequence dependency. Furthermore, one of the 10 mutants exhibited the slow-growing phenotype, and the mutant was functionally complemented by using our expression vector. Our system also worked with another model cyanobacterium, Synechococcus elongatus PCC 7942, with high frequency. These results indicate that the developed system can be applied to the forward genetic analysis of a broad range of cyanobacteria. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

In vitro kinetics of P700+ reduction of Thermosynechococcus elongatus trimeric Photosystem I complexes by recombinant cytochrome c 6 using a Joliot-type LED spectrophotometer.

Science.gov (United States)

Nguyen, Khoa; Vaughn, Michael; Frymier, Paul; Bruce, Barry D

2017-01-01

The reduction rate of photo-oxidized Photosystem I (PSI) with various natural and artificial electron donors have been well studied by transient absorption spectroscopy. The electron transfer rate from various donors to P 700 + has been measured for a wide range of photosynthetic organisms encompassing cyanobacteria, algae, and plants. PSI can be a limiting component due to tedious extraction and purification methods required for this membrane protein. In this report, we have determined the in vivo, intracellular cytochrome c 6 (cyt c 6 )/PSI ratio in Thermosynechococcus elongatus (T.e.) using quantitative Western blot analysis. This information permitted the determination of P 700 + reduction kinetics via recombinant cyt c 6 in a physiologically relevant ratio (cyt c 6 : PSI) with a Joliot-type, LED-driven, pump-probe spectrophotometer. Dilute PSI samples were tested under varying cyt c 6 concentration, temperature, pH, and ionic strength, each of which shows similar trends to the reported literature utilizing much higher PSI concentrations with laser-based spectrophotometer. Our results do however indicate kinetic differences between actinic light sources (laser vs. LED), and we have attempted to resolve these effects by varying our LED light intensity and duration. The standardized configuration of this spectrophotometer will also allow a more uniform kinetic analysis of samples in different laboratories. We can conclude that our findings from the LED-based system display an added total protein concentration effect due to multiple turnover events of P 700 + reduction by cyt c 6 during the longer illumination regime.

Variety of DNA Replication Activity Among Cyanobacteria Correlates with Distinct Respiration Activity in the Dark.

Science.gov (United States)

Ohbayashi, Ryudo; Yamamoto, Jun-Ya; Watanabe, Satoru; Kanesaki, Yu; Chibazakura, Taku; Miyagishima, Shin-Ya; Yoshikawa, Hirofumi

2017-02-01

Cyanobacteria exhibit light-dependent cell growth since most of their cellular energy is obtained by photosynthesis. In Synechococcus elongatus PCC 7942, one of the model cyanobacteria, DNA replication depends on photosynthetic electron transport. However, the critical signal for the regulatory mechanism of DNA replication has not been identified. In addition, conservation of this regulatory mechanism has not been investigated among cyanobacteria. To understand this regulatory signal and its dependence on light, we examined the regulation of DNA replication under both light and dark conditions among three model cyanobacteria, S. elongatus PCC 7942, Synechocystis sp. PCC 6803 and Anabaena sp. PCC 7120. Interestingly, DNA replication activity in Synechocystis and Anabaena was retained when cells were transferred to the dark, although it was drastically decreased in S. elongatus. Glycogen metabolism and respiration were higher in Synechocystis and Anabaena than in S. elongatus in the dark. Moreover, DNA replication activity in Synechocystis and Anabaena was reduced to the same level as that in S. elongatus by inhibition of respiratory electron transport after transfer to the dark. These results demonstrate that there is disparity in DNA replication occurring in the dark among cyanobacteria, which is caused by the difference in activity of respiratory electron transport. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

NMSBA: Aken Technologies Final Report: Toxicity Testing of Liquidoff

Energy Technology Data Exchange (ETDEWEB)

Ruffing, Anne [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jensen, Travis [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Strickland, Lucas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2015-02-01

To determine the effect of Liquidoff on bacteria, three bacterial strains were tested: Escherichia coli DH5α, Synechococcus sp. PCC 7002, and Synechococcus elongatus PCC 7942. E. coli DH5α is a Gram-negative, aerobic bacterium that is often found in normal gut flora and is commonly used the laboratory due to its fast growth rate. Synechococcus sp. PCC 7002 and S. elongatus PCC 7942 are Gram-negative, aquatic, autophototrophic cyanobacteria. Synechococcus sp. PCC 7002 is a marine cyanobacterium isolated from ‘fish pens’ on Magueyes Island, Puerto Rico in 1962, while S. elongatus PCC 7942 is a freshwater cyanobacterium. It should be noted that no Gram-positive bacterium was tested in this study.

Diversidade genética de três estoques de piapara (Leporinus elongatus, utilizando RAPD - DOI: 10.4025/actascianimsci.v30i2.4710 Genetic diversity of three stocks of piapara (Leporinus elongatus, using RAPD - DOI: 10.4025/actascianimsci.v30i2.4710

Directory of Open Access Journals (Sweden)

Lauro Vargas

2008-08-01

Full Text Available Recentemente a produção aquícola brasileira tem apresentado grande progresso. Dentre as espécies nativas cultivadas no Brasil, a piapara (Leporinus elongatus tem sido amplamente preconizada. Com objetivo de avaliar os programas de repovoamento, foram analisadas a variabilidade e a divergência genética de três estoques de piapara com a técnica de RAPD (Random Amplified Polymorphic. O primeiro estoque pertence à Estação de Aquicultura e Hidrologia da Duke Energy International (A; o segundo, à piscicultura de Rolândia (B e o terceiro, ao Programa de Repovoamento dos Rios do Paraná (C. Os dez primers para RAPD utilizados produziram 105 fragmentos polimórficos, conferindo um polimorfismo de 98,1% para os três estoques avaliados. A porcentagem de locos polimórficos e índice de Shannon foi superior para o estoque A. Porém, todos valores foram elevados, indicando alta diversidade intrapopulacional. Os valores de indicam que houve baixa diferenciação genética entre os estoques A x B e moderada diferenciação entre os demais. O Nm foi maior entre os estoques A x B. A distância genética e o dendrograma indicam que os estoques A x B são menos distantes geneticamente.Latelly, aquiculture production in Brazil has made great strides. Among the native species cultivated in Brazil, piapara (Leporinus elogatus has been widely praised. With the objective of evaluating restocking programs, the variability and genetic divergence of three piapara stocks were analyzed using the RAPD (Random Amplified Polymorphic DNA technique. The first stock belongs to the Aquiculture and Hydrology Station of Duke Energy International (A; the second one belongs to a fish farm in the city of Rolândia (B; and the third to the River Restocking Program of Paraná (C. The ten primers used for RAPD produced 105 polymorphic loci, conferring a polymorphism of 98.1% for the three evaluated stocks. Polymorphic loci percentage and Shannon index were higher for stock A

Characterization of mutants expressing thermostable D1 and D2 polypeptides of photosystem II in the cyanobacterium Synechococcus elongatus PCC 7942.

Science.gov (United States)

Haraguchi, Norihisa; Kaseda, Jun; Nakayama, Yasumune; Nagahama, Kazuhiro; Ogawa, Takahira; Matsuoka, Masayoshi

2018-06-08

Photosystem II complex embedded in thylakoid membrane performs oxygenic photosynthesis where the reaction center D1/D2 heterodimer accommodates all components of the electron transport chain. To express thermostable D1/D2 heterodimer in a cyanobacterium Synechococcus elongatus PCC 7942, we constructed a series of mutant strains whose psbA1 and psbD1 genes encoding, respectively, the most highly expressed D1 and D2 polypeptides were replaced with those of a thermophilic strain, Thermosynechococcus vulcanus. Because the C-terminal 16 amino acid sequences of D1 polypeptides should be processed prior to maturation but diverge from each other, we also constructed the psbA1ΔC-replaced strain expressing a thermostable D1 polypeptide devoid of the C-terminal extension. The psbA1/psbD1-replaced strain showed decreased growth rate and oxygen evolution rate, suggesting inefficient photosystem II. Immunoblot analyses for thermostable D1, D2 polypeptides revealed that the heterologous D1 protein was absent in thylakoid membrane from any mutant strains with psbA1, psbA1ΔC, and psbA1/psbD1-replacements, whereas the heterologous D2 protein was present in thylakoid membrane as well as purified photosystem II complex from the psbA1/psbD1-replaced strain. In the latter strain, the compensatory expression of psbA3 and psbD2 genes was elevated. These data suggest that heterologous D2 polypeptide could be combined with the host D1 polypeptide to form chimeric D1/D2 heterodimer, whereas heterologous D1 polypeptide even without the C-terminal extension was unable to make complex with the host D2 polypeptide. Since the heterologous D1 could not be detected even in the whole cells of psbA1/psbD1-replaced strain, the rapid degradation of unprocessed or unassembled heterologous D1 was implicated. Copyright © 2018 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

Genetic variability of wild populations of Leporinus elongatus in the São Domingos River - MS Brazil: a preliminary view on the construction of the hydroelectric plant

Directory of Open Access Journals (Sweden)

Ricardo Pereira Ribeiro

2016-09-01

Full Text Available Most of the electricity used in Brazil comes from hydroelectric plants, mainly due to the great availability of its water resources. However, the construction of these plants denotes serious problems related to migration of native fish and the genetic conservation of stocks. Current study evaluates two wild population of Leporinus elongatus (piapara located downstream (Population A - PopA and upstream (Population B - PopB of the Cachoeira Branca before the construction of the São Domingos hydroelectric plant (HPP in the Mato Grosso do Sul State, Brazil. Thirty samples from caudal fins were collected and analyzed for each population. Eighty-nine fragments, including 72 polymorphic ones (80.9%, were analyzed. Low fragments (less than 0.100 in both populations (PopA = 2 and PopB = 3 were identified. Nine fixed fragments (frequency 1.000 (PopA = 3 and PopB = 6, and four exclusive fragments (PopA = 3 and PopB = 1 were also reported. The genetic variability within populations, calculated by Shannon Index and by percentage of polymorphic fragments, indicated high rates of intrapopulation variability (PopA = 0.309 and 61.80% and PopB = 0.392 and 71.90%, respectively. Genetic distance and identity rates (0.089 and 0.915, respectively were different between populations, whilst AMOVA showed that most variations lie within the populations and not between them. Fst and Nm rates showed moderate genetic differentiation with low numbers of migrants. Results reveal populations with high intra-population genetic variability and genetic differentiation, with low gene flow. The passage ladders of São Domingos HPP should control fish transposition to preserve genetic variability.

A revised geographical range for Liolaemus elongates Koslowsky, 1896 (Squamata: Liolaemini in Argentina: review of reported and new-data based distribution with new localities

Directory of Open Access Journals (Sweden)

Ignacio Minoli

2013-12-01

Full Text Available Estimating the effective geographical ranges of species is central to species-oriented conservation and management. In this paper, we review the geographical distribution of Liolaemus elongatus Koslowsky, 1896 with three new records for northern Chubut and southern Río Negro provinces, Argentina. Based on detailed locality records pooled from multiple data sources, including new records obtained for this study, we revise the range of L. elongatus sensu stricto and provide geographical distribution maps comparing the previously recognized range to that proposed herein. Our results show that L. elongatus possesses a much more limited geographic distribution than previously thought, being restricted to areas south of 38°S latitude; the newly proposed range is merely half the species formerly recognized geographical distribution.

Seasonal dynamics of Pseudocalanus minutus elongatus and Acartia spp. in the southern Baltic Sea (Gdańsk Deep – numerical simulations

Directory of Open Access Journals (Sweden)

L. Dzierzbicka-Głowacka

2006-01-01

Full Text Available A population dynamics model for copepods is presented, describing the seasonal dynamics of Pseudocalanus minutus elongatus and Acartia spp. in the southern Baltic Sea (Gdańsk Deep. The copepod model was coupled with a one-dimensional physical and biological upper layer model for nutrients (total inorganic nitrogen, phosphate, phytoplankton, microzooplankton, and an early juvenile of herring as a predator. In this model, mesozooplankton (herbivorous copepods has been introduced as an animal having definite patterns of growth in successive stages, reproduction and mortality. The populations are represented by 6 cohorts in different developmental stages, thus assuming that recruitment of the next generation occurs after a fixed period of adult life. The copepod model links trophic processes and population dynamics, and simulates individual growth within cohorts and the changes in biomass between cohorts. The simulations of annual cycles of copepods contain one complete generation of Pseudocalanus and two generations of Acartia in the whole column water, and indicate the importance of growth in the older stages of 6 cohorts of each species, to arrive at a total population biomass. The peaks of copepods' biomass are larger at the turn of June and July for Pseudocalanus and smaller in July for Acartia, lagging that of phytoplankton by ca. two mouths, due to the growth of cohorts in successive stages and egg production by females. The numerical results show that the investigated species could not be the main factor limiting the spring phytoplankton bloom in the Gdańsk Deep, because the initial development was slow for Acartia and faster for Pseudocalanus, but the main development formed after the bloom, in both cases. The phytoplankton bloom is very important in the diet of the adults of the copepods, but it is not particularly important for the youngest part of new generation (early nauplii. However, the simulated microzooplankton biomass was

The role of lantern fish (Myctophidae) in the life-cycle of cetacean parasites from western Mediterranean waters

Science.gov (United States)

Mateu, Paula; Nardi, Valentina; Fraija-Fernández, Natalia; Mattiucci, Simonetta; Gil de Sola, Luis; Raga, Juan Antonio; Fernández, Mercedes; Aznar, Francisco Javier

2015-01-01

Myctophids (lantern fish) and cephalopods play a key role in trophic webs from the continental slope and oceanic waters linking the zooplankton to top predators. Many cetaceans feed on both lantern fish and cephalopods, and such prey would thus be expected to bridge the trophic gap in the life-cycles of helminths infecting cetaceans. However, information on the life-cycles of most of these helminths is extremely scanty. We examined the parasite fauna of myctophids and cephalopods in two areas from the western Mediterranean where at least 21 helminth taxa from cetaceans have been reported and both cetacean diversity and abundance is high. A total of 1012 individuals of 8 lantern fish species, namely, Ceratoscopelus maderensis, Lampanyctus crocodilus, Notoscopelus elongatus, Benthosema glaciale, Myctophum punctatum, Lobianchia dofleini, Diaphus holti and Hygophum benoiti, and 792 individuals of 2 cephalopod species, Alloteuthis media and Sepietta oweniana, were collected from the Gulf of Valencia and Alboran Sea (Spanish Mediterranean) during 2010-2012 and examined for larval helminths. All these species have been reported as prey for at least some cetacean species in the area. Only five helminth taxa were found. The nematodes Anisakis pegreffii and Anisakis physeteris were detected in N. elongatus and C. maderensis (overall prevalence for Anisakis: 8.1% and 0.5%, respectively). Their prevalence in N. elongatus was significantly higher than that from the other three myctophid species with n>50 individuals. A single individual of Hysterothylacium sp. was found in N. elongatus (prevalence: 0.5%) and Raphidascarididae gen. spp. in N. elongatus and L. crocodilus (prevalence: 20.3% and 0.7%, respectively). Juvenile didymozoid digeneans (Torticaecum type) were detected in N. elongatus and L. crocodilus (prevalence: 18.5% and 4.3%, respectively). Two unidentified cestode plerocercoids were collected from N. elongatus. Our study suggests, for the first time, that myctophids

Recombinant thermoactive phosphoenolpyruvate carboxylase (PEPC) from Thermosynechococcus elongatus and its coupling with mesophilic/thermophilic bacterial carbonic anhydrases (CAs) for the conversion of CO2 to oxaloacetate.

Science.gov (United States)

Del Prete, Sonia; De Luca, Viviana; Capasso, Clemente; Supuran, Claudiu T; Carginale, Vincenzo

2016-01-15

With the continuous increase of atmospheric CO2 in the last decades, efficient methods for carbon capture, sequestration, and utilization are urgently required. The possibility of converting CO2 into useful chemicals could be a good strategy to both decreasing the CO2 concentration and for achieving an efficient exploitation of this cheap carbon source. Recently, several single- and multi-enzyme systems for the catalytic conversion of CO2 mainly to bicarbonate have been implemented. In order to design and construct a catalytic system for the conversion of CO2 to organic molecules, we implemented an in vitro multienzyme system using mesophilic and thermophilic enzymes. The system, in fact, was constituted by a recombinant phosphoenolpyruvate carboxylase (PEPC) from the thermophilic cyanobacterium Thermosynechococcus elongatus, in combination with mesophilic/thermophilic bacterial carbonic anhydrases (CAs), for converting CO2 into oxaloacetate, a compound of potential utility in industrial processes. The catalytic procedure is in two steps: the conversion of CO2 into bicarbonate by CA, followed by the carboxylation of phosphoenolpyruvate with bicarbonate, catalyzed by PEPC, with formation of oxaloacetate (OAA). All tested CAs, belonging to α-, β-, and γ-CA classes, were able to increase OAA production compared to procedures when only PEPC was used. Interestingly, the efficiency of the CAs tested in OAA production was in good agreement with the kinetic parameters for the CO2 hydration reaction of these enzymes. This PEPC also revealed to be thermoactive and thermostable, and when coupled with the extremely thermostable CA from Sulphurhydrogenibium azorense (SazCA) the production of OAA was achieved even if the two enzymes were exposed to temperatures up to 60 °C, suggesting a possible role of the two coupled enzymes in biotechnological processes. Copyright © 2015 Elsevier Ltd. All rights reserved.

Unique attributes of cyanobacterial metabolism revealed by improved genome-scale metabolic modeling and essential gene analysis

Science.gov (United States)

Broddrick, Jared T.; Rubin, Benjamin E.; Welkie, David G.; Du, Niu; Mih, Nathan; Diamond, Spencer; Lee, Jenny J.; Golden, Susan S.; Palsson, Bernhard O.

2016-01-01

The model cyanobacterium, Synechococcus elongatus PCC 7942, is a genetically tractable obligate phototroph that is being developed for the bioproduction of high-value chemicals. Genome-scale models (GEMs) have been successfully used to assess and engineer cellular metabolism; however, GEMs of phototrophic metabolism have been limited by the lack of experimental datasets for model validation and the challenges of incorporating photon uptake. Here, we develop a GEM of metabolism in S. elongatus using random barcode transposon site sequencing (RB-TnSeq) essential gene and physiological data specific to photoautotrophic metabolism. The model explicitly describes photon absorption and accounts for shading, resulting in the characteristic linear growth curve of photoautotrophs. GEM predictions of gene essentiality were compared with data obtained from recent dense-transposon mutagenesis experiments. This dataset allowed major improvements to the accuracy of the model. Furthermore, discrepancies between GEM predictions and the in vivo dataset revealed biological characteristics, such as the importance of a truncated, linear TCA pathway, low flux toward amino acid synthesis from photorespiration, and knowledge gaps within nucleotide metabolism. Coupling of strong experimental support and photoautotrophic modeling methods thus resulted in a highly accurate model of S. elongatus metabolism that highlights previously unknown areas of S. elongatus biology. PMID:27911809

Two new Liolaemus lizards from the Andean highlands of Southern Chile (Squamata, Iguania, Liolaemidae)

Science.gov (United States)

Troncoso-Palacios, Jaime; Diaz, Hugo A.; Puas, German I.; Riveros-Riffo, Edvin; Elorza, Alvaro A.

2016-01-01

Abstract Liolaemus is a diverse genus of lizards, subdivided into two subgenera: Liolaemus (sensu stricto) and Eulaemus, distributed mainly in Chile and Argentina. The Liolaemus elongatus-kriegi complex is the most diverse group within Liolaemus (sensu stricto), especially the species closely related to Liolaemus elongatus, which form a clade currently comprising nine species. Several Chilean species of this group have been recently described, mainly from volcanoes and poorly explored mountains. Here molecular and morphological evidence are provided for a new species of the Liolaemus elongatus clade, which is characterized by its small size and lack of dorsal pattern, unusual features for the species of this group of lizards. Additionally, the lack of precloacal pores in males of Liolaemus (sensu stricto) is a trait found in few species, which do not constitute a monophyletic group. A second new southern Chilean species is also described, without precloacal pores and supported by molecular phylogenetics to be related to Liolaemus villaricensis. Both new species were found in the same locality, near a lake located in a pre-Andean zone with Araucaria and Nothofagus forest. The two species are dedicated to prominent Lonkos (tribal chiefs) of the Mapuche and Pehuenche people: Janequeo and Leftraru. Additionally, the phylogenetic results suggest that Liolaemus lonquimayensis is a synonym of Liolaemus elongatus. PMID:27920609

Influence of weather variables and plant communities on grasshopper density in the Southern Pampas, Argentina.

Science.gov (United States)

de Wysiecki, María Laura; Arturi, Marcelo; Torrusio, Sandra; Cigliano, María Marta

2011-01-01

A study was conducted to evaluate the influence of weather (precipitation and temperature) and plant communities on grasshopper density over a 14-year period (1996-2009) in Benito Juárez County, Southern Pampas, Argentina. Total density strongly varied among plant communities. Highest values were registered in 2001 and 2003 in highly disturbed pastures and in 2002 and 2009 in halophilous grasslands. Native grasslands had the lowest density values. Seasonal precipitation and temperature had no significant effect on total grasshopper density. Dichroplus elongatus (Giglio-Tos) (Orthoptera: Acridoidea), Covasacris pallidinota (Bruner), Dichroplus pratensis Bruner, Scotussa lemniscata Stål, Borellia bruneri (Rehn) and Dichroplus maculipennis (Blanchard) comprised, on average, 64% of the grasshopper assemblages during low density years and 79% during high density years. Dichroplus elongatus, S. lemniscata and C. pallidinota were the most abundant species in 2001, 2002 and 2003, while D. elongatus, B. brunneri and C. pallidinota in 2009. Dichroplus elongatus and D. pratensis, mixed feeders species, were positively affected by summer rainfall. This suggests that the increase in summer precipitation had a positive effect on the quantity and quality forage production, affecting these grasshopper populations. Scotussa lemniscata and C. pallidinota were negatively affected by winter and fall temperature, possibly affecting the embryonic development before diapause and hatching. Dichroplus elongatus and D. pratensis were associated with highly disturbed pastures, S. lemniscata with pastures and B. bruneri and D. maculipennis with halophilous grasslands. Covasacris pallidinota was closely associated with halophilous grasslands and moderately disturbed pastures. Weather conditions changed over the years, with 2001, 2002 and 2003 having excessive rainfall while 2008 and 2009 were the driest years since the study started. We suggest that although seasonal precipitation and

Structural determinants of the outer shell of β-carboxysomes in Synechococcus elongatus PCC 7942: roles for CcmK2, K3-K4, CcmO, and CcmL.

Directory of Open Access Journals (Sweden)

Benjamin D Rae

Full Text Available Cyanobacterial CO(2-fixation is supported by a CO(2-concentrating mechanism which improves photosynthesis by saturating the primary carboxylating enzyme, ribulose 1, 5-bisphosphate carboxylase/oxygenase (RuBisCO, with its preferred substrate CO(2. The site of CO(2-concentration is a protein bound micro-compartment called the carboxysome which contains most, if not all, of the cellular RuBisCO. The shell of β-type carboxysomes is thought to be composed of two functional layers, with the inner layer involved in RuBisCO scaffolding and bicarbonate dehydration, and the outer layer in selective permeability to dissolved solutes. Here, four genes (ccmK2-4, ccmO, whose products were predicted to function in the outer shell layer of β-carboxysomes from Synechococcus elongatus PCC 7942, were investigated by analysis of defined genetic mutants. Deletion of the ccmK2 and ccmO genes resulted in severe high-CO(2-requiring mutants with aberrant carboxysomes, whilst deletion of ccmK3 or ccmK4 resulted in cells with wild-type physiology and normal ultrastructure. However, a tandem deletion of ccmK3-4 resulted in cells with wild-type carboxysome structure, but physiologically deficient at low CO(2 conditions. These results revealed the minimum structural determinants of the outer shell of β-carboxysomes from this strain: CcmK2, CcmO and CcmL. An accessory set of proteins was required to refine the function of the pre-existing shell: CcmK3 and CcmK4. These data suggested a model for the facet structure of β-carboxysomes with CcmL forming the vertices, CcmK2 forming the bulk facet, and CcmO, a "zipper protein," interfacing the edges of carboxysome facets.

Protein (Cyanobacteria): 71044 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available erase Synechococcus elongatus PCC 6301 MSDYSDRSDFSERQDRSSDDRPNFRRFDRDRPSEGRRLEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRG...GYRGGDRDRPSEGRRFEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRGGYRGGDRDRPSEGRRFEGRSEGGFRGRDDRGGSGGYRGRDDRGGFRGRDDRGGFRGRDDRGSSGSYRGRDDRG

ORF Sequence: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ferase [Synechococcus elongatus PCC 6301] MSDYSDRSDFSERQDRSSDDRPNFRRFDRDRPSEGRRLEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRG...GYRGGDRDRPSEGRRFEGRSEGGYRGRDDRGGSGGYRQNRDDRGGFRGRDDRGGYRGGDRDRPSEGRRFEGRSEGGFRGRDDRGGSGGYRGRDDRGGFRGRDDRGGFRGRDDRG...SSGSYRGRDDRGGFRGRDDRRDDRDNFRPSRDRELNREVNTSPAGDQEATDHELIYGRHAVLAALQ

Active prey selection in two pelagic copepods feeding on potentially toxic and non-toxic dinoflagellates

DEFF Research Database (Denmark)

Schultz, Mette; Kiørboe, Thomas

2009-01-01

Grazing on two red tide dinoflagellates, the potentially toxic Karenia mikimotoi and the non-toxic Gyrodinium instriatum, was examined in two species of marine copepods, Pseudocalanus elongatus and Temora longicornis. Both copepods cleared K. mikimotoi at rates that were a little lower but compar......Grazing on two red tide dinoflagellates, the potentially toxic Karenia mikimotoi and the non-toxic Gyrodinium instriatum, was examined in two species of marine copepods, Pseudocalanus elongatus and Temora longicornis. Both copepods cleared K. mikimotoi at rates that were a little lower...

On Pomacea sordida (Swainson, 1823 (Prosobranchia, Ampullariidae Sobre Pomacea sordida (Swaison, 1823 (Prosobranchia, Ampullariidae

Directory of Open Access Journals (Sweden)

Silvana Carvalho Thiengo

1989-09-01

Full Text Available A description of Pomacea sordida (Swainson, 1823 collected in Caxias and Nova Iguaçu, state of Rio de Janeiro, is presented. The shell is globose, heavy, whith greenish or horn-colored periostracum and dark spinal bands; apex subelevated, 4-5 moderately shoudered whorls, increasing rather rapidly and separated by deep suture. Aperture large, moderately round, yellowish or violaceous; lip thick and sometimes dark brown; umbilicus large and deep; operculum corneous and heavy, entirely closing the aperture. Ratios: shell width/shell length = 0.81-0.91 (mean 0.86; aperture length/shell length = 0.66-0.75 (mean 0.70. Testis, spermiduct and penis pouch as in Pomacea lineata (Spix, 1827. Seminal vesicle whitish and bean-shaped. Prostate cylindric and narrow, cream in coloar as the testis. Penis whiplike whith a closed circular spermiduct. Penial sheath elongated and tapered, with its distal tip turned to the right; outer basal gland situated on the left; inner median gland rounded; apical gland elongated and wrinkled. Ovary composed of branched whitish tubules lying superficially on the digestive gland; oviduct and seminal receptacle as in P. lineata; albumen gland yellowish - orange. Vestigial male copulatory apparatus (penis and its sheath present in all females examined.Nesse trabalho é apresentada a descrição de Pomacea sordida (Swainson, 1823, coletada em Caxias e Nova Iguaçu, Estado do Rio de Janeiro. Concha globosa, espessa, com perióstraco esverdeado ou castanho e com faixas espirais escuras; ápice pouco elevado, 4-5 giros moderadamente arredondados, crescendo relativamente rápido, separados por suturas profundas. Abertura grande, moderadamente arredondada, amarelada ou violácea; lábio espesso e algumas vezes marrom escuro; umbílico grande e profundo; opérculo córneo e espesso, fechando completamente a abertura. Razões: largura da concha/comprimento da concha=0.81-0.91 (média 0.86; comprimento da abertura/comprimento da concha=0.66-0.75 (média 0.70. Testículo, espermiduto e bolsa do pênis como em Pomacea lineata (Spix, 1827. Vesícula seminal esbranquiçada e em forma de feijão. Próstata cilíndrica e estreita, de cor creme como o testículo. Pênis em forma de chicote, com espermiduto circular e fechado. Bainha do pênis alongada tendo sua largura diminuída da base para a extremidade, sendo esta última voltada para a direita; glândula basal extrema situada à esquerda; glândula mediana interna arredondada; glândula apical alongada e com sulcos. Ovário composto de túbulos brancos ramificados dispostos superficialmente sobre a glândula digestiva verde. Oviduto e receptáculo seminal como em P. lineata; glândula de albume de cor alaranjada; ovos prismáticos e calcáreos de cor alaranjada. Aparelho copulador masculino vestigial (pênis e sua bainha presente em todas as fêmeas examinadas.

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ECEASDVKSLLEALEQSFPGIKARLCDEQGQLRRFLNVYVN 62 ... ITVLIPTPLQKFTNNQASLECEASDVKS...LLEALEQSFPGIKARLCDEQGQLRRFLNVYVN Sbjct: 1 ... ITVLIPTPLQKFTNNQASLECEASDVKSLLEALEQSFPGIKARLCDEQGQLRRFLNVYVN 60 ... ...subunit ... [Synechococcus elongatus PCC 7942] ... Length = 89 ... Query: 3 ... ITVLIPTPLQKFTNNQASL

ORF Alignment: NC_004113 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available se ... [Thermosynechococcus elongatus BP-1] ... Length = 99 ... Query: 9 ... PWKRTPVKTWRFPIKTTIRIGRAADNDVI...LNDILVSRYHAELSCYRDPENLGRWFLKSLG 68 ... PWKRTPVKTWRFPIKTTIRIGRAADNDVI...LNDILVSRYHAELSCYRDPENLGRWFLKSLG Sbjct: 1 ... PWKRTPVKTWRFPIKTTIRIGRAADNDVILNDILVSRYHAELSCYRDPENLGRWFLKSLG 60 ...

ORF Alignment: NC_004113 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... elongatus BP-1] ... Length = 211 ... Query: 1 ... MATLEFLTFPDPAIAADHTLLLLHGWGANAADLISLGPLLAPHAQIYAAEAPF...PHPYVAQ 60 ... MATLEFLTFPDPAIAADHTLLLLHGWGANAADLISLGPLLAPHAQIYAAEAPFPHPYVA...Q Sbjct: 1 ... MATLEFLTFPDPAIAADHTLLLLHGWGANAADLISLGPLLAPHAQIYAAEAPFPHPYVAQ 60 ... Query: 121 AVGLRLPLAGLLVFSGYLV

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available occus ... elongatus PCC 6301] ... Length = 168 ... Query: 361 RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIY...SPEMSDRTXXXXXXXXXXXXXXXXX 420 ... RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIYSPEMS...DRT ... Sbjct: 17 ... RTIAERQRAIILRSDAVRKHLAGISLLERGGPEIYSPEMSDRTYGRLLYLGLGLAQAGYR 76 ... Query: 481

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ccus ... elongatus PCC 6301] ... Length = 155 ... Query: 2 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDR...AGLLVMFICQHCPFVKHVEEELAA 61 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVM...FICQHCPFVKHVEEELAA Sbjct: 1 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVMFICQHCPFVKHVEEELAA 60 ... Query: 122 DF

[Evaluation of ten fish species to be included as part of renal diet, due to their protein, phosphorus and fatty acids content].

Science.gov (United States)

Castro-González, Maria Isabel; Maafs-Rodríguez, Ana Gabriela; Pérez-Gil Romo, Fernando

2012-06-01

Because renal disease is highly complex, its nutritional treatment is complicated and many foods are restricted, including fish because its phosphorus content. The aim of the present study was to analyze ten fillet fish species, commonly consumed in Mexico (Cyprinus carpio carpio, Ophichthus rex, Symphurus elongatus, Eucinostomus entomelas, Chirostoma patzcuaro, Bairdiella chrysoura, Salmo salar Oreochromis urolepis hornorum, Sphyraena guachancho, Istiophorus albicans), to determine their phosphorus (P), protein (Pr), cholesterol, sodium, potassium, vitamins D3 and E, and n-3 PUFA (EPA+DHA) according to the AOAC techniques, in order to identify which species could be included in renal diet; particularly because of their risk:benefit relations (calculated with those results). Protein values ranged from 16.5 to 33.5g/100 g of fillet; the specie with the highest phosphorus contest was Salmo salar, and with the lowest, Symphurus elongatus. EPA+DHA quantity ranged from 79.64 mg/100 g to 1,381.53 mg/100 g. Considering de P/Pr relation recommended to renal patients, all analyzed species (except Salmo salar, Ophichthus rex and Istiophorus albicans) could be included in their diet. As for the P/EPA+DHA relation, the species most recommended to renal patients are Symphurus elongatus, Bairdiella chrysoura and Sphyraena guachancho.

Caracterización de las comunidades de acridios (Orthoptera: Acridoidea del partido de Benito Juárez, sudeste de la provincia de Buenos Aires, Argentina Grasshopper (Orthoptera: Acridoidea community structure in Benito Juárez county, in outhern Buenos Aires province, Argentina

Directory of Open Access Journals (Sweden)

María Laura de Wysiecki

2004-12-01

Full Text Available Se analizó la riqueza, densidad, constancia y distribución de especies de acridios, en distintas comunidades vegetales (1997-2002 en el partido de Benito Juárez, sudeste de la provincia de Buenos Aires. Las comunidades vegetales se categorizaron en pastizales nativos, comunidades halófilas, pasturas sin disturbio, pasturas con moderado disturbio y pasturas con alto disturbio. En total se registraron 23 especies de acridios. Los melanoplinos dominaron en casi todas las comunidades vegetales, excepto en las halófilas que se caracterizaron por la presencia de un acridino, Covasacris pallidinota (Bruner. La riqueza de especies promedio por sitio por año, varió entre 2,10 ± 0,60 especies en las pasturas con moderado disturbio y 6,20 ± 0,58 especies en las comunidades halófilas. La riqueza de especies acumulada fue de 17 en los pastizales nativos, 14 en las comunidades halófilas, 19 en las pasturas sin disturbio, 18 en las pasturas con moderado disturbio y 14 en las pasturas con alto disturbio. La densidad promedio de acridios fue máxima en el 2001 y 2002. Dichroplus pratensis Bruner y Dichroplus elongatus Giglio-Tos dominaron en los pastizales nativos y en las pasturas con alto disturbio, C. pallidinota en las comunidades halófilas, D. elongatus y Scotussa lemniscata (Stål en las pasturas sin disturbio y en las pasturas con moderado disturbio. La estructura taxonómica de las comunidades de acridios fue constante en los pastizales nativos, las comunidades halófilas y las pasturas. Hubo pocas especies de amplia distribución e intermedias y las raras fueron las más numerosas. De las 23 especies registradas en todos los sitios, D. elongatus fue la única de amplia distribución. Históricamente, para la zona de estudio, Dichroplus maculipennis (Blanch fue señalada como la especie dominante. Sin embargo, nuestros resultados sugieren que en la actualidad la especie dominante es D. elongatus. Si bien resulta imposible conocer las causas

Mobile acoustic telemetry data - Lingcod Stock Enhancement: ecological interactions, fishery contributions, and life history

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Lingcod (Ophiodon elongatus) populations along the West Coast of North America have recovered from overfishing, but the status of genetically distinct lingcod in...

Tag effect data - Lingcod Stock Enhancement: ecological interactions, fishery contributions, and life history

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Lingcod (Ophiodon elongatus) populations along the West Coast of North America have recovered from overfishing, but the status of genetically distinct lingcod in...

Description of a new genus and species of the Coleopterous family Colydidae

NARCIS (Netherlands)

Reitter, E.

1882-01-01

Corpus valde elongatum, convexum. Antennae 11-articulatae, sub frontis margine ante oculos insertae, apicem versus sensim incrassatae, articulo ultimo rotundato. Fronte tateribus elevata. Oculi antice emarginati. Prothorax elongatus, carinatus. Scutellum minutum. Elytra punctatostriata, interstitiis

Removal of triazine herbicides from freshwater systems using photosynthetic microorganisms

International Nuclear Information System (INIS)

Gonzalez-Barreiro, O.; Rioboo, C.; Herrero, C.; Cid, A.

2006-01-01

The uptake of the triazine herbicides, atrazine and terbutryn, was determined for two freshwater photosynthetic microorganisms, the green microalga Chlorella vulgaris and the cyanobacterium Synechococcus elongatus. An extremely rapid uptake of both pesticides was recorded, although uptake rate was lower for the cyanobacterium, mainly for atrazine. Other parameters related to the herbicide bioconcentration capacity of these microorganisms were also studied. Growth rate, biomass, and cell viability in cultures containing herbicide were clearly affected by herbicide uptake. Herbicide toxicity and microalgae sensitivity were used to determine the effectiveness of the bioconcentration process and the stability of herbicide removal. C. vulgaris showed higher bioconcentration capability for these two triazine herbicides than S. elongatus, especially with regard to terbutryn. This study supports the usefulness of such microorganisms, as a bioremediation technique in freshwater systems polluted with triazine herbicides

Removal of triazine herbicides from freshwater systems using photosynthetic microorganisms

Energy Technology Data Exchange (ETDEWEB)

Gonzalez-Barreiro, O. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain); Rioboo, C. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain); Herrero, C. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain); Cid, A. [Laboratorio de Microbiologia, Facultad de Ciencias, Universidad de A Coruna, Campus da Zapateira s/n. 15071 A Coruna (Spain)]. E-mail: cid@udc.es

2006-11-15

The uptake of the triazine herbicides, atrazine and terbutryn, was determined for two freshwater photosynthetic microorganisms, the green microalga Chlorella vulgaris and the cyanobacterium Synechococcus elongatus. An extremely rapid uptake of both pesticides was recorded, although uptake rate was lower for the cyanobacterium, mainly for atrazine. Other parameters related to the herbicide bioconcentration capacity of these microorganisms were also studied. Growth rate, biomass, and cell viability in cultures containing herbicide were clearly affected by herbicide uptake. Herbicide toxicity and microalgae sensitivity were used to determine the effectiveness of the bioconcentration process and the stability of herbicide removal. C. vulgaris showed higher bioconcentration capability for these two triazine herbicides than S. elongatus, especially with regard to terbutryn. This study supports the usefulness of such microorganisms, as a bioremediation technique in freshwater systems polluted with triazine herbicides.

ORF Alignment: NC_006576 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

PipY, a Member of the Conserved COG0325 Family of PLP-Binding Proteins, Expands the Cyanobacterial Nitrogen Regulatory Network

Directory of Open Access Journals (Sweden)

José I. Labella

2017-07-01

Full Text Available Synechococcus elongatus PCC 7942 is a paradigmatic model organism for nitrogen regulation in cyanobacteria. Expression of genes involved in nitrogen assimilation is positively regulated by the 2-oxoglutarate receptor and global transcriptional regulator NtcA. Maximal activation requires the subsequent binding of the co-activator PipX. PII, a protein found in all three domains of life as an integrator of signals of the nitrogen and carbon balance, binds to PipX to counteract NtcA activity at low 2-oxoglutarate levels. PII-PipX complexes can also bind to the transcriptional regulator PlmA, whose regulon remains unknown. Here we expand the nitrogen regulatory network to PipY, encoded by the bicistronic operon pipXY in S. elongatus. Work with PipY, the cyanobacterial member of the widespread family of COG0325 proteins, confirms the conserved roles in vitamin B6 and amino/keto acid homeostasis and reveals new PLP-related phenotypes, including sensitivity to antibiotics targeting essential PLP-holoenzymes or synthetic lethality with cysK. In addition, the related phenotypes of pipY and pipX mutants are consistent with genetic interactions in the contexts of survival to PLP-targeting antibiotics and transcriptional regulation. We also showed that PipY overexpression increased the length of S. elongatus cells. Taken together, our results support a universal regulatory role for COG0325 proteins, paving the way to a better understanding of these proteins and of their connections with other biological processes.

Toward solar biodiesel production from CO2 using engineered cyanobacteria.

Science.gov (United States)

Woo, Han Min; Lee, Hyun Jeong

2017-05-01

Metabolic engineering of cyanobacteria has received attention as a sustainable strategy to convert carbon dioxide to various biochemicals including fatty acid-derived biodiesel. Recently, Synechococcus elongatus PCC 7942, a model cyanobacterium, has been engineered to convert CO2 to fatty acid ethyl esters (FAEEs) as biodiesel. Modular pathway has been constructed for FAEE production. Several metabolic engineering strategies were discussed to improve the production levels of FAEEs, including host engineering by improving CO2 fixation rate and photosynthetic efficiency. In addition, protein engineering of key enzyme in S. elongatus PCC 7942 was implemented to address issues on FAEE secretions toward sustainable FAEE production from CO2. Finally, advanced metabolic engineering will promote developing biosolar cell factories to convert CO2 to feasible amount of FAEEs toward solar biodiesel. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Description d’une nouvelle espèce de Gyrinide du Musée de Leyde

NARCIS (Netherlands)

Regimbart, M.

1884-01-01

Long. 6 3/4 mm. (ano excepto). — Oblongo-ovalis, elongatus, mediocriter convexus; supra in regionibus glabris purpureocupreus, nitidus, subtilissime reticulatus, in regionibus punctato-tomentosis obscure cœruleus et subopacus, anguste pallide testaceo limbatus; infra pallide testaceus, pedibus

New synonymy in Cuban Tilloclytus (Coleoptera: Cerambycidae: Anaglyptini)

Science.gov (United States)

Examination of holotypes of Tilloclytus (Coleoptera: Cerambycidae: Anaglyptini) in the Fernando de Zayas collection (Havana, Cuba) and the Museum of Comparative Zoology, Harvard University reveals that T. elongatus Zayas (1975) is a new synonym of T. rufipes Fisher (1942)....

Species-specific differences of the spectroscopic properties of P700 - Analysis of the influence of non-conserved amino acid residues by site-directed mutagenesis of photosystem I from Chlamydomonas reinhardtii

NARCIS (Netherlands)

Witt, H.; Bordignon, E.; Carbonera, D.; Dekker, J.P.; Karapetyan, N.; Teutloff, C.; Webber, A.; Lubitz, W.; Schlodder, E.

2003-01-01

We applied optical spectroscopy, magnetic resonance techniques, and redox titrations to investigate the properties of the primary electron donor P700 in photosystem I (PS I) core complexes from cyanobacteria (Thermosynechococcus elongatus, Spirulina platensis, and Synechocystis sp. PCC 6803), algae

Cyanobacterial photosystem II at 2.9-A resolution and the role of quinones, lipids, channels and chloride

NARCIS (Netherlands)

Guskov, Albert; Kern, Jan; Gabdulkhakov, Azat; Broser, Matthias; Zouni, Athina; Saenger, Wolfram

Photosystem II (PSII) is a large homodimeric protein-cofactor complex located in the photosynthetic thylakoid membrane that acts as light-driven water:plastoquinone oxidoreductase. The crystal structure of PSII from Thermosynechococcus elongatus at 2.9-A resolution allowed the unambiguous assignment

Genome Engineering of the 2,3-Butanediol Biosynthetic Pathway for Tight Regulation in Cyanobacteria.

Science.gov (United States)

Nozzi, Nicole E; Atsumi, Shota

2015-11-20

Cyanobacteria have gained popularity among the metabolic engineering community as a tractable photosynthetic host for renewable chemical production. However, though a number of successfully engineered production systems have been reported, long-term genetic stability remains an issue for cyanobacterial systems. The genetic engineering toolbox for cyanobacteria is largely lacking inducible systems for expression control. The characterization of tight regulation systems for use in cyanobacteria may help to alleviate this problem. In this work we explore the function of the IPTG inducible promoter P(L)lacO1 in the model cyanobacterium Synechococcus elongatus PCC 7942 as well as the effect of gene order within an operon on pathway expression. According to our experiments, P(L)lacO1 functions well as an inducible promoter in S. elongatus. Additionally, we found that gene order within an operon can strongly influence control of expression of each gene.

Coléoptères nouveaux de l’Afrique du Musée de Leyde

NARCIS (Netherlands)

Fairmaire, L.

1888-01-01

Long. 22 à 25 mill. — Elongatus, convexus, fuscus aut brunneo-castaneus, modice nitidus, fulvo-pubescens; capite dense punctato, inter oculos sat late impresso, antice declivi, margine obtuse rotundato; antennis fuscis, medium corporis attingentibus, articulo 1° punctato, 2° minuto, 3° vix majore,

Electric field effects on red chlorophylls, b-carotenes and P700 in cyanobacterial photosystem I complexes.

NARCIS (Netherlands)

Frese, R.N.; Palacios, M.A.; Azzizi, A.; van Stokkum, I.H.M.; Kruip, J.; Rögner, M.; Karapetyan, N.V.; Schlodder, E.; van Grondelle, R.; Dekker, J.P.

2002-01-01

We have probed the absorption changes due to an externally applied electric field (Stark effect) of Photosystem I (PSI) core complexes from the cyanobacteria Synechocystis sp. PCC 6803, Synechococcus elongatus and Spirulina platensis. The results reveal that the so-called C719 chlorophylls in S.

Some Silurian (Llandovery) monograptids from Saudi Arabia

NARCIS (Netherlands)

El-Khayal, A.A.

1985-01-01

Three species of Monograptus are recognized from Qusayba, Al-Qasim Province, Saudi Arabia. The Qusayba Shales Member of the Tabuk Formation in central Saudi Arabia contains M. decipiens decipiens, M. ex gr. barrandei and M. elongatus, associated with other graptolites. This assemblage is indicative

Annual and spatial variability in endo- and ectoparasite infections of North Sea cod (Gadus morhua Linnaeus, 1758) larvae, post-larvae and juveniles

DEFF Research Database (Denmark)

Mehrdana, Foojan; Bahlool, Qusay Z. M.; Skovgaard, Alf

2014-01-01

A parasitological investigation was performed on a total of 5380 Atlantic cod larvae, post-larvae and small juveniles sampled from the North Sea during a period of five years. The copepod Caligus elongatus (Von Nordmann, 1832) and the nematode Hysterothylacium aduncum (Rudolphi, 1802) were found ...

Two new species of Colletteidae (Crustacea: Tanaidacea: Tanaidomorpha from Bransfield Strait, Antarctica

Directory of Open Access Journals (Sweden)

Juliana L. Segadilha

2017-11-01

Full Text Available Samples from deep benthic areas in the Bransfield Strait, Antarctica, revealed the presence of two new species of Colletteidae: Filitanais elongatus sp. nov. and Macrinella lavradoae sp. nov. Filitanais elongatus sp. nov. resembles F. moskalevi in its habitus; it can, however, be distinguished by characters such as the pleonites and pleotelson with lateral margins parallel and the uropod exopod being longer than half of the first endopod article. Macrinella lavradoae sp. nov. differs from the other species of Macrinella in the shape of the uropod and the pleotelson, with the uropod exopod shorter than the first article of the endopod, the uropod about as long as the pleotelson and the pleotelson with a rounded tip. The number of species of Tanaidacea recorded from Antarctica increases to 162, while the colletteids are now represented by 16 species. Moreover, the diagnosis of the genus Filitanais is herein modified.

Minimal tool set for a prokaryotic circadian clock.

Science.gov (United States)

Schmelling, Nicolas M; Lehmann, Robert; Chaudhury, Paushali; Beck, Christian; Albers, Sonja-Verena; Axmann, Ilka M; Wiegard, Anika

2017-07-21

Circadian clocks are found in organisms of almost all domains including photosynthetic Cyanobacteria, whereby large diversity exists within the protein components involved. In the model cyanobacterium Synechococcus elongatus PCC 7942 circadian rhythms are driven by a unique KaiABC protein clock, which is embedded in a network of input and output factors. Homologous proteins to the KaiABC clock have been observed in Bacteria and Archaea, where evidence for circadian behavior in these domains is accumulating. However, interaction and function of non-cyanobacterial Kai-proteins as well as homologous input and output components remain mainly unclear. Using a universal BLAST analyses, we identified putative KaiC-based timing systems in organisms outside as well as variations within Cyanobacteria. A systematic analyses of publicly available microarray data elucidated interesting variations in circadian gene expression between different cyanobacterial strains, which might be correlated to the diversity of genome encoded clock components. Based on statistical analyses of co-occurrences of the clock components homologous to Synechococcus elongatus PCC 7942, we propose putative networks of reduced and fully functional clock systems. Further, we studied KaiC sequence conservation to determine functionally important regions of diverged KaiC homologs. Biochemical characterization of exemplary cyanobacterial KaiC proteins as well as homologs from two thermophilic Archaea demonstrated that kinase activity is always present. However, a KaiA-mediated phosphorylation is only detectable in KaiC1 orthologs. Our analysis of 11,264 genomes clearly demonstrates that components of the Synechococcus elongatus PCC 7942 circadian clock are present in Bacteria and Archaea. However, all components are less abundant in other organisms than Cyanobacteria and KaiA, Pex, LdpA, and CdpA are only present in the latter. Thus, only reduced KaiBC-based or even simpler, solely KaiC-based timing systems

Modeling habitat suitability of the invasive clam Corbicula fluminea in a Neotropical shallow lagoon, southern Brazil

Directory of Open Access Journals (Sweden)

T. C. L. Silveira

Full Text Available Abstract This study aimed to model the habitat suitability for an invasive clam Corbicula fluminea in a coastal shallow lagoon in the southern Neotropical region (–30.22, –50.55. The lagoon (19km2, maximum deep 2.5m was sampled with an Ekman dredge in an orthogonal matrix comprising 84 points. At each sampling point, were obtained environmental descriptors as depth, organic matter content (OMC, average granulometry (Avgran, and the percentage of sand (Pcsand. Prediction performance of Generalized Linear Models (GLM, Generalized Additive Models (GAM and Boosted Regression Tree (BRT were compared. Also, niche overlapping with other native clam species (Castalia martensi, Neocorbicula limosa and Anodontites trapesialis was examined. A BRT model with 1400 trees was selected as the best model, with cross-validated correlation of 0.82. The relative contributions of predictors were Pcsand-42.6%, OMC-35.8%, Avgran-10.9% and Depth-10.8%. Were identified that C. fluminea occur mainly in sandy sediments with few organic matter, in shallow areas nor by the shore. The PCA showed a wide niche overlap with the native clam species C. martensi, N. limosa and A. trapesialis.

Toward the crystallization of photosystem II core complex from Pisum sativum L

Czech Academy of Sciences Publication Activity Database

Prudnikova, T.; Gavira, J. A.; Řezáčová, Pavlína; Molina, E.P.; Hunalová, Ivana; Sviridova, E.; Schmidt, V.; Kohoutová, J.; Kutý, Michal; Kaftan, D.; Vácha, F.; Garcia-Ruiz, J. M.; Kutá-Smatanová, Ivana

2010-01-01

Roč. 10, č. 8 (2010), s. 3391-3396 ISSN 1528-7483 R&D Projects: GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50510513; CEZ:AV0Z60870520; CEZ:AV0Z40550506 Keywords : crystal-structure * cyanobacterial * elongatus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.390, year: 2010

Towards a synthetic chloroplast.

Directory of Open Access Journals (Sweden)

Christina M Agapakis

2011-04-01

Full Text Available The evolution of eukaryotic cells is widely agreed to have proceeded through a series of endosymbiotic events between larger cells and proteobacteria or cyanobacteria, leading to the formation of mitochondria or chloroplasts, respectively. Engineered endosymbiotic relationships between different species of cells are a valuable tool for synthetic biology, where engineered pathways based on two species could take advantage of the unique abilities of each mutualistic partner.We explored the possibility of using the photosynthetic bacterium Synechococcus elongatus PCC 7942 as a platform for studying evolutionary dynamics and for designing two-species synthetic biological systems. We observed that the cyanobacteria were relatively harmless to eukaryotic host cells compared to Escherichia coli when injected into the embryos of zebrafish, Danio rerio, or taken up by mammalian macrophages. In addition, when engineered with invasin from Yersinia pestis and listeriolysin O from Listeria monocytogenes, S. elongatus was able to invade cultured mammalian cells and divide inside macrophages.Our results show that it is possible to engineer photosynthetic bacteria to invade the cytoplasm of mammalian cells for further engineering and applications in synthetic biology. Engineered invasive but non-pathogenic or immunogenic photosynthetic bacteria have great potential as synthetic biological devices.

Algal and invertebrate bioindicators detect sewage effluent along the coast of Titahi Bay, Wellington, New Zealand

International Nuclear Information System (INIS)

Dudley, B.D.; Shima, J.S.

2010-01-01

Sewage effluent contains both dissolved and particulate matter that can affect coastal ecosystems and cascade through food webs. We used δ 15 N and δ 13 C ratios to explore performance of a kelp (Carpophyllum maschalocarpum) and two invertebrates (a grazing isopod, Amphoroidea media, and a filter-feeding crab, Petrolisthes elongatus) as bioindicators along a gradient of sewage exposure. These species vary in trophic status and, consequently, are likely to assimilate sewage constituents differently into food webs. δ 15 N values in C. maschalocarpum and A. media were highest near the sewage outfall and decreased with increasing distance from the outfall. δ 13 C values in these two species did not appear to be reliable predictors of sewage concentrations in seawater. In contrast, δ 13 C ratios for P. elongatus were consistently depleted at sites nearest the sewage outfall, indicating the consumption of δ 13 C-depleted sewage particulates. These results suggest there is value in multiple-isotope and multi-species bioindicator approaches both for detecting sewage dispersal patterns and understanding the incorporation of sewage-derived nutrients into food webs. (author). 79 refs., 3 figs.

Lego clocks: building a clock from parts.

Science.gov (United States)

Brunner, Michael; Simons, Mirre J P; Merrow, Martha

2008-06-01

A new finding opens up speculation that the molecular mechanism of circadian clocks in Synechococcus elongatus is composed of multiple oscillator systems (Kitayama and colleagues, this issue, pp. 1513-1521), as has been described in many eukaryotic clock model systems. However, an alternative intepretation is that the pacemaker mechanism-as previously suggested-lies primarily in the rate of ATP hydrolysis by the clock protein KaiC.

A new species of Parichoronyssus (Acari: Dermanyssoidea: Macronyssidae) from bats of the genus Phyllostomus (Chiroptera: Phyllostomidae) in Peru and Venezuela, with keys to the species of Parichoronyssus.

Science.gov (United States)

Morales-Malacara, Juan B; Guerrero, Ricardo

2007-01-01

Parichoronyssus bakeri new species was found on two phyllostomid bats species, the greater spear-nosed bat, Phyllostomus hastatus (Pallas), and the lesser spear-nosed bat, Phyllostomus elongatus (E. Geoffroy), in Pakitza, National Park Manu, Madre de Dios, Peru, including additional material examined from Venezuela. The female, male, deutonymph, and protonymph are described and illustrated. A key to the seven species of Parichoronyssus is provided.

Live microbial cells adsorb Mg2+ more effectively than lifeless organic matter

Science.gov (United States)

Qiu, Xuan; Yao, Yanchen; Wang, Hongmei; Duan, Yong

2018-03-01

The Mg2+ content is essential in determining different Mg-CaCO3 minerals. It has been demonstrated that both microbes and the organic matter secreted by microbes are capable of allocating Mg2+ and Ca2+ during the formation of Mg-CaCO3, yet detailed scenarios remain unclear. To investigate the mechanism that microbes and microbial organic matter potentially use to mediate the allocation of Mg2+ and Ca2+ in inoculating systems, microbial mats and four marine bacterial strains ( Synechococcus elongatus, Staphylococcus sp., Bacillus sp., and Desulfovibrio vulgaris) were incubated in artificial seawater media with Mg/Ca ratios ranging from 0.5 to 10.0. At the end of the incubation, the morphology of the microbial mats and the elements adsorbed on them were analyzed using scanning electronic microscopy (SEM) and energy diffraction spectra (EDS), respectively. The content of Mg2+ and Ca2+ adsorbed by the extracellular polysaccharide substances (EPS) and cells of the bacterial strains were analyzed with atomic adsorption spectroscopy (AAS). The functional groups on the surface of the cells and EPS of S. elongatus were estimated using automatic potentiometric titration combined with a chemical equilibrium model. The results show that live microbial mats generally adsorb larger amounts of Mg2+ than Ca2+, while this rarely is the case for autoclaved microbial mats. A similar phenomenon was also observed for the bacterial strains. The living cells adsorb more Mg2+ than Ca2+, yet a reversed trend was observed for EPS. The functional group analysis indicates that the cell surface of S. elongatus contains more basic functional groups (87.24%), while the EPS has more acidic and neutral functional groups (83.08%). These features may be responsible for the different adsorption behavior of Mg2+ and Ca2+ by microbial cells and EPS. Our work confirms the differential Mg2+ and Ca2+ mediation by microbial cells and EPS, which may provide insight into the processes that microbes use to

¿La práctica de la siembra directa en cultivos de soja favorece las poblaciones de acridios (Orthoptera: Acrididae en el partido de Benito Juárez? Does the direct tillage practice in soybean crops favour grasshopper populations (Orthoptera: Acrididae, in Benito Juárez county?

Directory of Open Access Journals (Sweden)

Daniel Scuffi

2012-12-01

Full Text Available Considerando el desarrollo del cultivo de soja en siembra directa en el partido de Benito Juárez, y que algunos autores sostienen que esta práctica favorece los acridios, se evaluó la riqueza de especies y la abundancia en soja con siembra directa y convencional. Se registraron siete especies (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner y Scotussa lemniscata (Stål. La riqueza de especies acumulada en los diferentes cultivos fue similar (p> 0,05. En soja de primera con siembra directa, se registraron 2,3 ± 0,19 especies, en soja de primera con siembra convencional 1,45 ± 0,15 especies y en soja de segunda con siembra directa 2,25 ± 0,28 especies. Dichroplus elongatus fue la especie más abundante en todos los cultivos y en todos los momentos. Las restantes presentaron baja abundancia y se registraron en algunos momentos. No existió diferencia (p> 0,05 en la abundancia de tucuras entre los cultivos y en las diferentes fechas de muestreo. La baja riqueza de especies registrada estaría relacionada con la baja diversidad vegetal de los cultivos. Este estudio no mostró diferencias en la abundancia y riqueza de especies de acuerdo a la labranza utilizada.Considering the development of the soybean crops using direct tillage in Benito Juárez county, and taking into account that for some authors this practice favours the grasshopper populations, the abundance and species richness in soybean with direct and conventional tillage were evaluated. Seven species were registered (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner and Scotussa lemniscata (Stål. The accumulated richness was similar (p> 0.05, along the different crops; 2.3 ± 0.19 species were registered in

First report of two species of scarab beetles (Coleoptera, Scarabaeidae inside nests of Azteca cf. chartifex Forel (Hymenoptera, Formicidae in Brazilian Amazonian Rainforest

Directory of Open Access Journals (Sweden)

João Rafael Alves-Oliveira

Full Text Available ABSTRACT We report for the first time the occurrence of two species of scarab beetles, Phileurus carinatus declivis Prell, 1914 (Scarabaeidae: Dynastinae and Cyclidius elongatus (Olivier, 1789 (Cetoniinae: Cremastocheilini inside nests of Azteca cf. chartifex Forel, 1896, a neotropical arboreal ant species. This report indicates that these two beetle species are associated, at least as inquilines, to this ant species, although the nature of this relationship remains unclear.

Genetic diversity of pacu and piapara broodstocks in restocking programs in the rivers Paraná and Paranapanema (Brazil

Directory of Open Access Journals (Sweden)

Nelson Mauricio Lopera-Barrero

2016-09-01

Full Text Available The genetic diversity of Piaractus mesopotamicus (pacu and Leporinus elongatus (piapara broodstocks used in restocking programs in the rivers Paraná and Paranapanema is analyzed. One hundred and twenty specimens (two broodstocks of each species from fish ponds in Palotina PR Brazil and in Salto Grande SP Brazil were assessed. Ten primers produced 96 fragments, comprising 68 (70.83% and 94 (97.92% polymorphic fragments for P. mesopotamicus and L. elongatus broodstocks, respectively. Differences (p < 0.05 in the frequency of 15 and 27 fragments were detected for each species, without exclusive fragments. Shannon Index (0.347 - 0.572 and the percentage of polymorphic fragments (57.3% - 94.8% revealed high intra-population genetic variability for all broodstocks. Results of molecular variance analyses (AMOVA showed that most variations do not lie between the broodstocks but within each broodstock (89%. Genetic (0.088 and 0.142 and identity (0.916 and 0.868 distance rates demonstrated similarity between the broodstocks of each species, corroborated by Fst (0.1023 and 010.27 and Nm (4.18 and 4.33 rates, with a slight genetic difference due to genic flux. High intrapopulation genetic variability and similarity between the broodstocks of each species was also detected, proving a common ancestry.

Study on the Tribe Ochyromerini (Coleoptera, Curculionidae) from East Asia I, Descriptions of New Species of the Genera Endaeus and Endaenidius

OpenAIRE

Kojima, Hiroaki; Morimoto, Katsura

1995-01-01

This is the first part of our systematic study on the tribe Ochyromerini (=Endaeini) from East Asia with descriptions of 28 new species of the weevils in the genera Endaeus Schoenherr and Endaenidius Morimoto as follows: Endaeus albolineatus sp. nov. (E. Malaysia), Endaeus niger sp. nov. (E. Malaysia), Endaeus zonatus sp. nov. (E. Malaysia), Endaeus robustus sp. nov. (Thailand), Endaeus longipes sp. nov. (E. Malaysia), Endaeus formosanus sp. nov. (Taiwan), Endaeus elongatus sp. nov. (Taiwan),...

Iron Limitation and the Role of Siderophores in Marine Synechococcus

Science.gov (United States)

2009-06-01

an equilibrium exists between free metal ions in solution and metal ions bound to a cell’s transport enzymes . In this model the metal shifts between...cyanobacterium Synechococcus PCC 6301 and the thermophilic cyanobacterium Synechococcus elongatus. Planta 205: 73-81. Michel, K.P., Pistorius, E.K., and...and nitrogen metabo- lism enzymes (Dean et al., 1993; Geider and La Roche, 1994; Lin and Stewart, 1998), it is a key element with the potential to

Sea lice population and sex differences in P-glycoprotein expression and emamectin benzoate resistance on salmon farms in the Bay of Fundy, New Brunswick, Canada.

Science.gov (United States)

Igboeli, Okechukwu O; Burka, John F; Fast, Mark D

2014-06-01

Parasitic sea lice are a major challenge for salmon aquaculture. This is especially due to the recent development of resistance to emamectin benzoate (EMB) in the parasite. We investigated: (1) whether EMB treatment success in Grand Manan, Bay of Fundy, NB, Canada can be explained through EMB bioassay and P-glycoprotein (P-gp) mRNA expression studies; (2) if other populations of sea lice not under EMB selective pressure possess similar EMB sensitivity as Grand Manan sea lice populations; and (3) the heritability of EMB resistance in Lepeophtheirus salmonis. EMB bioassay results indicated population, species, sex and temporal differences in EMB EC50 values. RT-qPCR analyses revealed population and sex differences in P-gp mRNA levels, correlating with the bioassay results. Laboratory-reared sea lice maintained their EMB sensitivity status up to the F3 generation. Caligus elongatus, collected from Grand Manan showed more than twofold lower EMB EC50 values compared with L. salmonis collected from the same site. Concurrent exposure to EMB and verapamil yielded no increase in C. elongatus sensitivity to the parasiticide. Sea lice bioassay and P-gp mRNA studies can be used to track EMB resistance and sex differences in EMB sensitivity and P-gp mRNA levels exist in the parasite. © 2013 Society of Chemical Industry.

¿La práctica de la siembra directa en cultivos de soja favorece las poblaciones de acridios (Orthoptera: Acrididae en el partido de Benito Juárez?

Directory of Open Access Journals (Sweden)

Daniel SCUFFI

2012-01-01

Full Text Available Considerando el desarrollo del cultivo de soja en siembra directa en el partido de Benito Juárez, y que algunos autores sostienen que esta práctica favorece los acridios, se evaluó la riqueza de especies y la abundancia en soja con siembra directa y convencional. Se registraron siete especies (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner y Scotussa lemniscata (Stål. La riqueza de especies acumulada en los diferentes cultivos fue similar (p> 0,05. En soja de primera con siembra directa, se registraron 2,3 ± 0,19 especies, en soja de primera con siembra convencional 1,45 ± 0,15 especies y en soja de segunda con siembra directa 2,25 ± 0,28 especies. Dichroplus elongatus fue la especie más abundante en todos los cultivos y en todos los momentos. Las restantes presentaron baja abundancia y se registraron en algunos momentos. No existió diferencia (p> 0,05 en la abundancia de tucuras entre los cultivos y en las diferentes fechas de muestreo. La baja riqueza de especies registrada estaría relacionada con la baja diversidad vegetal de los cultivos. Este estudio no mostró diferencias en la abundancia y riqueza de especies de acuerdo a la labranza utilizada.

Actividad reproductiva en tres especies simpátricas del género Liolaemus (Reptilia: Sauria: Tropiduridae Actividad reproductiva en tres especies simpátricas del género Liolaemus (Reptilia: Sauria: Tropiduridae

Directory of Open Access Journals (Sweden)

Ramírez Pinilla Martha Patricia

1992-09-01

Full Text Available Sympatric species Liolaemus bibroni (oviparous, Liolaemus elongatus and Liolaemus ruibali (viviparous have partial fall reproductive activity for males and females. Males are reproductively active between fall and spring, females are vitellogenic especially during this season, they are gravid in spring and the oviposition/parturition occur at the end of spring and early summer. Reproductive cycles of males and females have not a long rest phase, and apparently are continuous. The incidence of  environmental and endogenous factors over the partial fall reproductive pattern in Liolaemus species is discussed. Machos y hembras de las especies simpátricas Liolaemus bibroni (ovípara, Liolaemus elongatus y Liolaemus ruibali (vivíparas tienen actividad reproductiva parcial de otoño. Los machos son reproductivos entre otoño y primavera, período en el que las hembras son vitelogénicas; las hembras están grávidas en primavera y el parto/oviposición sucede al final de esta estación y verano temprano. Los ciclos reproductivos de machos y hembras no tienen un período de receso prolongado, y tienden a ser continuos. Se discute la incidencia de factores ambientales y endógenos en el patrón reproductivo parcial de otoño en especies de Liolaemus.

Inhibitory activities of microalgal extracts against Epstein-Barr Virus (EBV antigen expression in lymphoblastoid cells

Directory of Open Access Journals (Sweden)

Koh Yih Yih

2014-01-01

Full Text Available The inhibitory activities of microalgal extracts against the expression of three EBV antigens, latent membrane protein (LMP1, Epstein-Barr nuclear antigen (EBNA1 and Z Epstein-Barr reactivation activator (ZEBRA were assessed by immunocytochemistry. The observation that the methanol extracts and their fractions from Ankistrodesmus convolutus, Synechococcus elongatus and Spirulina platensis exhibited inhibitory activity against EBV proteins in three Burkitt’s lymphoma cell lines at concentrations as low as 20 μg/ml suggests that microalgae could be a potential source of antiviral compounds against EBV.

New agnostina (Trilobita from the Llanvirn (Ordovician of Spain

Directory of Open Access Journals (Sweden)

Rábano, I.

1985-12-01

Full Text Available The agnostids from the Lower Llanvirn shales of the Southern Central-Iberian Zone (Mounts of Toledo, Villuercas and Almadén district are described. Seven localities are new for Ordovician agnostids and two are revised. Three new species, belonging to the genera Geragnostella and Geragnostus, are described: Geragnostella gilcidae n. sp., Geragnostus hispanicus n. sp. and Geragnostus ninhursagae n. sp. The new names Geragnostus pilleti nom. nov. and Geragnostus abdullaevi nom. nov. are proposed to rename, respectively, the species G. howelli PILLET, 1978 and G. elongatus ABDULLAEV, 1972, regarded herein as junior objective homonyms of other previously defined species.

Se estudian los trilobites agnóstidos procedentes de nueve localidades, siete de ellas nuevas para estas faunas, situadas en las pizarras del Llanvirn inferior de la parte meridional de la Zona Centroibérica (Montes de Toledo, Villuercas y región de Almadén. Se determina la presencia de los géneros Geragnostella y Geragnostus, y se describen tres nuevas especies: Geragnostella gilcidae n. sp., Geragnostus hispanicus n. sp. y Geragnostus ninhursagae n. sp. Se proponen también los nuevos nombres Geragnostus pilleti nom. nov. y Geragnostus abdullaevi nom. nov. para designar, respectivamente, las especies G. howelli PILLET, 1978, y G. elongatus ABDULLAEV, 1972, consideradas ambas homónimos objetivos primarios de otras especies definidas con anterioridad.

Culturing photosynthetic bacteria through surface plasmon resonance

Energy Technology Data Exchange (ETDEWEB)

Ooms, Matthew D.; Bajin, Lauren; Sinton, David [Department of Mechanical and Industrial Engineering and Centre for Sustainable Energy, University of Toronto, Toronto M5S 3G8 (Canada)

2012-12-17

In this work, cultivation of photosynthetic microbes in surface plasmon enhanced evanescent fields is demonstrated. Proliferation of Synechococcus elongatus was obtained on gold surfaces excited with surface plasmons. Excitation over three days resulted in 10 {mu}m thick biofilms with maximum cell volume density of 20% vol/vol (2% more total accumulation than control experiments with direct light). Collectively, these results indicate the ability to (1) excite surface-bound cells using plasmonic light fields, and (2) subsequently grow thick biofilms by coupling light from the surface. Plasmonic light delivery presents opportunities for high-density optofluidic photobioreactors for microalgal analysis and solar fuel production.

Population dynamics of calanoid copepods and the implications of their predation by clupeid fish in the Central Baltic Sea

DEFF Research Database (Denmark)

Möllmann, C.; Köster, Fritz

2002-01-01

. Additionally this study investigated the effect of predation by the major planktivorous fish species herring (Clupea harengus) and sprat (Sprattus sprattus) for the period 1977-1996 in the Gotland Basin (Central Baltic Sea). Examination of consumption by these fish species in relation to copepod production...... by sprat on CV/CVI of both copepod species in spring resulted in higher copepod mortality rates. In consequence, based on these results we suggest that the increase in the sprat stock since the late 1980s contributed to a decline of P. elongatus, and additionally prevented an even more pronounced...

Effects of elevated pH on marine copepods in mass cultivation systems

DEFF Research Database (Denmark)

Hansen, Benni Winding; Hansen, Per Juel; Nielsen, Torkel Gissel

2017-01-01

both Acartia spp. and C. typicus had higher mortality at pH 9.5 than at the other pH regimes while E. affinis nauplii were not affected by pH. Wild Acartia spp. and A. tonsa from a culture showed some differences in response although of minor practical importance for aquaculture; both produced no eggs......Female tolerance to pH (8.0–9.5) by six marine copepods, Oithona similis, Temora longicornis, Acartia spp., Centropages typicus, Pseudocalanus elongatus and Eurytemora affinis was investigated to identify robust species for live feed production. The species with the most oceanic...

Evaluation of algal biofilms on indium tin oxide (ITO for use in biophotovoltaic platforms based on photosynthetic performance.

Directory of Open Access Journals (Sweden)

Fong-Lee Ng

Full Text Available In photosynthesis, a very small amount of the solar energy absorbed is transformed into chemical energy, while the rest is wasted as heat and fluorescence. This excess energy can be harvested through biophotovoltaic platforms to generate electrical energy. In this study, algal biofilms formed on ITO anodes were investigated for use in the algal biophotovoltaic platforms. Sixteen algal strains, comprising local isolates and two diatoms obtained from the Culture Collection of Marine Phytoplankton (CCMP, USA, were screened and eight were selected based on the growth rate, biochemical composition and photosynthesis performance using suspension cultures. Differences in biofilm formation between the eight algal strains as well as their rapid light curve (RLC generated using a pulse amplitude modulation (PAM fluorometer, were examined. The RLC provides detailed information on the saturation characteristics of electron transport and overall photosynthetic performance of the algae. Four algal strains, belonging to the Cyanophyta (Cyanobacteria Synechococcus elongatus (UMACC 105, Spirulina platensis. (UMACC 159 and the Chlorophyta Chlorella vulgaris (UMACC 051, and Chlorella sp. (UMACC 313 were finally selected for investigation using biophotovoltaic platforms. Based on power output per Chl-a content, the algae can be ranked as follows: Synechococcus elongatus (UMACC 105 (6.38×10(-5 Wm(-2/µgChl-a>Chlorella vulgaris UMACC 051 (2.24×10(-5 Wm(-2/µgChl-a>Chlorella sp.(UMACC 313 (1.43×10(-5 Wm(-2/µgChl-a>Spirulina platensis (UMACC 159 (4.90×10(-6 Wm(-2/µgChl-a. Our study showed that local algal strains have potential for use in biophotovoltaic platforms due to their high photosynthetic performance, ability to produce biofilm and generation of electrical power.

Is Monoglucosyldiacylglycerol a Precursor to Monogalactosyldiacylglycerol in All Cyanobacteria?

Science.gov (United States)

Sato, Naoki

2015-10-01

Monogalactosyldiacylglycerol (MGDG) is ubiquitous in the photosynthetic membranes of cyanobacteria and chloroplasts. It is synthesized by galactosylation of diacylglycerol (DAG) in the chloroplasts, whereas it is produced by epimerization of monoglucosyldiacylglycerol (GlcDG) in at least several cyanobacteria that have been analyzed such as Synechocystis sp. PCC 6803. A previous study, however, showed that the mgdE gene encoding the epimerase is absent in some cyanobacteria such as Gloeobacter violaceus, Thermosynechococcus elongatus and Acaryochloris marina. In addition, the N-terminal 'fatty acid hydroxylase' domain is lacking in the MgdE protein of Prochlorococcus marinus. These problems may cast doubt upon the general (or exclusive) role of MgdE in the epimerization of GlcDG to MGDG in cyanobacteria. In addition, GlcDG is usually present at a very low level, and the structural determination of endogenous GlcDG has not been accomplished with cyanobacterial samples. In this study, I determined the structure of GlcDG from Anabaena variabilis by (1)H- and (13)C-nuclear magnetic resonance (NMR) spectroscopy. I then showed that G. violaceus, T. elongatus, A. marina and P. marinus contain GlcDG. In all cases, GlcDG consisted of fewer unsaturated molecular species than MGDG, providing further evidence that GlcDG is a precursor to MGDG. The conversion of GlcDG to MGDG was also demonstrated by radiolabeling and chase experiments in G. violaceus and P. marinus. These results demonstrate that all the analyzed cyanobacteria contain GlcDG, which is converted to MGDG, and suggest that an alternative epimerase is required for MGDG synthesis in these cyanobacteria. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Sinop Yarımadası (Güney Karadeniz Kıyısal Sularındaki Bazı Syngnathid Türlerinin (Syngnathus sp., Nerophis sp., Hippocampus sp. Besin Kompozisyonları

Directory of Open Access Journals (Sweden)

Şule GÜRKAN

2012-09-01

Full Text Available Bu araştırmada, Temmuz 2001 - Mayıs 2002 tarihleri arasında Sinop yarımadası (güney Karadeniz kıyısal sularının 5 – 15 m derinliklerindeki farklı biyotoplarından el direci kullanılarak yakalanan 6 deniziğnesi (Syngnathus acus Linnaeus, 1758; Syngnathus typhle Linnaeus, 1758; Syngnathus tenurostris Rathke, 1837; Syngnathus variegatus Palas, 1811; Nerophis ophidion Linnaeus, 1758; Syngnathus abaster Risso,1926 ve bir denizatı (Hippocampus hippocampus (L.,1758 türüne ait toplam 130 bireyde 105 mide içeriği incelenmiştir. Analizler sonunda mide içeriklerinde 13 av grubu tespit edilmiştir. Deniziğnesi türlerinin besin içeriğinde bulunuş frekans değeri (% F bakımından en baskın av grupları; S. acus’da % 90.9 Euterpina acutifrons, S. typhle’de % 93.3 tanımlanamamış doku parçaları, S. tenurostris’de % 87 Pseudocalanus elongatus, S. variegatus’da % 91.7 tanımlanamamış doku parçaları, N. ophidion’da % 90 Euterpina acutifrons, S. abaster’de ise % 100 Pseudocalanus elongatus, Euterpina acutifrons, Cirriped cypris, ve Cirriped nauiplius’dur. H. hippocampus ise % 25 ile Onceae sp. en baskın av grubudur. Sonuç olarak, deniziğnesi ve denizatı türlerinin esasen bentik ve planktonik krustase gruplarıyla beslendikleri görülmekle birlikte S. tenuirostris, S. abaster ve S. variegatus için besin kompozisyonu kıyılarımızdan ilk kez belirlenmiştir

The strontium inorganic mutant of the water oxidizing center (CaMn4O5) of PSII improves WOC efficiency but slows electron flux through the terminal acceptors.

Science.gov (United States)

Gates, Colin; Ananyev, Gennady; Dismukes, G Charles

2016-09-01

Herein we extend prior studies of biosynthetic strontium replacement of calcium in PSII-WOC core particles to characterize whole cells. Previous studies of Thermosynechococcus elongatus found a lower rate of light-saturated O2 from isolated PSII-WOC(Sr) cores and 5-8× slower rate of oxygen release. We find similar properties in whole cells, and show it is due to a 20% larger Arrhenius activation barrier for O2 evolution. Cellular adaptation to the sluggish PSII-WOC(Sr) cycle occurs in which flux through the QAQB acceptor gate becomes limiting for turnover rate in vivo. Benzoquinone derivatives that bind to QB site remove this kinetic chokepoint yielding 31% greater O2 quantum yield (QY) of PSII-WOC(Sr) vs. PSII-WOC(Ca). QY and efficiency of the WOC(Sr) catalytic cycle are greatly improved at low light flux, due to fewer misses and backward transitions and 3-fold longer lifetime of the unstable S3 state, attributed to greater thermodynamic stabilization of the WOC(Sr) relative to the photoactive tyrosine YZ. More linear and less cyclic electron flow through PSII occurs per PSII-WOC(Sr). The organismal response to the more active PSII centers in Sr-grown cells at 45°C is to lower the number of active PSII-WOC per Chl, producing comparable oxygen and energy per cell. We conclude that redox and protonic energy fluxes created by PSII are primary determinants for optimal growth rate of T. elongatus. We further conclude that the (Sr-favored) intermediate-spin S=5/2 form of the S2 state is the active form in the catalytic cycle relative to the low-spin S=1/2 form. Copyright © 2016 Elsevier B.V. All rights reserved.

Diet and feeding strategies of mesopelagic fishes in the western Mediterranean

Science.gov (United States)

Bernal, Ainhoa; Olivar, M. Pilar; Maynou, Francesc; Fernández de Puelles, M. Luz

2015-06-01

Myctophids, gonostomatids and sternoptychids are the most abundant teleosteans worldwide and constitute an important assemblage of the mesopelagic ecosystem, functioning as vehicles of energy and matter through trophic webs. This study concentrates on the trophic ecology of the most abundant mesopelagic fishes of the western Mediterranean (WM) based on stomach content analysis. The myctophids (in this study: Benthosema glaciale, Ceratoscopelus maderensis, Lobianchia dofleini, Myctophum punctatum, Hygophum benoiti, Hygophum hygomii, Lampanyctus crocodilus, Lampanyctus pusillus and Notoscopelus elongatus) perform extensive diel migrations across the water column, between the surface to as deep as 1000 m, interacting with plankton and micronekton at multiple depths, and generally feeding in the epipelagic layers at night. In contrast, the gonostomatids Cyclothone braueri, Cyclothone pygmaea, and the sternoptychid Argyropelecus hemigymnus remain below epipelagic layers, feeding at different times throughout the day and night. The diet composition, trophic niche breadth and prey selectivity of 11 of these fish species were determined for juvenile and adult individuals from two surveys performed in December 2009 and July 2010 in the western Mediterranean Sea. The number of prey items varied among species, e.g. Myctophum punctatum was the species with the highest feeding intensity, reaching ca. 700 prey items in a stomach, whereas the mean number of prey in Cyclothone braueri was low (usually 1 or 2 prey per stomach). A dietary shift towards larger prey was evident from juveniles to the largest and oldest adult individuals, despite trophic niche breadths did not increase with body length for any of these mesopelagic species. The diets of the small gonostomatids, sternoptychid and early juveniles of myctophids were dominated by non-calanoid copepods, ostracods, and other small zooplankton, whereas medium-sized myctophids, e.g. L. dofleini or H. benoiti, preyed mainly on

Cd2+ Effect on Photosynthetic Apparatus in Synechococcus elongatus and Spinach (Spinacia oleracea L.)

Czech Academy of Sciences Publication Activity Database

Nováková, Marie; Matějová, E.; Sofrová, D.

2004-01-01

Roč. 42, č. 3 (2004), s. 425-430 ISSN 0300-3604 R&D Projects: GA ČR GA525/02/0301 Institutional research plan: CEZ:AV0Z5038910 Keywords : cyanobacteria * heavy metals * photochemical activity Subject RIV: ED - Physiology Impact factor: 0.734, year: 2004

Coprorhexy, coprophagy, and coprochaly in the copepods Calanus helgolandicus, Pseudocalanus elongatus, and Oithona similis

DEFF Research Database (Denmark)

Iversen, Morten; Poulsen, Louise K.

2007-01-01

Studies of fecal pellet flux show that a large percentage of pellets produced in the upper ocean is degraded within the surface waters. It is therefore important to investigate these degradation mechanisms to understand the role of fecal pellets in the oceanic carbon cycle. Degradation of pellets...

Blind dating - mate finding in planktonic copepods. II. The pheromone cloud of Pseudocalanus elongatus

DEFF Research Database (Denmark)

Kiørboe, Thomas; Bagøien, E.; Thygesen, Uffe Høgsbro

2005-01-01

mm away from her. The multiple excursions define a near-spherical volume around the female within which he is capable of navigating back to her. During courtship the female hovers, but she frequently changes her body orientation and, thus, the direction of her feeding current, which also causes her...

Perfil de ácidos grasos de diversas especies de pescados consumidos en México

Directory of Open Access Journals (Sweden)

María Isabel Castro González

2013-12-01

Full Text Available Los factores bióticos y abióticos determinan la composición de ácidos grasos AG en los peces, información relevante por la asociación existente entre su consumo y los beneficios para la salud humana. El objetivo de esta investigación fue identificar la variación en la concentración de AG, según diferentes factores, en diez especies marinas de pescado comestible en México: Euthynnus alletteratus, Sciaenops ocellatus, Bairdiella chrysoura, Sphyraena guachancho, Symphurus elongatus, Istiophorus platypterus, Ophichthus rex, Eugerres plumieri, Eucinostomus entomelas y Oreochromis mossambicus. La determinación de AG se llevó a cabo mediante cromatografía de gases. El contenido de lípidos totales varió entre 0.93 y 1.95g/100g en E. entomelas y O. mossambicus, respectivamente. E. alletteratus, B. chrysoura, S elongatus, I. platypterus, O. rex y E. plumieri presentaron el siguiente orden en la concentración de AG: AG poliinsaturados AGPAG saturados AGSAG monoinsaturados AGM. S. ocellatus, S. guachancho y E. entomelas: AGSAGPAGM; mientras que tan solo O. mossambicus presentó AGSAGMAGP. Este tuvo la mayor concentración de AGS 559.40mg/100g y AGM 422.60mg/100g, mientras que B. chrysoura presentó el mayor contenido mg/100g de AGP 663.03, AGn-3 514.03, EPA+DHA 506.10 y AGn-6 145.80. Factores bióticos y abióticos influyeron significativamente en la concentración de AG. Las especies subtropicales presentaron una concentración 42.1 mayor de EPA+DHA que las tropicales. Los valores presentados pueden cambiar según modificaciones en el ecosistema y en las características de cada especie, sin embargo, el conocimiento aquí generado es útil para mejorar las recomendaciones sobre el consumo de pescado.

Commercial trials using emamectin benzoate to control sea lice Lepeophtheirus salmonis infestations in Atlantic salmon Salmo salar.

Science.gov (United States)

Stone, J; Sutherland, I H; Sommerville, C; Richards, R H; Varma, K J

2000-06-19

Two trials were conducted at commercial salmon farms to evaluate the efficacy of emamectin benzoate (Slice, 0.2% aquaculture pre-mix, Schering-Plough Animal Health) as a treatment for sea lice Lepeophtheirus salmonis (Krøyer) and Caligus elongatus Nordmann infestations in Atlantic salmon Salmo salar L. Trials were carried out in 15 m2 commercial sea pens, at temperatures of 5.5 to 7.5 degrees C and 10.8 to 13.8 degrees C. Each pen was stocked with 14,000 to 17,500 fish with mean weights of 0.44 to 0.74 and 1.33 to 1.83 kg. Fish were naturally infested with sea lice at the start of each trial. At Day -1, samples of 10 or 15 fish were taken from each pen to determine pre-treatment numbers of lice. Emamectin benzoate was administered in feed, to 4 replicate pens, at a dose of 50 micrograms kg-1 biomass d-1 for 7 consecutive days (Days 0 to 6). Sea lice were counted again, between Days 7 and 77, and comparisons made with untreated control fish. Despite adverse weather conditions, wide variations in fish weights and exposure to new infestations, treatment was effective against chalimus and motile stages of L. salmonis. In the autumn trial, efficacy at Day 27 was 89%, and lice numbers remained lower on treated fish than on control fish 64 d from the start of treatment. In the winter trial, reductions in lice numbers at low temperatures were slower but good efficacy was achieved by Day 35. Although control fish had to be treated with hydrogen peroxide at Day 21, fish treated only with emamectin benzoate on Days 0 to 6 still had 89% fewer lice than control fish at Day 35. There were very few C. elongatus present, but at the end of both trials numbers were lower on treated fish. No adverse effects were associated with treatment of fish with emamectin benzoate.

Aboriginal Consumption of Estuarine Food Resources and Potential Implications for Health through Trace Metal Exposure; A Study in Gumbaynggirr Country, Australia.

Science.gov (United States)

Russell, Shaina; Sullivan, Caroline A; Reichelt-Brushett, Amanda J

2015-01-01

Fishing and resource use continues to be an essential aspect of life for many Aboriginal communities throughout Australia. It is important for dietary sustenance, and also retains deep social, cultural and economic significance, playing a fundamental role in maintaining group cohesion, transferring cultural knowledge and affirming Indigenous identities. We surveyed approximately 20% of the Gumbaynggirr Aboriginal community of Nambucca Heads, New South Wales, Australia. This paper explores Gumbaynggirr Connection to Country and engagement in cultural practice. It quantifies fishing efforts and consumption of seafood within the community. We found 95% of the sample group fish, with the highest rate of fishing being 2-3 times a week (27%). Furthermore, 98% of participants eat seafood weekly or more frequently, up to more than once a day (24%). Survey results revealed that Myxus elongatus (Sand mullet) and naturally recruited Saccostrea glomerata (Sydney rock oysters) continue to be important wild resources to the Gumbaynggirr community. Trace metals were measured in M. elongatus and S. glomerata samples collected by community participants in this study. Maximum levels prescribed in the Australia New Zealand Food Standards Code were not exceeded in the edible tissue for either species, however both species exceeded the generally expected levels for zinc and copper and S. glomerata samples exceeded the generally expected level for selenium. Furthermore the average dietary exposure to trace metals from consuming seafood was calculated for the surveyed population. Trace metal intake was then compared to the provisional tolerable weekly intake prescribed by the Joint Expert Committee on Food Additives. This process revealed that copper and selenium intake were both within the provisional tolerable weekly intake, while there is no guideline for zinc. Furthermore, participants relying heavily on wild resources from the Nambucca River estuary may exceed the provisional

Aboriginal Consumption of Estuarine Food Resources and Potential Implications for Health through Trace Metal Exposure; A Study in Gumbaynggirr Country, Australia.

Directory of Open Access Journals (Sweden)

Shaina Russell

Full Text Available Fishing and resource use continues to be an essential aspect of life for many Aboriginal communities throughout Australia. It is important for dietary sustenance, and also retains deep social, cultural and economic significance, playing a fundamental role in maintaining group cohesion, transferring cultural knowledge and affirming Indigenous identities. We surveyed approximately 20% of the Gumbaynggirr Aboriginal community of Nambucca Heads, New South Wales, Australia. This paper explores Gumbaynggirr Connection to Country and engagement in cultural practice. It quantifies fishing efforts and consumption of seafood within the community. We found 95% of the sample group fish, with the highest rate of fishing being 2-3 times a week (27%. Furthermore, 98% of participants eat seafood weekly or more frequently, up to more than once a day (24%. Survey results revealed that Myxus elongatus (Sand mullet and naturally recruited Saccostrea glomerata (Sydney rock oysters continue to be important wild resources to the Gumbaynggirr community. Trace metals were measured in M. elongatus and S. glomerata samples collected by community participants in this study. Maximum levels prescribed in the Australia New Zealand Food Standards Code were not exceeded in the edible tissue for either species, however both species exceeded the generally expected levels for zinc and copper and S. glomerata samples exceeded the generally expected level for selenium. Furthermore the average dietary exposure to trace metals from consuming seafood was calculated for the surveyed population. Trace metal intake was then compared to the provisional tolerable weekly intake prescribed by the Joint Expert Committee on Food Additives. This process revealed that copper and selenium intake were both within the provisional tolerable weekly intake, while there is no guideline for zinc. Furthermore, participants relying heavily on wild resources from the Nambucca River estuary may exceed the

The genus Trematocarpus (Sarcodiaceae, Rhodophyta in southern Africa and the exclusion of Sphaerococcus (Chondrus scutellatus

Directory of Open Access Journals (Sweden)

R. H. Simons

1983-11-01

Full Text Available Trematocarpus Kützing in southern Africa is found to comprise four taxa in three species: newly described is T.  fragilis (Ag. De Toni var. divaricatus Simons, var. nov. Two of the species, T. flabellatus (J. Ag. De Toni and T.  affinis (J. Ag. De Toni are restored to independent specific rank after being regarded as synonyms of T.  scutellatus (Her. Searles. It is shown that  Sphaerococcus (Chondrus scutellatus Her., the basionym of  T.  scutellatus refers to a species of Gigartina, therefore a new combination Gigartina scutellata (Her. Simons is made for this species which was formerly known as G. fastigiata J. Ag. and G. scabiosa (Kiitz. Papenf. Trematocarpus elongatus Kiitz. is relegated to synonymy under T. fragilis var.  divaricatus.

Life-stage-specific differences in exploitation of food mixtures: diet mixing enhances copepod egg production but not juvenile development

DEFF Research Database (Denmark)

Koski, Marja; Breteler, W.K.; Schogt, N.

2006-01-01

, the copepods failed to moult past the first copepodite stage, and the mortality was high. In sharp contrast, mixing two nutritionally poor food species often resulted in egg production which was not significantly different from nutritionally high quality food, although hatching success in many mixtures was low......Development, egg production and hatching success of the calanoid copepods Temora longicornis and Pseudocalanus elongatus were measured in food mixtures to test their ability to obtain a complete nutrition by combining different nutritionally poor food species. In all the food mixtures used....... Whereas egg production was significantly correlated with particulate organic nitrogen in the diet, and independent of the highly unsaturated fatty acids (HUFAs), eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA), hatching increased with increasing DHA and EPA concentration. Growth and juvenile...

Specific Interaction between Redox Phospholipid Polymers and Plastoquinone in Photosynthetic Electron Transport Chain.

Science.gov (United States)

Tanaka, Kenya; Kaneko, Masahiro; Ishikawa, Masahito; Kato, Souichiro; Ito, Hidehiro; Kamachi, Toshiaki; Kamiya, Kazuhide; Nakanishi, Shuji

2017-04-19

Redox phospholipid polymers added in culture media are known to be capable of extracting electrons from living photosynthetic cells across bacterial cell membranes with high cytocompatibility. In the present study, we identify the intracellular redox species that transfers electrons to the polymers. The open-circuit electrochemical potential of an electrolyte containing the redox polymer and extracted thylakoid membranes shift to positive (or negative) under light irradiation, when an electron transport inhibitor specific to plastoquinone is added upstream (or downstream) in the photosynthetic electron transport chain. The same trend is also observed for a medium containing living photosynthetic cells of Synechococcus elongatus PCC7942. These results clearly indicate that the phospholipid redox polymers extract photosynthetic electrons mainly from plastoquinone. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

A new species of Tereancistrum (Monogenea, Dactylogyridae) from the gills of three Leporinus species (Characiformes, Anostomidae) and a revised description of Tereancistrum parvus.

Science.gov (United States)

Zago, Aline C; Yamada, Fábio H; Franceschini, Lidiane; Bongiovani, Marcela F; Yamada, Priscilla O F; Silva, Reinaldo J DA

2017-01-01

The present study describes Tereancistrum flabellum n. sp. (Dactylogyridae, Ancyrocephalinae) from the gills of the anostomid fishes Leporinus friderici, Leporinus amblyrhynchus and Leporinus elongatus from two freshwater ecosystems in the south east of Brazil. This new species is mainly characterized by the morphology of the copulatory complex (such as the MCO base formed by two fan-shaped structures, and accessory piece flattened, curved, rigid and channeled), a dorsal anchor with a well-developed superficial and inconspicuous deep root, and the shape of the accessory anchor sclerite with small spathulate termination. Tereancistrum flabellum n. sp. is the first record of a dactylogyrid from L. amblyrhynchus. The description of Tereancistrum parvus is also emended to correct and complement previous descriptions and the species is reported for the first time in Schizodon nasutus.

Effects of Irregular Bimetallic Nanostructures on the Optical Properties of Photosystem I from Thermosynechococcus elongatus

Directory of Open Access Journals (Sweden)

Imran Ashraf

2015-07-01

Full Text Available The fluorescence of photosystem I (PSI trimers in proximity to bimetallic plasmonic nanostructures have been explored by single-molecule spectroscopy (SMS at cryogenic temperature (1.6 K. PSI serves as a model for biological multichromophore-coupled systems with high potential for biotechnological applications. Plasmonic nanostructures are fabricated by thermal annealing of thin metallic films. The fluorescence of PSI has been intensified due to the coupling with plasmonic nanostructures. Enhancement factors up to 22.9 and 5.1 are observed for individual PSI complexes coupled to Au/Au and Ag/Au samples, respectively. Additionally, a wavelength dependence of fluorescence enhancement is observed, which can be explained by the multichromophoric composition of PSI.

Global metabolic rewiring for improved CO2 fixation and chemical production in cyanobacteria

Science.gov (United States)

Kanno, Masahiro; Carroll, Austin L.; Atsumi, Shota

2017-03-01

Cyanobacteria have attracted much attention as hosts to recycle CO2 into valuable chemicals. Although cyanobacteria have been engineered to produce various compounds, production efficiencies are too low for commercialization. Here we engineer the carbon metabolism of Synechococcus elongatus PCC 7942 to improve glucose utilization, enhance CO2 fixation and increase chemical production. We introduce modifications in glycolytic pathways and the Calvin Benson cycle to increase carbon flux and redirect it towards carbon fixation. The engineered strain efficiently uses both CO2 and glucose, and produces 12.6 g l-1 of 2,3-butanediol with a rate of 1.1 g l-1 d-1 under continuous light conditions. Removal of native regulation enables carbon fixation and 2,3-butanediol production in the absence of light. This represents a significant step towards industrial viability and an excellent example of carbon metabolism plasticity.

Development of a sperm cryopreservation protocol for redside dace, Clinostomus elongatus: implications for genome resource banking

DEFF Research Database (Denmark)

Butts, Ian A.E.; Mokdad, A.; Trippel, E.A.

2013-01-01

of extirpation.We developed cryopreservation protocols by testing the effects of diluent (buffered sperm motility-inhibiting saline solution [BSMIS]; BSMIS + glycine; sucrose; and Hanks’ balanced salt solution [HBSS]), cryoprotectant (dimethyl sulfoxide [DMSO]; propylene glycol [PG]; N,N-dimethylacetamide [DMA...... rate was not significant for BSMIS + glycine or for HBSS, but an effect was detected for sucrose, with sperm frozen at 5◦C/min or 10◦C/min having higher motility than sperm frozen at 1◦C/min. The effect of extender was not significant at 1◦C/min or 5◦C/min, but an effect was detected at 10◦C...

Short-term cold storage of sperm from six neotropical characiformes fishes

Directory of Open Access Journals (Sweden)

Simone Marques

2004-09-01

Full Text Available Sperm of the following Neotropical Characiformes fish species were tested for cold storage: Brycon lundii, Piaractus mesopotamicus, Leporinus elongatus, Leporinus friderici, Prochilodus lineatus and Prochilodus marggravii. Each sperm sample was split into two aliquots. The first was placed into a plastic bag with air or oxygen and the second, in a plastic tube with air. The samples were maintained at temperatures between 1.7-4.9 ºC. The rate of sperm motility was estimated using a 50 mM NaCl solution as the activating solution. The shortest sperm storage duration (7 h was recorded for L. friderici, when the sperm motility rate reached ~ 30%, whereas the longest duration (20 h was obtained with the sperm of P. lineatus. A fertilisation test using Prochilodus marggravii sperm refrigerated for 8 h yielded 88-90% of viable embryos. The refrigerated storage method could be of practical applications, especially in fish reproductive management at hatchery stations.O sêmen das seguintes espécies de Characiformes neotropicais foi testado para armazenamento em ambiente resfriado: Brycon lundii, Piaractus mesopotamicus, Leporinus elongatus, Leporinus friderici, Prochilodus lineatus e Prochilodus marggravii. Amostras de sêmen, obtidas por massagem da parede celômica, foram armazenadas em saco plástico com ar ou oxigênio ou em tubo plástico com ar, e mantidas resfriadas entre 1,7-4,9º C. A taxa de motilidade espermática foi estimada usando-se NaCl 50 mM como solução ativadora. O sêmen com menor duração de viabilidade (7 h foi o de L. friderici, quando a taxa de motilidade espermática alcançou ~30%, enquanto que o de maior duração (20 h foi o de P. lineatus. A fertilização de ovócitos utilizando sêmen refrigerado por 8 h de Prochilodus marggravii produziu 88-90% de embriões viáveis. O método de armazenamento desenvolvido neste trabalho tem aplicações práticas, especialmente no manejo reprodutivo de peixes em estações de

Engineering a cyanobacterium as the catalyst for the photosynthetic conversion of CO2 to 1,2-propanediol

Directory of Open Access Journals (Sweden)

Li Han

2013-01-01

Full Text Available Abstract Background The modern society primarily relies on petroleum and natural gas for the production of fuels and chemicals. One of the major commodity chemicals 1,2-propanediol (1,2-PDO, which has an annual production of more than 0.5 million tons in the United States, is currently produced by chemical processes from petroleum derived propylene oxide, which is energy intensive and not sustainable. In this study, we sought to achieve photosynthetic production of 1,2-PDO from CO2 using a genetically engineered cyanobacterium Synechococcus elongatus PCC 7942. Compared to the previously reported biological 1,2-PDO production processes which used sugar or glycerol as the substrates, direct chemical production from CO2 in photosynthetic organisms recycles the atmospheric CO2 and will not compete with food crops for arable land. Results In this study, we reported photosynthetic production of 1,2-PDO from CO2 using a genetically engineered cyanobacterium Synechococcus elongatus PCC 7942. Introduction of the genes encoding methylglyoxal synthase (mgsA, glycerol dehydrogenase (gldA, and aldehyde reductase (yqhD resulted in the production of ~22mg/L 1,2-PDO from CO2. However, a comparable amount of the pathway intermediate acetol was also produced, especially during the stationary phase. The production of 1,2-PDO requires a robust input of reducing equivalents from cellular metabolism. To take advantage of cyanobacteria’s NADPH pool, the synthetic pathway of 1,2-PDO was engineered to be NADPH-dependent by exploiting the NADPH-specific secondary alcohol dehydrogenases which have not been reported for 1,2-PDO production previously. This optimization strategy resulted in the production of ~150mg/L 1,2-PDO and minimized the accumulation of the incomplete reduction product, acetol. Conclusion This work demonstrated that cyanobacteria can be engineered as a catalyst for the photosynthetic conversion of CO2 to 1,2-PDO. This work also characterized two NADPH

Improved Alkane Production in Nitrogen-Fixing and Halotolerant Cyanobacteria via Abiotic Stresses and Genetic Manipulation of Alkane Synthetic Genes.

Science.gov (United States)

Kageyama, Hakuto; Waditee-Sirisattha, Rungaroon; Sirisattha, Sophon; Tanaka, Yoshito; Mahakhant, Aparat; Takabe, Teruhiro

2015-07-01

Cyanobacteria possess the unique capacity to produce alkane. In this study, effects of nitrogen deficiency and salt stress on biosynthesis of alkanes were investigated in three kinds of cyanobacteria. Intracellular alkane accumulation was increased in nitrogen-fixing cyanobacterium Anabaena sp. PCC7120, but decreased in non-diazotrophic cyanobacterium Synechococcus elongatus PCC7942 and constant in a halotolerant cyanobacterium Aphanothece halophytica under nitrogen-deficient condition. We also found that salt stress increased alkane accumulation in Anabaena sp. PCC7120 and A. halophytica. The expression levels of two alkane synthetic genes were not upregulated significantly under nitrogen deficiency or salt stress in Anabaena sp. PCC7120. The transformant Anabaena sp. PCC7120 cells with additional alkane synthetic gene set from A. halophytica increased intracellular alkane accumulation level compared to control cells. These results provide a prospect to improve bioproduction of alkanes in nitrogen-fixing halotolerant cyanobacteria via abiotic stresses and genetic engineering.

Role of essential lipids in copepod nutrition: no evidence for trophic upgrading of food quality by a marine ciliate

DEFF Research Database (Denmark)

Klein Breteler, W.; Koski, Marja; Rampen, S.

2004-01-01

-quality Rhodomonas sp. diet. The specific mass of fatty acids in S. sulcatum was much lower than in the Dunaliella sp. diet, However, the fatty acid composition of the protozoan more or less resembled that of the food, lacking long-chain highly unsaturated fatty acids (HUFAs). Sterols only occurred in Dunaliella sp......The ciliate Strombidium sulcatum was used to feed and grow young stages of the copepods Temora longicornis (Muller) and Pseudocalanus elongatus (Boeck). The ciliate was cultured in the laboratory using either bacteria or the green alga Dunaliella sp. as a food source. Young copepodites of both......., although in low abundance of unuseful Delta7 sterols. Obviously, S. sulcatum did not biochemically enhance bacterial or algal food for subsequent use at higher trophic levels, and only transferred fatty acids without further conversion. The results indicate a deficiency in the ciliate of HUFAs and sterols...

Cyanobacterial diversity in extreme environments in Baja California, Mexico: a polyphasic study.

Science.gov (United States)

López-Cortés, A; García-Pichel, F; Nübel, U; Vázquez-Juárez, R

2001-12-01

Cyanobacterial diversity from two geographical areas of Baja California Sur, Mexico, were studied: Bahia Concepcion, and Ensenada de Aripez. The sites included hypersaline ecosystems, sea bottom, hydrothermal springs, and a shrimp farm. In this report we describe four new morphotypes, two are marine epilithic from Bahia Concepcion, Dermocarpa sp. and Hyella sp. The third, Geitlerinema sp., occurs in thermal springs and in shrimp ponds, and the fourth, Tychonema sp., is from a shrimp pond. The partial sequences of the 16S rRNA genes and the phylogenetic relationship of four cyanobacterial strains (Synechococcus cf. elongatus, Leptolyngbya cf. thermalis, Leptolyngbya sp., and Geitlerinema sp.) are also presented. Polyphasic studies that include the combination of light microscopy, cultures and the comparative analysis of 16S rRNA gene sequences provide the most powerful approach currently available to establish the diversity of these oxygenic photosynthetic microorganisms in culture and in nature.

Genetic variability in five species of Anostomidae (Ostariophysi - Characiformes

Directory of Open Access Journals (Sweden)

Chiari Lucimara

1999-01-01

Full Text Available Genetic variability was studied in five fish species (Anostomidae: Schizodon intermedius and S. nasutus and Leporinus friderici, L. elongatus and L. obtusidens, collected at one location on the Tibagi River (Paraná, Brazil. The protein data from seven systems coded collectively for 19 loci in the liver, muscle and heart. Nine of these loci were polymorphic. The estimated proportion of polymorphism loci ( varied from 16.7% in S. intermedius to 36.9% in L. friderici; the mean heterozygosity observed (o was 0.027 ± 0.015 and 0.109 ± 0.042, respectively. The estimated value of the genetic identity among L. friderici and S. intermedius (0.749 and S. nasutus (0.787 suggested that these are "congeneric" species. Morphological characteristics indicate that these species belong to distinct genera, while isoenzymatic data show that they are very similar at the genetic/biochemical level.

Records of new localities and hosts for crustacean parasites in fish from the eastern Amazon in northern Brazil.

Science.gov (United States)

Oliveira, Marcos Sidney Brito; Corrêa, Lincoln Lima; Oliveira Ferreira, Drielly; Neves, Lígia Rigor; Tavares-Dias, Marcos

2017-06-01

The aim of this study was to investigate parasites crustacean fauna in Arapaima gigas , Cichla monoculus , Cichla ocellaris , Cichla jariina , Satanoperca jurupari , Leporinus friderici , Leporinus fasciatus , Hoplias malabaricus , Phractocephalus hemioliopterus , Serrasalmus altispinis , Pseudoplatystoma tigrinum and Potamotrygon motoro of the State Amapá and Pará, in northern Brazil. A total of 242 parasites, including Argulus elongatus , Argulus multicolor, Argulus juparanaensis , Argulus nattereri , Dolops discoidalis , Dolops longicauda , Braga patagonica , Braga fluviatilis , Livoneca guianensis and undetermined Lernaeidae, were collected from these hosts. The Argulus species had the greatest richness among the community of parasitic crustaceans. There was a low abundance of parasites among the hosts, other than D. discoidalis , was most abundant in the integument of A. gigas and P. tigrinum . Finally, the present study reported nine new hosts for the crustacean parasite species and expanded knowledge of the occurrence of some parasite species in the Jari River basin, in eastern Amazon.

Photosystem II Water Oxidation: Mechanism, Efficiency and Flux in Diverse Oxygenic Phototrophs

Energy Technology Data Exchange (ETDEWEB)

Dismukes, Gerard Charles [Rutgers Univ., Piscataway, NJ (United States); Ananyev, Gennady [Rutgers Univ., Piscataway, NJ (United States); Gates, Colin [Rutgers Univ., Piscataway, NJ (United States)

2018-01-09

In one year, we pursued four aims: 1) extend the VZAD model to allow analysis of PSII chlorophyll fluorescence emission as modulated by interaction with the WOC (partial success); 2) compare the solar energy conversion efficiencies of PSII-WOCs from intact cells, isolated thylakoid membranes and PSII core complexes and crystals from cyanobacterium Thermosynechococcus elongatus (collaboration with Lawrence Berkeley National Laboratory; some success after changing collaborator); 3) determine whether PSIIs can store light energy by pumping protons across the thylakoid membrane (PSII-cyclic electron flow) and how it is regulated within the green alga Chlorella ohadii (collaboration with the Hebrew University of Jerusalem; some success); and 4) genetically replace the native PSII-D1 protein subunit from a higher plant with two cyanobacterial D1 isoforms to test whether their functional advantages in growth and photoprotection can be transferred (collaboration with Rutgers University; success).

Integrity and activity of photosystem 2 complexes isolated from the thermophilic cyanobacterium Synechococcus elongatus using various detergents

Czech Academy of Sciences Publication Activity Database

Šetlíková, Eva; Sofrová, D.; Prášil, Ondřej; Budáč, Petr; Koblížek, Michal; Šetlík, Ivan

1999-01-01

Roč. 37, č. 2 (1999), s. 183-200 ISSN 0300-3604. [Regional Photosynthesis Workshop /2./. Lipno, 31.01.1999-03.02.1999] R&D Projects: GA ČR GA206/96/1266; GA ČR GA206/98/P110; GA MŠk VS96085; GA MŠk ME 138 Grant - others:NATO(EC) LG970388 Subject RIV: ED - Physiology Impact factor: 0.734, year: 1999

Single Molecule Spectroscopy on Photosynthetic Pigment-Protein Complexes

CERN Document Server

Jelezko, F; Schuler, S; Thews, E; Tietz, C; Wechsler, A; Wrachtrup, J

2001-01-01

Single molecule spectroscopy was applied to unravel the energy transfer pathway in photosynthetic pigment-protein complexes. Detailed analysis of excitation and fluorescence emission spectra has been made for peripheral plant antenna LHC II and Photosystem I from cyanobacterium Synechococcus elongatus. Optical transitions of individual pigments were resolved under nonselective excitation of antenna chlorophylls. High-resolution fluorescence spectroscopy of individual plant antenna LHC II indicates that at low temperatures, the excitation energy is localized on the red-most Chl a pool absorbing at 680 nm. More than one pigment molecule is responsible for the fluorescence emission of the LHC II trimer. The spectral lines of single Chl a molecules absorbing at 675 nm are broadened because of the Foerster energy transfer towards the red-most pigments. Low-temperature spectroscopy on single PS I trimers indicates that two subgroups of pigments, which are present in the red antenna pool, differ by the strength of t...

Preparation and HPLC isolation of L-[U-14C]tryptophan from enzyme hydrolysate labelled with 14C

International Nuclear Information System (INIS)

Novak, J.; Tintera, S.; Hromadkova, B.

1990-01-01

Tryptophan was obtained from biomass of the blue-green alga Synechococcus elongatus cultivated under 14 CO 2 . After partial purification, the protein fraction was subjected to enzymatic hydrolysis using pronase. Semipreparative isolation of L-[U- 14 C]tryptophan was accomplished on a HPLC column of Separon S Hema 1000 CM, 2% ethanol were added to the eluent, and a precolumn packed with the basic anion exchanger Spheron 1000 DEAE was used. Always after the passage of L-[U- 14 C]tryptophan, the precolumn was decoupled. The substance was collected in 96% ethanol. After removing the solvent by vacuum evaporation, the sample was analyzed on a column packed with Separon SIX C 18 in the eluent of 0.1M-NaH 2 PO 4 , 2% methanol. When the desired radiochemical purity was not attained, the sample was purified on Separon SIX C 18 using 2% methanol. The final radiochemical purity achieved by using this method is 98%. (P.A.). 5 figs., 2 tabs., 4 refs

Circadian clock protein KaiC forms ATP-dependent hexameric rings and binds DNA.

Science.gov (United States)

Mori, Tetsuya; Saveliev, Sergei V; Xu, Yao; Stafford, Walter F; Cox, Michael M; Inman, Ross B; Johnson, Carl H

2002-12-24

KaiC from Synechococcus elongatus PCC 7942 (KaiC) is an essential circadian clock protein in cyanobacteria. Previous sequence analyses suggested its inclusion in the RecADnaB superfamily. A characteristic of the proteins of this superfamily is that they form homohexameric complexes that bind DNA. We show here that KaiC also forms ring complexes with a central pore that can be visualized by electron microscopy. A combination of analytical ultracentrifugation and chromatographic analyses demonstrates that these complexes are hexameric. The association of KaiC molecules into hexamers depends on the presence of ATP. The KaiC sequence does not include the obvious DNA-binding motifs found in RecA or DnaB. Nevertheless, KaiC binds forked DNA substrates. These data support the inclusion of KaiC into the RecADnaB superfamily and have important implications for enzymatic activity of KaiC in the circadian clock mechanism that regulates global changes in gene expression patterns.

Enhancing the light-driven production of D-lactate by engineering cyanobacterium using a combinational strategy

Science.gov (United States)

Li, Chao; Tao, Fei; Ni, Jun; Wang, Yu; Yao, Feng; Xu, Ping

2015-05-01

It is increasingly attractive to engineer cyanobacteria for bulk production of chemicals from CO2. However, cofactor bias of cyanobacteria is different from bacteria that prefer NADH, which hampers cyanobacterial strain engineering. In this study, the key enzyme D-lactate dehydrogenase (LdhD) from Lactobacillus bulgaricus ATCC11842 was engineered to reverse its favored cofactor from NADH to NADPH. Then, the engineered enzyme was introduced into Synechococcus elongatus PCC7942 to construct an efficient light-driven system that produces D-lactic acid from CO2. Mutation of LdhD drove a fundamental shift in cofactor preference towards NADPH, and increased D-lactate productivity by over 3.6-fold. We further demonstrated that introduction of a lactic acid transporter and bubbling CO2-enriched air also enhanced D-lactate productivity. Using this combinational strategy, increased D-lactate concentration and productivity were achieved. The present strategy may also be used to engineer cyanobacteria for producing other useful chemicals.

Responses of the crab Heterozius rotundifrons to heterospecific chemical alarm cues: phylogeny vs. ecological overlap.

Science.gov (United States)

Hazlett, Brian A; McLay, Colin

2005-03-01

The big-handed brachyuran crab Heterozius rotundifrons extends the time spent in its anti-predator posture, limb extended posture, if exposed to chemical cues from crushed conspecifics. In this study, we tested whether crabs also respond to chemical cues from crushed heterospecific crabs, and if so, whether phylogenetic relations or ecological overlap is more important in influencing the duration of the anti-predator posture. Chemical cues from two other brachyuran crabs (Cyclograpsus lavauxi and Hemigrapsus sexdentatus), which do not overlap directly in ecological distribution with H. rotundifrons, elicited a duration of the anti-predator posture that was indistinguishable from that produced by conspecific chemical cues. In contrast, chemical cues from two anomuran crabs (Petrolisthes elongatus and Pagurus novizealandiae) that overlap in ecological distribution with H. rotundifrons, elicited durations of the antipredator posture that were significantly shorter than those of either conspecifics or more closely related crab species. Thus, phylogenetic relationship seems to be more important than ecological overlap in influencing anti-predator behavior in H. rotundifrons.

Optimization of isopropanol production by engineered cyanobacteria with a synthetic metabolic pathway.

Science.gov (United States)

Hirokawa, Yasutaka; Suzuki, Iwane; Hanai, Taizo

2015-05-01

Cyanobacterium is an attractive host for the production of various chemicals and alternative fuels using solar energy and carbon dioxide. In previous study, we succeeded to produce isopropanol using engineered Synechococcus elongatus PCC 7942 under dark and anaerobic conditions (0.43 mM, 26.5 mg/l). In the present study, we report the further optimization of this isopropanol producing condition. We then optimized growth conditions for production of isopropanol by the engineered cyanobacteria, including the use of cells in early stationary phase and buffering of the production medium to neutral pH. We observed that shifting of cultures from dark and anaerobic to light and aerobic conditions during the production phase dramatically increased isopropanol production by conversion to isopropanol from acetate, byproduct under dark and anaerobic condition. Under the optimized production conditions, the titer of isopropanol was elevated 6-fold, to 2.42 mM (146 mg/l). Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

Different zooplankton structures in the German Bight

Science.gov (United States)

Martens, P.; Brockmann, U.

1993-06-01

In August 1982, a net of 48 stations with altogether 208 samples was investigated in the eastern German Bight with respect to temperature, salinity, as well as the amount and species composition of the mesozooplankton (>80 μm). The data were arranged into different structures by means of a cluster analysis. Four different clusters were found: (a) a “Wadden sea water” with few holoplankton organisms but a higher amount of spionid larvae; (b) a “German Bight water” with a maximum occurrence of turbellaria ( Alaurina composita) and medium concentrations of copepods; (c) a mixing area between these two water masses with highest amounts of Oikopleura dioica, Temora longicornis, Acartia sp., mussel larvae and larvae of the spionid worms; (d) a “North Sea water” mass with highest concentrations of Pseudocalanus elongatus, Paracalanus parvus und Oithona similis. The differences in the concentrations of the species mentioned between the four clusters were significant on the 0.1%-level.

Engineering an Obligate Photoautotrophic Cyanobacterium to Utilize Glycerol for Growth and Chemical Production.

Science.gov (United States)

Kanno, Masahiro; Atsumi, Shota

2017-01-20

Cyanobacteria have attracted much attention as a means to directly recycle carbon dioxide into valuable chemicals that are currently produced from petroleum. However, the titers and productivities achieved are still far below the level required in industry. To make a more industrially applicable production scheme, glycerol, a byproduct of biodiesel production, can be used as an additional carbon source for photomixotrophic chemical production. Glycerol is an ideal candidate due to its availability and low cost. In this study, we found that a heterologous glycerol respiratory pathway enabled Synechococcus elongatus PCC 7942 to utilize extracellular glycerol. The engineered strain produced 761 mg/L of 2,3-butanediol in 48 h with a 290% increase over the control strain under continuous light conditions. Glycerol supplementation also allowed for continuous cell growth and 2,3-butanediol production in diurnal light conditions. These results highlight the potential of glycerol as an additional carbon source for photomixotrophic chemical production in cyanobacteria.

Prolonging hypothermic storage (4 C) of bovine embryos with fish antifreeze protein.

Science.gov (United States)

Ideta, Atsushi; Aoyagi, Yoshito; Tsuchiya, Kanami; Nakamura, Yuuki; Hayama, Kou; Shirasawa, Atsushi; Sakaguchi, Kenichiro; Tominaga, Naomi; Nishimiya, Yoshiyuki; Tsuda, Sakae

2015-01-01

Embryos obtained via superovulation are necessary for mammalian artificial reproduction, and viability is a key determinant of success. Nonfreezing storage at 4 C is possible, but currently used storage solutions can maintain embryo viability for only 24-48 h. Here we found that 10 mg/ml antifreeze protein (AFP) dissolved in culture medium 199 with 20% (v/v) fetal bovine serum and 25 mM HEPES could keep bovine embryos alive for 10 days at 4 C. We used a recombinant AFP isolated from the notched-fin eelpout (Zoarces elongatus Kner). Photomicroscopy indicated that the AFP-embryo interaction was enhanced at 37 C. Embryos pre-warmed with the AFP solution at 37 C for 60 min maintained high viability, whereas those that were not pre-warmed could live no longer than 7 days. Thus, short-term storage of bovine embryos was achieved by a combination of AFP-containing medium and controlled pre-warming.

Fluorescent minerals - A potential source of UV protection and visible light for the growth of green algae and cyanobacteria in extreme cosmic environments

Science.gov (United States)

Omairi, Tareq; Wainwright, Milton

2015-07-01

We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark.

A New Environmentally Safe Formulation and of Low Cost for Prolonged Release System of Atrazine and Diuron

Directory of Open Access Journals (Sweden)

Gracy karla da Rocha Cortes

2017-07-01

Full Text Available Diuron and atrazine were incorporated in new formulations developed with the purpose to improve herbicides action through release systems, as well as to reduce the environmental toxicity. A low cost formulation (ALG/ESC was obtained by combining sodium alginate (ALG with fish scales of the Piau fish (ESC from the Leporinus elongatus species. From the crosslinking of ALG/ESC with CaCl2, the formulation ALG/ESC-CaCl2 was obtained. For ALG/ESC-CaCl2, the results are successful, showing a prolonged release of 3.5 and 4.5 days for atrazine and diuron, respectively. Based on parameters of an empirical equation used to fit the herbicide release data, it appears that the release systems of diuron and atrazine from ALG/ESC-CaCl2 are by diffusion processes due to anomalous transport, which did not follow Fick’s laws of diffusion. DOI: http://dx.doi.org/10.17807/orbital.v9i3.994

Internal radiation dose to the public from polonium-210 due to consumption of seafood from Bombay-harbour bay

International Nuclear Information System (INIS)

Bangera, V.S.; Rudran, Kamala

1995-01-01

Marine organisms such as fishes, molluscs and crustaceans are known to accumulate 210 Po. Distribution of 210 Po in coastal marine organisms mainly fishes and shell fishes is studied. Concentration of 210 Po obtained in muscle of common fishes (edible portion) varied from 2.10 ± 0.11 to 21.90 ± 5.00 Bq kg -1 dry muscle (for fishes like Pampus argenteus (Pomfret), Cynoglossus elongatus (sole), Rastrelliger kanagurta (mackerel), Harpodon nehereus (Bombay duck) etc. Concentration factors for 210 Po in edible portion of fish from sea water works out to 10 3 to 10 4 . Radiation dose to the public has been evaluated on the basis of daily intake of 40 g of fish (15 kg y -1 ). Committed effective dose (CED) to 210 Po due to consumption of sea food is calculated, CED varied from 2.05 x 10 -3 to 4 x 10 -2 mSv y -1 . (author). 7 refs., 3 figs., 3 tabs

Photophysiological and photosynthetic complex changes during iron starvation in Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942.

Directory of Open Access Journals (Sweden)

Jared M Fraser

Full Text Available Iron is an essential component in many protein complexes involved in photosynthesis, but environmental iron availability is often low as oxidized forms of iron are insoluble in water. To adjust to low environmental iron levels, cyanobacteria undergo numerous changes to balance their iron budget and mitigate the physiological effects of iron depletion. We investigated changes in key protein abundances and photophysiological parameters in the model cyanobacteria Synechococcus PCC 7942 and Synechocystis PCC 6803 over a 120 hour time course of iron deprivation. The iron stress induced protein (IsiA accumulated to high levels within 48 h of the onset of iron deprivation, reaching a molar ratio of ~42 IsiA : Photosystem I in Synechococcus PCC 7942 and ~12 IsiA : Photosystem I in Synechocystis PCC 6803. Concomitantly the iron-rich complexes Cytochrome b6f and Photosystem I declined in abundance, leading to a decrease in the Photosystem I : Photosystem II ratio. Chlorophyll fluorescence analyses showed a drop in electron transport per Photosystem II in Synechococcus, but not in Synechocystis after iron depletion. We found no evidence that the accumulated IsiA contributes to light capture by Photosystem II complexes.

Nitrogen Starvation Acclimation in Synechococcus elongatus: Redox-Control and the Role of Nitrate Reduction as an Electron Sink

Directory of Open Access Journals (Sweden)

Alexander Klotz

2015-03-01

Full Text Available Nitrogen starvation acclimation in non-diazotrophic cyanobacteria is characterized by a process termed chlorosis, where the light harvesting pigments are degraded and the cells gradually tune down photosynthetic and metabolic activities. The chlorosis response is governed by a complex and poorly understood regulatory network, which converges at the expression of the nblA gene, the triggering factor for phycobiliprotein degradation. This study established a method that allows uncoupling metabolic and redox-signals involved in nitrogen-starvation acclimation. Inhibition of glutamine synthetase (GS by a precise dosage of l-methionine-sulfoximine (MSX mimics the metabolic situation of nitrogen starvation. Addition of nitrate to such MSX-inhibited cells eliminates the associated redox-stress by enabling electron flow towards nitrate/nitrite reduction and thereby, prevents the induction of nblA expression and the associated chlorosis response. This study demonstrates that nitrogen starvation is perceived not only through metabolic signals, but requires a redox signal indicating over-reduction of PSI-reduced electron acceptors. It further establishes a cryptic role of nitrate/nitrite reductases as electron sinks to balance conditions of over-reduction.

Nitrogen Starvation Acclimation in Synechococcus elongatus: Redox-Control and the Role of Nitrate Reduction as an Electron Sink

Science.gov (United States)

Klotz, Alexander; Reinhold, Edgar; Doello, Sofía; Forchhammer, Karl

2015-01-01

Nitrogen starvation acclimation in non-diazotrophic cyanobacteria is characterized by a process termed chlorosis, where the light harvesting pigments are degraded and the cells gradually tune down photosynthetic and metabolic activities. The chlorosis response is governed by a complex and poorly understood regulatory network, which converges at the expression of the nblA gene, the triggering factor for phycobiliprotein degradation. This study established a method that allows uncoupling metabolic and redox-signals involved in nitrogen-starvation acclimation. Inhibition of glutamine synthetase (GS) by a precise dosage of l-methionine-sulfoximine (MSX) mimics the metabolic situation of nitrogen starvation. Addition of nitrate to such MSX-inhibited cells eliminates the associated redox-stress by enabling electron flow towards nitrate/nitrite reduction and thereby, prevents the induction of nblA expression and the associated chlorosis response. This study demonstrates that nitrogen starvation is perceived not only through metabolic signals, but requires a redox signal indicating over-reduction of PSI-reduced electron acceptors. It further establishes a cryptic role of nitrate/nitrite reductases as electron sinks to balance conditions of over-reduction. PMID:25780959

Fluorescent minerals--A potential source of UV protection and visible light for the growth of green algae and cyanobacteria in extreme cosmic environments.

Science.gov (United States)

Omairi, Tareq; Wainwright, Milton

2015-07-01

We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark. Copyright © 2015 The Committee on Space Research (COSPAR). Published by Elsevier Ltd. All rights reserved.

Analysis of Selected Environmental Indicators in the Cultivation System of Energy Crops

Directory of Open Access Journals (Sweden)

Šoltysová Božena Š

2017-11-01

Full Text Available The changes of selected chemical parameters were observed in Gleyic Fluvisols. The field experiment was established as a twofactor experiment with four energy crops (Arundo donax L., Miscanthus × giganteus, Elymus elongatus Gaertner, Sida hermafrodita and two variants of fertilization (nitrogen fertilization in rate 60 kg ha-1, without nitrogen fertilization. Soil samples were taken from the depth of 0 to 0.3 m at the beginning of the experiment in the autumn 2012 and at the end of reference period in the autumn 2015. Land management conversion from market crops to perennial energy crops cultivation has influenced changes of selected soil chemical parameters. The contents of soil organic carbon were affected by cultivated energy crops differently. It was found out that Arundo increased the organic carbon content and Miscanthus, Elymus and Sida decreased its content. At the same time, the same impact of the crops on content of available phosphorus and potassium and soil reaction was found. It was recorded that each cultivated crop decreased the soil reaction and available phosphorus content and increased the content of available potassium.

Structural insights into the light-driven auto-assembly process of the water-oxidizing Mn4CaO5-cluster in photosystem II.

Science.gov (United States)

Zhang, Miao; Bommer, Martin; Chatterjee, Ruchira; Hussein, Rana; Yano, Junko; Dau, Holger; Kern, Jan; Dobbek, Holger; Zouni, Athina

2017-07-18

In plants, algae and cyanobacteria, Photosystem II (PSII) catalyzes the light-driven splitting of water at a protein-bound Mn 4 CaO 5 -cluster, the water-oxidizing complex (WOC). In the photosynthetic organisms, the light-driven formation of the WOC from dissolved metal ions is a key process because it is essential in both initial activation and continuous repair of PSII. Structural information is required for understanding of this chaperone-free metal-cluster assembly. For the first time, we obtained a structure of PSII from Thermosynechococcus elongatus without the Mn 4 CaO 5 -cluster. Surprisingly, cluster-removal leaves the positions of all coordinating amino acid residues and most nearby water molecules largely unaffected, resulting in a pre-organized ligand shell for kinetically competent and error-free photo-assembly of the Mn 4 CaO 5 -cluster. First experiments initiating (i) partial disassembly and (ii) partial re-assembly after complete depletion of the Mn 4 CaO 5 -cluster agree with a specific bi-manganese cluster, likely a di-µ-oxo bridged pair of Mn(III) ions, as an assembly intermediate.

Nematodes (Mermithidae parasitizing grasshoppers (Orthoptera: Acrididae in the Pampean region, Argentina

Directory of Open Access Journals (Sweden)

J. M. Rusconi

Full Text Available Abstract This work provides the results of a survey of entomonematodes parasites of grasshoppers in grasslands of the Pampean Region, Argentina. Nymphs of Staurorhectus longicornis Giglio-Tos, Laplatacris dispar Rhen, 1939, Dichroplus elongatus Giglio-Tos, 1894 and Metaleptea brevicornis (L. (Orthoptera: Acrididae were collected. Mermithidae was the only family registered with seven species: Agamermis decaudata Cobb, Steiner and Christie, 1923, Amphimermis bonaerensis Miralles and Camino, 1983, Amphimermis dichroplusi Camino and Lange, 1997, Amphimermis ronderosi Camino and Lange, 1997, Hexamermis coclhearius Stock and Camino, 1992, Hexamermis ovistriata Stock and Camino, 1992, and Longimermis acridophila Camino and Stock, 1989. The values of parasitism ranged between 1-12%, and intensity not overcome the number of 5.0 nematodes per larva. The nematodes observed showed specificity, not registering the same species of parasite in more than one host species. The Pampean region constituted an area with high diversity of mermithids where new species could be consider as bioregulator agents of this troublesome insect pests in agricultural areas of Argentina.

Defining an additivity framework for mixture research in inducible whole-cell biosensors

DEFF Research Database (Denmark)

Martin-Betancor, K; Ritz, Christian; Fernández-Piñas, F

2015-01-01

A novel additivity framework for mixture effect modelling in the context of whole cell inducible biosensors has been mathematically developed and implemented in R. The proposed method is a multivariate extension of the effective dose (EDp) concept. Specifically, the extension accounts for differe......A novel additivity framework for mixture effect modelling in the context of whole cell inducible biosensors has been mathematically developed and implemented in R. The proposed method is a multivariate extension of the effective dose (EDp) concept. Specifically, the extension accounts...... for differential maximal effects among analytes and response inhibition beyond the maximum permissive concentrations. This allows a multivariate extension of Loewe additivity, enabling direct application in a biphasic dose-response framework. The proposed additivity definition was validated, and its applicability...... illustrated by studying the response of the cyanobacterial biosensor Synechococcus elongatus PCC 7942 pBG2120 to binary mixtures of Zn, Cu, Cd, Ag, Co and Hg. The novel method allowed by the first time to model complete dose-response profiles of an inducible whole cell biosensor to mixtures. In addition...

Larval fish distribution and their relationship with environmental factors in the southern Tyrrhenian Sea (central Mediterranean during two years of sampling

Directory of Open Access Journals (Sweden)

Adriana Profeta

2014-06-01

The results of this study could have implications for the management of marine resources, because the investigated area has already been identified as a nursery area for many pelagic and coastal fishes and a natural habitat for many species of high commercial interest. Fig. 1. Results of CCA analysis for larval fish species and sampled stations during June 2006. Two first axes (CCA1 and CCA2 are represented. Species abbreviations in alphabetical order: An_a (Anthias anthias, Ap_i (Apogon imberbis, Ar_k (Arnoglossus kessleri, Ar_h (Argyropelecus hemigymnus, Ar_l (Arnoglossus laterna, Ar_r (Arnoglossus rueppelii, Ar_t (Arnoglossus thori, Be_g (Benthosema glaciale, Bl_o (Blennius ocellaris, Bo_b (Boops boops, Bo_p (Bothus podas, Ca_a (Capros aper, Ca_p (Callyonimus maculatus, Ce_m (Ceratoscopelus maderensis, Ce_m1(Cepola macrophtalma, Ci_l (Citharus linguatula, Co_j (Coris julis, Co_n (Ophidion barbatum, Cy_b (Cyclothone braueri, Cy_p (Cyclothone pygmaea, En_e (Engraulis encrasicolus, Di_a (Diplodus annularis, Di_h (Diaphus holti, Di_r (Diaphus rafinesquei, El_r (Electrona rissoi, Go_n (Gobius niger, He_d (Helicolenus dactylopterus, Hy_b (Hygophum benoiti, Hy_h (Hygophum hygomii, La_c (Lampanyctus crocodilus, La_p (Lampanyctus pusillus, Le_c (Lepidotrigla cavillone, Le_j (Lestidiops jayakari, Lo_d (Lobianchia dofleini, Ma_m (Maurolicus muelleri, Ma_s (Macrorhamphosus scolopax, Me_m (Merluccius merluccius, Mi_p (Micromesistius poutassou, My_p (Myctophum punctatum, Mu_s (Mullus surmuletus, Ne_s (Nemichthys scolopaceus, No_b (Notoscopelus bolini, No_e (Notoscopelus elongatus, No_r (Arctozenus risso, Ob_m (Oblada melanura, Pa_s (Paralepis speciosa. Sc_p (Scorpaena porcus, Sc_s (Scorpaena scrofa, Se_c (Serranus cabrilla, Se_h (Serranushepatus, Sp_f (Spicara maena, Sp_s (Spicara smaris, Sy sp. (Symphurus nigrescens, Sy_v, (Symphurus ligulatus, St_b (Stomias boa boa, Tr_d (Trachinus draco, Tr_me (Trachurus mediterraneus, Tr_t (Trachurus trachurus, Ur_s (Uranoscopus scaber

Seasonal dynamic of the occurrence of the gregarines infection of Harpalus rufipes (Coleoptera, Carabidae in agroecosystem

Directory of Open Access Journals (Sweden)

D. Y. Reshetnyak

2015-08-01

Full Text Available Relationships in the “parasite-host” system are closely interrelated and occur at all levels from the molecular to behavioral and population ones. There are two models of realization of these relations. The first case is when the parasites are uniformly distributed in the host population. High extensiveness of invasion is accompanied by its low intensity. The second case is when a part of host population is infected with parasites, but the negative impact is manifested to the maximum extent. Invasion of the ground beetle Harpalus rufipes (De Geer, 1774, dwelling in sweet corn agroecosystems located in the vicinity of Dnipropetrovsk near Doslidnoe village, by several gregarines species is investigated in this study. H. rufipes is an abundant, ubiquitous species, living in extremely wide range of terrestrial ecosystems, with especially high populations inhabiting anthropogenically transformed environments. H. rufipes has a wide range of feeding. This species is distributed in the Central and Eastern Europe, and introduced to North America. Gregarines were found in the intestines of 20 individuals of H. rufipes from 190 (10.5%: Gregarina ovata Dufour, 1828, G. steini Berndt, 1902, G. amarae (Hammerschmidt, 1839 Frantzius, 1848, Clitellocephalus ophoni (Tuzet and Ormieres, 1956 Clopton, 2002, Torogregarina sphinx Clopton, 1998, Gigaductus macrospora Filipponi, 1948 and G. elongatus (Moriggi, 1943 Filipponi, 1948. There is high level of infestation of C. ophoni and G. steini. At the same time, not more than three species of the gregarines were localized in the beetle body. Seasonal dynamic of occurrence of the gregarines is as follows. Maximal indices of occurrence are found at the end of August (22.2% and minimal ones at the end of June (4.8%. The highest total number of gregarines (383 ind. is recorded at the end of August, the lowest one is fixed at the beginning of September (33 ind.. Indices of gregarine species dominance are as follows

Estudio Palinológico de los 35 mts. Superiores de la Sección Tarragona, Sabana de Bogotá Estudio Palinológico de los 35 mts. Superiores de la Sección Tarragona, Sabana de Bogotá

Directory of Open Access Journals (Sweden)

Dueñas J. Hernando

1979-12-01

Full Text Available En el presente trabajo se da a conocer el resulrado del estudio palinológico de los 35 metros superiores de la sección Tarragona, localizada en la Sabana de Bogotá, a 2.560 metros sobre el nivel del mar. Se describen 2 géneros (Spirotremesporites, Striadyadosporites y 5 especies(Spirotremesporites simplex, Spirotremesporites multiplex, Spirotremesporites ecuatorialis, Striadyadosporites elongatus y Striadyadosporites constrictus de fungi fósil, 14 tipos de polen, 8 tipos de esporas triletes, 4 tipos de Pediastrum y un tipo especial de Chlorococcales. Con base en la relación de polen de elementos de páramo a polen de elementos de bosque (Pp/Pb y a la estrarigrafía, se dividió el diagrama depolen en 8 zonas climáticas (vegetación, con las cuales fue posible correlacionar la sección Tarragona con otras secciones levantadas en la Sabana de Bogotá y regiones aledañas. Utilizando esta correlación y las fechas de edad absoluta que se han obtenido en las diferentes secciones del área, fue posible efectuar una correlacion tentativa con las unidades cronoestratigráficas europeas.  Los 35 metros superiores de la sección Tarragona representan la historia geológica de por lo menos los últimos 500.000 años de la Sabana de Bogotá.In this study it is given the result of the palynological study of the uppermost 35 meters of the Tarragona section, located in the Sabana de Bogotá at an altitude of 2.560 meters above sea level.  It is described: 2 genus (Spirotremesporites, Striadyadosporites and 5 species (Spirotremesporites simplex, Spirotremesporites multiplex, Spirotremesporites ecuatorialis, Striadyadosporites elongatus and Striadyadosporites constrictus of fossil fungi, 14 types of pollen, 8 types of trilete spores, 4 types of Pediastrum and one special type of Chlorococcales.  On the basis of the relation, Pollen of paramo elements to Pollen of forest elements (Pp/Pb and the stratigraphy it was possible to divide the pollen diagram

Revisão da subfamília Atactorhynchinae Petrotschenko, 1956 (Acanthocephala - Neoechinorhynchidae A review of Atactorhynchinae Petrotschenko, 1956 (Acanthocephala, Neoechinorhynchidae

Directory of Open Access Journals (Sweden)

Dely Noronha

1973-01-01

Full Text Available No presente trabalho é feita a revisão da subfamília Atactorhynchinae Petrostschenko, 1956. Para o gênero Floridosentis Ward, 1953, o estudo é baseado em exemplares do material tipo, além de outros encontrados parasitnando três peixes do gênero Mugil (Parati, provenientes de Cabo Frio, Rio de Janeiro. Quanto ao gênero Atactorhynchus Chandler, 1935, o nosso estudo foi baseado na descrição original de Chandler e do trabalho de Golvan sobre a classe dos Eoacanthocephala (Van Cleave, 1936.In this paper, the authors revise the sub-family Atactorhynchinae Petrotschenko, 1956, after studying types of Floridosentis mugilis (Machado Filho, 1951 and material recovered from intestine of Mugil sp. from Cabo Frio, Estado do Rio de Janeiro, Brasil. They confirm what was suggested by Bullock, 1962, about a new combination for the type species of Floridosentis Ward, 1953. For this reason, they make F. elongatus, synonym of F. mugilis Machado Filho, 1951. Besides they also enlarge the subfamily diagnosis and add a table showing the maind differences between the two genera under Atactorhynchinae Petrotschenko, 1956.

Silica ecosystem for synergistic biotransformation

Science.gov (United States)

Mutlu, Baris R.; Sakkos, Jonathan K.; Yeom, Sujin; Wackett, Lawrence P.; Aksan, Alptekin

2016-06-01

Synergistical bacterial species can perform more varied and complex transformations of chemical substances than either species alone, but this is rarely used commercially because of technical difficulties in maintaining mixed cultures. Typical problems with mixed cultures on scale are unrestrained growth of one bacterium, which leads to suboptimal population ratios, and lack of control over bacterial spatial distribution, which leads to inefficient substrate transport. To address these issues, we designed and produced a synthetic ecosystem by co-encapsulation in a silica gel matrix, which enabled precise control of the microbial populations and their microenvironment. As a case study, two greatly different microorganisms: Pseudomonas sp. NCIB 9816 and Synechococcus elongatus PCC 7942 were encapsulated. NCIB 9816 can aerobically biotransform over 100 aromatic hydrocarbons, a feat useful for synthesis of higher value commodity chemicals or environmental remediation. In our system, NCIB 9816 was used for biotransformation of naphthalene (a model substrate) into CO2 and the cyanobacterium PCC 7942 was used to provide the necessary oxygen for the biotransformation reactions via photosynthesis. A mathematical model was constructed to determine the critical cell density parameter to maximize oxygen production, and was then used to maximize the biotransformation rate of the system.

Enhanced limonene production in cyanobacteria reveals photosynthesis limitations.

Science.gov (United States)

Wang, Xin; Liu, Wei; Xin, Changpeng; Zheng, Yi; Cheng, Yanbing; Sun, Su; Li, Runze; Zhu, Xin-Guang; Dai, Susie Y; Rentzepis, Peter M; Yuan, Joshua S

2016-12-13

Terpenes are the major secondary metabolites produced by plants, and have diverse industrial applications as pharmaceuticals, fragrance, solvents, and biofuels. Cyanobacteria are equipped with efficient carbon fixation mechanism, and are ideal cell factories to produce various fuel and chemical products. Past efforts to produce terpenes in photosynthetic organisms have gained only limited success. Here we engineered the cyanobacterium Synechococcus elongatus PCC 7942 to efficiently produce limonene through modeling guided study. Computational modeling of limonene flux in response to photosynthetic output has revealed the downstream terpene synthase as a key metabolic flux-controlling node in the MEP (2-C-methyl-d-erythritol 4-phosphate) pathway-derived terpene biosynthesis. By enhancing the downstream limonene carbon sink, we achieved over 100-fold increase in limonene productivity, in contrast to the marginal increase achieved through stepwise metabolic engineering. The establishment of a strong limonene flux revealed potential synergy between photosynthate output and terpene biosynthesis, leading to enhanced carbon flux into the MEP pathway. Moreover, we show that enhanced limonene flux would lead to NADPH accumulation, and slow down photosynthesis electron flow. Fine-tuning ATP/NADPH toward terpene biosynthesis could be a key parameter to adapt photosynthesis to support biofuel/bioproduct production in cyanobacteria.

Genetic variability of broodstocks of restocking programs in Brazil

Directory of Open Access Journals (Sweden)

Nelson Lopera-Barrero

2015-09-01

Full Text Available Objective. The aim of this study was evaluate the genetic diversity of the following broodstocks: piapara (Leporinus elongatus, dourado (Salminus brasiliensis, jundiá (Rhamdia quelen and cachara (Pseudoplatystoma fasciatum already useful for restocking programs in the Paranapanema, Iguaçu and Paraná Brazilian Rivers. Materials and methods. Samples from the caudal fin of 122 fish were analyzed. DNA was extracted by NaCl protocol. PCR products were separated by a horizontal agarose gel electrophoresis. The fragments were visualized by staining with ethidium bromide. Results. The amplification of 25 primers generated different fragments in studied species that allowed characterizing 440 fragments of 100-2900 bp. High percentage of polymorphic fragments (66.67 to 86.29, Shannon index (0.365 to 0.486 and genetic diversity of Nei (0.248 to 0.331 were detected. Conclusions. The level of genetic variability in the broodstocks was adequate for allowing their use in restocking programs in the studied Rivers. However, periodical monitoring studies of genetic variability in these stocks, the mating system, reproductive system and general management must be made to guarantee the preservation of wild populations.

Delineating Substrate Diversity of Disparate Short-Chain Dehydrogenase Reductase from Debaryomyces hansenii.

Directory of Open Access Journals (Sweden)

Arindam Ghatak

Full Text Available Short-chain dehydrogenase reductases (SDRs have been utilized for catalyzing the reduction of many aromatic/aliphatic prochiral ketones to their respective alcohols. However, there is a paucity of data that elucidates their innate biological role and diverse substrate space. In this study, we executed an in-depth biochemical characterization and substrate space mapping (with 278 prochiral ketones of an unannotated SDR (DHK from Debaryomyces hansenii and compared it with structurally and functionally characterized SDR Synechococcus elongatus. PCC 7942 FabG to delineate its industrial significance. It was observed that DHK was significantly more efficient than FabG, reducing a diverse set of ketones albeit at higher conversion rates. Comparison of the FabG structure with a homology model of DHK and a docking of substrate to both structures revealed the presence of additional flexible loops near the substrate binding site of DHK. The comparative elasticity of the cofactor and substrate binding site of FabG and DHK was experimentally substantiated using differential scanning fluorimetry. It is postulated that the loop flexibility may account for the superior catalytic efficiency of DHK although the positioning of the catalytic triad is conserved.

Mussel shell evaluation as bioindicator for heavy metals

Energy Technology Data Exchange (ETDEWEB)

Andrello, Avacir Casanova; Lopes, Fabio; Galvao, Tiago D. [Universidade Estadual de Londrina (UEL), PR (Brazil). Dept. de Fisica. Lab. de Fisica Nuclear Aplicada

2009-07-01

Full text: Recently, in Brazil, it has been appearing a new and unusual 'plague' in leisure and commercial fishing, caused by the parasitic larval phase of certain native bivalve mollusks of fresh water known as 'Naiades'. Such situation involves the presence of big bivalve of fresh water, mainly Anodontites trapesialis, in the tanks and dams of the fish creation, such bivalve mollusks belonging to the Ordem Unionoida and the Familia Mycetopodidae. The present work objectified to analyze the shells of such mollusks to verify the possibility of such mollusks as bioindicators of heavy metals in fresh water. The mollusks shells were collected in a commercial fishing at Londrina-PR, and analyzed qualitatively to determine the chemical composition and possible correlation with existent heavy metals in the aquatic environment. Studies of the literature have been showing that those mollusks are susceptible the existent chemical alterations in the aquatic environment due to anthropogenic action. Three different shells were analyzed, with the measures done on the external and internal side, using a portable Energy Dispersive X-Ray Fluorescence system (PXRF-LFNA-02). The measures were realized in the applied nuclear physics laboratory of State University of Londrina, and the PXRF-LFNA-02 is composed by a X-Ray tube (with Ag target and filter) with potency of 4W, and a detector Si-PIN model XR-100CR of Ampetc Inc. with resolution of 221eV for the line of 5.9 keV of the {sup 55}Fe (with a 25{mu}m Be window thickness and Ag collimator), Current 10 mA and High Voltage 28 kV. In the internal part of shells were identified the elements Ca, P, Fe, Mn and Sr and in the external part were identified Ca, P, Fe, Mn, Sr and Cu. The Ca ratio among the external and internal sides of the analyzed shells is around of 1, and it was expected because Ca is the main composed of mollusks shells. The ratio of P, Fe, Mn, and Sr for Ca stayed constant in all analyzed shells

A morphological study on the African genus Micralestes (Characidae

Directory of Open Access Journals (Sweden)

Pier Giorgio Bianco

2015-12-01

Full Text Available The study is based on the compared morphology of most of Micralestes nominal taxa, described from whole Africa, with particular attention to the dentition, meristics counts and, in several cases, the color pattern. Type materials and more than 1.500 additional specimens were analyzed. The genus is spread in sub-sahariana areas, and the Nile. Is absent in estern Africa and the southernmost area of South Africa. About 11 species were recognized. The most spread species are: M. humilis which is found from western Africa to the head water of River Sobat (White Nile basin, and the Congo basin, and M. elongatus which range from western Africa to the Nile Basin, but absent in central and southern Africa All others species have restricted ranges: M. occidentalis in basins of western Africa; M. woosmani, M. holargyreus, M. congicus, M. neglectus. M.ambiguous and M. schelly, are all endemic of Congo Basin. M. acutidens was found only in rivers of southern Africa and I did not found any specimens in the Congo basin which can be identified as this species. In Lake Rudolf exist a populations previously identified as M. acutidens which cannot be assigned to any known species and it should be considered as a new one.

Genetic support for the morphological identification of larvae of Myctophidae, Gonostomatidae, Sternoptychidae and Phosichthyidae (Pisces from the western Mediterranean

Directory of Open Access Journals (Sweden)

Ainhoa Bernal

2014-12-01

Full Text Available Mesopelagic fishes experience an extreme body transformation from larvae to adults. The identification of the larval stages of fishes from the two orders Myctophiformes and Stomiiformes is currently based on the comparison of morphological, pigmentary and meristic characteristics of different developmental stages. However, no molecular evidence to confirm the identity of the larvae of these mesopelagic species is available so far. Since DNA barcoding emerged as an accurate procedure for species discrimination and larval identification, we have used the cytochrome c oxidase 1 or the mitochondrial 12S ribosomal DNA regions to identify larvae and adults of the most frequent and abundant species of myctophiforms (family Myctophidae and stomiiforms (families Gonostomatidae, Sternoptychidae and Phosichthyidae from the Mediterranean Sea. The comparisons of sequences from larval and adult stages corroborated the value of the morphological characters that were used for taxonomic classification. The combination of the sequences obtained in this study and those of related species from GenBank was used to discuss the consistency of monophyletic clades for different genera. Pairwise nucleotide distances were notably higher inter- than intraspecifically, and were useful to discern between congeners such as Cyclothone braueri and C. pygmaea, Hygophum benoiti and H. hygomii, Lampanyctus crocodilus and L. pusillus, and Notoscopelus bolini and N. elongatus.

Prevalence and Sequence-Based Identity of Rumen Fluke in Cattle and Deer in New Caledonia.

Directory of Open Access Journals (Sweden)

Laura Cauquil

Full Text Available An abattoir survey was performed in the French Melanesian archipelago of New Caledonia to determine the prevalence of paramphistomes in cattle and deer and to generate material for molecular typing at species and subspecies level. Prevalence in adult cattle was high at animal level (70% of 387 adult cattle and batch level (81%. Prevalence was lower in calves at both levels (33% of 484 calves, 51% at batch level. Animals from 2 of 7 deer farms were positive for rumen fluke, with animal-level prevalence of 41.4% (29/70 and 47.1% (33/70, respectively. Using ITS-2 sequencing, 3 species of paramphistomes were identified, i.e. Calicophoron calicophorum, Fischoederius elongatus and Orthocoelium streptocoelium. All three species were detected in cattle as well as deer, suggesting the possibility of rumen fluke transmission between the two host species. Based on heterogeneity in ITS-2 sequences, the C. calicophorum population comprises two clades, both of which occur in cattle as well as deer. The results suggest two distinct routes of rumen fluke introduction into this area. This approach has wider applicability for investigations of the origin of rumen fluke infections and for the possibility of parasite transmission at the livestock-wildlife interface.

Physiological tolerance and stoichiometric potential of cyanobacteria for hydrocarbon fuel production.

Science.gov (United States)

Kämäräinen, Jari; Knoop, Henning; Stanford, Natalie J; Guerrero, Fernando; Akhtar, M Kalim; Aro, Eva-Mari; Steuer, Ralf; Jones, Patrik R

2012-11-30

Cyanobacteria are capable of directly converting sunlight, carbon dioxide and water into hydrocarbon fuel or precursors thereof. Many biological and non-biological factors will influence the ability of such a production system to become economically sustainable. We evaluated two factors in engineerable cyanobacteria which could potentially limit economic sustainability: (i) tolerance of the host to the intended end-product, and (ii) stoichiometric potential for production. Alcohols, when externally added, inhibited growth the most, followed by aldehydes and acids, whilst alkanes were the least inhibitory. The growth inhibition became progressively greater with increasing chain-length for alcohols, whilst the intermediate C6 alkane caused more inhibition than both C3 and C11 alkane. Synechocystis sp. PCC 6803 was more tolerant to some of the tested chemicals than Synechococcus elongatus PCC 7942, particularly ethanol and undecane. Stoichiometric evaluation of the potential yields suggested that there is no difference in the potential productivity of harvestable energy between any of the studied fuels, with the exception of ethylene, for which maximal stoichiometric yield is considerably lower. In summary, it was concluded that alkanes would constitute the best choice metabolic end-product for fuel production using cyanobacteria if high-yielding strains can be developed. Copyright © 2012 Elsevier B.V. All rights reserved.

A barrier to upstream migration in the fish passage of Itaipu Dam (Canal da Piracema), Paraná River basin

Science.gov (United States)

,; Fontes Júnior, Hélio Martins; Makrakis, Sergio; Gomes, Luiz Carlos; Latini, João Dirço

2012-01-01

The majority of the fish passages built in the Neotropical region are characterised by low efficiency and high selectivity; in many cases, the benefits to fish populations are uncertain. Studies conducted in the Canal da Piracema at Itaipu dam on the Parana River indicate that the system component designated as the Discharge channel in the Bela Vista River (herein named Canal de deságue no rio Bela Vista or CABV), a 200 m long technical section, was the main barrier to the upstream migration. The aim of this study was to evaluate the degree of restriction imposed by the CABV on upstream movements of Prochilodus lineatus and Leporinus elongatus, Characiformes. Fish were tagged with passive integrated transponders (PIT tags) and released both downstream and upstream of this critical section. Individuals of both species released downstream of the CABV took much more time to reach the upper end of the system (43.6 days vs. 15.9 days), and passed in much lower proportions (18% vs. 60.8%) than those tagged upstream of this component. Although more work is needed to differentiate between fishway effects and natural variation in migratory motivation, the results clearly demonstrate passage problems at the CABV.

An evolutionary fitness enhancement conferred by the circadian system in cyanobacteria

International Nuclear Information System (INIS)

Ma, Peijun; Woelfle, Mark A.; Johnson, Carl Hirschie

2013-01-01

Circadian clocks are found in a wide variety of organisms from cyanobacteria to mammals. Many believe that the circadian clock system evolved as an adaption to the daily cycles in light and temperature driven by the rotation of the earth. Studies on the cyanobacterium, Synechococcus elongatus PCC 7942, have confirmed that the circadian clock in resonance with environmental cycles confers an adaptive advantage to cyanobacterial strains with different clock properties when grown in competition under light–dark cycles. The results thus far suggest that in a cyclic environment, the cyanobacterial strains whose free running periods are closest to the environmental period are the most fit and the strains lacking a functional circadian clock are at a competitive disadvantage relative to strains with a functional clock. In contrast, the circadian system provides little or no advantage to cyanobacteria grown in competition in constant light. To explain the potential mechanism of this clock-mediated enhancement in fitness in cyanobacteria, several models have been proposed; these include the limiting resource model, the diffusible inhibitor model and the cell-to-cell communication model. None of these models have been excluded by the currently available experimental data and the mechanistic basis of clock-mediated fitness enhancement remains elusive

An Approach for Predicting Essential Genes Using Multiple Homology Mapping and Machine Learning Algorithms.

Science.gov (United States)

Hua, Hong-Li; Zhang, Fa-Zhan; Labena, Abraham Alemayehu; Dong, Chuan; Jin, Yan-Ting; Guo, Feng-Biao

Investigation of essential genes is significant to comprehend the minimal gene sets of cell and discover potential drug targets. In this study, a novel approach based on multiple homology mapping and machine learning method was introduced to predict essential genes. We focused on 25 bacteria which have characterized essential genes. The predictions yielded the highest area under receiver operating characteristic (ROC) curve (AUC) of 0.9716 through tenfold cross-validation test. Proper features were utilized to construct models to make predictions in distantly related bacteria. The accuracy of predictions was evaluated via the consistency of predictions and known essential genes of target species. The highest AUC of 0.9552 and average AUC of 0.8314 were achieved when making predictions across organisms. An independent dataset from Synechococcus elongatus , which was released recently, was obtained for further assessment of the performance of our model. The AUC score of predictions is 0.7855, which is higher than other methods. This research presents that features obtained by homology mapping uniquely can achieve quite great or even better results than those integrated features. Meanwhile, the work indicates that machine learning-based method can assign more efficient weight coefficients than using empirical formula based on biological knowledge.

Circadian Rhythms in Cyanobacteria

Science.gov (United States)

Golden, Susan S.

2015-01-01

SUMMARY Life on earth is subject to daily and predictable fluctuations in light intensity, temperature, and humidity created by rotation of the earth. Circadian rhythms, generated by a circadian clock, control temporal programs of cellular physiology to facilitate adaptation to daily environmental changes. Circadian rhythms are nearly ubiquitous and are found in both prokaryotic and eukaryotic organisms. Here we introduce the molecular mechanism of the circadian clock in the model cyanobacterium Synechococcus elongatus PCC 7942. We review the current understanding of the cyanobacterial clock, emphasizing recent work that has generated a more comprehensive understanding of how the circadian oscillator becomes synchronized with the external environment and how information from the oscillator is transmitted to generate rhythms of biological activity. These results have changed how we think about the clock, shifting away from a linear model to one in which the clock is viewed as an interactive network of multifunctional components that are integrated into the context of the cell in order to pace and reset the oscillator. We conclude with a discussion of how this basic timekeeping mechanism differs in other cyanobacterial species and how information gleaned from work in cyanobacteria can be translated to understanding rhythmic phenomena in other prokaryotic systems. PMID:26335718

Diversification of DnaA dependency for DNA replication in cyanobacterial evolution.

Science.gov (United States)

Ohbayashi, Ryudo; Watanabe, Satoru; Ehira, Shigeki; Kanesaki, Yu; Chibazakura, Taku; Yoshikawa, Hirofumi

2016-05-01

Regulating DNA replication is essential for all living cells. The DNA replication initiation factor DnaA is highly conserved in prokaryotes and is required for accurate initiation of chromosomal replication at oriC. DnaA-independent free-living bacteria have not been identified. The dnaA gene is absent in plastids and some symbiotic bacteria, although it is not known when or how DnaA-independent mechanisms were acquired. Here, we show that the degree of dependency of DNA replication on DnaA varies among cyanobacterial species. Deletion of the dnaA gene in Synechococcus elongatus PCC 7942 shifted DNA replication from oriC to a different site as a result of the integration of an episomal plasmid. Moreover, viability during the stationary phase was higher in dnaA disruptants than in wild-type cells. Deletion of dnaA did not affect DNA replication or cell growth in Synechocystis sp. PCC 6803 or Anabaena sp. PCC 7120, indicating that functional dependency on DnaA was already lost in some nonsymbiotic cyanobacterial lineages during diversification. Therefore, we proposed that cyanobacteria acquired DnaA-independent replication mechanisms before symbiosis and such an ancestral cyanobacterium was the sole primary endosymbiont to form a plastid precursor.

Discrete gene replication events drive coupling between the cell cycle and circadian clocks.

Science.gov (United States)

Paijmans, Joris; Bosman, Mark; Ten Wolde, Pieter Rein; Lubensky, David K

2016-04-12

Many organisms possess both a cell cycle to control DNA replication and a circadian clock to anticipate changes between day and night. In some cases, these two rhythmic systems are known to be coupled by specific, cross-regulatory interactions. Here, we use mathematical modeling to show that, additionally, the cell cycle generically influences circadian clocks in a nonspecific fashion: The regular, discrete jumps in gene-copy number arising from DNA replication during the cell cycle cause a periodic driving of the circadian clock, which can dramatically alter its behavior and impair its function. A clock built on negative transcriptional feedback either phase-locks to the cell cycle, so that the clock period tracks the cell division time, or exhibits erratic behavior. We argue that the cyanobacterium Synechococcus elongatus has evolved two features that protect its clock from such disturbances, both of which are needed to fully insulate it from the cell cycle and give it its observed robustness: a phosphorylation-based protein modification oscillator, together with its accompanying push-pull read-out circuit that responds primarily to the ratios of different phosphoform concentrations, makes the clock less susceptible to perturbations in protein synthesis; the presence of multiple, asynchronously replicating copies of the same chromosome diminishes the effect of replicating any single copy of a gene.

Homology modeling of Homo sapiens lipoic acid synthase: Substrate docking and insights on its binding mode.

Science.gov (United States)

Krishnamoorthy, Ezhilarasi; Hassan, Sameer; Hanna, Luke Elizabeth; Padmalayam, Indira; Rajaram, Rama; Viswanathan, Vijay

2017-05-07

Lipoic acid synthase (LIAS) is an iron-sulfur cluster mitochondrial enzyme which catalyzes the final step in the de novo pathway for the biosynthesis of lipoic acid, a potent antioxidant. Recently there has been significant interest in its role in metabolic diseases and its deficiency in LIAS expression has been linked to conditions such as diabetes, atherosclerosis and neonatal-onset epilepsy, suggesting a strong inverse correlation between LIAS reduction and disease status. In this study we use a bioinformatics approach to predict its structure, which would be helpful to understanding its role. A homology model for LIAS protein was generated using X-ray crystallographic structure of Thermosynechococcus elongatus BP-1 (PDB ID: 4U0P). The predicted structure has 93% of the residues in the most favour region of Ramachandran plot. The active site of LIAS protein was mapped and docked with S-Adenosyl Methionine (SAM) using GOLD software. The LIAS-SAM complex was further refined using molecular dynamics simulation within the subsite 1 and subsite 3 of the active site. To the best of our knowledge, this is the first study to report a reliable homology model of LIAS protein. This study will facilitate a better understanding mode of action of the enzyme-substrate complex for future studies in designing drugs that can target LIAS protein. Copyright © 2017 Elsevier Ltd. All rights reserved.

An allele of the crm gene blocks cyanobacterial circadian rhythms.

Science.gov (United States)

Boyd, Joseph S; Bordowitz, Juliana R; Bree, Anna C; Golden, Susan S

2013-08-20

The SasA-RpaA two-component system constitutes a key output pathway of the cyanobacterial Kai circadian oscillator. To date, rhythm of phycobilisome associated (rpaA) is the only gene other than kaiA, kaiB, and kaiC, which encode the oscillator itself, whose mutation causes completely arrhythmic gene expression. Here we report a unique transposon insertion allele in a small ORF located immediately upstream of rpaA in Synechococcus elongatus PCC 7942 termed crm (for circadian rhythmicity modulator), which results in arrhythmic promoter activity but does not affect steady-state levels of RpaA. The crm ORF complements the defect when expressed in trans, but only if it can be translated, suggesting that crm encodes a small protein. The crm1 insertion allele phenotypes are distinct from those of an rpaA null; crm1 mutants are able to grow in a light:dark cycle and have no detectable oscillations of KaiC phosphorylation, whereas low-amplitude KaiC phosphorylation rhythms persist in the absence of RpaA. Levels of phosphorylated RpaA in vivo measured over time are significantly altered compared with WT in the crm1 mutant as well as in the absence of KaiC. Taken together, these results are consistent with the hypothesis that the Crm polypeptide modulates a circadian-specific activity of RpaA.

Transgenic tobacco plants with improved cyanobacterial Rubisco expression but no extra assembly factors grow at near wild-type rates if provided with elevated CO2.

Science.gov (United States)

Occhialini, Alessandro; Lin, Myat T; Andralojc, P John; Hanson, Maureen R; Parry, Martin A J

2016-01-01

Introducing a carbon-concentrating mechanism and a faster Rubisco enzyme from cyanobacteria into higher plant chloroplasts may improve photosynthetic performance by increasing the rate of CO2 fixation while decreasing losses caused by photorespiration. We previously demonstrated that tobacco plants grow photoautotrophically using Rubisco from Synechococcus elongatus, although the plants exhibited considerably slower growth than wild-type and required supplementary CO2 . Because of concerns that vascular plant assembly factors may not be adequate for assembly of a cyanobacterial Rubisco, prior transgenic plants included the cyanobacterial chaperone RbcX or the carboxysomal protein CcmM35. Here we show that neither RbcX nor CcmM35 is needed for assembly of active cyanobacterial Rubisco. Furthermore, by altering the gene regulatory sequences on the Rubisco transgenes, cyanobacterial Rubisco expression was enhanced and the transgenic plants grew at near wild-type growth rates, although still requiring elevated CO2 . We performed detailed kinetic characterization of the enzymes produced with and without the RbcX and CcmM35 cyanobacterial proteins. These transgenic plants exhibit photosynthetic characteristics that confirm the predicted benefits of introduction of non-native forms of Rubisco with higher carboxylation rate constants in vascular plants and the potential nitrogen-use efficiency that may be achieved provided that adequate CO2 is available near the enzyme. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

PSII as an in vivo molecular catalyst for the production of energy rich hydroquinones - A new approach in renewable energy.

Science.gov (United States)

Das, Sai; Maiti, Soumen K

2018-03-01

One of the pertinent issues in the field of energy science today is the quest for an abundant source of hydrogen or hydrogen equivalents. In this study, phenyl-p-benzoquinone (pPBQ) has been used to generate a molecular store of hydrogen equivalents (phenyl-p-hydroquinone; pPBQH 2 ) from thein vivo splitting of water by photosystem II of the marine cyanobacterium Synechococcus elongatus BDU 70542. Using this technique, 10.8 μmol of pPBQH 2 per mg chlorophyll a can be extracted per minute, an efficiency that is orders of magnitude higher when compared to the techniques present in the current literature. Moreover, the photo-reduction process was stable when tested over longer periods of time. Addition of phenyl-p-benzoquinone on an intermittent basis resulted in the precipitation of phenyl-p-hydroquinone, obviating the need for costly downstream processing units for product recovery. Phenyl-p-hydroquinone so obtained is a molecular store of free energy preserved through the light driven photolysis of water and can be used as a cheap and a renewable source of hydrogen equivalents by employing transition metal catalysts or fuel cells with the concomitant regeneration of phenyl-p-benzoquinone. The cyclic nature of this technique makes it an ideal candidate to be utilized in mankind's transition from fossil fuels to solar fuels. Copyright © 2018 Elsevier B.V. All rights reserved.

Species-specific roles of sulfolipid metabolism in acclimation of photosynthetic microbes to sulfur-starvation stress.

Directory of Open Access Journals (Sweden)

Norihiro Sato

Full Text Available Photosynthetic organisms utilize sulfate for the synthesis of sulfur-compounds including proteins and a sulfolipid, sulfoquinovosyl diacylglycerol. Upon ambient deficiency in sulfate, cells of a green alga, Chlamydomonas reinhardtii, degrade the chloroplast membrane sulfolipid to ensure an intracellular-sulfur source for necessary protein synthesis. Here, the effects of sulfate-starvation on the sulfolipid stability were investigated in another green alga, Chlorella kessleri, and two cyanobacteria, Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942. The results showed that sulfolipid degradation was induced only in C. kessleri, raising the possibility that this degradation ability was obtained not by cyanobacteria, but by eukaryotic algae during the evolution of photosynthetic organisms. Meanwhile, Synechococcus disruptants concerning sqdB and sqdX genes, which are involved in successive reactions in the sulfolipid synthesis pathway, were respectively characterized in cellular response to sulfate-starvation. Phycobilisome degradation intrinsic to Synechococcus, but not to Synechocystis, and cell growth under sulfate-starved conditions were repressed in the sqdB and sqdX disruptants, respectively, relative to in the wild type. Their distinct phenotypes, despite the common loss of the sulfolipid, inferred specific roles of sqdB and sqdX. This study demonstrated that sulfolipid metabolism might have been developed to enable species- or cyanobacterial-strain dependent processes for acclimation to sulfate-starvation.

Habitat preferences of ground beetle (Coleoptera: Carabidae) species in the northern Black Hills of South Dakota.

Science.gov (United States)

Bergmann, David J; Brandenburg, Dylan; Petit, Samantha; Gabel, Mark

2012-10-01

Ground beetles (Coleoptera: Carabidae) are a major component of terrestrial invertebrate communities and have been used as bioindicators of habitat change and disturbance. The Black Hills of South Dakota is a small area with a high biodiversity, but the ground beetles of this region are little studied. The habitat preferences of ground beetles in the Black Hills are unknown, and baseline data must be collected if these beetles are to be used in the future as bioindicators. Ground beetles (Coleoptera: Carabidae) were collected from pitfall traps at two sites in each of five kinds of habitats (grassland, bur oak-ironwood forests, ponderosa pine-common juniper forests, aspen-pine forests, and a spruce forest) from which habitat structure characteristics and plant abundance data also were collected. In total, 27 species of ground beetles were identified. Although some species, such as Dicaelus sculptilis Say were found in most habitats, other species showed distinct habitat preferences: Poecilus lucublandus (Say) preferred oak forests, Pasimachus elongatus LeConte preferred grasslands, and Calathus ingratus Dejean preferred high-elevation aspen-pine forests. Pterostichus adstrictus Escholtz was found only in woodlands, and Carabus taedatus Say strictly in higher elevation (over 1,500 m) aspen or coniferous woods, and may represent relict populations of boreal species. Elevation, exposure to sunlight, and cover of woody plants strongly influence the structure of carabid communities in the Black Hills.

Cyanobacterial defense mechanisms against foreign DNA transfer and their impact on genetic engineering

Directory of Open Access Journals (Sweden)

Karina Stucken

2013-01-01

Full Text Available Cyanobacteria display a large diversity of cellular forms ranging from unicellular to complex multicellular filaments or aggregates. Species in the group present a wide range of metabolic characteristics including the fixation of atmospheric nitrogen, resistance to extreme environments, production of hydrogen, secondary metabolites and exopolysaccharides. These characteristics led to the growing interest in cyanobacteria across the fields of ecology, evolution, cell biology and biotechnology. The number of available cyanobacterial genome sequences has increased considerably in recent years, with more than 140 fully sequenced genomes to date. Genetic engineering of cyanobacteria is widely applied to the model unicellular strains Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942. However the establishment of transformation protocols in many other cyanobacterial strains is challenging. One obstacle to the development of these novel model organisms is that many species have doubling times of 48 h or more, much longer than the bacterial models E. coli or B. subtilis. Furthermore, cyanobacterial defense mechanisms against foreign DNA pose a physical and biochemical barrier to DNA insertion in most strains. Here we review the various barriers to DNA uptake in the context of lateral gene transfer among microbes and the various mechanisms for DNA acquisition within the prokaryotic domain. Understanding the cyanobacterial defense mechanisms is expected to assist in the development and establishment of novel transformation protocols that are specifically suitable for this group.

Redescription of Tripaphylus musteli (van Beneden, 1851) (Copepoda: Sphyriidae) and the relegation of Paeon Wilson, 1919 to synonymy with Tripaphylus Richiardi in Anonymous, 1878.

Science.gov (United States)

Benz, George W; Boxshall, Geoffrey A

2017-07-01

Tripaphylus musteli (van Beneden, 1851) (Copepoda, Siphonostomatoida, Sphyriidae) is redescribed from an adult female collected from the branchial chamber of a starry smooth-hound, Mustelus asterias Cloquet (Carcharhiniformes, Triakidae), captured in the English Channel off Portland, UK. The new account of T. musteli is the first based on a complete adult female and highlighted the lack of a robust distinction separating Tripaphylus Richiardi, in Anonymous, 1878 and Paeon Wilson, 1919 prompting us to relegate Paeon to a junior subjective synonym of Tripaphylus. In the light of this synonymy the eight former species of Paeon are transferred to Tripaphylus as follows: T. ferox (Wilson, 1919) new combination, T. elongatus (Wilson, 1932) new combination, T. vassierei (Delamare Deboutteville & Nuñes-Ruivo, 1954) new combination, T. lobatus (Kirtisinghe, 1964) new combination, T. asymboli (Turner, Kyne & Bennett, 2003) new combination, T. versicolor (Wilson, 1919) new combination, T. australis (Kabata, 1993) new combination, and T. triakis (Castro Romero, 2001) new combination. Comparisons between terminology used in this report and that in the literature indicate that all transformed adult females of Tripaphylus probably possess a full complement of cephalic appendages and maxillipeds. All limbs, with the exception of the maxillae share a general morphological similarity to the corresponding appendages of conspecific males. The maxilla of the transformed adult female of Tripaphylus is a small digitiform protuberance associated with a swelling in some species.

The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

NARCIS (Netherlands)

Danchin, Etienne G.J.; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Rocha, Da Martine; Bajew, Simon; Neilson, Roy; Sokolova, Elena; Silva, Da Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Hans; Jones, John T.; Eves-van den Akker, Sebastian

2017-01-01

Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been

Engineered Photosystem II reaction centers optimize photochemistry versus photoprotection at different solar intensities.

Science.gov (United States)

Vinyard, David J; Gimpel, Javier; Ananyev, Gennady M; Mayfield, Stephen P; Dismukes, G Charles

2014-03-12

The D1 protein of Photosystem II (PSII) provides most of the ligating amino acid residues for the Mn4CaO5 water-oxidizing complex (WOC) and half of the reaction center cofactors, and it is present as two isoforms in the cyanobacterium Synechococcus elongatus PCC 7942. These isoforms, D1:1 and D1:2, confer functional advantages for photosynthetic growth at low and high light intensities, respectively. D1:1, D1:2, and seven point mutations in the D1:2 background that are native to D1:1 were expressed in the green alga Chlamydomonas reinhardtii. We used these nine strains to show that those strains that confer a higher yield of PSII charge separation under light-limiting conditions (where charge recombination is significant) have less efficient photochemical turnover, measured in terms of both a lower WOC turnover probability and a longer WOC cycle period. Conversely, these same strains under light saturation (where charge recombination does not compete) confer a correspondingly faster O2 evolution rate and greater protection against photoinhibition. Taken together, the data clearly establish that PSII primary charge separation is a trade-off between photochemical productivity (water oxidation and plastoquinone reduction) and charge recombination (photoprotection). These trade-offs add up to a significant growth advantage for the two natural isoforms. These insights provide fundamental design principles for engineering of PSII reaction centers with optimal photochemical efficiencies for growth at low versus high light intensities.

From PII signaling to metabolite sensing: a novel 2-oxoglutarate sensor that details PII-NAGK complex formation.

Directory of Open Access Journals (Sweden)

Jan Lüddecke

Full Text Available The widespread PII signal transduction proteins are known for integrating signals of nitrogen and energy supply and regulating cellular behavior by interacting with a multitude of target proteins. The PII protein of the cyanobacterium Synechococcus elongatus forms complexes with the controlling enzyme of arginine synthesis, N-acetyl-L-glutamate kinase (NAGK in a 2-oxoglutarate- and ATP/ADP-dependent manner. Fusing NAGK and PII proteins to either CFP or YFP yielded a FRET sensor that specifically responded to 2-oxoglutarate. The impact of the fluorescent tags on PII and NAGK was evaluated by enzyme assays, surface plasmon resonance spectroscopy and isothermal calorimetric experiments. The developed FRET sensor provides real-time data on PII - NAGK interaction and its modulation by the effector molecules ATP, ADP and 2-oxoglutarate in vitro. Additionally to its utility to monitor 2-oxoglutarate levels, the FRET assay provided novel insights into PII - NAGK complex formation: (i It revealed the formation of an encounter-complex between PII and NAGK, which holds the proteins in proximity even in the presence of inhibitors of complex formation; (ii It revealed that the PII T-loop residue Ser49 is neither essential for complex formation with NAGK nor for activation of the enzyme but necessary to form a stable complex and efficiently relieve NAGK from arginine inhibition; (iii It showed that arginine stabilizes the NAGK hexamer and stimulates PII - NAGK interaction.

Allometric shape change of the lower pharyngeal jaw correlates with a dietary shift to piscivory in a cichlid fish

Science.gov (United States)

Hellig, Christoph J.; Kerschbaumer, Michaela; Sefc, Kristina M.; Koblmüller, Stephan

2010-07-01

The morphological versatility of the pharyngeal jaw of cichlid fishes is assumed to represent a key factor facilitating their unparalleled trophic diversification and explosive radiation. It is generally believed that the functional design of an organism relates to its ecology, and thus, specializations to different diets are typically associated with distinct morphological designs, especially manifested in the cichlids’ pharyngeal jaw apparatus. Thereby, the lower pharyngeal jaw (LPJ) incorporates some of the most predictive features for distinct diet-related morphotypes. Thus, considering that piscivorous cichlids experience an ontogenetic dietary shift from typically various kinds of invertebrates to fish, concomitant morphological changes in the LPJ are expected. Using Lepidiolamprologus elongatus, a top predator in the shallow rocky habitat of Lake Tanganyika, as model, and applying geometric and traditional morphometric techniques, we demonstrate an allometric change in ontogenetic LPJ shape development coinciding with the completion of the dietary shift toward piscivory. The piscivorous LPJ morphotype is initiated in juvenile fish by increasing elongation and narrowing of the LPJ and—when the fish reach a size of 80-90 mm standard length—further refined by the elongation of the posterior muscular processes, which serve as insertion for the fourth musculus levator externus. The enlarged muscular processes of the fully mature piscivorous morphotype provide for the construction of a powerful lever system, which allows the large individuals to process large prey fish and rely on exclusive piscivory.

A balanced ATP driving force module for enhancing photosynthetic biosynthesis of 3-hydroxybutyrate from CO2.

Science.gov (United States)

Ku, Jason T; Lan, Ethan I

2018-03-01

Using engineered photoautotrophic microorganisms for the direct chemical synthesis from CO 2 is an attractive direction for both sustainability and CO 2 mitigation. However, the behaviors of non-native metabolic pathways may be difficult to control due to the different intracellular contexts between natural and heterologous hosts. While most metabolic engineering efforts focus on strengthening driving forces in pathway design to favor biochemical production in these organisms, excessive driving force may be detrimental to product biosynthesis due to imbalanced cellular intermediate distribution. In this study, an ATP-hydrolysis based driving force module was engineered into cyanobacterium Synechococcus elongatus PCC 7942 to produce 3-hydroxybutyrate (3HB), a valuable chemical feedstock for the synthesis of biodegradable plastics and antibiotics. However, while the ATP driving force module is effective for increasing product formation, uncontrolled accumulation of intermediate metabolites likely led to metabolic imbalance and thus to cell growth inhibition. Therefore, the ATP driving force module was reengineered by providing a reversible outlet for excessive carbon flux. Upon expression of this balanced ATP driving force module with 3HB biosynthesis, engineered strain produced 3HB with a cumulative titer of 1.2 g/L, a significant increase over the initial strain. This result highlighted the importance of pathway reversibility as an effective design strategy for balancing driving force and intermediate accumulation, thereby achieving a self-regulated control for increased net flux towards product biosynthesis. Copyright © 2018 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

Análise faunística de gafanhotos na Floresta Nacional de Chapecó, Santa Catarina Faunistic analyses of grasshoppers in the National Forest of Chapecó, Santa Catarina, Brazil

Directory of Open Access Journals (Sweden)

Cladis Juliana Lutinski

2011-03-01

Full Text Available

Realizou-se a análise faunística de gafanhotos coletados em três constituições vegetais da Flona de Chapecó. Coletas semanais foram realizadas em áreas de eucalipto, mata nativa e pinus durante o período de dezembro de 2003 a dezembro de 2004. Utilizaram-se armadilhas do tipo “pitfall”, rede de varredura, guarda-chuva entomológico e “malaise”. A fauna encontrada nas diferentes áreas foi caracterizada por meio dos índices de abundância, constância, dominância e frequência. Dezoito espécies foram comuns para as três áreas. As espécies Staurorhectus logicornis logicornis, Cylindrotettix sp. e Ommexecha virens ocorreram apenas em eucaliptos e pínus, enquanto, Scotussa lemniscata e Zoniopoda tarsata ocorreram para eucaliptos e mata nativa enquanto Amblytropidia sp. ocorreu somente em mata nativa e pínus. Tridactylus politus ocorreu somente em pínus. As espécies Allotruxalis gracilis, Dichroplus elongatus, Dichroplus misionensis e Ronderosia bergi foram muito frequentes, dominantes e muito abundantes na área de eucaliptos. A. gracilis, Metaleptea adspersa e D. misionensis foram muito frequentes, dominantes e muito abundantes na área de mata nativa. Metaleptea adspersa e R. bergi foram muito frequentes, dominantes e muito abundantes na área de pínus. Observou-se uma semelhança na diversidade de espécies entre as áreas, com maior abundância para a área de eucaliptos.

doi: 10.4336/2011.pfb.31.65.43

A study of the grasshopper fauna was performed through samples collected in three vegetal types in the National Forest of Chapecó. Weekly collections were carried out from December 2003 to December 2004. Pitfall traps, sweep nets, entomological umbrellas and malaise traps were used. Collections were repeated in areas with eucalyptus trees, native

CRISPR-Cas9 for the genome engineering of cyanobacteria and succinate production.

Science.gov (United States)

Li, Hung; Shen, Claire R; Huang, Chun-Hung; Sung, Li-Yu; Wu, Meng-Ying; Hu, Yu-Chen

2016-11-01

Cyanobacteria hold promise as a cell factory for producing biofuels and bio-derived chemicals, but genome engineering of cyanobacteria such as Synechococcus elongatus PCC 7942 poses challenges because of their oligoploidy nature and long-term instability of the introduced gene. CRISPR-Cas9 is a newly developed RNA-guided genome editing system, yet its application for cyanobacteria engineering has yet to be reported. Here we demonstrated that CRISPR-Cas9 system can effectively trigger programmable double strand break (DSB) at the chromosome of PCC 7942 and provoke cell death. With the co-transformation of template plasmid harboring the gene cassette and flanking homology arms, CRISPR-Cas9-mediated DSB enabled precise gene integration, ameliorated the homologous recombination efficiency and allowed the use of lower amount of template DNA and shorter homology arms. The CRISPR-Cas9-induced cell death imposed selective pressure and enhanced the chance of concomitant integration of gene cassettes into all chromosomes of PCC 7942, hence accelerating the process of obtaining homogeneous and stable recombinant strains. We further explored the feasibility of engineering cyanobacteria by CRISPR-Cas9-assisted simultaneous glgc knock-out and gltA/ppc knock-in, which improved the succinate titer to 435.0±35.0μg/L, an ≈11-fold increase when compared with that of the wild-type cells. These data altogether justify the use of CRISPR-Cas9 for genome engineering and manipulation of metabolic pathways in cyanobacteria. Copyright © 2016 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

Light-optimized growth of cyanobacterial cultures: Growth phases and productivity of biomass and secreted molecules in light-limited batch growth.

Science.gov (United States)

Clark, Ryan L; McGinley, Laura L; Purdy, Hugh M; Korosh, Travis C; Reed, Jennifer L; Root, Thatcher W; Pfleger, Brian F

2018-03-27

Cyanobacteria are photosynthetic microorganisms whose metabolism can be modified through genetic engineering for production of a wide variety of molecules directly from CO 2 , light, and nutrients. Diverse molecules have been produced in small quantities by engineered cyanobacteria to demonstrate the feasibility of photosynthetic biorefineries. Consequently, there is interest in engineering these microorganisms to increase titer and productivity to meet industrial metrics. Unfortunately, differing experimental conditions and cultivation techniques confound comparisons of strains and metabolic engineering strategies. In this work, we discuss the factors governing photoautotrophic growth and demonstrate nutritionally replete conditions in which a model cyanobacterium can be grown to stationary phase with light as the sole limiting substrate. We introduce a mathematical framework for understanding the dynamics of growth and product secretion in light-limited cyanobacterial cultures. Using this framework, we demonstrate how cyanobacterial growth in differing experimental systems can be easily scaled by the volumetric photon delivery rate using the model organisms Synechococcus sp. strain PCC7002 and Synechococcus elongatus strain UTEX2973. We use this framework to predict scaled up growth and product secretion in 1L photobioreactors of two strains of Synechococcus PCC7002 engineered for production of l-lactate or L-lysine. The analytical framework developed in this work serves as a guide for future metabolic engineering studies of cyanobacteria to allow better comparison of experiments performed in different experimental systems and to further investigate the dynamics of growth and product secretion. Copyright © 2018 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

Helminth Fauna Associated with Three Neotropical Bat Species (Chiroptera: Mormoopidae) in Veracruz, México.

Science.gov (United States)

Clarke-Crespo, Emilio; de León, Gerardo Pérez-Ponce; Montiel-Ortega, Salvador; Rubio-Godoy, Miguel

2017-08-01

Bats are recognized as potential hosts of pathogens exploiting the food chain to reach them as definitive hosts. However, very little is known about their endoparasites, especially for Neotropical bats. In this study, we assessed the helminth fauna associated with 3 insectivorous bat species roosting in the same single hot cave in central Veracruz, México: Mormoops megalophylla, Pteronotus davyi, and Pteronotus personatus. During a period of 1 yr (April 2007-2008), 135 mormoopid bats in total were collected and examined for helminths. Six parasite species representing 3 types of intestinal helminths were found: 1 cestode Vampirolepis elongatus; 2 trematodes Maxbraunium tubiporum and Ochoterenatrema labda; and 3 nematodes Linustrongylus pteronoti, Molineidae gen. sp., and Capillaria sp. Overall, trematodes were the most abundant parasite group (72.4%), followed by nematodes (20.7%) and cestodes (6.9%). Species-accumulation curves suggest that the worms collected (n = 1,331) from these 6 parasite species comprise the helminth fauna associated with the 3 bat populations studied. The only species shared by the 3 bat species was Capillaria sp. Most (5/6) of the helminth species recorded use Lepidoptera and Diptera as intermediate hosts; therefore, diet is likely the main source of infection. Although insectivorous bats are considered dietary generalist species, the differences found in helminth diversity in these sympatric populations of closely related bat species, suggest that diet partitioning occurs in mormoopid bat communities. Helminths tend to exploit the food chain to reach their final hosts; therefore, studying these parasites can provide useful information to further understand the biology of bats.

Genomic architecture of habitat-related divergence and signature of directional selection in the body shapes of Gnathopogon fishes.

Science.gov (United States)

Kakioka, Ryo; Kokita, Tomoyuki; Kumada, Hiroki; Watanabe, Katsutoshi; Okuda, Noboru

2015-08-01

Evolution of ecomorphologically relevant traits such as body shapes is important to colonize and persist in a novel environment. Habitat-related adaptive divergence of these traits is therefore common among animals. We studied the genomic architecture of habitat-related divergence in the body shape of Gnathopogon fishes, a novel example of lake-stream ecomorphological divergence, and tested for the action of directional selection on body shape differentiation. Compared to stream-dwelling Gnathopogon elongatus, the sister species Gnathopogon caerulescens, exclusively inhabiting a large ancient lake, had an elongated body, increased proportion of the caudal region and small head, which would be advantageous in the limnetic environment. Using an F2 interspecific cross between the two Gnathopogon species (195 individuals), quantitative trait locus (QTL) analysis with geometric morphometric quantification of body shape and restriction-site associated DNA sequencing-derived markers (1622 loci) identified 26 significant QTLs associated with the interspecific differences of body shape-related traits. These QTLs had small to moderate effects, supporting polygenic inheritance of the body shape-related traits. Each QTL was mostly located on different genomic regions, while colocalized QTLs were detected for some ecomorphologically relevant traits that are proxy of body and caudal peduncle depths, suggesting different degree of modularity among traits. The directions of the body shape QTLs were mostly consistent with the interspecific difference, and QTL sign test suggested a genetic signature of directional selection in the body shape divergence. Thus, we successfully elucidated the genomic architecture underlying the adaptive changes of the quantitative and complex morphological trait in a novel system. © 2015 John Wiley & Sons Ltd.

Diversidad y distribución de acridios (Orthoptera: Acridoidea en pastizales del sur de la región pampeana, Argentina

Directory of Open Access Journals (Sweden)

Yanina Mariottini

2013-03-01

Full Text Available Los acridios son componentes nativos de los pastizales, dichos sistemas han sido modificados debido a la intensificación de las actividades agrícola-ganaderas y por lo tanto se considera importante estudiar las comunidades de acridios asociadas. Se estudió la diversidad y distribución de acridios en el Sur de la región pampeana a través de muestreos realizados en las comunidades vegetales más representativas del partido de Laprida, provincia de Buenos Aires, durante cinco temporadas (2005-2010. Se recolectaron 22 especies. La subfamilia Melanoplinae fue la más diversa (ocho especies. La mayor cantidad de especies se observó en los pastizales nativos (18. La diversidad en los pastizales alterados (1.75±0.096 fue superior (p<0.05 a la de los pastizales halófilos (1.34±0.12. La riqueza de plantas en los pastizales nativos y los pastizales alterados fue superior (p<0.05 a la de las demás comunidades. Se registro una relación positiva entre la riqueza de plantas y las variables riqueza y diversidad de acridios. La similitud entre las comunidades de acridios estimada por los índices cualitativos fue superior al 60%. En general, las especies que tuvieron una mayor frecuencia de aparición, mostraron una mayor abundancia y distribución. Covasacris pallidinota, Dichroplus elongatus, D. maculipennis, Borellia bruneri y B. pallida fueron las de mayor distribución, cinco especies tuvieron una distribución intermedia y la mayoría (12 una distribución restringida.

Effects of non-steroidal anti-inflammatory drugs on cyanobacteria and algae in laboratory strains and in natural algal assemblages.

Science.gov (United States)

Bácsi, István; B-Béres, Viktória; Kókai, Zsuzsanna; Gonda, Sándor; Novák, Zoltán; Nagy, Sándor Alex; Vasas, Gábor

2016-05-01

In recent years measurable concentrations of non-steroidal anti-inflammatory drugs (NSAIDs) have been shown in the aquatic environment as a result of increasing human consumption. Effects of five frequently used non-steroidal anti-inflammatory drugs (diclofenac, diflunisal, ibuprofen, mefenamic acid and piroxicam in 0.1 mg ml(-1) concentration) in batch cultures of cyanobacteria (Synechococcus elongatus, Microcystis aeruginosa, Cylindrospermopsis raciborskii), and eukaryotic algae (Desmodesmus communis, Haematococcus pluvialis, Cryptomonas ovata) were studied. Furthermore, the effects of the same concentrations of NSAIDs were investigated in natural algal assemblages in microcosms. According to the changes of chlorophyll-a content, unicellular cyanobacteria seemed to be more tolerant to NSAIDs than eukaryotic algae in laboratory experiments. Growth of eukaryotic algae was reduced by all drugs, the cryptomonad C. ovata was the most sensitive to NSAIDs, while the flagellated green alga H. pluvialis was more sensitive than the non-motile green alga D. communis. NSAID treatments had weaker impact in the natural assemblages dominated by cyanobacteria than in the ones dominated by eukaryotic algae, confirming the results of laboratory experiments. Diversity and number of functional groups did not change notably in cyanobacteria dominated assemblages, while they decreased significantly in eukaryotic algae dominated ones compared to controls. The results highlight that cyanobacteria (especially unicellular ones) are less sensitive to the studied, mostly hardly degradable NSAIDs, which suggest that their accumulation in water bodies may contribute to the expansion of cyanobacterial mass productions in appropriate environmental circumstances by pushing back eukaryotic algae. Thus, these contaminants require special attention during wastewater treatment and monitoring of surface waters. Copyright © 2016 Elsevier Ltd. All rights reserved.

Prevalence of infection and molecular confirmation by using ITS-2 region of Fasciola gigantica found in domestic cattle from Chiang Mai province, Thailand.

Science.gov (United States)

Phalee, Anawat; Wongsawad, Chalobol

2014-03-01

To investigate the infection of Fasciola gigantica (F. gigantica) in domestic cattle from Chiang Mai province and molecular confirmation using ITS-2 region. The liver and gall bladder of Bubalus bubalis (B. bubalis) and Bos taurus (B. taurus) from slaughterhouses were examined adult worms and prevalence investigation. The species confirmation with phylogenetic analysis using ITS-2 sequences was performed by maximum likelihood and UPGMA methods. The total prevalences of infection in B. bubalis and Bubalus taurus (B. taurus) were 67.27% and 52.94% respectively. The respective prevalence in both B. bubalis and B. taurus were acquired from Doi-Saket, Muang, and Sanpatong districts, with 81.25%, 62.50% and 60.00% for B. bubalis and 62.50%, 50.00% and 47.06% for Bos taurus respectively. The species confirmation of F. gigantica and some related species by basing on maximum likelihood and UPGMA methods used, 4 groups of trematodes were generated, first F. gigantica group including specimen of Chiang Mai, second 2 samples of F. hepatica, third group of 3 rumen flukes; Orthocoelium streptocoelium, F. elongatus and Paramphistomum epliclitum and fourth group of 3 minute intestinal flukes; Haplorchis taichui, Stellantchasmu falcatus, Haplorchoides sp. and liver fluke; Opisthorchis viverrini respectively. These results can be confirmed the Giant liver fluke which mainly caused fascioliasis in Chiang Mai was identified as F. gigantica and specimens were the same as those of F. gigantica recorded in other different countries. Nucleotide sequence of ITS-2 region has been proven as effective diagnostic tool for the identification of F. gigantica. Copyright © 2014 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

Zooplankton trophic niches respond to different water types of the western Tasman Sea: A stable isotope analysis

Science.gov (United States)

Henschke, Natasha; Everett, Jason D.; Suthers, Iain M.; Smith, James A.; Hunt, Brian P. V.; Doblin, Martina A.; Taylor, Matthew D.

2015-10-01

The trophic relationships of 21 species from an oceanic zooplankton community were studied using stable isotopes of carbon and nitrogen. Zooplankton and suspended particulate organic matter (POM) were sampled in three different water types in the western Tasman Sea: inner shelf (IS), a cold core eddy (CCE) and a warm core eddy (WCE). δ15N values ranged from 3.9‰ for the parasitic copepod Sapphirina augusta to 10.2‰ for the euphausiid, Euphausia spinifera. δ13C varied from -22.6 to -19.4‰ as a result of the copepod Euchirella curticauda and E. spinifera. The isotopic composition of POM varied significantly among water types; as did the trophic enrichment of zooplankton over POM, with the lowest enrichment in the recently upwelled IS water type (0.5‰) compared to the warm core eddy (1.6‰) and cold core eddy (2.7‰). The WCE was an oligotrophic environment and was associated with an increased trophic level for omnivorous zooplankton (copepods and euphausiids) to a similar level as carnivorous zooplankton (chaetognaths). Therefore carnivory in zooplankton can increase in response to lower abundance and reduced diversity in their phytoplankton and protozoan prey. Trophic niche width comparisons across three zooplankton species: the salp Thalia democratica, the copepod Eucalanus elongatus and the euphausiid Thysanoessa gregaria, indicated that both niche partitioning and competition can occur within the zooplankton community. We have shown that trophic relationships among the zooplankton are dynamic and respond to different water types. The changes to the zooplankton isotopic niche, however, were still highly variable as result of oceanographic variation within water types.

A RAD-based linkage map and comparative genomics in the gudgeons (genus Gnathopogon, Cyprinidae

Directory of Open Access Journals (Sweden)

Kakioka Ryo

2013-01-01

Full Text Available Abstract Background The construction of linkage maps is a first step in exploring the genetic basis for adaptive phenotypic divergence in closely related species by quantitative trait locus (QTL analysis. Linkage maps are also useful for comparative genomics in non-model organisms. Advances in genomics technologies make it more feasible than ever to study the genetics of adaptation in natural populations. Restriction-site associated DNA (RAD sequencing in next-generation sequencers facilitates the development of many genetic markers and genotyping. We aimed to construct a linkage map of the gudgeons of the genus Gnathopogon (Cyprinidae for comparative genomics with the zebrafish Danio rerio (a member of the same family as gudgeons and for the future QTL analysis of the genetic architecture underlying adaptive phenotypic evolution of Gnathopogon. Results We constructed the first genetic linkage map of Gnathopogon using a 198 F2 interspecific cross between two closely related species in Japan: river-dwelling Gnathopogon elongatus and lake-dwelling Gnathopogon caerulescens. Based on 1,622 RAD-tag markers, a linkage map spanning 1,390.9 cM with 25 linkage groups and an average marker interval of 0.87 cM was constructed. We also identified a region involving female-specific transmission ratio distortion (TRD. Synteny and collinearity were extensively conserved between Gnathopogon and zebrafish. Conclusions The dense SNP-based linkage map presented here provides a basis for future QTL analysis. It will also be useful for transferring genomic information from a “traditional” model fish species, zebrafish, to screen candidate genes underlying ecologically important traits of the gudgeons.

Structures of the Mycobacterium tuberculosis GlpX protein (class II fructose-1,6-bisphosphatase): implications for the active oligomeric state, catalytic mechanism and citrate inhibition.

Science.gov (United States)

Wolf, Nina M; Gutka, Hiten J; Movahedzadeh, Farahnaz; Abad-Zapatero, Celerino

2018-04-01

The crystal structures of native class II fructose-1,6-bisphosphatase (FBPaseII) from Mycobacterium tuberculosis at 2.6 Å resolution and two active-site protein variants are presented. The variants were complexed with the reaction product fructose 6-phosphate (F6P). The Thr84Ala mutant is inactive, while the Thr84Ser mutant has a lower catalytic activity. The structures reveal the presence of a 222 tetramer, similar to those described for fructose-1,6/sedoheptulose-1,7-bisphosphatase from Synechocystis (strain 6803) as well as the equivalent enzyme from Thermosynechococcus elongatus. This homotetramer corresponds to a homologous oligomer that is present but not described in the crystal structure of FBPaseII from Escherichia coli and is probably conserved in all FBPaseIIs. The constellation of amino-acid residues in the active site of FBPaseII from M. tuberculosis (MtFBPaseII) is conserved and is analogous to that described previously for the E. coli enzyme. Moreover, the structure of the active site of the partially active (Thr84Ser) variant and the analysis of the kinetics are consistent with the previously proposed catalytic mechanism. The presence of metabolites in the crystallization medium (for example citrate and malonate) and in the corresponding crystal structures of MtFBPaseII, combined with their observed inhibitory effect, could suggest the existence of an uncharacterized inhibition of this class of enzymes besides the allosteric inhibition by adenosine monophosphate observed for the Synechocystis enzyme. The structural and functional insights derived from the structure of MtFBPaseII will provide critical information for the design of lead inhibitors, which will be used to validate this target for future chemical intervention.

Interspecific variation in life history relates to antipredator decisions by marine mesopredators on temperate reefs.

Directory of Open Access Journals (Sweden)

Alejandro Frid

Full Text Available As upper-level predatory fishes become overfished, mesopredators rise to become the new 'top' predators of over-exploited marine communities. To gain insight into ensuing mechanisms that might alter indirect species interactions, we examined how behavioural responses to an upper-level predatory fish might differ between mesopredator species with different life histories. In rocky reefs of the northeast Pacific Ocean, adult lingcod (Ophiodon elongatus are upper-level predators that use a sit-and-wait hunting mode. Reef mesopredators that are prey to adult lingcod include kelp greenling (Hexagrammos decagrammus, younger lingcod, copper rockfish (Sebastes caurinus and quillback rockfish (S. maliger. Across these mesopredators species, longevity and age at maturity increases and, consequently, the annual proportion of lifetime reproductive output decreases in the order just listed. Therefore, we hypothesized that the level of risk taken to acquire resources would vary interspecifically in that same order. During field experiments we manipulated predation risk with a model adult lingcod and used fixed video cameras to quantify interactions between mesopredators and tethered prey (Pandalus shrimps. We predicted that the probabilities of inspecting and attacking tethered prey would rank from highest to lowest and the timing of these behaviours would rank from earliest to latest as follows: kelp greenling, lingcod, copper rockfish, and quillback rockfish. We also predicted that responses to the model lingcod, such as avoidance of interactions with tethered prey, would rank from weakest to strongest in the same order. Results were consistent with our predictions suggesting that, despite occupying similar trophic levels, longer-lived mesopredators with late maturity have stronger antipredator responses and therefore experience lower foraging rates in the presence of predators than mesopredators with faster life histories. The corollary is that the fishery

Responses of Szarvasi-1 energy grass to sewage sludge treatments in hydroponics.

Science.gov (United States)

Rév, Ambrus; Tóth, Brigitta; Solti, Ádám; Sipos, Gyula; Fodor, Ferenc

2017-09-01

Sewage sludge (SS) originating from communal wastewater is a hazardous material but have a potentially great nutritive value. Its disposal after treatment in agricultural lands can be a very economical and safe way of utilization once fast growing, high biomass, perennial plants of renewable energy production are cultivated. Szarvasi-1 energy grass (Elymus elongatus subsp. ponticus cv. Szarvasi-1), a good candidate for this application, was grown in hydroponics in order to assess its metal accumulation and tolerance under increasing SS amendments. The applied SS had a composition characteristic to SS from communal wastes and did not contain any toxic heavy metal contamination from industrial sludge in high concentration. Toxic effects was assessed in quarter strength Hoagland nutrient solution and only the two highest doses (12.5-18.75 g dm -3 ) caused decreases in root growth, shoot water content and length and stomatal conductance whereas shoot growth, root water content, chlorophyll concentration and the maximal quantum efficiency of photosystem II was unaffected. Shoot K, Ca, Mg, Mn, Zn and Cu content decreased but Na and Ni increased in the shoot compared to the unamended control. The nutritive effect was tested in 1/40 strength Hoagland solution and only the highest dose (12.5 g dm -3 ) decreased root growth and stomatal conductance significantly while lower doses (1.25-6.25 g dm -3 ) had a stimulative effect. Shoot K, Na, Fe and Ni increased and Ca, Mg, Mn, Zn and Cu decreased in this treatment. It was concluded that SS with low heavy metal content can be a potentially good fertilizer for high biomass non-food crops such as Szarvasi-1 energy grass. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

Structural studies of cyanobacterial PSII

International Nuclear Information System (INIS)

Da Fonseca, Paula Cristina Alves

2001-01-01

Photosystem II (PSII) is the photosynthetic transmembrane protein-pigment complex which utilises light energy to drive the splitting of water and release of oxygen, a unique reaction in biological systems. The determination of the structure of PSII at high resolution is required in order to understand its mechanisms of reaction. For this reason, methods have been developed to purify highly active PSII complexes from the thermophilic cyanobacterium Synechococcus elongate These complexes have been studied by high resolution electron microscopy, using both single particle analysis and electron crystallography. A 30A three-dimensional map of the cyanobacterial PSII complex was obtained by single particle analysis. The comparison of this map with structural data from the spinach PSII core dimer revealed that both complexes share similar overall size and shape. These data also allowed a discussion on the organisation and positioning of the extrinsic lumenal proteins within the cyanobacterial PSII complex. A Synechococcus elongatus PSII projection map, at a resolution of 20A, was determined by image processing of two-dimensional crystals formed by the in vitro reconstitution method. This was the first projection map obtained by electron crystallography of a cyanobacterial highly active PSII complex, with all the extrinsic subunits retained. The analysis of this map and its comparison with a 10A three-dimensional map recently obtained from the spinach PSII core dimer revealed a similar organisation of the main transmembrane subunits. Moreover, at the level of resolution of the present data it is possible to identify differences which can be related to the content and organisation of the small subunits forming the PSII complex from both organisms. Cytochrome b559, an important but incompletely understood PSII subunit, was purified and subjected to crystallisation trials in order to aid the interpretation of intermediate resolution PSII structural data. Small crystals were

Barcoding Atlantic Canada's mesopelagic and upper bathypelagic marine fishes.

Directory of Open Access Journals (Sweden)

Ellen L Kenchington

Full Text Available DNA barcode sequences were developed from 557 mesopelagic and upper bathypelagic teleost specimens collected in waters off Atlantic Canada. Confident morphological identifications were available for 366 specimens, of 118 species and 93 genera, which yielded 328 haplotypes. Five of the species were novel to the Barcode of Life Database (BOLD. Most of the 118 species conformed to expectations of monophyly and the presence of a "barcode gap", though some known weaknesses in existing taxonomy were confirmed and a deficiency in published keys was revealed. Of the specimens for which no firm morphological identification was available, 156 were successfully identified to species, and a further 11 to genus, using their barcode sequences and a combination of distance- and character-based methods. The remaining 24 specimens were from species for which no reference barcode is yet available or else ones confused by apparent misidentification of publicly available sequences in BOLD. Addition of the new sequences to those previously in BOLD contributed support to recent taxonomic revisions of Chiasmodon and Poromitra, while it also revealed 18 cases of potential cryptic speciation. Most of the latter appear to result from genetic divergence among populations in different ocean basins, while the general lack of strong horizontal environmental gradients within the deep sea has allowed morphology to be conserved. Other examples of divergence appear to distinguish individuals living under the sub-tropical gyre of the North Atlantic from those under that ocean's sub-polar gyre. In contrast, the available sequences for two myctophid species, Benthosema glaciale and Notoscopelus elongatus, showed genetic structuring on finer geographic scales. The observed structure was not consistent with recent suggestions that "resident" populations of myctophids can maintain allopatry despite the mixing of ocean waters. Rather, it indicates that the very rapid speciation

Cofactors involved in light-driven charge separation in photosystem I identified by subpicosecond infrared spectroscopy.

Science.gov (United States)

Di Donato, Mariangela; Stahl, Andreas D; van Stokkum, Ivo H M; van Grondelle, Rienk; Groot, Marie-Louise

2011-02-01

Photosystem I is one of the key players in the conversion of solar energy into chemical energy. While the chlorophyll dimer P(700) has long been identified as the primary electron donor, the components involved in the primary charge separation process in PSI remain undetermined. Here, we have studied the charge separation dynamics in Photosystem I trimers from Synechococcus elongatus by femtosecond vis-pump/mid-infrared-probe spectroscopy upon excitation at 700, 710, and 715 nm. Because of the high specificity of the infrared region for the redox state and small differences in the molecular structure of pigments, we were able to clearly identify specific marker bands indicating chlorophyll (Chl) oxidation. Magnitudes of chlorophyll cation signals are observed to increase faster than the time resolution of the experiment (~0.2 ps) upon both excitation conditions: 700 nm and selective red excitation. Two models, involving either ultrafast charge separation or charge transfer character of the red pigments in PSI, are discussed to explain this observation. A further increase in the magnitudes of cation signals on a subpicosecond time scale (0.8-1 ps) indicates the formation of the primary radical pair. Evolution in the cation region with time constants of 7 and 40 ps reveals the formation of the secondary radical pair, involving a secondary electron donor. Modeling of the data allows us to extract the spectra of the two radical pairs, which have IR signatures consistent with A+A₀- and P₇₀₀+A₁-. We conclude that the cofactor chlorophyll A acts as the primary donor in PSI. The existence of an equilibrium between the two radical pairs we interpret as concerted hole/electron transfer between the pairs of electron donors and acceptors, until after 40 ps, relaxation leads to a full population of the P₇₀₀+A₁. radical pair.

Loop-Loop Interactions Regulate KaiA-Stimulated KaiC Phosphorylation in the Cyanobacterial KaiABC Circadian Clock

Energy Technology Data Exchange (ETDEWEB)

Egli, Martin [Vanderbilt Univ., Nashville, TN (United States); Pattanayek, Rekha [Vanderbilt Univ., Nashville, TN (United States); Sheehan, Jonathan H. [Vanderbilt Univ., Nashville, TN (United States); Xu, Yao [Vanderbilt Univ., Nashville, TN (United States); Mori, Tetsuya [Vanderbilt Univ., Nashville, TN (United States); Smith, Jarrod A. [Vanderbilt Univ., Nashville, TN (United States); Johnson, Carl H. [Vanderbilt Univ., Nashville, TN (United States)

2013-01-25

We found that the Synechococcus elongatus KaiA, KaiB, and KaiC proteins in the presence of ATP generate a post-translational oscillator that runs in a temperature-compensated manner with a period of 24 h. KaiA dimer stimulates phosphorylation of KaiC hexamer at two sites per subunit, T432 and S431, and KaiB dimers antagonize KaiA action and induce KaiC subunit exchange. Neither the mechanism of KaiA-stimulated KaiC phosphorylation nor that of KaiB-mediated KaiC dephosphorylation is understood in detail at present. We demonstrate here that the A422V KaiC mutant sheds light on the former mechanism. It was previously reported that A422V is less sensitive to dark pulse-induced phase resetting and has a reduced amplitude of the KaiC phosphorylation rhythm in vivo. A422 maps to a loop (422-loop) that continues toward the phosphorylation sites. By pulling on the C-terminal peptide of KaiC (A-loop), KaiA removes restraints from the adjacent 422-loop whose increased flexibility indirectly promotes kinase activity. We found in the crystal structure that A422V KaiC lacks phosphorylation at S431 and exhibits a subtle, local conformational change relative to wild-type KaiC. Molecular dynamics simulations indicate higher mobility of the 422-loop in the absence of the A-loop and mobility differences in other areas associated with phosphorylation activity between wild-type and mutant KaiCs. Finally, the A-loop–422-loop relay that informs KaiC phosphorylation sites of KaiA dimer binding propagates to loops from neighboring KaiC subunits, thus providing support for a concerted allosteric mechanism of phosphorylation.

CryoEM and Molecular Dynamics of the Circadian KaiB-KaiC Complex Indicates That KaiB Monomers Interact with KaiC and Block ATP Binding Clefts

Energy Technology Data Exchange (ETDEWEB)

Villarreal, Seth A.; Pattanayek, Rekha; Williams, Dewight R.; Mori, Tetsuya; Qin, Ximing; Johnson, Carl H.; Egli, Martin; Stewart, Phoebe L. [Case Western; (Vanderbilt); (Vanderbilt-MED)

2014-10-02

The circadian control of cellular processes in cyanobacteria is regulated by a posttranslational oscillator formed by three Kai proteins. During the oscillator cycle, KaiA serves to promote autophosphorylation of KaiC while KaiB counteracts this effect. Here, we present a crystallographic structure of the wild-type Synechococcus elongatus KaiB and a cryo-electron microscopy (cryoEM) structure of a KaiBC complex. The crystal structure shows the expected dimer core structure and significant conformational variations of the KaiB C-terminal region, which is functionally important in maintaining rhythmicity. The KaiBC sample was formed with a C-terminally truncated form of KaiC, KaiC-Δ489, which is persistently phosphorylated. The KaiB–KaiC-Δ489 structure reveals that the KaiC hexamer can bind six monomers of KaiB, which form a continuous ring of density in the KaiBC complex. We performed cryoEM-guided molecular dynamics flexible fitting simulations with crystal structures of KaiB and KaiC to probe the KaiBC protein–protein interface. This analysis indicated a favorable binding mode for the KaiB monomer on the CII end of KaiC, involving two adjacent KaiC subunits and spanning an ATP binding cleft. A KaiC mutation, R468C, which has been shown to affect the affinity of KaiB for KaiC and lengthen the period in a bioluminescence rhythm assay, is found within the middle of the predicted KaiBC interface. The proposed KaiB binding mode blocks access to the ATP binding cleft in the CII ring of KaiC, which provides insight into how KaiB might influence the phosphorylation status of KaiC.

Interspecific variation in life history relates to antipredator decisions by marine mesopredators on temperate reefs.

Science.gov (United States)

Frid, Alejandro; Marliave, Jeff; Heithaus, Michael R

2012-01-01

As upper-level predatory fishes become overfished, mesopredators rise to become the new 'top' predators of over-exploited marine communities. To gain insight into ensuing mechanisms that might alter indirect species interactions, we examined how behavioural responses to an upper-level predatory fish might differ between mesopredator species with different life histories. In rocky reefs of the northeast Pacific Ocean, adult lingcod (Ophiodon elongatus) are upper-level predators that use a sit-and-wait hunting mode. Reef mesopredators that are prey to adult lingcod include kelp greenling (Hexagrammos decagrammus), younger lingcod, copper rockfish (Sebastes caurinus) and quillback rockfish (S. maliger). Across these mesopredators species, longevity and age at maturity increases and, consequently, the annual proportion of lifetime reproductive output decreases in the order just listed. Therefore, we hypothesized that the level of risk taken to acquire resources would vary interspecifically in that same order. During field experiments we manipulated predation risk with a model adult lingcod and used fixed video cameras to quantify interactions between mesopredators and tethered prey (Pandalus shrimps). We predicted that the probabilities of inspecting and attacking tethered prey would rank from highest to lowest and the timing of these behaviours would rank from earliest to latest as follows: kelp greenling, lingcod, copper rockfish, and quillback rockfish. We also predicted that responses to the model lingcod, such as avoidance of interactions with tethered prey, would rank from weakest to strongest in the same order. Results were consistent with our predictions suggesting that, despite occupying similar trophic levels, longer-lived mesopredators with late maturity have stronger antipredator responses and therefore experience lower foraging rates in the presence of predators than mesopredators with faster life histories. The corollary is that the fishery removal of top

Microhabitats de mosquitos (Diptera, Culicidae em internódios de taquara na Mata Atlântica, Paraná, Brasil Mosquitoes microhabitats (Diptera, Culicidae in bamboo internodes in Atlantic forest, Paraná, Brazil

Directory of Open Access Journals (Sweden)

Ana Leuch Lozovei

Full Text Available During two consecutive years, from January 1985 to December 1986, a comparative study of mosquitoes preferences for breeding habitat was carried out in the Atlantic Forest of the Serra do Mar, Paraná State, Brazil. To achieve it, 1875 bamboo internodes aligned vertically in live green, bamboo plants Merostachys speciosa Munro and Merostachys sp. were used, in which metabolic water was exuded from the plant itself, and presenting different size/pattern holes at their lateral walls, bored by the local sylvan fauna. Another group of 1200 individual internode traps was used as comparative element, carved out with a transversal cut by a saw, filled with local stream water and held in branches at different heights in the vegetal strata nearby. At both microhabitat types, a total of 17 culicid species was registered. Culex (Microculex neglectus Lutz, 1904, Cx. (Carrollia soperi Antunes & Lane, 1937, Sabethes (Sabethes batesi Lane & Cerqueira, 1942 and Sa. (Sabethinus melanonymphe (Dyar, 1924colonized exclusively live plant internodes, while Culex (Microculex elongatus Rozeboom & Lane, 1950, Cx. (Carrollia iridescens (Lutz, 1905, Cx. (Carrollia kompi Valencia,1973and Trichoprosopon (Trichoprosopon soaresi Dyar & Knab, 1907 bred only in internode traps. The remaining nine species colonized both habitats indistinctly. Quantitatively, was detected the abundance of 60.1% at live green internodes, against 39.9% for internode traps. Concerning the different patterns of bored live internode holes, 40.3% of the total computed specimens were collected in square or rectangular holes, 31.9% in two hole internodes, one minute circular, the other wider, and the remaining 28.8% of specimens distributed in other pattern type internodes. The mosquitoes breeding at these microhabitats fall in the culicid entomofauna specialized at locating and detecting peculiar and propitious mesogen conditions for breeding purposes.

Comparison of Chain-Length Preferences and Glucan Specificities of Isoamylase-Type α-Glucan Debranching Enzymes from Rice, Cyanobacteria, and Bacteria.

Directory of Open Access Journals (Sweden)

Taiki Kobayashi

Full Text Available It has been believed that isoamylase (ISA-type α-glucan debranching enzymes (DBEs play crucial roles not only in α-glucan degradation but also in the biosynthesis by affecting the structure of glucans, although molecular basis on distinct roles of the individual DBEs has not fully understood. In an attempt to relate the roles of DBEs to their chain-length specificities, we analyzed the chain-length distribution of DBE enzymatic reaction products by using purified DBEs from various sources including rice, cyanobacteria, and bacteria. When DBEs were incubated with phytoglycogen, their chain-length specificities were divided into three groups. First, rice endosperm ISA3 (OsISA3 and Eschericia coli GlgX (EcoGlgX almost exclusively debranched chains having degree of polymerization (DP of 3 and 4. Second, OsISA1, Pseudomonas amyloderamosa ISA (PsaISA, and rice pullulanase (OsPUL could debranch a wide range of chains of DP≧3. Third, both cyanobacteria ISAs, Cyanothece ATCC 51142 ISA (CytISA and Synechococcus elongatus PCC7942 ISA (ScoISA, showed the intermediate chain-length preference, because they removed chains of mainly DP3-4 and DP3-6, respectively, while they could also react to chains of DP5-10 and 7-13 to some extent, respectively. In contrast, all these ISAs were reactive to various chains when incubated with amylopectin. In addition to a great variation in chain-length preferences among various ISAs, their activities greatly differed depending on a variety of glucans. Most strikingly, cyannobacteria ISAs could attack branch points of pullulan to a lesser extent although no such activity was found in OsISA1, OsISA3, EcoGlgX, and PsaISA. Thus, the present study shows the high possibility that varied chain-length specificities of ISA-type DBEs among sources and isozymes are responsible for their distinct functions in glucan metabolism.

Molecular modeling and computational simulation of the photosystem-II reaction center to address isoproturon resistance in Phalaris minor.

Science.gov (United States)

Singh, Durg Vijay; Agarwal, Shikha; Kesharwani, Rajesh Kumar; Misra, Krishna

2012-08-01

Isoproturon is the only herbicide that can control Phalaris minor, a competitive weed of wheat that developed resistance in 1992. Resistance against isoproturon was reported to be due to a mutation in the psbA gene that encodes the isoproturon-binding D1 protein. Previously in our laboratory, a triazole derivative of isoproturon (TDI) was synthesized and found to be active against both susceptible and resistant biotypes at 0.5 kg/ha but has shown poor specificity. In the present study, both susceptible D1((S)), resistant D1((R)) and D2 proteins of the PS-II reaction center of P. minor have been modeled and simulated, selecting the crystal structure of PS-II from Thermosynechococcus elongatus (2AXT.pdb) as template. Loop regions were refined, and the complete reaction center D1/D2 was simulated with GROMACS in lipid (1-palmitoyl-2-oleoylglycero-3-phosphoglycerol, POPG) environment along with ligands and cofactor. Both S and R models were energy minimized using steepest decent equilibrated with isotropic pressure coupling and temperature coupling using a Berendsen protocol, and subjected to 1,000 ps of MD simulation. As a result of MD simulation, the best model obtained in lipid environment had five chlorophylls, two plastoquinones, two phenophytins and a bicarbonate ion along with cofactor Fe and oxygen evolving center (OEC). The triazole derivative of isoproturon was used as lead molecule for docking. The best worked out conformation of TDI was chosen for receptor-based de novo ligand design. In silico designed molecules were screened and, as a result, only those molecules that show higher docking and binding energies in comparison to isoproturon and its triazole derivative were proposed for synthesis in order to get more potent, non-resistant and more selective TDI analogs.

[Diversity and distribution of grasshoppers (Orthoptera: Acridoidea) in grasslands of the Southern Pampas region, Argentina].

Science.gov (United States)

Mariottini, Yanina; De Wysiecki, María Laura; Lange, Carlos Ernesto

2013-03-01

abundance and distribution. Covasacris pallidinota, Dichroplus elongatus, D. maculipennis, Borellia bruneri and B. pallida were the most widely distributed species, most of them (12) showed a restricted distribution and few (five) an intermediate distribution.

On the ultrafast kinetics of the energy and electron transfer reactions in photosystem I

Energy Technology Data Exchange (ETDEWEB)

Slavov, Chavdar Lyubomirov

2009-07-09

The subject of the current work is one of the main participants in the light-dependent phase of oxygenic photosynthesis, Photosystem I (PS I). This complex carries an immense number of cofactors: chlorophylls (Chl), carotenoids, quinones, etc, which together with the protein entity exhibit several exceptional properties. First, PS I has an ultrafast light energy trapping kinetics with a nearly 100% quantum efficiency. Secondly, both of the electron transfer branches in the reaction center are suggested to be active. Thirdly, there are some so called 'red' Chls in the antenna system of PS I, absorbing light with longer wavelengths than the reaction center. These 'red' Chls significantly modify the trapping kinetics of PS I. The purpose of this thesis is to obtain better understanding of the above-mentioned, specific features of PS I. This will not merely cast more light on the mechanisms of energy and electron transfer in the complex, but also will contribute to the future developments of optimized artificial light-harvesting systems. In the current work, a number of PS I complexes isolated from different organisms (Thermosynechococcus elongatus, Chlamydomonas reinhardtii, Arabidopsis thaliana) and possessing distinctive features (different macroorganisation, monomers, trimers, monomers with a semibelt of peripheral antenna attached; presence of 'red' Chls) is investigated. The studies are primarily focused on the electron transfer kinetics in each of the cofactor branches in the PS I reaction center, as well as on the effect of the antenna size and the presence of 'red' Chls on the trapping kinetics of PS I. These aspects are explored with the help of several ultrafast optical spectroscopy methods: (i) time-resolved fluorescence ? single photon counting and synchroscan streak camera; and (ii) ultrafast transient absorption. Physically meaningful information about the molecular mechanisms of the energy trapping in PS I is

Fossil and Genetic Evidence for the Polyphyletic Nature of the Planktonic Foraminifera "Globigerinoides", and Description of the New Genus Trilobatus

Science.gov (United States)

Spezzaferri, Silvia; Kucera, Michal; Pearson, Paul Nicholas; Wade, Bridget Susan; Rappo, Sacha; Poole, Christopher Robert; Morard, Raphaël; Stalder, Claudio

2015-01-01

Planktonic foraminifera are one of the most abundant and diverse protists in the oceans. Their utility as paleo proxies requires rigorous taxonomy and comparison with living and genetically related counterparts. We merge genetic and fossil evidence of “Globigerinoides”, characterized by supplementary apertures on spiral side, in a new approach to trace their “total evidence phylogeny” since their first appearance in the latest Paleogene. Combined fossil and molecular genetic data indicate that this genus, as traditionally understood, is polyphyletic. Both datasets indicate the existence of two distinct lineages that evolved independently. One group includes “Globigerinoides” trilobus and its descendants, the extant “Globigerinoides” sacculifer, Orbulina universa and Sphaeroidinella dehiscens. The second group includes the Globigerinoides ruber clade with the extant G. conglobatus and G. elongatus and ancestors. In molecular phylogenies, the trilobus group is not the sister taxon of the ruber group. The ruber group clusters consistently together with the modern Globoturborotalita rubescens as a sister taxon. The re-analysis of the fossil record indicates that the first “Globigerinoides” in the late Oligocene are ancestral to the trilobus group, whereas the ruber group first appeared at the base of the Miocene with representatives distinct from the trilobus group. Therefore, polyphyly of the genus "Globigerinoides" as currently defined can only be avoided either by broadening the genus concept to include G. rubescens and a large number of fossil species without supplementary apertures, or if the trilobus group is assigned to a separate genus. Since the former is not feasible due to the lack of a clear diagnosis for such a broad genus, we erect a new genus Trilobatus for the trilobus group (type species Globigerina triloba Reuss) and amend Globoturborotalita and Globigerinoides to clarify morphology and wall textures of these genera. In the new

The Canal da Piracema at Itaipu Dam as a fish pass system

Directory of Open Access Journals (Sweden)

Sérgio Makrakis

Full Text Available The Canal da Piracema is the longest (nearly 10 km fish pass system in the world. The construction of this fish pass was somehow controversial, because it connected two distinct ichthyofaunistic provinces. This study evaluated the ichthyofauna present in the Canal da Piracema and the abundance and distribution of long-distance migratory fish species along this fish pass system (evaluated possible selectivity. The Canal da Piracema was shown to be difficult to sample because of its environmental heterogeneity: artificial ponds, ladders and nature-like fish pass. To solve this problem, we used several fishing gears, adequate for the several biotopes present (unstructured and structured littoral were sampled with seining nets and electrofishing; lentic were sampled with gillnets and longlines (deeper areas; and rapid water areas were sampled with cast nets. The ichthyofauna of the Canal da Piracema followed the pattern for South America and the Paraná River, with a predominance of Characiformes and Siluriformes. The most representative families were Characidae, Anostomidae, Pimelodidae and Loricariidae. We captured 116 species (17 were long-distance migratory during the period studied. Small-sized species were predominant in unstructured and structured littoral areas, especially Bryconamericus exodon and Apareiodon affinis.The most abundant species was Hypostomus spp. in lentic areas, followed by Iheringichthys labrosus. Hoplias aff. malabaricus predominated in deeper lentic areas. Long-distance migratory species were abundant in rapid waters; they were Prochilodus lineatus and Leporinus elongatus. The sharp reduction in the number of species, including migratory ones, is an indication that the Canal da Piracema is selecting the species that ascend it. Therefore, the search for information on the efficiency of the various fish passes present in the Canal da Piracema is fundamental, to facilitate upward movements of fish. If this is reached, this

Identification and characterization of a carboxysomal γ-carbonic anhydrase from the cyanobacterium Nostoc sp. PCC 7120.

Science.gov (United States)

de Araujo, Charlotte; Arefeen, Dewan; Tadesse, Yohannes; Long, Benedict M; Price, G Dean; Rowlett, Roger S; Kimber, Matthew S; Espie, George S

2014-09-01

Carboxysomes are proteinaceous microcompartments that encapsulate carbonic anhydrase (CA) and ribulose 1,5-bisphosphate carboxylase/oxygenase (Rubisco); carboxysomes, therefore, catalyze reversible HCO3 (-) dehydration and the subsequent fixation of CO2. The N- and C-terminal domains of the β-carboxysome scaffold protein CcmM participate in a network of protein-protein interactions that are essential for carboxysome biogenesis, organization, and function. The N-terminal domain of CcmM in the thermophile Thermosynechococcus elongatus BP-1 is also a catalytically active, redox regulated γ-CA. To experimentally determine if CcmM from a mesophilic cyanobacterium is active, we cloned, expressed and purified recombinant, full-length CcmM from Nostoc sp. PCC 7120 as well as the N-terminal 209 amino acid γ-CA-like domain. Both recombinant proteins displayed ethoxyzolamide-sensitive CA activity in mass spectrometric assays, as did the carboxysome-enriched TP fraction. NstCcmM209 was characterized as a moderately active and efficient γ-CA with a k cat of 2.0 × 10(4) s(-1) and k cat/K m of 4.1 × 10(6) M(-1) s(-1) at 25 °C and pH 8, a pH optimum between 8 and 9.5 and a temperature optimum spanning 25-35 °C. NstCcmM209 also catalyzed the hydrolysis of the CO2 analog carbonyl sulfide. Circular dichroism and intrinsic tryptophan fluorescence analysis demonstrated that NstCcmM209 was progressively and irreversibly denatured above 50 °C. NstCcmM209 activity was inhibited by the reducing agent tris(hydroxymethyl)phosphine, an effect that was fully reversed by a molar excess of diamide, a thiol oxidizing agent, consistent with oxidative activation being a universal regulatory mechanism of CcmM orthologs. Immunogold electron microscopy and Western blot analysis of TP pellets indicated that Rubisco and CcmM co-localize and are concentrated in Nostoc sp. PCC 7120 carboxysomes.

Identification of residues important for the activity of aldehyde-deformylating oxygenase through investigation into the structure-activity relationship.

Science.gov (United States)

Wang, Qing; Bao, Luyao; Jia, Chenjun; Li, Mei; Li, Jian-Jun; Lu, Xuefeng

2017-03-16

Aldehyde-deformylating oxygenase (ADO) is a key enzyme involved in the biosynthetic pathway of fatty alk(a/e)nes in cyanobacteria. However, cADO (cyanobacterial ADO) showed extreme low activity with the k cat value below 1 min -1 , which would limit its application in biofuel production. To identify the activity related key residues of cADO is urgently required. The amino acid residues which might affect cADO activity were identified based on the crystal structures and sequence alignment of cADOs, including the residues close to the di-iron center (Tyr39, Arg62, Gln110, Tyr122, Asp143 of cADO-1593), the protein surface (Trp 178 of cADO-1593), and those involved in two important hydrogen bonds (Gln49, Asn123 of cADO-1593, and Asp49, Asn123 of cADO-sll0208) and in the oligopeptide whose conformation changed in the absence of the di-iron center (Leu146, Asn149, Phe150 of cADO-1593, and Thr146, Leu148, Tyr150 of cADO-sll0208). The variants of cADO-1593 from Synechococcus elongatus PCC7942 and cADO-sll0208 from Synechocystis sp. PCC6803 were constructed, overexpressed, purified and kinetically characterized. The k cat values of L146T, Q49H/N123H/F150Y and W178R of cADO-1593 and L148R of cADO-sll0208 were increased by more than two-fold, whereas that of R62A dropped by 91.1%. N123H, Y39F and D143A of cADO-1593, and Y150F of cADO-sll0208 reduced activities by ≤ 20%. Some important amino acids, which exerted some effects on cADO activity, were identified. Several enzyme variants exhibited greatly reduced activity, while the k cat values of several mutants are more than two-fold higher than the wild type. This study presents the report on the relationship between amino acid residues and enzyme activity of cADOs, and the information will provide a guide for enhancement of cADO activity through protein engineering.

Gene Expression Measurement Module (GEMM) - A Fully Automated, Miniaturized Instrument for Measuring Gene Expression in Space

Science.gov (United States)

Pohorille, Andrew; Peyvan, Kia; Karouia, Fathi; Ricco, Antonio

2012-01-01

The capability to measure gene expression on board spacecraft opens the door to a large number of high-value experiments on the influence of the space environment on biological systems. For example, measurements of gene expression will help us to understand adaptation of terrestrial life to conditions beyond the planet of origin, identify deleterious effects of the space environment on a wide range of organisms from microbes to humans, develop effective countermeasures against these effects, and determine the metabolic bases of microbial pathogenicity and drug resistance. These and other applications hold significant potential for discoveries in space biology, biotechnology, and medicine. Supported by funding from the NASA Astrobiology Science and Technology Instrument Development Program, we are developing a fully automated, miniaturized, integrated fluidic system for small spacecraft capable of in-situ measurement of expression of several hundreds of microbial genes from multiple samples. The instrument will be capable of (1) lysing cell walls of bacteria sampled from cultures grown in space, (2) extracting and purifying RNA released from cells, (3) hybridizing the RNA on a microarray and (4) providing readout of the microarray signal, all in a single microfluidics cartridge. The device is suitable for deployment on nanosatellite platforms developed by NASA Ames' Small Spacecraft Division. To meet space and other technical constraints imposed by these platforms, a number of technical innovations are being implemented. The integration and end-to-end technological and biological validation of the instrument are carried out using as a model the photosynthetic bacterium Synechococcus elongatus, known for its remarkable metabolic diversity and resilience to adverse conditions. Each step in the measurement process-lysis, nucleic acid extraction, purification, and hybridization to an array-is assessed through comparison of the results obtained using the instrument with

Secondary structural entropy in RNA switch (Riboswitch) identification.

Science.gov (United States)

Manzourolajdad, Amirhossein; Arnold, Jonathan

2015-04-28

RNA regulatory elements play a significant role in gene regulation. Riboswitches, a widespread group of regulatory RNAs, are vital components of many bacterial genomes. These regulatory elements generally function by forming a ligand-induced alternative fold that controls access to ribosome binding sites or other regulatory sites in RNA. Riboswitch-mediated mechanisms are ubiquitous across bacterial genomes. A typical class of riboswitch has its own unique structural and biological complexity, making de novo riboswitch identification a formidable task. Traditionally, riboswitches have been identified through comparative genomics based on sequence and structural homology. The limitations of structural-homology-based approaches, coupled with the assumption that there is a great diversity of undiscovered riboswitches, suggests the need for alternative methods for riboswitch identification, possibly based on features intrinsic to their structure. As of yet, no such reliable method has been proposed. We used structural entropy of riboswitch sequences as a measure of their secondary structural dynamics. Entropy values of a diverse set of riboswitches were compared to that of their mutants, their dinucleotide shuffles, and their reverse complement sequences under different stochastic context-free grammar folding models. Significance of our results was evaluated by comparison to other approaches, such as the base-pairing entropy and energy landscapes dynamics. Classifiers based on structural entropy optimized via sequence and structural features were devised as riboswitch identifiers and tested on Bacillus subtilis, Escherichia coli, and Synechococcus elongatus as an exploration of structural entropy based approaches. The unusually long untranslated region of the cotH in Bacillus subtilis, as well as upstream regions of certain genes, such as the sucC genes were associated with significant structural entropy values in genome-wide examinations. Various tests show that there

Bioremediation/Biorecovery of uranium from aquatic resource/waste: the Cyano-Deino story

International Nuclear Information System (INIS)

Apte, Shree Kumar

2015-01-01

Terrestrial sources of uranium are getting depleted fast and may be exhausted in the next few decades. This has triggered a search for alternate or secondary resources for this precious metal. Nearly 4.5 billion tons of uranium on our planet resides in seawater, albeit at very low concentrations of 3 ppb. Recovering uranium from such low concentrations is a major challenge. Two marine cyanobacteria, the unicellular Synechococcus elongatus and the filamentous Anabaena torulosa, were found to be capable of rapidly sequestering uranyl carbonate (the predominant uranyl species at the sea-water pH of 7.8) from aqueous solutions, including simulated sea-water. While Synechococcus strain adsorbed the metal as carbonato complexes on cell surface ligands, A. torulosa trapped it in novel surface-associated polyphosphate bodies. The uranium binding potential of cyanobacterial biomass was comparable to, if not better than, the currently in use polyamidoxime resin. The bound uranium could be desorbed easily and the biomass reused a few times. The method has eminently higher application potential in uranium-contaminated terrestrial waters, where the metal concentration is several times higher. Low concentrations (<1 to few mM) of uranium are also found in acidic/alkaline nuclear waste and arise from metal extraction or during reprocessing of fuel. Removal of uranium from such solutions is very desirable for safer disposal of such waste. Biological agents to be employed in such situations also need to be tolerant to and stable in high radiation environments, unless dead cells can be used. To address such bioremediation, the extremely radio-resistant microbe Deinococcus radiodurans was genetically engineered to express either a non-specific acid phosphatase PhoN or a highly active novel alkaline phosphatase PhoK. Apart from the need for high expression of desired protein, such engineering is also fraught with problems of stability, localization and activity of the expressed

Engineering Cyanobacterial Cell Morphology for Enhanced Recovery and Processing of Biomass.

Science.gov (United States)

Jordan, Adam; Chandler, Jenna; MacCready, Joshua S; Huang, Jingcheng; Osteryoung, Katherine W; Ducat, Daniel C

2017-05-01

Cyanobacteria are emerging as alternative crop species for the production of fuels, chemicals, and biomass. Yet, the success of these microbes depends on the development of cost-effective technologies that permit scaled cultivation and cell harvesting. Here, we investigate the feasibility of engineering cell morphology to improve biomass recovery and decrease energetic costs associated with lysing cyanobacterial cells. Specifically, we modify the levels of Min system proteins in Synechococcus elongatus PCC 7942. The Min system has established functions in controlling cell division by regulating the assembly of FtsZ, a tubulin-like protein required for defining the bacterial division plane. We show that altering the expression of two FtsZ-regulatory proteins, MinC and Cdv3, enables control over cell morphology by disrupting FtsZ localization and cell division without preventing continued cell growth. By varying the expression of these proteins, we can tune the lengths of cyanobacterial cells across a broad dynamic range, anywhere from an ∼20% increased length (relative to the wild type) to near-millimeter lengths. Highly elongated cells exhibit increased rates of sedimentation under low centrifugal forces or by gravity-assisted settling. Furthermore, hyperelongated cells are also more susceptible to lysis through the application of mild physical stress. Collectively, these results demonstrate a novel approach toward decreasing harvesting and processing costs associated with mass cyanobacterial cultivation by altering morphology at the cellular level. IMPORTANCE We show that the cell length of a model cyanobacterial species can be programmed by rationally manipulating the expression of protein factors that suppress cell division. In some instances, we can increase the size of these cells to near-millimeter lengths with this approach. The resulting elongated cells have favorable properties with regard to cell harvesting and lysis. Furthermore, cells treated in this

Dephosphorylation of the Core Clock Protein KaiC in the Cyanobacterial KaiABC Circadian Oscillator Proceeds via an ATP Synthase Mechanism

Energy Technology Data Exchange (ETDEWEB)

Egli, Martin; Mori, Tetsuya; Pattanayek, Rekha; Xu, Yao; Qin, Ximing; Johnson, Carl H. (Vanderbilt)

2014-10-02

The circadian clock of the cyanobacterium Synechococcus elongatus can be reconstituted in vitro from three proteins, KaiA, KaiB, and KaiC in the presence of ATP, to tick in a temperature-compensated manner. KaiC, the central cog of this oscillator, forms a homohexamer with 12 ATP molecules bound between its N- and C-terminal domains and exhibits unusual properties. Both the N-terminal (CI) and C-terminal (CII) domains harbor ATPase activity, and the subunit interfaces between CII domains are the sites of autokinase and autophosphatase activities. Hydrolysis of ATP correlates with phosphorylation at threonine and serine sites across subunits in an orchestrated manner, such that first T432 and then S431 are phosphorylated, followed by dephosphorylation of these residues in the same order. Although structural work has provided insight into the mechanisms of ATPase and kinase, the location and mechanism of the phosphatase have remained enigmatic. From the available experimental data based on a range of approaches, including KaiC crystal structures and small-angle X-ray scattering models, metal ion dependence, site-directed mutagenesis (i.e., E318, the general base), and measurements of the associated clock periods, phosphorylation patterns, and dephosphorylation courses as well as a lack of sequence motifs in KaiC that are typically associated with known phosphatases, we hypothesized that KaiCII makes use of the same active site for phosphorylation and dephosphorlyation. We observed that wild-type KaiC (wt-KaiC) exhibits an ATP synthase activity that is significantly reduced in the T432A/S431A mutant. We interpret the first observation as evidence that KaiCII is a phosphotransferase instead of a phosphatase and the second that the enzyme is capable of generating ATP, both from ADP and P{sub i} (in a reversal of the ATPase reaction) and from ADP and P-T432/P-S431 (dephosphorylation). This new concept regarding the mechanism of dephosphorylation is also supported by the

Gene Expression Measurement Module (GEMM) - a fully automated, miniaturized instrument for measuring gene expression in space

Science.gov (United States)

Karouia, Fathi; Ricco, Antonio; Pohorille, Andrew; Peyvan, Kianoosh

2012-07-01

The capability to measure gene expression on board spacecrafts opens the doors to a large number of experiments on the influence of space environment on biological systems that will profoundly impact our ability to conduct safe and effective space travel, and might also shed light on terrestrial physiology or biological function and human disease and aging processes. Measurements of gene expression will help us to understand adaptation of terrestrial life to conditions beyond the planet of origin, identify deleterious effects of the space environment on a wide range of organisms from microbes to humans, develop effective countermeasures against these effects, determine metabolic basis of microbial pathogenicity and drug resistance, test our ability to sustain and grow in space organisms that can be used for life support and in situ resource utilization during long-duration space exploration, and monitor both the spacecraft environment and crew health. These and other applications hold significant potential for discoveries in space biology, biotechnology and medicine. Accordingly, supported by funding from the NASA Astrobiology Science and Technology Instrument Development Program, we are developing a fully automated, miniaturized, integrated fluidic system for small spacecraft capable of in-situ measuring microbial expression of thousands of genes from multiple samples. The instrument will be capable of (1) lysing bacterial cell walls, (2) extracting and purifying RNA released from cells, (3) hybridizing it on a microarray and (4) providing electrochemical readout, all in a microfluidics cartridge. The prototype under development is suitable for deployment on nanosatellite platforms developed by the NASA Small Spacecraft Office. The first target application is to cultivate and measure gene expression of the photosynthetic bacterium Synechococcus elongatus, i.e. a cyanobacterium known to exhibit remarkable metabolic diversity and resilience to adverse conditions

Spectroscopic properties of reaction center pigments in photosystem II core complexes: revision of the multimer model.

Science.gov (United States)

Raszewski, Grzegorz; Diner, Bruce A; Schlodder, Eberhard; Renger, Thomas

2008-07-01

Absorbance difference spectra associated with the light-induced formation of functional states in photosystem II core complexes from Thermosynechococcus elongatus and Synechocystis sp. PCC 6803 (e.g., P(+)Pheo(-),P(+)Q(A)(-),(3)P) are described quantitatively in the framework of exciton theory. In addition, effects are analyzed of site-directed mutations of D1-His(198), the axial ligand of the special-pair chlorophyll P(D1), and D1-Thr(179), an amino-acid residue nearest to the accessory chlorophyll Chl(D1), on the spectral properties of the reaction center pigments. Using pigment transition energies (site energies) determined previously from independent experiments on D1-D2-cytb559 complexes, good agreement between calculated and experimental spectra is obtained. The only difference in site energies of the reaction center pigments in D1-D2-cytb559 and photosystem II core complexes concerns Chl(D1). Compared to isolated reaction centers, the site energy of Chl(D1) is red-shifted by 4 nm and less inhomogeneously distributed in core complexes. The site energies cause primary electron transfer at cryogenic temperatures to be initiated by an excited state that is strongly localized on Chl(D1) rather than from a delocalized state as assumed in the previously described multimer model. This result is consistent with earlier experimental data on special-pair mutants and with our previous calculations on D1-D2-cytb559 complexes. The calculations show that at 5 K the lowest excited state of the reaction center is lower by approximately 10 nm than the low-energy exciton state of the two special-pair chlorophylls P(D1) and P(D2) which form an excitonic dimer. The experimental temperature dependence of the wild-type difference spectra can only be understood in this model if temperature-dependent site energies are assumed for Chl(D1) and P(D1), reducing the above energy gap from 10 to 6 nm upon increasing the temperature from 5 to 300 K. At physiological temperature, there are

Diversidad y distribución de acridios (Orthoptera: Acridoidea en pastizales del sur de la región pampeana, Argentina Diversity and distribution of grasshoppers (Orthoptera: Acridoidea in grasslands of the Southern Pampas region, Argentina

Directory of Open Access Journals (Sweden)

Yanina Mariottini

2013-03-01

species of grasshoppers were collected, of which 21 belong to the family Acrididae. The subfamily Melanoplinae was the most diverse with eight species. The largest species richness was recorded in native grasslands (18. The different communities of grasshoppers had similar indices of evenness and dominance (p>0.05. Considering all plant communities, the average value of Shannon-Wiener index was 1.58±0.075. There was a positive correlation between evenness index and species richness (p<0.05. The diversity index H’ was different between plants communities (p<0.05, and it was higher in the disturbed grassland (1.75±0.096, p<0.05 than in the halophilous grasslands (1.34±0.12. Native and disturbed grasslands had a higher plant richness than halophilous grasslands and implanted pastures (p<0.05. There was a positive relationship between plant richness and grasshoppers species richness, and diversity of grasshoppers. According to the qualitative indices applied, the similitude between different grasshopper communities was higher than 60%. In general, the species that had a higher frequency of occurrence showed greater abundance and distribution. Covasacris pallidinota, Dichroplus elongatus, D. maculipennis, Borellia bruneri and B. pallid were the most widely distributed species, most of them (12 showed a restricted distribution and few (five an intermediate distribution.

Desarrollo post-embrionario, fecundidad y consumo de alimento de Dichroplus exilis (Orthoptera: Acrididae bajo condiciones controladas

Directory of Open Access Journals (Sweden)

Christian Bardi

2011-12-01

Full Text Available La Subfamilia Melanoplinae tiene una relevancia central dentro de la acridiofauna Argentina. Varias especies suelen ser numéricamente dominantes en las comunidades de acridios del país y algunas constituyen serias plagas. El objetivo de este trabajo fue conocer el ciclo de vida postembrionario, la fecundidad y supervivencia de las hembras y el consumo de alimento de Dichruplus exilis bajo condiciones controladas (30°C; 40%HR y 14L-10O. Para ello se realizó el seguimiento de tres cohortes de 16, 17 y 20 individuos. El tiempo de incubación fue de 14.4±1.08 días. La duración del desarrollo ninfal fue 41.38; 0.71 días (I 8.73; 0.20, II 6.38; 0.24, III 5.64; 0.33, IV 7.15; 0.43, V 9.76; 0.54; IV 7.85; 0.95; la fecundidad promedio fue de 381.84, 38.54huevos/hembra. El consumo registrado fue de 9.89; 1.08 (mg/ind./día para las ninfas de IV, 18.04; 0.73 (mg/ind./día para las de V y IV, mientras que el consumo promedio de los adultos, sin diferenciar sexo y estado reproductivo, fue de 16.41; 4.32mg/día. Estos parámetros, al ser comparados con los de otras especies afines, indican que D. exilis exhibe atributos biológicos que condicen con los de otros melanoplinos considerados plaga.Postembryonic development, fecundity and food consumption of Dichroplus exilis (Orthoptera: Acrididae under controlled conditions. Dichroplus exilis is a widely distributed species in Southern South America. Although there have been reports of D. exilis as an agricultural pest, some recent observations suggest that the damage attributed to D. elongatus may actually have been caused by D. exilis. This study was conducted to determine the postembryonic life cycle stages, fertility and food consumption of this species under controlled conditions (30°C, 14L-10D, 40% RH.Individuals employed belong to the laboratory-hatched first generation (F1, from adults (n=64, ♀=28, ♂=36 collected in natural grasslands near Rafaela, Santa Fe province in North- Eastern

A taxonomic monograph of the genus Tylodinus Champion (Coleoptera: Curculionidae: Cryptorhynchinae: Tylodina) of Chiapas, Mexico.

Science.gov (United States)

Luna-Cozar, Jesús; Anderson, Robert S; Jones, Robert W; León-Corté, Jorge L

2014-04-15

nodulosus species group (3) T. andersoni new species (Chiapas, Ángel Albino Corzo, Reserva El Triunfo, Polígono 1), T. nodulosus (Boheman), T. zilchi Kuschel; Tylodinus pusillus species group (2) T. porvenirensis new species (type locality: Chiapas, El Porvenir, El Porvenir (2 km NE)), T. pusillus new species (type locality: Chiapas, 4 km SE Custepec); Tylodinus spiniventris species group (2) T. lum new species (Chiapas, San Cristóbal de las Casas, Cerro Huitepec), and T. spiniventris new species (type locality: Chiapas, San Cristóbal de las Casas, Reserva Huitepec); Incertae sedis (13) T. pinguis new species (type locality: Chiapas, Ángel Albino Corzo, Reserva El Triunfo, Polígono 1) , T. kissingeri new species (type locality: Chiapas, Tapalapa, ca. 14 km NE Coapilla), T. complicatus new species (type locality: Chiapas, Pueblo Nuevo Solistahuacán, La Yerbabuena), T. dominicus new species (type locality: Chiapas, Villa Corzo, Reserva de la Biósfera La Sepultura), T. noctis new species (type locality: Chiapas, Coapilla, ca. 10.5 km NE Coapilla), T. rufus new species (type locality: Chiapas, San Cristóbal de las Casas, Cerro Huitepec); T. branstetteri new species (type locality: Chiapas, La Concordia, 4 km SE Custepec), T. kuscheli new species (type locality: Chiapas, Villa Flores, Ejido Sierra Morena), T. pappi new species (type locality: Chiapas, Unión Juárez, Volcán Tacan), T. gibbosus new species (type locality: Chiapas, Pueblo Nuevo Solistahuacán, Yerbabuena Reserve), T. immundus new species (type locality: Chiapas, San Cristóbal de las Casas Cerro Huitepec), T. intzin new species (type locality: Chiapas, Tenejapa, Yashanal), T. elongatus new species (type locality: Chiapas, Ángel Albino Corzo, Reserva El Triunfo, Polígono 1). Three species (T. nodulosus (Boheman), T. zilchi Kuschel and T. cavicrus Champion) are not known to occur in Chiapas but were included in this study to be more representative of inter- and intraspecific variation and to provide a

Hydrogen from Water in a Novel Recombinant Cyanobacterial System

Energy Technology Data Exchange (ETDEWEB)

Weyman, Philip D [J. Craig Venter Institute; Smith, Hamillton O.

2014-12-03

established. In the course of this work, we identified a new hydrogenase from environmental DNA sequence and successfully expressed it in a variety of hosts including cyanobacteria. This was one of the first examples of these complicated enzymes being moved across vastly different bacterial species and is the first example of a hydrogenase being “brought to life” from no other information than a DNA sequence from metagenomic data. The hydrogenase we identified had the molecular signature of other O2-tolerant hydrogenases, and we discovered that the resulting enzyme had exceptionally high oxygen- and thermo-tolerance. The new enzyme retained 80% of its activity after incubation at 80° C for 2 hours and retained 20% activity in 1% O2. We performed detailed analysis on the maturation genes required for construction of a functional enzyme of this class of hydrogenase, and found that seven additional maturation genes were required for minimal activity and a total of nine genes besides the hydrogenase were required for optimal maturation efficiency. Furthermore, we demonstrated that the maturation genes are functional on closely-related hydrogenase enzymes such as those from Alteromonas macleodii and Thiocapsa roseopersicina. Finally, we have extensively modified the hydrogenase to engineer new traits including higher H2 production and better interaction with electron donors. For example, combining two strategies increased hydrogenase activity in cyanobacteria by at least 20-fold over our initial expression level. The activity of this combined strain is almost twice that of the native hydrogenase activity in S. elongatus. This work validates the idea that these enzymes are broadly tolerant to modifications that may help integrate them into a successful photobiological H2 production system. While we did not achieve our ultimate goal of integrating the functional hydrogenase with the cyanobacterial photosynthetic apparatus, the work on this project has led to significant

A systematic revision of Operclipygus Marseul (Coleoptera, Histeridae, Exosternini

Directory of Open Access Journals (Sweden)

Michael Caterino

2013-02-01

., O. hamistrius (Schmidt, 1893 comb. n., O. impressicollis sp. n., O. intersectus sp. n., O. montanus sp. n., O. nubosus sp. n., O. pichinchensis sp. n., O. propinquus sp. n., O. quinquestriatus sp. n., O. rubidus (Hinton, 1935 comb. n., O. rufescens sp. n., O. troglodytes sp. n.], O. plicicollis group [O. cephalicus sp. n., O. longidens sp. n., O. plicicollis (Schmidt, 1893], O. fossipygus group [O. disconnectus sp. n., O. fossipygus (Wenzel, 1944, O. foveipygus (Bickhardt, 1918, O. fungicolus (Wenzel & Dybas, 1941, O. gibbulus (Schmidt, 1889 comb. n., O. olivensis sp. n., O. simplicipygus sp. n., O. subdepressus (Schmidt, 1889, O. therondi (Wenzel, 1976], O. impunctipennis group [O. chamelensis sp. n., O. foveiventris sp. n., O. granulipectus sp. n., O. impunctipennis (Hinton, 1935 comb. n., O. latifoveatus sp. n., O. lissipygus sp. n., O. maesi sp. n., O. mangiferus sp. n., O. marginipennis sp. n., O. nicodemus sp. n., O. nitidus sp. n., O. pacificus sp. n., O. pauperculus sp. n., O. punctissipygus sp. n., O. subviridis sp. n., O. tripartitus sp. n., O. vorax sp. n.], O. marginellus group [O. ashei sp. n., O. baylessae sp. n., O. dentatus sp. n., O. formicatus sp. n., O. hintoni sp. n., O. marginellus (J.E. LeConte, 1860 comb. n., O. orchidophilus sp. n., O. selvorum sp. n., O. striatellus (Fall, 1917 comb. n.], incertae sedis: O. teapensis (Marseul, 1853 comb. n., O. punctulatus sp. n., O. lama Mazur, 1988, O. florifaunensis sp. n., O. bosquesecus sp. n., O. arnaudi Dégallier, 1982, O. subsphaericus sp. n., O. latipygus sp. n., O. elongatus sp. n., O. rupicolus sp. n., O. punctipleurus sp. n., O. falini sp. n., O. peregrinus sp. n., O. brooksi sp. n., O. profundipygus sp. n., O. punctatissimus sp. n., O. cavisternus sp. n., O. siluriformis sp. n., O. parallelus sp. n., O. abbreviatus sp. n., O. pygidialis (Lewis, 1908, O. faltistrius sp. n., O. limonensis sp. n., O. wenzeli sp. n., O. iheringi (Bickhardt, 1917, O. angustisternus (Wenzel, 1944, O. shorti sp. n. We