WorldWideScience

Sample records for annona cherimola mill

  1. Nutritional and phytochemical composition of Annona cherimola Mill. fruits and by-products: Potential health benefits.

    Science.gov (United States)

    Albuquerque, Tânia Gonçalves; Santos, Filipa; Sanches-Silva, Ana; Beatriz Oliveira, M; Bento, Ana Cristina; Costa, Helena S

    2016-02-15

    Annona cherimola Mill., commonly known as cherimoya, is a tropical fruit well known due to its tasty flavour. In the present study the antioxidant activity of pulp, peel and seeds of four cultivars from A. cherimola Mill. from Madeira Island (Madeira, Funchal, Perry Vidal and Mateus II) was analysed. Moreover, nutritional composition (proximates and vitamins) and bioactive compounds content were determined. The peel of Madeira cultivar showed the highest antioxidant capacity, with an EC50 of 0.97mg/mL, and total flavonoids (44.7 epicatechin equivalents/100g). The most abundant carotenoid was lutein, with values ranging from 129 to 232μg/100g. The highest l-ascorbic acid content (4.41mg/100g) was found in the peel of Perry Vidal cultivar. These results highlight A. cherimola Mill. antioxidant properties, especially in its by-products and encourage their application in cosmetic, pharmaceutical and food processing industries, as added value natural extracts. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. A Mesoamerican origin of cherimoya (Annona cherimola Mill.): Implications for the conservation of plant genetic resources.

    Science.gov (United States)

    Larranaga, N; Albertazzi, F J; Fontecha, G; Palmieri, M; Rainer, H; van Zonneveld, M; Hormaza, J I

    2017-08-01

    Knowledge on the structure and distribution of genetic diversity is a key aspect to plan and execute an efficient conservation and utilization of the genetic resources of any crop as well as for determining historical demographic inferences. In this work, a large data set of 1,765 accessions of cherimoya (Annona cherimola Mill, Annonaceae), an underutilized fruit tree crop native to the Neotropics and used as a food source by pre-Columbian cultures, was collected from six different countries across the American continent and amplified with nine highly informative microsatellite markers. The structure analyses, fine representation of the genetic diversity and an ABC approach suggest a Mesoamerican origin of the crop, contrary to previous reports, with clear implications for the dispersion of plant germplasm between Central and South America in pre-Columbian times. These results together with the potential distribution of the species in a climatic change context using two different climate models provide new insights for the history and conservation of extant genetic resources of cherimoya that can be applied to other currently underutilized woody perennial crops. © 2017 John Wiley & Sons Ltd.

  3. Micropropagation and determination of the in vitro stability of Annona cherimola Mill. and Annona muricata L.

    OpenAIRE

    Bridg, Hannia

    2000-01-01

    A. cherimola und A. muricata sind als Halblaubbäume in den tropischen Hochländern Südamerikas und besonders auf den Karibischen Inseln endemisch. Beide besitzen ein großes Potential als Handelsfrüchte aufgrund ihrer wohlschmeckenden Früchte und ihrer Eigenschaften als Heilpflanzen. Die Forschung über diese Obstarten wurde in Kolumbien, Peru, Ekuador, Venezuela und in der Dominikanischen Republik vernachlässigt. Deshalb sollte die wissenschaftliche Bearbeitung, das Sammeln, die Konservieru...

  4. A catechol oxidase AcPPO from cherimoya (Annona cherimola Mill.) is localized to the Golgi apparatus

    NARCIS (Netherlands)

    Olmedo, Patricio; Moreno, Adrián A.; Sanhueza, Dayan; Balic, Iván; Silva-Sanzana, Christian; Zepeda, Baltasar; Verdonk, Julian C.; Arriagada, César; Meneses, Claudio; Campos-Vargas, Reinaldo

    2018-01-01

    Cherimoya (Annona cherimola) is an exotic fruit with attractive organoleptic characteristics. However, it is highly perishable and susceptible to postharvest browning. In fresh fruit, browning is primarily caused by the polyphenol oxidase (PPO) enzyme catalyzing the oxidation of o-diphenols to

  5. Pollen development in Annona cherimola Mill. (Annonaceae. Implications for the evolution of aggregated pollen

    Directory of Open Access Journals (Sweden)

    Hormaza Jose I

    2009-10-01

    Full Text Available Abstract Background In most flowering plants, pollen is dispersed as monads. However, aggregated pollen shedding in groups of four or more pollen grains has arisen independently several times during angiosperm evolution. The reasons behind this phenomenon are largely unknown. In this study, we followed pollen development in Annona cherimola, a basal angiosperm species that releases pollen in groups of four, to investigate how pollen ontogeny may explain the rise and establishment of this character. We followed pollen development using immunolocalization and cytochemical characterization of changes occurring from anther differentiation to pollen dehiscence. Results Our results show that, following tetrad formation, a delay in the dissolution of the pollen mother cell wall and tapetal chamber is a key event that holds the four microspores together in a confined tapetal chamber, allowing them to rotate and then bind through the aperture sites through small pectin bridges, followed by joint sporopollenin deposition. Conclusion Pollen grouping could be the result of relatively minor ontogenetic changes beneficial for pollen transfer or/and protection from desiccation. Comparison of these events with those recorded in the recent pollen developmental mutants in Arabidopsis indicates that several failures during tetrad dissolution may convert to a common recurring phenotype that has evolved independently several times, whenever this grouping conferred advantages for pollen transfer.

  6. Pollen development in Annona cherimola Mill. (Annonaceae). Implications for the evolution of aggregated pollen

    Science.gov (United States)

    Lora, Jorge; Testillano, Pilar S; Risueño, Maria C; Hormaza, Jose I; Herrero, Maria

    2009-01-01

    Background In most flowering plants, pollen is dispersed as monads. However, aggregated pollen shedding in groups of four or more pollen grains has arisen independently several times during angiosperm evolution. The reasons behind this phenomenon are largely unknown. In this study, we followed pollen development in Annona cherimola, a basal angiosperm species that releases pollen in groups of four, to investigate how pollen ontogeny may explain the rise and establishment of this character. We followed pollen development using immunolocalization and cytochemical characterization of changes occurring from anther differentiation to pollen dehiscence. Results Our results show that, following tetrad formation, a delay in the dissolution of the pollen mother cell wall and tapetal chamber is a key event that holds the four microspores together in a confined tapetal chamber, allowing them to rotate and then bind through the aperture sites through small pectin bridges, followed by joint sporopollenin deposition. Conclusion Pollen grouping could be the result of relatively minor ontogenetic changes beneficial for pollen transfer or/and protection from desiccation. Comparison of these events with those recorded in the recent pollen developmental mutants in Arabidopsis indicates that several failures during tetrad dissolution may convert to a common recurring phenotype that has evolved independently several times, whenever this grouping conferred advantages for pollen transfer. PMID:19874617

  7. Mineral composition, nutritional properties, total phenolics and flavonoids compounds of the atemoya fruit (Annona squamosa L. x Annona cherimola Mill.) and evaluation using multivariate analysis techniques.

    Science.gov (United States)

    Santos, Walter N L Dos; Sauthier, Maria Celeste S; Cavalcante, Dannuza D; Benevides, Clícia M J; Dias, Fábio S; Santos, Daniele C M B

    2016-09-01

    The atemoya is a hybrid fruit obtained by crossing of cherimoya (Annona cherimola Mill.) with sweet sop (Annona squamosa L.). The information about chemical composition of atemoya is scarce. The mineral composition was evaluated employing Inductively Coupled Plasma Optical Emission Spectrometry (ICP OES) and the centesimal composition and the physico-chemical parameters were assessed employing procedures described in the AOAC methods. The total phenolic compounds (TPC) and total flavonoids (TF) were determined using spectroanalytical methods. Considering the Reference Daily Intake (RDI), the concentrations of K, Cu and Vitamin C found in atemoya were the highest, representing about 32, 23 and 37% of the RDI, respectively. The total carbohydrates were 32 g 100g-1 and the soluble solids was equivalent to (32.50 ± 0.03) °Brix. The result for TPC was 540.47 ± 2.32 mgGAE 100 g-1 and the TF was 11.56 ± 1.36 mgQE 100 g-1. The exploratory evaluation of 42 atemoya samples was performed through Principal Component Analysis (PCA), which discriminated green and ripe fruits according to their mineral composition. The elements that contributed most for the variability between green and ripe fruits were: Ba, Ca, Cu, K, Mg and P.

  8. Mineral composition, nutritional properties, total phenolics and flavonoids compounds of the atemoya fruit (Annona squamosa L. x Annona cherimola Mill. and evaluation using multivariate analysis techniques

    Directory of Open Access Journals (Sweden)

    WALTER N.L. DOS SANTOS

    2016-01-01

    Full Text Available ABSTRACT The atemoya is a hybrid fruit obtained by crossing of cherimoya (Annona cherimola Mill. with sweet sop (Annona squamosa L.. The information about chemical composition of atemoya is scarce. The mineral composition was evaluated employing Inductively Coupled Plasma Optical Emission Spectrometry (ICP OES and the centesimal composition and the physico-chemical parameters were assessed employing procedures described in the AOAC methods. The total phenolic compounds (TPC and total flavonoids (TF were determined using spectroanalytical methods. Considering the Reference Daily Intake (RDI, the concentrations of K, Cu and Vitamin C found in atemoya were the highest, representing about 32, 23 and 37% of the RDI, respectively. The total carbohydrates were 32 g 100g-1 and the soluble solids was equivalent to (32.50 ± 0.03 °Brix. The result for TPC was 540.47 ± 2.32 mgGAE 100 g-1 and the TF was 11.56 ± 1.36 mgQE 100 g-1. The exploratory evaluation of 42 atemoya samples was performed through Principal Component Analysis (PCA, which discriminated green and ripe fruits according to their mineral composition. The elements that contributed most for the variability between green and ripe fruits were: Ba, Ca, Cu, K, Mg and P.

  9. Atividade antioxidante e antimicrobiana de extratos de atemoia (Annona cherimola Mill. x A. squamosa L.

    Directory of Open Access Journals (Sweden)

    Suzana Vieira Rabêlo

    2014-01-01

    Full Text Available O objetivo deste trabalho foi quantificar os teores de fenóis e flavonoides totais, bem como avaliar as atividades antioxidante e antimicrobiana de extratos obtidos dos talos e folhas de atemoia (A. cherimola Mill. x A. squamosa L., que pertence à família Annonaceae. A atividade antioxidante foi avaliada pelos métodos de sequestro dos radicais 2,2-difenil-1-picrilhidrazil (DPPH e 2,2'-azinobis-3-etilbenzotiazolina-6-ácido sulfônico (ABTS, bem como pelo método da cooxidação do β-caroteno/ácido linoleico. A avaliação da atividade antimicrobiana dos extratos foi analisada contra 10 cepas de bactérias. Os resultados da atividade antioxidante dos extratos mostraram que o extrato etanólico dos talos (EEt foi o antioxidante mais efetivo (IC50 = 10,44 ± 1,25 µg/mL no método do sequestro do DPPH, bem como no sequestro do radical ABTS (24,81 ± 0,49%. O extrato hexânico das folhas apresentou o melhor percentual de atividade antioxidante no ensaio do β-caroteno/ácido linoleico (41,12 ± 4,35%. Os extratos etanólico dos talos e metanólico das folhas mostraram-se ativos contra cepas de Bacillus cereus, Klebsiella pneumoniae, Staphylococcus aureus resistente à meticilina (MRSA, Staphylococcus aureus e Staphylococcus epidermidis.

  10. Alkaloids isolated from the leaves of atemoya (Annona cherimola × Annona squamosa)

    OpenAIRE

    Rabêlo,Suzana V.; Costa,Emmanoel V.; Barison,Andersson; Dutra,Lívia M.; Nunes,Xirley P.; Tomaz,José C.; Oliveira,Gibson G.; Lopes,Norberto P.; Santos,Maria de Fátima C.; Almeida,Jackson R.G. da Silva

    2015-01-01

    AbstractAtemoya is an interspecific annonaceous hybrid between Annona cherimola Mill. and Annona squamosa L. Its phytochemical investigation led to seven alkaloids, including two aporphine (anonaine and asimilobine), three oxoaporphine (lanuginosine, liriodenine and lysicamine) and two proaporphine (pronuciferine and stepharine). These alkaloids were identified by a series of spectrometric methods, mainly MS and NMR (1D and 2D), as well as by comparison with literature data. Our findings show...

  11. Mapping Genetic Diversity of Cherimoya (Annona cherimola Mill.): Application of Spatial Analysis for Conservation and Use of Plant Genetic Resources

    Science.gov (United States)

    van Zonneveld, Maarten; Scheldeman, Xavier; Escribano, Pilar; Viruel, María A.; Van Damme, Patrick; Garcia, Willman; Tapia, César; Romero, José; Sigueñas, Manuel; Hormaza, José I.

    2012-01-01

    There is a growing call for inventories that evaluate geographic patterns in diversity of plant genetic resources maintained on farm and in species' natural populations in order to enhance their use and conservation. Such evaluations are relevant for useful tropical and subtropical tree species, as many of these species are still undomesticated, or in incipient stages of domestication and local populations can offer yet-unknown traits of high value to further domestication. For many outcrossing species, such as most trees, inbreeding depression can be an issue, and genetic diversity is important to sustain local production. Diversity is also crucial for species to adapt to environmental changes. This paper explores the possibilities of incorporating molecular marker data into Geographic Information Systems (GIS) to allow visualization and better understanding of spatial patterns of genetic diversity as a key input to optimize conservation and use of plant genetic resources, based on a case study of cherimoya (Annona cherimola Mill.), a Neotropical fruit tree species. We present spatial analyses to (1) improve the understanding of spatial distribution of genetic diversity of cherimoya natural stands and cultivated trees in Ecuador, Bolivia and Peru based on microsatellite molecular markers (SSRs); and (2) formulate optimal conservation strategies by revealing priority areas for in situ conservation, and identifying existing diversity gaps in ex situ collections. We found high levels of allelic richness, locally common alleles and expected heterozygosity in cherimoya's putative centre of origin, southern Ecuador and northern Peru, whereas levels of diversity in southern Peru and especially in Bolivia were significantly lower. The application of GIS on a large microsatellite dataset allows a more detailed prioritization of areas for in situ conservation and targeted collection across the Andean distribution range of cherimoya than previous studies could do, i.e. at

  12. Mapping genetic diversity of cherimoya (Annona cherimola Mill.): application of spatial analysis for conservation and use of plant genetic resources.

    Science.gov (United States)

    Zonneveld, Maarten van; Scheldeman, Xavier; Escribano, Pilar; Viruel, María A; Van Damme, Patrick; Garcia, Willman; Tapia, César; Romero, José; Sigueñas, Manuel; Hormaza, José I

    2012-01-01

    There is a growing call for inventories that evaluate geographic patterns in diversity of plant genetic resources maintained on farm and in species' natural populations in order to enhance their use and conservation. Such evaluations are relevant for useful tropical and subtropical tree species, as many of these species are still undomesticated, or in incipient stages of domestication and local populations can offer yet-unknown traits of high value to further domestication. For many outcrossing species, such as most trees, inbreeding depression can be an issue, and genetic diversity is important to sustain local production. Diversity is also crucial for species to adapt to environmental changes. This paper explores the possibilities of incorporating molecular marker data into Geographic Information Systems (GIS) to allow visualization and better understanding of spatial patterns of genetic diversity as a key input to optimize conservation and use of plant genetic resources, based on a case study of cherimoya (Annona cherimola Mill.), a Neotropical fruit tree species. We present spatial analyses to (1) improve the understanding of spatial distribution of genetic diversity of cherimoya natural stands and cultivated trees in Ecuador, Bolivia and Peru based on microsatellite molecular markers (SSRs); and (2) formulate optimal conservation strategies by revealing priority areas for in situ conservation, and identifying existing diversity gaps in ex situ collections. We found high levels of allelic richness, locally common alleles and expected heterozygosity in cherimoya's putative centre of origin, southern Ecuador and northern Peru, whereas levels of diversity in southern Peru and especially in Bolivia were significantly lower. The application of GIS on a large microsatellite dataset allows a more detailed prioritization of areas for in situ conservation and targeted collection across the Andean distribution range of cherimoya than previous studies could do, i.e. at

  13. Mapping genetic diversity of cherimoya (Annona cherimola Mill.: application of spatial analysis for conservation and use of plant genetic resources.

    Directory of Open Access Journals (Sweden)

    Maarten van Zonneveld

    Full Text Available There is a growing call for inventories that evaluate geographic patterns in diversity of plant genetic resources maintained on farm and in species' natural populations in order to enhance their use and conservation. Such evaluations are relevant for useful tropical and subtropical tree species, as many of these species are still undomesticated, or in incipient stages of domestication and local populations can offer yet-unknown traits of high value to further domestication. For many outcrossing species, such as most trees, inbreeding depression can be an issue, and genetic diversity is important to sustain local production. Diversity is also crucial for species to adapt to environmental changes. This paper explores the possibilities of incorporating molecular marker data into Geographic Information Systems (GIS to allow visualization and better understanding of spatial patterns of genetic diversity as a key input to optimize conservation and use of plant genetic resources, based on a case study of cherimoya (Annona cherimola Mill., a Neotropical fruit tree species. We present spatial analyses to (1 improve the understanding of spatial distribution of genetic diversity of cherimoya natural stands and cultivated trees in Ecuador, Bolivia and Peru based on microsatellite molecular markers (SSRs; and (2 formulate optimal conservation strategies by revealing priority areas for in situ conservation, and identifying existing diversity gaps in ex situ collections. We found high levels of allelic richness, locally common alleles and expected heterozygosity in cherimoya's putative centre of origin, southern Ecuador and northern Peru, whereas levels of diversity in southern Peru and especially in Bolivia were significantly lower. The application of GIS on a large microsatellite dataset allows a more detailed prioritization of areas for in situ conservation and targeted collection across the Andean distribution range of cherimoya than previous studies could

  14. A catechol oxidase AcPPO from cherimoya (Annona cherimola Mill.) is localized to the Golgi apparatus.

    Science.gov (United States)

    Olmedo, Patricio; Moreno, Adrián A; Sanhueza, Dayan; Balic, Iván; Silva-Sanzana, Christian; Zepeda, Baltasar; Verdonk, Julian C; Arriagada, César; Meneses, Claudio; Campos-Vargas, Reinaldo

    2018-01-01

    Cherimoya (Annona cherimola) is an exotic fruit with attractive organoleptic characteristics. However, it is highly perishable and susceptible to postharvest browning. In fresh fruit, browning is primarily caused by the polyphenol oxidase (PPO) enzyme catalyzing the oxidation of o-diphenols to quinones, which polymerize to form brown melanin pigment. There is no consensus in the literature regarding a specific role of PPO, and its subcellular localization in different plant species is mainly described within plastids. The present work determined the subcellular localization of a PPO protein from cherimoya (AcPPO). The obtained results revealed that the AcPPO- green fluorescent protein co-localized with a Golgi apparatus marker, and AcPPO activity was present in Golgi apparatus-enriched fractions. Likewise, transient expression assays revealed that AcPPO remained active in Golgi apparatus-enriched fractions obtained from tobacco leaves. These results suggest a putative function of AcPPO in the Golgi apparatus of cherimoya, providing new perspectives on PPO functionality in the secretory pathway, its effects on cherimoya physiology, and the evolution of this enzyme. Copyright © 2017. Published by Elsevier B.V.

  15. Germinação de sementes de atemoia (Annona Cherimola Mill. x A. squamosa L. cv 'Gefner' submetidas a tratamentos com ácido Giberélico (GA3 e ethephon Germination of atemoya seeds (Annona Cherimola Mill. x A. squamosa L. cv 'Gefner' subjected to treatments with Gibberellic acid (GA3 and ethephon

    Directory of Open Access Journals (Sweden)

    Marcos Campos de Oliveira

    2010-06-01

    Full Text Available O objetivo deste trabalho foi estudar os efeitos do ácido giberélico (GA3, do ethephon e da interação de ambos os reguladores vegetais no processo germinativo de sementes de atemoia (Annona cherimola Mill. x A. squamosa L. , cultivar 'Gefner'. Empregou-se delineamento experimental inteiramente casualizado, em esquema fatorial 5², com os tratamentos constituídos pela combinação de cinco concentrações de GA3 (ácido giberélico e cinco concentrações de ethephon, resultando em 25 tratamentos, com quatro repetições de 25 sementes por parcela. As concentrações de GA3 empregadas foram: 0; 250; 500; 750 e 1.000 mg L-1 i.a.e de ethephon: 0; 25; 50; 75 e 100 mg L-1 i.a.. Os tratamentos com os reguladores vegetais foram aplicados na semente por imersão das mesmas nas soluções de GA3 e ethephon por período de 36 horas. As sementes foram semeadas em rolo de papel germitest e levadas à câmara de germinação onde permaneceram no escuro, com temperatura alternada entre 20ºC por 8 horas e 30ºC por 16 horas. As variáveis avaliadas foram: percentagem, tempo e índice de velocidade de germinação, percentagem de plântulas normais e percentagem de sementes dormentes. Existe interação da ação dos reguladores vegetais estudados no processo germinativo de sementes de atemoia, o que permite concluir que a percentagem de germinação de sementes de atemoia (Annona cherimola Mill. x A. squamosa L. cv 'Gefner' é aumentada com o emprego de 778 mg L-1 de GA3, enquanto a associação entre elevadas concentrações de GA3 e 75 a 100 mg L-1 de ethephon incrementam o índice de velocidade de germinação e a percentagem de plântulas normais.The aim of this work was to evaluate the effect of gibberellic acid (GA3 and ethephon, besides the interaction of both plant growth regulators, on the germinative process of atemoya seeds (Annona cherimola Mill. X A. squamosa L., cultivar 'Gefner'. Experimental design was completely randomized, in a 5

  16. Enraizamento de estacas de atemoieira (Annona Cherimola Mill. x A. squamosa L. cv. Gefner submetidas a tratamento lento e rápido com auxinas Rooting of atemoya (Annona cherimola Mill. x A. squamosa L. cv. Gefner cuttings subjected to slow and fast treatment with auxins

    Directory of Open Access Journals (Sweden)

    Gisela Ferreira

    2010-04-01

    Full Text Available Realizou-se este trabalho, com o objetivo de avaliar o uso de concentrações de diferentes auxinas no enraizamento de estacas de atemoieira (Annona cherimola Mill. x A. squamosa L. cv. Gefner, empregando-se tratamento lento e rápido. O delineamento experimental empregado foi inteiramente casualizado, em esquema fatorial 3x7 (auxinas x concentrações, com 5 repetições de 12 estacas por parcela, para cada método de aplicação de auxina (lento e rápido. As estacas foram tratadas com os reguladores vegetais, por meio da imersão da base em soluções, contendo IBA, NAA e 2,4-D, durante 24 horas (tratamento lento nas concentrações 0 (testemunha, 50, 100, 200, 300, 400 e 500 mg L-1 de cada regulador e 5 segundos (tratamento rápido nas concentrações 0 (testemunha, 500, 1000, 2000, 3000, 4000 e 5000 mg L-1 de cada regulador. As variáveis avaliadas foram: porcentagem de estacas sobreviventes, enraizadas, sobreviventes com calos, comprimento de raiz por estaca, porcentagem de estacas enraizadas com folhas remanescentes, com brotação e com folhas remanescentes e brotação. Para o enraizamento de estacas de atemoieira cv. 'Gefner' conclui-se que, o tratamento lento, com 200 mg L-1 de NAA, proporcionou incremento ao processo, da mesma forma que o tratamento rápido com IBA, independente da concentração.This study aimed to evaluate the effect of different auxin concentrations in the rooting of atemoya (Annona cherimola Mill. x A. squamosa L. cv. Gefner stacks, employing slow and fast treatments. The experimental design used was completely randomized, in 3x7 factorial arrangement (auxins x concentrations, with 5 replicates of 12 stacks per plot, for each auxin application method (slow and fast. Stacks were treated with plant growth regulators by bottom immersion in a solution containing IBA, NAA and 2,4-D for 24 hours (slow treatment at the following concentrations: 0 (control, 50, 100, 200, 300, 400 and 500 mg L-1 of each growth regulator

  17. The Unusual Acid-Accumulating Behavior during Ripening of Cherimoya (Annona cherimola Mill.) is Linked to Changes in Transcription and Enzyme Activity Related to Citric and Malic Acid Metabolism.

    Science.gov (United States)

    González-Agüero, Mauricio; Tejerina Pardo, Luis; Zamudio, María Sofía; Contreras, Carolina; Undurraga, Pedro; Defilippi, Bruno G

    2016-04-25

    Cherimoya (Annona cherimola Mill.) is a subtropical fruit characterized by a significant increase in organic acid levels during ripening, making it an interesting model for studying the relationship between acidity and fruit flavor. In this work, we focused on understanding the balance between the concentration of organic acids and the gene expression and activity of enzymes involved in the synthesis and degradation of these metabolites during the development and ripening of cherimoya cv. "Concha Lisa". Our results showed an early accumulation of citric acid and other changes associated with the accumulation of transcripts encoding citrate catabolism enzymes. During ripening, a 2-fold increase in malic acid and a 6-fold increase in citric acid were detected. By comparing the contents of these compounds with gene expression and enzymatic activity levels, we determined that cytoplasmic NAD-dependent malate dehydrogenase (cyNAD-MDH) and mitochondrial citrate synthase (mCS) play important regulatory roles in the malic and citric acid biosynthetic pathways.

  18. Evaluation of cholesterol absorption and biosynthesis by decoctions of Annona cherimola leaves.

    Science.gov (United States)

    Falé, Pedro L; Ferreira, Catarina; Maruzzella, Federica; Helena Florêncio, Maria; Frazão, Fátima N; Serralheiro, Maria L M

    2013-11-25

    Decoctions of the leaves of Annona cherimola Mill. are traditionally used in Azores to treat hypercholesterolemia. Although they are sold and consumed by people in order to improve their health, these are products that cannot be sold with claims for health benefits as they have never been studied scientifically. The activities of decoctions from Annona cherimola leaves were analysed for the two therapeutic approaches currently used to reduce plasma cholesterol: inhibition of dietary cholesterol uptake and inhibition of HMG-CoA reductase activity. Furthermore, the composition of the decoction was elucidated by LC-MS and the permeability of the active components was analysed using Caco-2 cell monolayers as a model of the intestinal barrier (dietary cholesterol uptake). The chemical composition of the Annona cherimola leaves' extract revealed that rutin was its main component. The in vitro gastrointestinal digestion did not modify the chemical composition of the extract. This extract was able to originate a slight reduction in cholesterol absorption through Caco-2 cells lines and to reduce the HMG-CoA reductase activity in 50% when using 137.3 μg of the extract/mL. Rutin, when used in the same concentration as that found in the extract, was able to reduce cholesterol absorption through Caco-2 cells monolayer in approximately 47%. This flavonoid had an IC50 of 17.85 μM relatively to the HMG-CoA reductase activity. The traditional use of decoctions from the leaves of Annona cherimola may be justified, at least by the inhibition of HMG-CoA reductase activity. © 2013 Elsevier Ireland Ltd. All rights reserved.

  19. Pollen performance, cell number, and physiological state in the early-divergent angiosperm Annona cherimola Mill. (Annonaceae) are related to environmental conditions during the final stages of pollen development

    OpenAIRE

    Lora, Jorge; Herrero Romero, María; Hormaza Urroz, José Ignacio

    2012-01-01

    Pollen performance is an important determinant for fertilization success, but high variability in pollen behavior both between and within species occurs in different years and under varying environmental conditions. Annona cherimola, an early-divergent angiosperm, is a species that releases a variable ratio of bicellular and tricellular hydrated pollen at anther dehiscence depending on temperature. The presence of both bi- and tricellular types of pollen is an uncommon characteristic in angio...

  20. Pollen performance, cell number, and physiological state in the early-divergent angiosperm Annona cherimola Mill. (Annonaceae) are related to environmental conditions during the final stages of pollen development.

    Science.gov (United States)

    Lora, J; Herrero, M; Hormaza, J I

    2012-09-01

    Pollen performance is an important determinant for fertilization success, but high variability in pollen behavior both between and within species occurs in different years and under varying environmental conditions. Annona cherimola, an early-divergent angiosperm, is a species that releases a variable ratio of bicellular and tricellular hydrated pollen at anther dehiscence depending on temperature. The presence of both bi- and tricellular types of pollen is an uncommon characteristic in angiosperms and makes Annona cherimola an interesting model to study the effect of varying environmental conditions on subsequent pollen performance during the final stages of pollen development. In this work, we study the influence of changes in temperature and humidity during the final stages of pollen development on subsequent pollen performance, evaluating pollen germination, presence of carbohydrates, number of nuclei, and water content. At 25 °C, which is the average field temperature during the flowering period of this species, pollen had a viability of 60-70 %, starch hydrolyzed just prior to shedding, and pollen mitosis II was taking place, resulting in a mixture of bi- and tricellular pollen. This activity may be related to the pollen retaining 70 % water content at shedding. Temperatures above 30 °C resulted in a decrease in pollen germination, whereas lower temperatures did not have a clear influence on pollen germination, although they did have a clear effect on starch hydrolysis. On the other hand, slightly higher dehydration accelerated mitosis II, whereas strong dehydration arrested starch hydrolysis and reduced pollen germination. These results show a significant influence of environmental conditions on myriad pollen characteristics during the final stages of pollen development modifying subsequent pollen behavior and contributing to our understanding of the variability observed in pollen tube performance.

  1. The coexistence of bicellular and tricellular pollen in Annona cherimola (Annonaceae): Implications for pollen evolution

    OpenAIRE

    Lora, Jorge; Herrero Romero, María; Hormaza Urroz, José Ignacio

    2009-01-01

    Most angiosperms release bicellular pollen. However, in about one-third of extant angiosperms, the second pollen mitosis occurs before anthesis such that pollen is tricellular upon release. The shift from bicellular to tricellular development has occurred several times independently, but its causes are largely unknown. In this work, we observed the coexistence of both kinds of pollen at anther dehiscence in Annona cherimola, a species that belongs to the basal angiosperm family Annonaceae. Ex...

  2. Armazenamento de atemoias (Annona squamosa x Annona cherimola recobertas com filme PVC

    Directory of Open Access Journals (Sweden)

    P. A. de Souza

    2015-12-01

    Full Text Available A atemoia, assim como todos os frutos climatéricos, apresenta uma elevada perecibilidade, tornando-se importante a adoção de técnicas pós-colheita. Este trabalho teve como objetivo avaliar o armazenamento de atemoias recobertas com filme PVC. Os frutos utilizados foram da variedade ‘Gefner’ apresentando-se em estado de maturação verde-maduro. Estes foram transferidos para o laboratório de Química de Alimentos do IFCE, submetidos à higienização e divididos nos devidos tratamentos. O primeiro tratamento constou no armazenamento de cinco frutos em bandejas de isopor recobertos com filme PVC. O segundo, do recobrimento individual dos frutos em filme PVC, sendo estes acondicionados em bandejas de isopor e os frutos do controle. Estes foram armazenados durante 8 dias. O delineamento utilizado foi o DIC em esquema fatorial 3x4 com quatro repetições de cinco frutos por parcela. A cada tempo de armazenamento foram avaliadas: perda de massa, sólidos solúveis, acidez titulável, Ratio, pH e índice de rachaduras. O uso de filme plástico reduz a perda de massa, porém retarda o amadurecimento de frutos de atemoia. As rachaduras estão diretamente associadas ao amadurecimento dos frutos, ao aumento dos teores de sólidos solúveis e possivelmente a cultivar avaliada. Storage of atemoyas (Annona squamosa x Annona cherimola covered with PVC filmAbstract: The atemoya, as well as all climacteric fruits, is highly perishable, becoming important to adopt post-harvest techniques. This work aimed to evaluate the atemoyas storage covered with plastic wrap. The fruits used were of the variety 'Gefner' presenting itself in a state of green-mature aging. These were transferred to the Food Chemistry Lab IFCE submitted to cleaning and divided in appropriate treatments. The first treatment consisted in five fruit storage in styrofoam trays covered with plastic wrap. The second, the individual coating of the fruits in PVC film, which are packed in

  3. Attraction of pollinators to atemoya (Annona squamosa x A. cherimola) in Puerto Rico using commercial lures and food attractants

    Science.gov (United States)

    Atemoya is a hybrid between Annona squamosa and A. cherimola (Annonaceae) and has potential to be a major fruit crop in tropical and subtropical areas. A major impediment to fruit production is low fruit-set due to inadequate pollinator visits, typically Nitidulidae beetles. We used Universal moth t...

  4. Antihyperglycemic Activity of the Leaves from Annona cherimola Miller and Rutin on Alloxan-induced Diabetic Rats

    Science.gov (United States)

    Calzada, Fernando; Solares-Pascasio, Jesús Iván; Ordoñez-Razo, R. M.; Velazquez, Claudia; Barbosa, Elizabeth; García-Hernández, Normand; Mendez-Luna, David; Correa-Basurto, José

    2017-01-01

    Background: Annona cherimola, known as “chirimoya” has been reported in Mexican traditional medicine for the treatment of diabetes. Objective: The aims of the present study were to validate and assess the traditional use of A. cherimola as an antidiabetic agent. Materials and Methods: The ethanol extract from A. cherimola (300 mg/kg, EEAc), subsequent fractions (100 mg/kg), and rutin (30 mg/kg) were studied on alloxan-induced type 2 diabetic (AITD) and normoglycemic rats. In addition, oral glucose tolerance test (OGTT) and oral sucrose tolerance test (OSTT) were performed in normoglycemic rats. Molecular docking technique was used to conduct the computational study. Results: Bioassay-guided fractionation of EEAc afforded as major antihyperglycemic compound, rutin. EEAc attenuated postprandial hyperglycemia in acute test using AITD rats (331.5 mg/dL) carrying the glycemic levels to 149.2 mg/dL. Rutin after 2 h, attenuated postprandial hyperglycemia in an acute assay using AITD rats such as EEAc, with maximum effect (150.0 mg/dL) being seen at 4 h. The antihyperglycemic activities of EEAc and rutin were comparable with acarbose (151.3 mg/dL). In the subchronic assay on AITD rats, the EEAc and rutin showed a reduction of the blood glucose levels since the 1st week of treatment, reaching levels similar to normoglycemic state (116.9 mg/kg) that stayed constant for the rest of the assay. OGTT and OSTT showed that EEAc and rutin significantly lowered blood glucose levels in normoglycemic rats at 2 h after a glucose or sucrose load such as acarbose. Computational molecular docking showed that rutin interacted with four amino acids residues in the enzyme α-glucosidase. Conclusion: The results suggest that rutin an α-glucosidase inhibitor was responsible in part of the antihyperglycemic activity of A. cherimola. Its in vivo antihyperglycemic activity is in good agreement with the traditional use of A. cherimola for the treatment of diabetes. SUMMARY The ethanol extract

  5. The progamic phase of an early-divergent angiosperm, Annona cherimola (Annonaceae)

    Science.gov (United States)

    Lora, J.; Hormaza, J. I.; Herrero, M.

    2010-01-01

    Background and Aims Recent studies of reproductive biology in ancient angiosperm lineages are beginning to shed light on the early evolution of flowering plants, but comparative studies are restricted by fragmented and meagre species representation in these angiosperm clades. In the present study, the progamic phase, from pollination to fertilization, is characterized in Annona cherimola, which is a member of the Annonaceae, the largest extant family among early-divergent angiosperms. Beside interest due to its phylogenetic position, this species is also an ancient crop with a clear niche for expansion in subtropical climates. Methods The kinetics of the reproductive process was established following controlled pollinations and sequential fixation. Gynoecium anatomy, pollen tube pathway, embryo sac and early post-fertilization events were characterized histochemically. Key Results A plesiomorphic gynoecium with a semi-open carpel shows a continuous secretory papillar surface along the carpel margins, which run from the stigma down to the obturator in the ovary. The pollen grains germinate in the stigma and compete in the stigma-style interface to reach the narrow secretory area that lines the margins of the semi-open stylar canal and is able to host just one to three pollen tubes. The embryo sac has eight nuclei and is well provisioned with large starch grains that are used during early cellular endosperm development. Conclusions A plesiomorphic simple gynoecium hosts a simple pollen–pistil interaction, based on a support–control system of pollen tube growth. Support is provided through basipetal secretory activity in the cells that line the pollen tube pathway. Spatial constraints, favouring pollen tube competition, are mediated by a dramatic reduction in the secretory surface available for pollen tube growth at the stigma–style interface. This extramural pollen tube competition contrasts with the intrastylar competition predominant in more recently derived

  6. Attraction of Pollinators to Atemoya (Annona squamosa × Annona cherimola) in Puerto Rico Using Commercial Lures and Food Attractants.

    Science.gov (United States)

    Jenkins, David A; Millan-Hernandez, Christian; Cline, Andrew R; McElrath, Thomas C; Irish, Brian; Goenaga, Ricardo

    2015-08-01

    Atemoya is a hybrid between Annona squamosa L. and Annona cherimola Miller (Annonaceae) and has potential to be an important fruit crop in tropical and subtropical areas. A major impediment to fruit production is low fruit set due to inadequate pollinator visits, typically, by beetles in the family Nitidulidae. We used Universal moth traps to monitor the attractiveness of two commercially available Nitidulidae lures in combination with various food attractants, including raw bread dough, apple juice, and malta beverage, a soft drink by-product of the brewing process. The most commonly trapped beetles were, in order of decreasing frequency, Carpophilus dimidiatus (F.), Brachypeplus mutilatus Erichson, Urophorus humeralis (F.) (Coleoptera: Nitidulidae), and Europs fervidus Blatchley (Coleoptera: Monotomidae). All traps, except the unbaited control traps, caught beetles. In a previous study, we found that combining two commercial lures had a synergistic effect on the attraction of these beetle species. In this study, the addition of food attractants increased the number of beetles trapped compared with traps baited with only the commercial lures. Also, food attractants appear to be key in attracting U. humeralis; only one U. humeralis individual of the 206 caught during the experiment was trapped without a food attractant. The variation between the number of beetles caught in traps containing the same treatments was high and may explain the erratic results reported in other studies of pollination in Annona spp. The results are discussed with respect to the use of nitidulid lures and food attractants to increase fruit set in atemoya and other Annonaceae. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  7. Two cold-induced family 19 glycosyl hydrolases from cherimoya (Annona cherimola) fruit: an antifungal chitinase and a cold-adapted chitinase.

    Science.gov (United States)

    Goñi, Oscar; Sanchez-Ballesta, María T; Merodio, Carmen; Escribano, María I

    2013-11-01

    Two cold-induced chitinases were isolated and purified from the mesocarp cherimoyas (Annona cherimola Mill.) and they were characterised as acidic endochitinases with a Mr of 24.79 and 47.77kDa (AChi24 and AChi48, respectively), both family 19 glycosyl hydrolases. These purified chitinases differed significantly in their biochemical and biophysical properties. While both enzymes had similar optimal acidic pH values, AChi24 was enzymatically active and stable at alkaline pH values, as well as displaying an optimal temperature of 45°C and moderate thermostability. Kinetic studies revealed a great catalytic efficiency of AChi24 for oligomeric and polymeric substrates. Conversely, AChi48 hydrolysis showed positive co-operativity that was associated to a mixture of different functional oligomeric states through weak transient protein interactions. The rise in the AChi48 kcat at increasing enzyme concentrations provided evidence of its oligomerisation. AChi48 chitinase was active and stable in a broad acidic pH range, and while it was relatively labile as temperatures increased, with an optimal temperature of 35°C, it retained about 50% of its maximal activity from 5 to 50°C. Thermodynamic characterisation reflected the high kcat of AChi48 and the remarkably lower ΔH(‡), ΔS(‡) and ΔG(‡) values at 5°C compared to AChi24, indicating that the hydrolytic activity of AChi48 was less thermodependent. In vitro functional studies revealed that AChi24 had a strong antifungal defence potential against Botrytis cinerea, whereas they displayed no cryoprotective or antifreeze activity. Hence, based on biochemical, thermodynamic and functional data, this study demonstrates that two acidic endochitinases are induced at low temperatures in a subtropical fruit, and that one of them acts in an oligomeric cold-adapted manner. Copyright © 2013 Elsevier Ltd. All rights reserved.

  8. Profiling of lipophilic and phenolic phytochemicals of four cultivars from cherimoya (Annona cherimola Mill.).

    Science.gov (United States)

    Santos, Sónia A O; Vilela, Carla; Camacho, João F; Cordeiro, Nereida; Gouveia, Manuela; Freire, Carmen S R; Silvestre, Armando J D

    2016-11-15

    The lipophilic and phenolic extractives of the ripe mesocarp of four cherimoya cultivars ('Perry Vidal', 'Mateus I', 'Mateus III' and 'Funchal') from Madeira Island, were studied for the first time. The predominant lipophilic compounds are kaurene diterpenes (42.2-59.6%), fatty acids (18.0-35.6%) and sterols (9.6-23.7%). Kaur-16-en-19-oic acid is the major lipophilic component of all cultivars accounting between 554 and 1350mgkg(-1) of dry material. The studied fruits also contain a high variety of flavan-3-ols, including galloylated and non-galloylated compounds. Five phenolic compounds were identified for the first time: catechin, (epi)catechin-(epi)gallocatechin, (epi)gallocatechin, (epi)afzelechin-(epi)catechin and procyanidin tetramer. 'Mateus I' and 'Mateus III' cultivars present the highest content of phenolic compounds (6299 and 9603mgkg(-1) of dry weight, respectively). These results support the use of this fruit as a rich source of health-promoting components, with the capacity to prevent or delay the progress of oxidative-stress related disorders. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. INFLUENCIA DE LA FUENTE DE POLEN Y SU EFECTIVIDAD EN LA CALIDAD DE FRUTOS DE CHIRIMOYA (Annona cherimola MILL.

    Directory of Open Access Journals (Sweden)

    Isela Apolonio

    2015-01-01

    Full Text Available Se evaluó la influencia de la fuente de polen y los horarios de polinización sobre el amarre y la calidad de frutos en 3 cultivares de chirimoya: ‘Campas’, ‘White’ y ‘Bonita’. El cultivar ‘White’ se cultiva comercialmente en California, mientras que ‘Campas ́ y ́Bonita ́ son cultivados, en menor escala, en España. Se realizó autopolinización y polinización cruzada artificial sin mezcla de polen en cada cultivar, en 3 horarios diferentes (07:00-09:00, 10:00-12:00 y 18:00-20:00 h, empleando la técnica del pincel. En todos los cultivares, el porcentaje de amarre de frutos con polinización natural fue bajo (de 5 a 10%. El tratamiento de autopolinización fue el menos eficiente, especialmente en ‘Bonita’ (47,90%. Por el contrario, cuando ‘Bonita’ fue usada como polen padre, el porcentaje de amarre de frutos fue significativamente alto en ‘Campas’ (85,83% y ‘White’ (87,40%. Además, tuvo un efecto significativo al incrementar el peso del fruto, número de semillas, peso de semillas, peso de pulpa y simetría en los 3 cultivares.

  10. Odontopus brevirostris (Hustache, 1936 (Coleoptera, Curculionidae associated with new host plants belonging to Annona (Annonaceae

    Directory of Open Access Journals (Sweden)

    Germano H. Rosado-Neto

    2002-01-01

    Full Text Available Odontopus brevirostris (Hustache, 1936 feeding on Annona squamosa L., A. cherimola Mill., A. glabra L., and A. muricata L. was observed. The last three host plants are recorded for the first time. The endophitic oviposition occurs in the veins of the ventral surface of the young leaves. The larvae, leaf miners, eat the parenchyma and the adults make small holes in the leaves. The pupation occurs in spherical cocoons protected by a sort of nest (pupation chamber between the two epidermal layers.

  11. Identification of the environmental neurotoxins annonaceous acetogenins in an Annona cherimolia Mill. Alcoholic Beverage Using HPLC-ESI-LTQ-Orbitrap.

    Science.gov (United States)

    Le Ven, Jessica; Schmitz-Afonso, Isabelle; Lewin, Guy; Brunelle, Alain; Touboul, David; Champy, Pierre

    2014-08-27

    Epidemiological and toxicological studies have suggested Annonaceaeous acetogenins to be environmental neurotoxins responsible for sporadic atypical parkinsonism/dementia in tropical areas. These compounds are present in the tropical genus Annona (Annonaceae), known for its fruit-yielding cultivated species such as Annona cherimolia. This species is widely cultivated in South America, Spain, and Portugal and yields acetogenins in its seeds, stems, and roots. The presence of these compounds in the pulp of its fruit and in derived food products is unclear. An innovative and sensitive methodology by HPLC-ESI-LTQ-Orbitrap with postcolumn infusion of lithium iodide was used to identify the presence of low levels of acetogenins in an A. cherimolia Mill. fruit-based commercial alcoholic beverage. More than 80 representatives were detected, and the 31 most intense acetogenins were identified. All together these findings indicate that this species should be considered as a risk factor within the framework of a worldwide problem of food toxicity.

  12. Biotechnology applied to Annona species: a review

    Directory of Open Access Journals (Sweden)

    Carlos Lopez Encina

    2014-01-01

    Full Text Available Annonaceae is an ancient family of plants including approximately 50 genera growing worldwide in a quite restricted area with specific agroclimatic requirements. Only few species of this family has been cultivated and exploited commercially and most of them belonging to the genus Annona such as A. muricata, A. squamosa, the hybrid A. cherimola x A. squamosa and specially Annona cherimola: the cherimoya, commercially cultivated in Spain, Chile, California, Florida, México, Australia, Ecuador, Peru, Brazil, New Zealand and several countries in South and Central America. The cherimoya shows a high degree of heterozygosis, and to obtain homogeneous and productive orchards it is necessary to avoid the propagation by seeds of this species. Additionally, the traditional methods of vegetative propagation were inefficient and inadequate, due to the low morphogenetic potential of this species, and the low rooting rate. The in vitro tissue culture methods of micropropagation can be applied successfully to cherimoya and other Annona sp to overcome these problems. Most of the protocols of micropropagation and regeneration were developed using the cultivar Fino de Jete, which is the major cultivar in Spain. First it is developed the method to micropropagate the juvenile material of cherimoya (ENCINA et al., 1994, and later it was optimized a protocol to micropropagate adult cherimoya genotypes selected by outstanding agronomical traits (PADILLA and ENCINA, 2004 and further it was improved the process through micrografting (PADILLA and ENCINA, 2011.At the present time we are involved in inducing and obtaining new elite genotypes, as part of a breeding program for the cherimoya and other Annonas, using and optimizing different methodologies in vitro: a Adventitious organogenesis and regeneration from cellular cultures (ENCINA, 2004, b Ploidy manipulation of the cherimoya, to obtain haploid, tetraploid and triploid plants (seedless, c Genetic transformation

  13. Annona glabra

    Indian Academy of Sciences (India)

    Admin

    Annona glabra L. (MONKEY-APPLE) of Annonaceae is a medium-sized tree with spreading branches. Leaves are simple, ovate to oblong in shape, 10 × 5 cm with an acute apex. Flowers are solitary and large. Sepals and petals are fleshy whereas stamens and pistils are small and numerous. Fruit is of apple's size and is ...

  14. Annona glabra

    Indian Academy of Sciences (India)

    Admin

    Annona glabra L. (MONKEY-APPLE) of Annonaceae is a medium-sized tree with spreading branches. Leaves are simple, ovate to oblong in shape, 10 x 5 cm with an acute apex. Flowers are solitary and large. Sepals and petals are fleshy whereas stamens and pistils are small and numerous. Fruit is of apple's size and is ...

  15. PERMANENT GENETIC RESOURCES: Development of 52 new polymorphic SSR markers from cherimoya (Annona cherimola Mill.): transferability to related taxa and selection of a reduced set for DNA fingerprinting and diversity studies.

    Science.gov (United States)

    Escribano, P; Viruel, M A; Hormaza, J I

    2008-03-01

    Fifty-two single locus polymorphic microsatellites were developed using two genomic libraries digested with HaeIII and RsaI of cherimoya cv. Fino de Jete enriched in CT/AG repeats. A total of 222 alleles were detected with the selected simple sequence repeats (SSRs). The observed and expected heterozygosities ranged from 0.08 to 0.73 and from 0.20 to 0.84, respectively. Most of the SSRs were transferable to other species in the Annonaceae. A set of 20 microsatellites was selected to facilitate the exchange of data among laboratories. © 2007 The Authors.

  16. DNA barcoding of perennial fruit tree species of agronomic interest in the genus Annona (Annonaceae)

    Science.gov (United States)

    Larranaga, Nerea; Hormaza, José I.

    2015-01-01

    The DNA barcode initiative aims to establish a universal protocol using short genetic sequences to discriminate among animal and plant species. Although many markers have been proposed to become the barcode of plants, the Consortium for the Barcode of Life (CBOL) Plant Working Group recommended using as a core the combination of two portions of plastid coding region, rbcL and matK. In this paper, specific markers based on matK sequences were developed for 7 closely related Annona species of agronomic interest (Annona cherimola, A. reticulata, A. squamosa, A. muricata, A. macroprophyllata, A. glabra, and A. purpurea) and the discrimination power of both rbcL and matK was tested using also sequences of the genus Annona available in the Barcode of Life Database (BOLD) data systems. The specific sequences developed allowed the discrimination among all those species tested. Moreover, the primers generated were validated in six additional species of the genus (A. liebmanniana, A. longiflora, A. montana, A. senegalensis, A. emarginata and A. neosalicifolia) and in an interspecific hybrid (A. cherimola x A. squamosa). The development of a fast, reliable and economic approach for species identification in these underutilized subtropical fruit crops in a very initial state of domestication is of great importance in order to optimize genetic resource management. PMID:26284104

  17. DNA barcoding of perennial fruit tree species of agronomic interest in the genus Annona (Annonaceae

    Directory of Open Access Journals (Sweden)

    Nerea eLarranaga

    2015-07-01

    Full Text Available The DNA barcode initiative aims to establish a universal protocol using short genetic sequences to discriminate among animal and plant species. Although many markers have been proposed to become the barcode of plants, the Consortium for the Barcode of Life (CBOL Plant Working Group recommended using as a core the combination of two portions of plastid coding region, rbcL and matK. In this paper, specific markers based on matK sequences were developed for 7 closely related Annona species of agronomic interest (Annona cherimola, A. reticulata, A. squamosa, A. muricata, A. macroprophyllata, A. glabra and A. purpurea and the discrimination power of both rbcL and matK was tested using also sequences of the genus Annona available in the Barcode of Life Database (BOLD data systems. The specific sequences developed allowed the discrimination among all those species tested. Moreover, the primers generated were validated in six additional species of the genus (A. liebmanniana, A. longiflora, A. montana, A. senegalensis, A. emarginata and A. neosalicifolia and in an interspecific hybrid (A. cherimola x A. squamosa. The development of a fast, reliable and economic approach for species identification in these underutilized subtropical fruit crops in a very initial state of domestication is of great importance in order to optimize genetic resource management.

  18. DNA barcoding of perennial fruit tree species of agronomic interest in the genus Annona (Annonaceae).

    Science.gov (United States)

    Larranaga, Nerea; Hormaza, José I

    2015-01-01

    The DNA barcode initiative aims to establish a universal protocol using short genetic sequences to discriminate among animal and plant species. Although many markers have been proposed to become the barcode of plants, the Consortium for the Barcode of Life (CBOL) Plant Working Group recommended using as a core the combination of two portions of plastid coding region, rbcL and matK. In this paper, specific markers based on matK sequences were developed for 7 closely related Annona species of agronomic interest (Annona cherimola, A. reticulata, A. squamosa, A. muricata, A. macroprophyllata, A. glabra, and A. purpurea) and the discrimination power of both rbcL and matK was tested using also sequences of the genus Annona available in the Barcode of Life Database (BOLD) data systems. The specific sequences developed allowed the discrimination among all those species tested. Moreover, the primers generated were validated in six additional species of the genus (A. liebmanniana, A. longiflora, A. montana, A. senegalensis, A. emarginata and A. neosalicifolia) and in an interspecific hybrid (A. cherimola x A. squamosa). The development of a fast, reliable and economic approach for species identification in these underutilized subtropical fruit crops in a very initial state of domestication is of great importance in order to optimize genetic resource management.

  19. Biosistematik species Annona muricata Annona squamosa dan Annona reticulata dengan pendekatan alkaloid

    OpenAIRE

    Hamidah Hamidah; Santoso Santoso; Rina Kasiamdari

    2013-01-01

    This research aimed to explore kinship Annona muricata, Annona squamosa and Annona reticulata on the basis alkaloid content. Study phenotype Annona muricata, Annona squamosa and Annona reticulata based alkaloid content. Data alkaloid obtained are thenprocessed by a computer program SPSS version 14. The results of this study indicate that the presence of variations in the characterof the three types of Annona of species alkaloid. From the data analysis it can be seen that there are differences...

  20. Biosistematik species Annona muricata Annona squamosa dan Annona reticulata dengan pendekatan alkaloid

    Directory of Open Access Journals (Sweden)

    Hamidah Hamidah

    2013-03-01

    Full Text Available This research aimed to explore kinship Annona muricata, Annona squamosa and Annona reticulata on the basis alkaloid content. Study phenotype Annona muricata, Annona squamosa and Annona reticulata based alkaloid content. Data alkaloid obtained are thenprocessed by a computer program SPSS version 14. The results of this study indicate that the presence of variations in the characterof the three types of Annona of species alkaloid. From the data analysis it can be seen that there are differences in the variations that occur in Annona muricata, Annona squamosa and Annona reticulata by different habitats and is a variation of phenotypic variation.Dendrogram grouping results suggest that Annona squamosa and Annona reticulata fenetic ties closer, so clumped into one large group while Annona muricata split away from the other groups.

  1. Chemical and physicochemical characterization of the seed oil from ...

    African Journals Online (AJOL)

    Atemoya is a hybrid fruit derived from the crossing of sugar-apple (Annona squamosa L.), with cherimoya (Annona cherimola Mill.). The objective of this study was to compare two extraction methodologies for the seed oil from 'Gefner' atemoya, for yield, chemical and physicochemical characteristics, in order to use the oil as ...

  2. Antidepressant-like effects of an alkaloid extract of the aerial parts of Annona cherimolia in mice.

    Science.gov (United States)

    Martínez-Vázquez, M; Estrada-Reyes, R; Araujo Escalona, A G; Ledesma Velázquez, I; Martínez-Mota, L; Moreno, J; Heinze, G

    2012-01-06

    Several species of Annona (Annonaceae) are used in traditional Mexican medicine by their anti-anxiety, anticonvulsant and tranquilizing properties. It has been reported that the alkaloids isolated from some species of the Annona have affinity to serotonergic 5-HT(1A) receptors and modulate dopaminergic transmission, which is involved in depressive disorders. To investigate the antidepressant-like effect of an alkaloid extract from the aerial parts of Annona cherimola (TA) in mice. The antidepressant-like effect was evaluated in the forced swimming test. To elucidate a possible mechanism of action, experiments of synergism with antidepressant drugs, such as imipramine (IMI), clomipramine (CLIMI), and fluoxetine (FLX), were carried out. The neurotransmitter content (DA: dopamine, 5HT: serotonin and its metabolites, HVA: homovanillic acid and 5HIAA: 5-hydroxyindoleacetic) in the whole brain of mice were also determined by HPLC method. TA chemical composition was determined using high performance liquid chromatography-electrospray mass spectrometry. The results showed that repeated treatment with TA produced antidepressant-like effects in mice. This effect was not related to an increase in locomotor activity. Administration of TA facilitated the antidepressant effect of IMI and CLIMI as well as increased the turnover of DA and 5-HT. The alkaloids: 1,2-dimethoxy-5,6,6a,7-tetrahydro-4H-dibenzoquinoline-3,8,9,10-tetraol, anonaine, liriodenine, and nornuciferine were the main constituents of TA. Results showed that TA produces an antidepressant-like action from a generalized increase in monominergic turnover, supporting the use in tradicional medicine of Annona cherimolia, and strongly suggest its therapeutic potency as an antidepressant agent. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  3. Estudio preliminar del potencial bioactivo de la Annona cherimola (anona y Prunus domestica (ciruelo cultivadas en Costa Rica

    Directory of Open Access Journals (Sweden)

    Mirtha Navarro-Hoyos

    2014-06-01

    Se ubicaron plantas de ambas especies, recolectándose los frutos que luego de su debido procesamiento fueron analizados en laboratorio en cuanto a su contenido de polifenoles y a su bioactividad. Asimismo se extrajeron estacas de las plantas para reproducción vegetativa tradicional y se sembraron en las comunidades de Cabuyal de San Pedro de Poás, Alajuela (Damas Verdes y Llano Bonito de León Cortés, San José (PROAL donde se trabajó con grupos de mujeres organizadas que elaboran productos artesanales como champú, cremas y aceites, contribuyendo con ellas en el adiestramiento con las buenas prácticas en laboratorio y la importancia del cuido del germoplasma.

  4. Fatty Acid Profile and Bioactivity from Annona hypoglauca Seeds Oil ...

    African Journals Online (AJOL)

    Plants from Annona (Annonaceae) genus are present in tropical regions, where they have economic and medicinal potential. Information on the fatty acids profile and bioactivity from seed oil of Annona species are incipient. The objective of this work was to investigate Annona hypoglauca seeds oil in terms of its yield, ...

  5. NATURAL PESTICIDES FROM SEEDS OF CHIRIMOYA (Annona cherimolia Mill.) AND GUANABANA (Annona muricata L.)

    OpenAIRE

    Rivera C., D.; Departamento Académico de Química Analítica, FQIQ Universidad Nacional Mayor de San Marcos Lima, Perú; Ale B., N.; Departamento Académico de Química Analítica, FQIQ Universidad Nacional Mayor de San Marcos Lima, Perú; Huamán M., J.; Departamento de Química Orgánica, FQIQ Universidad Nacional Mayor de San Marcos Lima, Perú; Muñoz H., P.; Departamento Académico de Fisicoquímica, FQIQ Universidad Nacional Mayor de San Marcos Lima, Perú; Rodríguez B., M.; Departamento Académico de Química Analítica, FQIQ Universidad Nacional Mayor de San Marcos Lima, Perú; Bravo A., M.; Departamento Académico de Química Analítica, FQIQ Universidad Nacional Mayor de San Marcos Lima, Perú; Delmás R., D.; Departamento Académico de Química Analítica, FQIQ Universidad Nacional Mayor de San Marcos Lima, Perú

    2014-01-01

    Seeds of chirimoya and guanabana from the communities of Cumbe and Callahuanca - Yauyos, Lima were analyzed. The extraction of natural toxic was realized using ethanol as the optimal solvent, after several solvent tests, phytochemicals analysis identified :saponins, coumarins, tannins, quinones and essential oils, mostly castor oil which was confirmed by FTIR spectra. Qualitative analysis results identified: PO4(3-), AsO4(3-) and others. Toxicological tests extracts applied on larvae and frui...

  6. Evaluation of reversible contraceptive activities of Annona ...

    African Journals Online (AJOL)

    Evaluation of reversible contraceptive activities of Annona squamosa (Linn.) ... Plant Products Research Journal ... Therefore the present study was undertaken to evaluate the contraceptive activities of methanol extract of the stem bark of Annoa squamosa L. (Annonaceae) with their respective reversibility in male rats.

  7. Germination ecophysiology of Annona crassiflora Mart. seeds

    NARCIS (Netherlands)

    Silva, da E.A.A.; Melo, de D.L.B.; Davide, A.C.; Bode, N.; Abreu, G.B.; Faria, J.M.R.; Hilhorst, H.W.M.

    2007-01-01

    Background and Aims Little is known about environmental factors that break morphophysiological dormancy in seeds of the Annonaceae and the mechanisms involved. The aim of this study was to characterize the morphological and physiological components of dormancy of Annona crassiflora, a tree species

  8. Neuropharmacological evaluation of Annona senegalensis leaves ...

    African Journals Online (AJOL)

    ... alkaloids, carbohydrates, reducing sugar, flavonoids and glycosides; while F7 tested positive for flavonoids. These findings suggest that leaves of A. senegalensis possess anticonvulsant, central depressant and anxiolytic-like properties attributable to flavonoids. Keywords: Annona senegalensis, anticonvulsant, anxiolytic, ...

  9. Study on the volatile oil contents of Annona glabra L., Annona squamosa L., Annona muricata L. and Annona reticulata L., from Vietnam.

    Science.gov (United States)

    Thang, T D; Dai, D N; Hoi, T M; Ogunwande, I A

    2013-01-01

    The volatile compounds identified from four species of Annona from Vietnam are being reported. The oils were obtained from aliquots of plant samples by steam distillation and subjected to GC and GC-MS analysis. The main compounds of Annona glabra L., were β-caryophyllene (21.5%) germacrene D (17.7%), α-cadinol (5.4%) and β-elemene (5.2%). Annona squamosa L., comprised mainly of α-pinene (1.0-11.9%), limonene (0.8-11.7%), β-cubebene (0.5-13.0%), β-caryophyllene (11.6-24.5%), spathulenol (0.8-9.0%), caryophyllene oxide (1.0-10.6%) and α-cadinol (3.3-7.8%). The significant constituents of Annona muricata L., were α-pinene (9.4%), β-pinene (20.6%), ρ-mentha-2,4(8)-diene (9.8%), β-elemene (9.1%) and germacrene D (18.1%). However, camphene (0.2-6.6%), α-copaene (2.0-7.3%), β-elemene (5.9-16.6%), β-caryophyllene (8.3-14.9%), β-bisabolene (0.4-10.2%), δ-cadinene (1.7-4.8%) and germacrene D (9.3-22.8%) were the main compounds common to samples of Annona reticulata L. There were significant amounts of sabinene (11.2% and 2.7%; leaf and stem bark) and bicycloelemene (9.6% and 6.1%; stem and bark).

  10. Morphoanatomical And Physico-Chemical Studies Of Annona ...

    African Journals Online (AJOL)

    The leaves of Annona reticulate Linn. (Annonaceae), commonly known as Bullock's heart, are frequently used as a substitute for Annona squamosa for the treatment of diabetes by various tribes in India. The leaves are also used for their powerful insecticidal activity, especially for destroying lice. Pharmacognostical study of ...

  11. ( Annona muricata Linn) Fruit and Molecular Docking Experiments

    African Journals Online (AJOL)

    Annona muricata (Soursop) has attracted attention due to its content of annonaceous acetogenins, a large family of naturally occurring polyketides isolated from various species of the genus Annonaceae. The ethyl acetate fraction of Annona muricata was subjected to standard isolation protocol-gradient and isocratic silica ...

  12. Novel cytotoxic annonaceous acetogenins from Annona muricata.

    Science.gov (United States)

    Chang, F R; Wu, Y C

    2001-07-01

    Seven new annonaceous acetogenins, muricins A-G (1-7), as well as five known compounds, a mixture of muricatetrocin A (8) and muricatetrocin B (9), longifolicin (10), corossolin (11), and corossolone (12), were isolated from the seeds of Annona muricata. The structures of all isolates were elucidated and characterized by spectral and chemical methods. These acetogenins showed significantly selective in vitro cytotoxicities toward the human hepatoma cell lines Hep G(2) and 2,2,15.

  13. Free Radical Scavenging Properties of Annona squamosa

    Science.gov (United States)

    Vikas, Biba; S, Akhil B; P, Remani; Sujathan, K

    2017-01-01

    Annona squamosa has extensively been used in the traditional and folkloric medicine and found to possess many biological activities. Different solvents, petroleum ether, chloroform, ethyl acetate and methanol extracts of Annona squamosa seeds (ASPE, ASCH, ASEA, ASME) have been used to prepare plant extracts. The present investigations dealt with the free radical scavenging activity of four extracts using various techniques such as total reducing power estimation, total phenolic count, 1,1-diphenyl-2-picryl hydrazyl (DPPH) radical scavenging effect, evaluation of ABTS cation decolorisation capacity, FRAP assay, hdroxyl radical scavenging assay, super oxide assay and Nitric oxide radical scavenging assay of the extracts. The results showed that the four extracts of Annona squamosa showed significant reducing power in four extracts. The total phenolic contents in petroleum ether, chloroform, ethyl acetate, methanol extracts and positive control were 0.64±0.17, 0.54±0.27, 0.49±0.24, 0.57±0.22 and 0.66±0.33. The antioxidant capacity by ABTS assay of ASPE, ASCH, ASEA, ASME and positive control, trolox showed 77.75±0.5,73.25±1.7,78.5± 1.2, 80 ± 0.8 μg/ml and 94.2 ± 0.9 respectively. The (50 % scavenging activity) SA50 of ASPE and ASCH, ASEA and ASME was found to be 34.4 µg/ml, 43.8 µg/ml 34.7 µg/m and 28.8 µg/ml respectively by DPPH assay. The percentage of hydroxyl radical scavenging increased with the increasing concentration of the extracts. ASPE, ASCH, ASEA and ASME showed superoxide radical scavenging activity, as indicated by their values 66 ± 0.5, 68 ± 1, 63 ± 1 and 70 ± 0.5 μg/ml respectively compared to gallic acid which was 97 ± 0.5 μg/ml. The values for scavenging of nitric oxide for ASPE, ASCH, ASEA and ASME were 91.0 ± 1.0, 66.75 ± 0.5, 71.75 ± 1.1 and 75.75 ± 1.15 μg/ml while value for standard ascorbic acid was 91.0 ± 1.0 μg/ml. The results revealed strong antioxidants in four extracts may lead to the development of potent

  14. Free Radical Scavenging Properties of Annona squamosa

    Science.gov (United States)

    Vikas, Biba; Akhil B, S; P, Remani; Sujathan, K

    2017-10-26

    Annona squamosa has extensively been used in the traditional and folkloric medicine and found to possess many biological activities. Different solvents, petroleum ether, chloroform, ethyl acetate and methanol extracts of Annona squamosa seeds (ASPE, ASCH, ASEA, ASME) have been used to prepare plant extracts. The present investigations dealt with the free radical scavenging activity of four extracts using various techniques such as total reducing power estimation, total phenolic count, 1,1-diphenyl-2-picryl hydrazyl (DPPH) radical scavenging effect, evaluation of ABTS cation decolorisation capacity, FRAP assay, hdroxyl radical scavenging assay, super oxide assay and Nitric oxide radical scavenging assay of the extracts. The results showed that the four extracts of Annona squamosa showed significant reducing power in four extracts. The total phenolic contents in petroleum ether, chloroform, ethyl acetate, methanol extracts and positive control were 0.64±0.17, 0.54±0.27, 0.49±0.24, 0.57±0.22 and 0.66±0.33. The antioxidant capacity by ABTS assay of ASPE, ASCH, ASEA, ASME and positive control, trolox showed 77.75±0.5,73.25±1.7,78.5± 1.2 , 80 ± 0.8 μg/ml and 94.2 ± 0.9 respectively. The (50 % scavenging activity) SA50 of ASPE and ASCH, ASEA and ASME was found to be 34.4 μg/ml, 43.8 μg/ml 34.7 μg/m and 28.8 μg/ml respectively by DPPH assay. The percentage of hydroxyl radical scavenging increased with the increasing concentration of the extracts. ASPE, ASCH, ASEA and ASME showed superoxide radical scavenging activity, as indicated by their values 66 ± 0.5, 68 ± 1 ,63 ± 1 and 70 ± 0.5 μg/ml respectively compared to gallic acid which was 97 ± 0.5 μg/ml. The values for scavenging of nitric oxide for ASPE, ASCH, ASEA and ASME were 91.0 ± 1.0, 66.75 ± 0.5, 71.75 ± 1.1 and 75.75 ± 1.15 μg/ml while value for standard ascorbic acid was 91.0 ± 1.0 μg/ml. The results revealed strong antioxidants in four extracts may lead to the development of potent

  15. Dicty_cDB: Contig-U15047-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cultivar Zhongnong... 79 5e-13 AF401757_1( AF401757 |pid:none) Annona cherimola x Annona...0 2e-12 AF443280_1( AF443280 |pid:none) Annona cherimola ACC synthase mRNA... 77 2e-12 CP001173_615( CP00117

  16. Cohibins C and D, two important metabolites in the biogenesis of acetogenins from Annona muricata and Annona nutans.

    Science.gov (United States)

    Gleye, C; Raynaud, S; Fourneau, C; Laurens, A; Laprévote, O; Serani, L; Fournet, A; Hocquemiller, R

    2000-09-01

    Two new annonaceous acetogenins, cohibins C (1a) and D (1b), have been isolated by extensive chromatography of a hexane extract of Annona muricata seeds and a cyclohexane extract of Annona nutans root bark. Their structures have been established on the basis of spectral evidence (NMR, MS) and confirmed by chemical transformation into a pair of monotetrahydrofuran (mono-THF) acetogenins. The role of these compounds in the biogenesis of mono-THF acetogenins is discussed.

  17. Eksplorasi dan uji biolarvasida fraksi daun tanaman marga Annona terhadap larva nyamuk Aedes aegypti dan Culex quinquefasciatus

    OpenAIRE

    Hamidah Hamidah

    2001-01-01

    The research aim wants to know: (1) Lethal Concentration (LC90) leaves fraction of Annona muricata, Annona squamosal, and Annona reticulate that caused death of third instar larvae of Aedes aegypti and Culex quinguefasciatus. The experimental method was used in research with completely random design. Each concentration was replicated five times. After introducing bioassay was done, five concentration used at real bioassay. For knowing LC90 from leaves fraction of Annona muricata, Annona squam...

  18. Annona species (Annonaceae): a rich source of potential antitumor agents?

    Science.gov (United States)

    Tundis, Rosa; Xiao, Jianbo; Loizzo, Monica R

    2017-06-01

    Plants have provided the basis of traditional medicine systems throughout the world for thousands of years and continue to yield molecules for new remedies. We analyzed studies published from 2009 to 2016 on the Annona species (Annonaceae), including A. coriacea, A. crassifolia, A. hypoglauca, A. muricata, A. squamosa, A. sylvatica, and A. vepretorum, as sources of potential antitumor agents. Here, we report and discuss the mechanisms of action and structure-activity relationships of the most active Annona constituents. Annonaceous acetogenins are one of the most promising classes of natural products, owing to their potential antitumor activity. However, their neurotoxicity should not be underestimated. © 2017 New York Academy of Sciences.

  19. OVERCOMING SEED DORMANCY IN Annona macroprophyllata AND Annona purpureaUSING PLANT GROWTH REGULATORS

    Directory of Open Access Journals (Sweden)

    GISELA FERREIRA

    Full Text Available ABSTRACT Some Annonaceae seeds are known to exhibit dormancy mechanisms ranging from possible seed coat impermeability to physiological dormancy. Thus, the aim of this study was to evaluate the effects of gibberellin (GA GA3 and GA4+7 + benzyladenine (GA4+7 + BA application in seeds of Annona macroprophyllata Donn. Sm (papausa and Annona purpurea Moc. & Sessé ex Dunal (chincuya. The experiment was performed by the application of GA3 and GA4+7 + BA on seeds in concentrations of 0, 200, 400, 500, 600, 800 and 1000 mg L-1. The regulators broke the dormancy of both species. However, application of the GA4+7 + BA mixture had more significant results, with greater increases in germination in A. macroprophyllata than in A. purpurea. Treatments that promoted the highest germinations were GA4+7 + BA at a concentration of 200 mg L-1 for A. macroprophyllata (77% and 200 mg L-1 of GA4+7 + BA and 500 mg L-1 of GA3 for A. purpurea (30% and 29%, respectively. Rate index, mean time and frequency of germination were distinct for both species and both treatments. Although both GA3 and GA4+7 + BA promote germination, the GA4+7 + BA mixture was more effective than GA3 to overcoming seed dormancy of both species, A. purpurea has a harder dormancy than A. macroprophyllata

  20. Extracts from Annona Muricata L. and Annona Reticulata L. (Annonaceae) Potently and Selectively Inhibit Plasmodium Falciparum

    Science.gov (United States)

    Yamthe, Lauve Rachel Tchokouaha; Fokou, Patrick Valere Tsouh; Mbouna, Cedric Derick Jiatsa; Keumoe, Rodrigue; Ndjakou, Bruno Lenta; Djouonzo, Paul Toukam; Mfopa, Alvine Ngoutane; Legac, Jennifer; Tsabang, Nole; Gut, Jiri; Rosenthal, Philip J.; Boyom, Fabrice Fekam

    2015-01-01

    The aim of this work was to screen extracts from Annona muricata and Annona reticulata in vitro against Plasmodium falciparum. Crude ethanolic extracts, methylene chloride fractions, aqueous fractions, subfractions and isolated compounds (stigmasterol-3-O-β-d-glucopyranoside, lichexanthone, gallic acid and β-sitosterol-3-O-β-d-glucopyranoside) were tested for cytotoxicity on erythrocytes and Human Foreskin Fibroblasts cells and against the W2 strain of P. falciparum in culture. Results indicated that none of the extracts was cytotoxic at concentrations up to 10 µg/mL. Most of the extracts, fractions and subfractions inhibited the growth of P. falciparum with IC50 values ranging from 0.07 to 3.46 µg/mL. The most potent was the subfraction 30 from A. muricata stem bark (IC50 = 0.07 µg/mL) with a selectivity index of ˃ 142. Subfraction 3 from A. muricata root also exhibited very good activity (IC50 = 0.09 µg/mL) with a high selectivity index (SI ˃ 111). Amongst the isolated compounds, only gallic acid showed activity with IC50 of 3.32 µg/mL and SI > 10. These results support traditional claims for A. muricata and A. reticulata in the treatment of malaria. Given their limited cytotoxicity profile, their extracts qualify as promising starting points for antimalarial drug discovery. PMID:28930201

  1. Extracts from Annona Muricata L. and Annona Reticulata L. (Annonaceae) Potently and Selectively Inhibit Plasmodium Falciparum.

    Science.gov (United States)

    Yamthe, Lauve Rachel Tchokouaha; Fokou, Patrick Valere Tsouh; Mbouna, Cedric Derick Jiatsa; Keumoe, Rodrigue; Ndjakou, Bruno Lenta; Djouonzo, Paul Toukam; Mfopa, Alvine Ngoutane; Legac, Jennifer; Tsabang, Nole; Gut, Jiri; Rosenthal, Philip J; Boyom, Fabrice Fekam

    2015-04-30

    The aim of this work was to screen extracts from Annona muricata and Annona reticulata in vitro against Plasmodium falciparum . Crude ethanolic extracts, methylene chloride fractions, aqueous fractions, subfractions and isolated compounds (stigmasterol-3- O -β-d-glucopyranoside, lichexanthone, gallic acid and β-sitosterol-3- O -β-d-glucopyranoside) were tested for cytotoxicity on erythrocytes and Human Foreskin Fibroblasts cells and against the W2 strain of P. falciparum in culture. Results indicated that none of the extracts was cytotoxic at concentrations up to 10 µg/mL. Most of the extracts, fractions and subfractions inhibited the growth of P. falciparum with IC 50 values ranging from 0.07 to 3.46 µg/mL. The most potent was the subfraction 30 from A. muricata stem bark (IC 50 = 0.07 µg/mL) with a selectivity index of ˃ 142. Subfraction 3 from A. muricata root also exhibited very good activity (IC 50 = 0.09 µg/mL) with a high selectivity index (SI ˃ 111). Amongst the isolated compounds, only gallic acid showed activity with IC 50 of 3.32 µg/mL and SI > 10. These results support traditional claims for A. muricata and A. reticulata in the treatment of malaria. Given their limited cytotoxicity profile, their extracts qualify as promising starting points for antimalarial drug discovery.

  2. Coumarinolignans from the Seeds of Annona squamosa Linn.

    OpenAIRE

    Ranjan, Rakesh; Sahai, Mahendra

    2009-01-01

    Phytochemical investigations of Annona squamosa seeds have led to the isolation of three lignans consisting of coumarin moiety, cleomiscosin A (1), cleomiscosin B (2) and cleomiscosin C (3). Their structures were arrived at by detailed spectroscopic analysis. Cleomiscosin A and cleomiscosin B are position isomer.

  3. Coumarinolignans from the Seeds of Annona squamosa Linn.

    Directory of Open Access Journals (Sweden)

    Rakesh Ranjan

    2009-01-01

    Full Text Available Phytochemical investigations of Annona squamosa seeds have led to the isolation of three lignans consisting of coumarin moiety, cleomiscosin A (1, cleomiscosin B (2 and cleomiscosin C (3. Their structures were arrived at by detailed spectroscopic analysis. Cleomiscosin A and cleomiscosin B are position isomer.

  4. Genetic diversity of Annona senegalensis Pers. populations as ...

    African Journals Online (AJOL)

    Annona senegalensis Pers. is one of the wild fruit tree for domestication in southern Africa. An assessment of the genetic diversity in A. senegalensis would assist in planning for future germplasm collection, conservation and fruit domestication programmes. During 2004 to 2006 nine populations were collected from different ...

  5. In vivo antimalarial and cytotoxic properties of Annona senegalensis ...

    African Journals Online (AJOL)

    The in vivo animal antimalarial and in vitro cytotoxic activities of the methanol extract of Annona senegalensis Pers. (Annonaceae) was investigated in this study. The in vivo antimalarial activity of the methanol extract against Plasmodium berghei was assessed using the 4-day suppressive test procedure. The extract of A.

  6. The allelopathic effects of crude water extracts of Annona muricata ...

    African Journals Online (AJOL)

    Annona muricata (sour sop) belongs to the family Annonaceae. This plant inhibits the growth of other plants growing around it, a phenomenon called “allelopathic effect”. Allelopathy is the production of specific biomolecules by plant species mostly secondary metabolites that can induce suffering or give benefit to other plant ...

  7. Potentials of Annona muricata Linnaeus (Annonaceae) as a ...

    African Journals Online (AJOL)

    A study was carried out on the bioactivity of ethanolic extract of Annona muricata Linn. (Annonaceae) as protectant at different concentrations (0, 0.25, 0.50, 0.75, 1.00g/L). against Callosobruchus maculatus Fabricius (Coleptera: Bruchidae) in stored cowpea seeds. Its effect was also investigated on adult mortality, ...

  8. Anti hyperglycemic activities of Annona muricata (Linn) | Aderibigbe ...

    African Journals Online (AJOL)

    This study was designed to determine the effects of methanolic extracts of Annona muricata (Linn) on the blood glucose level of streptozotocin-induced diabetic Wistar rats. Thirty adult Wistar rats were randomly assigned into three groups (A, B and C) of ten rats each. Group A was the control, Group B was untreated ...

  9. Three new megastigmanes from the leaves of Annona muricata.

    Science.gov (United States)

    Matsushige, Ayano; Matsunami, Katsuyoshi; Kotake, Yaichiro; Otsuka, Hideaki; Ohta, Shigeru

    2012-04-01

    Three new megastigmanes (1-3), named annoionols A and B (1, 2) and annoionoside (3), were isolated from the leaves of Annona muricata L. (Annonaceae) together with 14 known compounds (4-17). Among the known compounds, annoionol C (4) was isolated from a natural source for the first time. The structures of all compounds were elucidated by spectroscopic and chemical analyses.

  10. Cytotoxicity and antileishmanial activity of Annona muricata pericarp.

    Science.gov (United States)

    Jaramillo, M C; Arango, G J; González, M C; Robledo, S M; Velez, I D

    2000-04-01

    Hexane, ethyl acetate and methanol extracts of Annona muricata pericarp were tested in vitro against Leishmania braziliensis and L. panamensis promastigotes, and against cell line U-937. The ethyl acetate extract was more active than the other extracts and even of Glucantime used as reference substance. Its fractionation led to the isolation of three acetogenins--annonacin, annonacin A and annomuricin A.

  11. Assessment of Annona reticulata Linn. leaves fractions for invitro ...

    African Journals Online (AJOL)

    Since from long time the plant, Annona reticulata Linn. is known for its beneficial effects. Leaves of A. reticulata were screened for phytochemicals and in vitro antioxidant, antibacterial and antifungal activity. The shade dried leaves were extracted with methanol and aqueous methanolic extract was partitioned successively ...

  12. Chemopreventive effect of Annona muricata on DMBA-induced cell ...

    African Journals Online (AJOL)

    J.B. Minari

    2014-05-24

    May 24, 2014 ... Terpenoid. +. 3. Steroid. +. 4. Flavonoids. +. 5. Cardiac glycoside. +. 6. Tannin. +. 7. Phenol. +. 8. Phlobatannin. А. 9. Alkaloid. +. 10. Reducing sugar. +. Key: (+), Presence of phytochemical; (А), Absence of phytochemical. Chemopreventive effect of Annona muricata on DMBA-induced cell proliferation. 329 ...

  13. Genomic DNA extraction method from Annona senegalensis Pers ...

    African Journals Online (AJOL)

    ... with starches. The isolated DNA proved amenable to polymerase chain reaction (PCR) amplification and restriction digestion. This technique is fast, reproducible, and can be applied for simple sequence repeats (SSR)-PCR markers identification. Key words: Annona senegalensis, genomic DNA, fruits, modified, markers.

  14. Phytochemical screening, cytotoxicity and acute toxicity of Annona ...

    African Journals Online (AJOL)

    Phytochemical screening, cytotoxicity and acute toxicity of Annona vepretorum Mart (Annonaceae) leaf extracts. Mariana G e Silva, Ana P de Oliveira, Camila de S Araújo, Érica M de Lavor, Juliane C Silva, Rosemairy L Mendes, Cláudia do Ó Pessoa, Marcília P Costa, Jackson R G da S Almeida ...

  15. Nutritional composition of Annona crassiflora pulp and acceptability of bakery products prepared with its flour

    Directory of Open Access Journals (Sweden)

    Paula Villela

    2013-09-01

    Full Text Available Annona crassiflora offers an edible fruit native to the Savanna. This study aimed to develop a flour meal from Annona crassiflora pulp; analyze the chemical composition of the fresh pulp and its flour; develop and verify the acceptance of formulations with different concentrations of the flour of Annona crassiflora pulp. Fruit used were selected and processed. The pulp was dried in an oven at 60-65 ºC/48h. We analyzed the chemical composition, and two formulations of breads were prepared with 10 and 20% Annona crassiflora pulp. The results showed that the drying of Annona crassiflora pulp enriched its nutritional value. The Annona crassiflora pulp showed important chemical components, as insoluble fibers (pulp and flour, minerals (potassium, calcium, manganese and others and antioxidant compounds. The formulations were well-accepted in a sensory point of view and proved to be a good alternative to the exploitation of the fruit.

  16. Antitumor activity of Annona squamosa seed oil.

    Science.gov (United States)

    Chen, Yong; Chen, Yayun; Shi, Yeye; Ma, Chengyao; Wang, Xunan; Li, Yue; Miao, Yunjie; Chen, Jianwei; Li, Xiang

    2016-12-04

    Custard apple (Annona squamosa Linn.) is an edible tropical fruit, and its seeds have been used to treat "malignant sore" (cancer) and other usage as insecticide. A comparison of extraction processes, chemical composition analysis and antitumor activity of A. squamosa seed oil (ASO) were investigated. The optimal extraction parameters of ASO were established by comparing percolation, soxhlet, ultrasonic and SFE-CO 2 extraction methods. The chemical composition of fatty acid and content of total annonaceous acetogenins (ACGs) of ASO was investigated by GC-MS and colorimetric assay, and anti-tumor activity of ASO was tested using H 22 xenografts bearing mice. The optimal extraction parameters of ASO were obtained as follows: using soxhlet extraction method with extraction solvent of petroleum ether, temperature of 80°C, and extraction time of 90min. Under these conditions, the yield of ASO was 22.65%. GC-MS analysis results showed that the main chemical compositions of fatty acid of ASO were palmitic acid (9.92%), linoleic acid (20.49%), oleic acid (56.50%) and stearic acid (9.14%). The total ACGs content in ASO was 41.00mg/g. ASO inhibited the growth of H 22 tumor cells in mice with a maximum inhibitory rate of 53.54% by oral administration. Furthermore, it was found that ASO exerted an antitumor effect via decreasing interleukin-6 (IL-6), janus kinase (Jak) and phosphorylated signal transducers and activators of transcription (p-Stat3) expression. The results demonstrated that ASO suppressed the H 22 solid tumor development may due to its main chemical constituents unsaturated fatty acid and ACGs via IL-6/Jak/Stat3 pathway. ASO may be a potential candidate for the treatment of cancer. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  17. Germination Ecophysiology of Annona crassiflora Seeds

    Science.gov (United States)

    da Silva, Edvaldo A. A.; de Melo, Daniel L. B.; Davide, Antonio C.; de Bode, Nienke; Abreu, Guilherme B.; Faria, José M. R.; Hilhorst, Henk W. M.

    2007-01-01

    Background and Aims Little is known about environmental factors that break morphophysiological dormancy in seeds of the Annonaceae and the mechanisms involved. The aim of this study was to characterize the morphological and physiological components of dormancy of Annona crassiflora, a tree species native to the Cerrado of Brazil, in an ecophysiological context. Methods Morphological and biochemical characteristics of both embryo and endosperm were monitored during dormancy break and germination at field conditions. Seeds were buried in the field and exhumed monthly for 2 years. Germination, embryo length and endosperm digestion, with endo-β-mannanase activity as a marker, were measured in exhumed seeds, and scanning electron microscopy was used to detect cell division. The effect of constant low and high temperatures and exogenous gibberellins on dormancy break and germination was also tested under laboratory conditions. Key Results After burial in April, A. crassiflora seeds lost their physiological dormancy in the winter months with lowest monthly average minimum temperatures (May–August) prior to the first rainfall of the wet season. The loss of physiological dormancy enabled initiation of embryo growth within the seed during the first 2 months of the rainy season (September–October), resulting in a germination peak in November. Embryo growth occurred mainly through cell expansion but some dividing cells were also observed. Endosperm digestion started at the micropylar side around the embryo and diffused to the rest of the endosperm. Exogenous gibberellins induced both embryo growth and endo-β-mannanase activity in dormant seeds. Conclusions The physiological dormancy component is broken by low temperature and/or temperature fluctuations preceding the rainy season. Subsequent embryo growth and digestion of the endosperm are both likely to be controlled by gibberellins synthesized during the breaking of physiological dormancy. Radicle protrusion thus

  18. Anti hyperglycemic activities of Annona muricata (Linn).

    Science.gov (United States)

    Adeyemi, David Olawale; Komolafe, Omobola Aderibigbe; Adewole, Olarinde Stephen; Obuotor, Efere Martins; Adenowo, Thomas Kehinde

    2008-10-25

    This study was designed to determine the effects of methanolic extracts of Annona muricata (Linn) on the blood glucose level of streptozotocin-induced diabetic Wistar rats. Thirty adult Wistar rats were randomly assigned into three groups (A, B and C) of ten rats each. Group A was the control, Group B was untreated hyperglycemic group and group C was A. muricata-treated group. Hyperglycemia was induced in groups B and C by a single intraperitoneal injection of 80 mg/kg streptozotocin dissolved in 0.1 M citrate buffer. The control group was intraperitoneally injected with equivalent volume of citrate buffer and all the animals were monitored for four weeks. Daily intra peritoneal injection of 100 mg/kg A. muricata was administered to group C rats for two weeks and the animals were monitored for another two weeks. The data obtained were analyzed with descriptive and inferential statistics. The result showed a mean body weight of 206 +/- 7.74 g, 173.29+/-5.13 g and 197 +/- 5.62 g respectively for the control, untreated diabetic and A. muricata-treated diabetic group, and a mean blood glucose concentration of 3.78 +/- 0.190 mmol/L, 21.64 +/- 2.229 mmol/L and 4.22 +/- 0.151 mmol/L for the control, untreated diabetic and treated diabetic groups respectively. A significant difference exists between the blood glucose concentrations of treated and untreated hyperglycemic groups of rats. The result of this study demonstrated that A. muricata possesses anti-hyperglycemic activities.

  19. [Low Polar Constituents from Annona squamosa Fruit Pericarp].

    Science.gov (United States)

    Chen, Ya-yun; Bai, Gang-gang; Chen, Yong; Li, Xiang

    2015-07-01

    To study the low polar constituents from Annona squamosa fruit pericarp. The fruit pericarp was percolated with 95% EtOH at room temperature. The extract was subjected to Silica gel chromatography and eluted with gradually more polar and EtOAc-MeOH mixtures. The part eluted range Pet-EtOAc from 5:1 to 1:1 was subjected to repeated column chromatography. The constituents were identified by physicochemical property and NMR data. Eight constituents were isolated and identified as tricosane(1), β-sitosterol(2), succinic acid (3), annosquamosin D(4), 4α-hydroxy-19-nor-(E)-kauran-17-oic acid(5), (E)-16β, 17-dihydroxy-kauran-19-oic acid(6), (E)-16α, 17-dihydroxy-kauran-19-oic acid(7), and 16β-hydroxy-17-acetoxy-(E)-kauran-19-oic acid(8). All constituents are firstly isolated from Annona squamosa fruit pericarp except compound 6.

  20. Acetogenins in Annona muricata L. (annonaceae) leaves are potent molluscicides.

    Science.gov (United States)

    Luna, J De S; De Carvalho, J M; De Lima, M R F; Bieber, L W; Bento, Edson De S; Franck, X; Sant'ana, A E G

    2006-03-01

    An ethanolic extract of the leaves of Annona muricata was shown to be toxic to adult forms of the snail Biomphalaria glabrata (LC50 9.32 microg mL(-1)) and to larvae of the brine shrimp Artemia salina (LC50 0.49 microg mL(-1)). Activity-guided fractionation of the extract gave rise to a sample with high molluscicidal activity that contained the acetogenins, annonacin (90%), isoannonacin (6%) and goniothalamicin (4%).

  1. Apolar Annonaceous acetogenins from the fruit pulp of Annona muricata.

    Science.gov (United States)

    Melot, Alice; Fall, Djibril; Gleye, Christophe; Champy, Pierre

    2009-11-02

    A methylene chloride extract of the pulp of Annona muricata L. was fractionated in search for scarcely functionalized Annonaceous acetogenins (type E). Previously known C-35 and C-37 mono-epoxy unsaturated compounds, epomuricenins-A and -B (1+2) and epomusenins-A and -B (3+4), were obtained. Two new mono-epoxy saturated C-35 representatives, epomurinins-A and -B (5+6) were also isolated.

  2. Hepatoprotective activity of Annona muricata Linn. and Polyalthia cerasoides bedd.

    Science.gov (United States)

    Padma, P; Chansouria, J P; Khosa, R L

    1999-07-01

    The hepatoprotective effect of Annona muricata and Polyalthia cerasoides (Annonaceae) were monitored by estimating the serum transaminases (SGOT and SGPT), serum alkaline phosphatase (SALP), liver and brain lipid peroxidation (LOP) and their total protein content. Both drugs at a dose of 100 μg/kg significantly prevented the increase in serum transaminases, SALP, liver and brain LOP and decrease in liver and brain total protein content following carbontetrachloride (CCl) induced hepatoxicity in albino rats.

  3. Safety of Annona muricata Extract Supplementation for Colorectal Cancer Patients

    OpenAIRE

    Lili Indrawati; Purwantyastuti; Murdani Abdullah; Ingrid S Surono; Ibrahim Basir

    2016-01-01

    Background: People have used Annona muricata leaves traditionally as tea drinks. Traditional use of A. muricata leaves is as an infusion which is closed to water extract. The potential health benefit of A. muricata tea leaves that is traditionally used for maintaining health which lately is being used by cancer patients. Therefore it is urgent to verify the safety of A. muricata leaves extract. Method: A randomized double blind placebo controlled trial was conducted on 30 colorectal canc...

  4. Characterization of the chemical composition of the essential oils from Annona emarginata (Schltdl.) H. Rainer 'terra-fria' and Annona squamosa L.

    OpenAIRE

    Campos,Felipe Girotto; Baron,Daniel; Marques,Marcia Ortiz Mayo; Ferreira,Gisela; Boaro,Carmen Silvia Fernandes

    2014-01-01

    The objective of this study was to characterize the chemical composition of the essential oil from the leaves of Annona emarginata (Schltdl.) H. Rainer 'terra-fria' and Annona squamosa L. The species were grown in a greenhouse for 18 months, which nutrient solution was applied weekly; the plants were then harvested and the leaves dried to extract the essential oil. The essential oil was analyzed by gas chromatography and mass spectrometry to study its chemical profiles. Eleven substances were...

  5. Anti-Acetylcholinesterase Alkaloids from Annona glabra Leaf.

    Science.gov (United States)

    Lee, Shoei-Sheng; Wu, Dong-Yi; Tsai, Sheng-Fa; Chen, Chien-Kuang

    2015-06-01

    Bioassay guided fractionation and separation of the EtOH extract of Annona glabra leaf against acetylcholinesterse led to the characterization of 15 alkaloids. Among them, (-)-actinodaphnine (2) and (-)-(6aS,7R)-7-hydroxyactinodaphnine (9) are new aporphines, although (+)-2 and (±)-2 have been found in several plants. Their structures were established by spectroscopic analysis. (-)-Anolobine (5) and (-)-roemeroline (8) showed moderate inhibitory activity against eel acetylcholinesterase with IC50 values of 22.4 and 26.3 μM, respectively.

  6. Agricultural waste Annona squamosa peel extract: Biosynthesis of silver nanoparticles

    Science.gov (United States)

    Kumar, Rajendran; Roopan, Selvaraj Mohana; Prabhakarn, Arunachalam; Khanna, Venkatesan Gopiesh; Chakroborty, Subhendu

    2012-05-01

    Development of reliable and eco-friendly process for the synthesis of metallic nanoparticles is an important step in the field of application of nanotechnology. We have developed modern method by using agriculture waste to synthesize silver nanoparticles by employing an aqueous peel extract of Annona squamosa in AgNO3. Controlled growth of silver nanoparticles was formed in 4 h at room temperature (25 °C) and 60 °C. AgNPs were irregular spherical in shape and the average particle size was about 35 ± 5 nm and it is consistent with particle size obtained by XRD Scherer equation.

  7. Cytotoxic bistetrahydrofuran annonaceous acetogenins from the seeds of Annona squamosa.

    Science.gov (United States)

    Chen, Yong; Chen, Jian-Wei; Li, Xiang

    2011-11-28

    Three new bistetrahydrofuran annonaceous acetogenins (1-3) were isolated from a 95% EtOH extract of Annona squamosa seeds. Four known annonaceous acetogenins, uvarigrandin A (4), bullatacin (5), squamostatin-A (6), and squamostatin-D (7), were also isolated. Their structures were elucidated by spectroscopic analyses, and the absolute configurations of the carbinol centers of 1-3 were defined by application of the Mosher method. These compounds all exhibited significant cytotoxic activity in vitro against five human tumor cell lines.

  8. Four cytotoxic annonaceous acetogenins from the seeds of Annona squamosa.

    Science.gov (United States)

    Miao, Y; Xu, X; Yuan, F; Shi, Y; Chen, Y; Chen, J; Li, X

    2016-06-01

    Four new annonaceous acetogenins (ACGs), squamocin-I (1), II (2) and III (3) and squamoxinone-D (4), together with seven known ACGs (5-11), were isolated from the seeds of Annona squamosa. The structures of all isolates were elucidated and characterised by spectral and chemical methods. Compounds 1-4 were evaluated for their cytotoxicities against Hep G2, SMMC 7721, BEL 7402, BGC 803 and H460 human cancer cell lines. Compound 1 exhibited better potent activity than the positive compound and compound 3 shows selectively cytotoxical activity against H460 with IC50 values of 0.0492 μg/ml.

  9. Novel cytotoxic monotetrahydrofuranic Annonaceous acetogenins from Annona montana.

    Science.gov (United States)

    Liaw, Chih-Chuang; Chang, Fang-Rong; Chen, Shu-Li; Wu, Chin-Chung; Lee, Kuo-Hsiung; Wu, Yang-Chang

    2005-08-01

    Four new monotetrahydrofuranic Annonaceous acetogenins, montalicins G (1) and H (2) and monlicins A (3) and B (4), and two new linear acetogenins, (+)-monhexocin (5) and (-)-monhexocin (6), as well as three known compounds, murisolin (7), 4-deoxyannomontacin (8), and muricatacin (9), were isolated from the seeds of Annona montana by high performance liquid chromatographic (HPLC) method. The absolute stereochemical structures of new isolates were elucidated and characterized by spectral and chemical methods. Interestingly, these compounds show special cytotoxicity against human hepatoma cells, Hep G2.

  10. Annona muricata aqueous extract suppresses T47D breast cancer cell proliferation

    Directory of Open Access Journals (Sweden)

    Ika Fidianingsih

    2015-12-01

    The proliferative inhibition of soursop leaves against T47D breast cancer cells is higher than that of soursop fruits and seeds. Annona muricata fruit, seed, and leaf aqueous extracts were less toxic than tamoxifen

  11. KONSENTRASI DAN WAKTU PENDEDAHAN EFEKTIF EKSTRAK DAUN SIRSAK (Annona muricata L) SEBAGAI LARVASIDA HAYATI JENTIK Aedes aegypti

    OpenAIRE

    Luluk Kusnatin; M. Arief Soendjoto; Eko Rini Indrayatie; Taufiqur Rohman

    2016-01-01

    Crop Sirsak (Annona Muricata L.) having potency as larvasida involve. use Larvasida involve the peaceful relative because the residu easy to degradasi and non relative contaminate the environment. This research aim to specify the concentration of extract Annona muricata L leaf effective kill to wiggler of  Aedes aegypti, specifying concentration influence with the disclosure time and specify  of concentration and disclosure time of extract Annona muricata L leaf with the death wiggler of Aede...

  12. PENGARUH KONSENTRASI AIR REBUSAN DAUN SIRSAK (Annona muricata Linn) TERHADAP PERTUMBUHAN LARVA NYAMUK Aedes aegypti

    OpenAIRE

    Diah Ariana

    2016-01-01

    PENGARUH KONSENTRASI AIR REBUSAN DAUN SIRSAK (Annona muricata Linn) TERHADAP PERTUMBUHAN LARVA NYAMUK Aedes aegypti Diah Ariana, ST, M.Kes Prodi D3 Analis Kesehatan UM Surabaya   Abstract Leaves of the soursop (Annona muricata Linn) Indonesia is known as a medicinal plant that can treat a variety of diseases other than as a cure soursop leaves is also an insecticide-producing plants are bioactive compounds known as acetogenin which are bioactive compounds in high concent...

  13. Annona muricata aqueous extract suppresses T47D breast cancer cell proliferation

    OpenAIRE

    Ika Fidianingsih; Ety Sari Handayani

    2014-01-01

    Background Cancer is a dreadful disease caused by abnormal and uncontrolled cell division. Annona muricata L, also known as soursop, is useful as an anticancer herbal medication since its leaves, seeds and fruits contain active compounds called annonaceous acetogenins. The objective of this study was to scientifically justify the traditional application of soursop for anticancer treatment in the community, by comparing the antiproliferative effect of Annona muricata L leaf, seed and fruit ...

  14. Estudio químico en especies cubanas del género Annona II: Annona sclerophylla Safford

    Directory of Open Access Journals (Sweden)

    Daisy Sandoval López

    2002-08-01

    Full Text Available Se informan los resultados obtenidos del estudio del contenido de alcaloides en las hojas y tallos de la especie endémica cubana Annona sclerophylla, de discreta actividad antimicrobiana. Para la extracción y purificación de dichos metabolitos se utilizaron solventes orgánicos y métodos cromatográficos de separación por columna. Con el empleo de técnicas espectroscópicas de UV, IR, masa y RMN1H y 13C, así como por la medición de sus constantes físicas, se identificaron los alcaloides isocorypalmina y liriodenina, y los compuestos (--kau-16-en-19-oico y (--kauran-16alfa-o1.This paper presents the results of the study of the alkaloid contents in leaves and stems of the Cuban endemic species called Annona sclerophylla that has modest antimicrobial effects. For the extraction and purification of such metabolites, organic solvents and chromatographic methods of separation by columns are used. Spectroscopic techniques like UV, IR, mass and NMR1H and 13C as well as the measurement of physical constants allowed identifying alkaloids isocorypalmine and liriodenine, and compounds (--kau-16-en-19-oico and (--kauran-16µ-o1.

  15. Biomass torrefaction mill

    Science.gov (United States)

    Sprouse, Kenneth M.

    2016-05-17

    A biomass torrefaction system includes a mill which receives a raw biomass feedstock and operates at temperatures above 400 F (204 C) to generate a dusty flue gas which contains a milled biomass product.

  16. Alkaloids from aerial parts of Annona senegalensis against Streptococcus mutans.

    Science.gov (United States)

    Lall, N; Kishore, N; Bodiba, D; More, G; Tshikalange, E; Kikuchi, H; Oshima, Y

    2017-08-01

    Antimicrobial potential of medicinal plants have been explored extensively these days. This study was carried out to evaluate the antibacterial potential from aerial parts of plant, called 'Annona senegalensis' and its constituents. Bioassay guided fractionation led to the isolation of four metabolites, (+)-catechin (1), (-)-anonaine (2), (-)-asimilobine (3) and (+)-nornantenine (4). This is the first report on the isolation of compounds 1, 3 and 4 from this plant. Compounds 2 and 4 showed good activity, whereas 1 and 3 displayed weak inhibition against Streptococcus mutans (ATCC 25175). The results showed that compound 2 and 3 showed significant activity with a minimum inhibition concentration (MIC) of 0.12 and 0.25 mg/mL, respectively. The present study reports for the first time the antibacterial activity of the extract of A. senegalensis and its constituents. As S. mutans is a rather resistant bacteria, the MIC obtained during the present study is significant.

  17. Potential Benefits of Annona muricata in Combating Cancer: A Review

    Science.gov (United States)

    Ab Rahman, Husna Syakirah; Wong, Michael Pak Kai; Wan Zain, Wan Zainira

    2018-01-01

    The incidence of cancer is increasing each year, which generates concerns regarding the efficacy of the current treatment options. This has caused patients to seek alternatives to complement or to replace surgery, chemotherapy and radiotherapy. Annona muricata and other plants have been shown to have promising compounds that can be utilised in the treatment of cancer. Native to the tropical and subtropical parts of the world, A. muricata plant extracts contain compounds that are particularly effective against cancer cells. In light of increasing concerns regarding the limitations of cancer treatment in hospitals, this review attempts to highlight the benefits of A. muricata and its potential to be integrated as one of the treatment options against cancer. PMID:29599630

  18. Nematicidal activity of Annona crassiflora leaf extract on Caenorhabditis elegans.

    Science.gov (United States)

    Machado, Alan Rodrigues Teixeira; Ferreira, Sebastião Rodrigo; da Silva Medeiros, Felipe; Fujiwara, Ricardo Toshio; de Souza Filho, José Dias; Pimenta, Lúcia Pinheiro Santos

    2015-02-19

    The aim of this work was to investigate the potential nematicidal activity of Annona crassiflora leaf extract against Caenorhabditis elegans. The hydroalcoholic leaf extract and its fractions (dichloromethane, ethyl acetate, methanol and water) were submitted to mobility assay against the roundworm Caenorhabditis elegans. GC-MS and NMR analysis were performed in order to identify metabolites. The dichloromethane and ethyl acetate fractions showed to be the most active among the hydroalcoholic leaf extracts and its four fractions. The percentages of C. elegans larvae immobility were 98.13 and 89.66%, respectively, at a concentration of 1000 μg.mL(-1). Besides some amino acids, palmitic acid methyl ester, 2-isopropyl-5-methylcyclohexanol, oleic acid methyl esther, stearic acid methyl ester, quercetin and kaempferol were also identified in these fractions. The results indicated that of A. crassiflora leaf ethanolic extract has a good potential as a source for natural nematicide.

  19. New cytotoxic monotetrahydrofuran annonaceous acetogenins from Annona muricata.

    Science.gov (United States)

    Liaw, Chih-Chuang; Chang, Fang-Rong; Lin, Chih-Yuan; Chou, Chi-Jung; Chiu, Hui-Fen; Wu, Ming-Jung; Wu, Yang-Chang

    2002-04-01

    Three new monotetrahydrofuran annonaceous acetogenins, muricin H (1), muricin I (2), and cis-annomontacin (3), along with five known acetogenins, annonacin, annonacinone, annomontacin, murisolin, and xylomaticin, were isolated from the seeds of Annona muricata. Additionally, two new monotetrahydrofuran annonaceous acetogenins, cis-corossolone (4) and annocatalin (5), together with four known ones, annonacin, annonacinone, solamin, and corossolone, were isolated from the leaves of this species. The structures of all new isolates were elucidated and characterized by spectral and chemical methods. These new acetogenins exhibited significant activity in in vitro cytotoxic assays against two human hepatoma cell lines, Hep G(2) and 2,2,15. Compound 5 showed a high selectivity toward the Hep 2,2,15 cell line.

  20. New adjacent Bis-tetrahydrofuran Annonaceous acetogenins from Annona muricata.

    Science.gov (United States)

    Chang, Fang-Rong; Liaw, Chih-Chuang; Lin, Chih-Yuan; Chou, Chi-Jung; Chiu, Hui-Fen; Wu, Yang-Chang

    2003-03-01

    Bioactivity-guided fractionation led to the isolation of two new Annonaceous acetogenins, annocatacin A ( 1). and annocatacin B ( 2). from the seeds and the leaves, respectively, of Annona muricata. Compounds 1 and 2 are the first examples where the adjacent bis-tetrahydrofuran ring system is located at C-15. The new structures were elucidated and characterized by spectral and chemical methods. Both Annonaceous acetogenins 1 and 2 showed significant in vitro cytotoxicity toward the human hepatoma cell lines, Hep G2 and 2,2,15, and were compared with the known adjacent bis-tetrahydrofuran acetogenins, neoannonin ( 3). desacetyluvaricin ( 4). bullatacin ( 5). asimicin ( 6). annoglaucin ( 7). squamocin ( 8). and rollimusin ( 9).

  1. Isolation and characterization of a lectin from Annona muricata seeds.

    Science.gov (United States)

    Damico, D C S; Freire, M G M; Gomes, V M; Toyama, M H; Marangoni, S; Novello, J C; Macedo, M L R

    2003-11-01

    A lectin with a high affinity for glucose/mannose was isolated from Annona muricata seeds (Annonaceae) by gel filtration chromatography on Sephacryl S-200, ion exchange chromatography on a DEAE SP-5 PW column, and molecular exclusion on a Protein Pak Glass 300 SW column. Sodium dodecyl sulfate polyacrylamide gel electrophoresis (PAGE) yielded two protein bands of approximately 14 kDa and 22 kDa. However, only one band was seen in native PAGE. The Mr of the lectin estimated by fast-performance liquid chromatography-gel filtration on Superdex 75 was 22 kDa. The lectin was a glycoprotein with 8% carbohydrate (neutral sugar) and required divalent metal cations (Ca2+, Mg2+, and Mn2+) for full activity. Amino acid analysis revealed a large content of Glx, Gly, Phe, and Lys. The lectin agglutinated dog, chicken, horse, goose, and human erythrocytes and inhibited the growth of the fungi Fusarium oxysporum, Fusarium solani, and Colletotrichum musae.

  2. Potential Benefits of Annona muricata in Combating Cancer: A Review.

    Science.gov (United States)

    Yajid, Aidy Irman; Ab Rahman, Husna Syakirah; Wong, Michael Pak Kai; Wan Zain, Wan Zainira

    2018-02-01

    The incidence of cancer is increasing each year, which generates concerns regarding the efficacy of the current treatment options. This has caused patients to seek alternatives to complement or to replace surgery, chemotherapy and radiotherapy. Annona muricata and other plants have been shown to have promising compounds that can be utilised in the treatment of cancer. Native to the tropical and subtropical parts of the world, A. muricata plant extracts contain compounds that are particularly effective against cancer cells. In light of increasing concerns regarding the limitations of cancer treatment in hospitals, this review attempts to highlight the benefits of A. muricata and its potential to be integrated as one of the treatment options against cancer.

  3. Antidiabetic and antioxidant effects of Annona muricata (Annonaceae), aqueous extract on streptozotocin-induced diabetic rats.

    Science.gov (United States)

    Florence, Ngueguim Tsofack; Benoit, Massa Zibi; Jonas, Kouamouo; Alexandra, Tchuidjang; Désiré, Dzeufiet Djomeni Paul; Pierre, Kamtchouing; Théophile, Dimo

    2014-02-03

    The leaves of Annona muricata are used in Cameroon to manage diabetes and its complications. The aim of this study was to evaluate the antidiabetic, antioxidant activities and the potential toxicity of aqueous extract of Annona muricata in streptozotocin-induced diabetic rats. Oral administration of Annona muricata aqueous extract (100mg/kg or 200mg/kg) was studied in normal and streptozotocin-induced diabetic rats. In long term treatment, 2 weeks after streptozotocin-induced diabetic rats, animals received plant extract during 28 consecutive days. For a protective effect, extract was administered 3 days prior to streptozotocin exposure and animals were observed 2 weeks without treatment. The plant extract was not effective in normal rats. In diabetic rats, single administration of the extract significantly reduced blood glucose levels by 75% and 58.22% respectively at the dose of 100mg/kg and 200mg/kg as compared to the initial value. Treatment of normal rats 3 days prior to diabetes induction showed that, Annona muricata extract has no effect within 72h following STZ injection. However, after 14 days post-treatment, the extract at the dose of 100mg/kg significantly reduced blood glucose levels as compared with initial value and diabetic control rats. Immunohistochemical staining of pancreatic β-cells of diabetic rats treated with the dose of 100mg/kg expressed strong staining for β-cell compared to diabetic control. In a long-term study daily administration of Annona muricata aqueous extract for 28 days to diabetic rats, reduced blood glucose levels, serum creatinine, MDA, AST, ALT activity, and nitrite levels LDL-cholesterol. Total cholesterol, triglycerides, SOD, and CAT activity contents were restored. These different results show that the antidiabetic activity of Annona muricata aqueous extract can be explained by its hypolipidaemic effect, its antioxidant and protective action on pancreatic β-cells, which in turn improve glucose metabolism. © 2013

  4. Annona muricata aqueous extract suppresses T47D breast cancer cell proliferation

    Directory of Open Access Journals (Sweden)

    Ika Fidianingsih

    2014-04-01

    Full Text Available Background Cancer is a dreadful disease caused by abnormal and uncontrolled cell division. Annona muricata L, also known as soursop, is useful as an anticancer herbal medication since its leaves, seeds and fruits contain active compounds called annonaceous acetogenins. The objective of this study was to scientifically justify the traditional application of soursop for anticancer treatment in the community, by comparing the antiproliferative effect of Annona muricata L leaf, seed and fruit aqueous extracts on T47D breast cancer cells. Methods This study used an experimental post test trial with control group design. Infusions of soursop leaves, seeds, and fruits collected from Kaliurang, Sleman district, Yogyakarta were used for cytotoxicity tests on T47D cells, in comparison with tamoxifen as standard cancer therapy. Proliferative inhibition was determined by 3-(4,5-dimethyl thiazol-2-yl-2,5-diphenyl tetrazolium bromide [MTT] assay. The parameter of proliferative inhibition was IC50 which is defined as 50% proliferative inhibition ability of soursop and tamoxifen. Significant differences between groups were determined at p<0.05 by Kruskal-Wallis test. Results The leaves, fruits, and seeds Annona muricata and tamoxifen were proven to be able to inhibit T47D cell proliferation. The IC50 of Annona muricata leaf, seed, fruit aqueous extracts and tamoxifen were 31,384.21 µg/ml; 1.528,800 µg/ml; 329,194.81 µg/ml and 114.52 µg/ml, respectively (p=0.016. The IC50 of Annona muricata aqueous extract was significantly different from that of tamoxifen. Conclusions The proliferative inhibition of soursop leaves against T47D breast cancer cells is higher than that of soursop fruits and seeds. Annona muricata fruit, seed, and leaf aqueous extracts were less toxic than tamoxifen.

  5. The histological effects of Annona Muricata (Soursop) on the Adrenal Gland of Adult Wistar Rats

    OpenAIRE

    N, Ezejindu D.; O, Udemezue O; E, Chukwujekwu I; C, Uchefuna R; O, Maduka S; J, Akingboye A; N, Ezejindu C

    2014-01-01

    This study was undertaken to evaluate the histological effects of ethanolic extract of Annona muricata on the adrenal gland of adult wistar rats. Twenty wistar rats weighing between 180 – 210g were used for the study. They were divided into four groups (A, B, C & D) of five animals each. Group A animals served as the control and received 0.3 ml of distilled water; the experimental groups B, C & D were orally administered 0.2 ml, 0.4 ml and 0.6 ml of ethanolic extract of Annona muricat...

  6. Acute Toxicity Test of Soursop Leaves (Annona muricata) on Liver and Kidney of Switzerland Mice

    OpenAIRE

    Astika Widy Utomo; Neni Susilaningsih; Desy Armalina

    2016-01-01

    Introduction: The soursoup leaves extract (Annona muricata) has widely been used as traditional medicine for cancer. No studies have been conduct to investigate the safety of the extract. Objectives: The purpose of the study was to investigate the acute oral toxicity test of soursoup leaves extract (Annona muricata) on Swiss mice’s liver and kidney. Methods: Twenty four mice were divided into 4 groups. Group I was control group, while group II-IV was given soursoup leaves extract as ...

  7. FM Interviews: Stephanie Mills

    OpenAIRE

    Valauskas, Edward

    2002-01-01

    Stephanie Mills is an author, editor, lecturer and ecological activist who has concerned herself with the fate of the earth and humanity since 1969, when her commencement address at Mills College in Oakland, Calif., drew the attention of a nation. Her speech, which the New York Times called "perhaps the most anguished statement" of the year's crop of valedictory speeches, predicted a bleak future. According to Mills, humanity was destined for suicide, the result of overpopulation and overuse ...

  8. Prediction of mill performance

    Energy Technology Data Exchange (ETDEWEB)

    P.A. Bennett [CoalTech Pty Ltd. (Australia)

    2005-07-01

    This Australian Coal Association Research Program (ACARP) project aimed to demonstrate that the Hardgrove Grindability Index (HGI) coupled with standard Petrographic Analysis can be used to greatly improve the prediction of mill power requirements, mill throughput and product size. The project examined the mill test data from ACIRL's pilot scale vertical spindle mill on 96 coals. A total of 360 mill tests, conducted under a wide range of throughputs, roll pressures and classifier settings, were included into the data set. The mill performance of maceral groups or microlithotypes was assumed to be additive, that is, each maceral group or microlithotype behaved independently and a size fraction of the product PF was the volume weighted sum of the petrographic components of that size fraction. Based on this assumption it was possible to determine the size distribution of the product PF, for a wide range of milling conditions, based solely on petrographic analysis. Microlithotypes were not determined directly but were estimated from the maceral analysis. The size distribution of individual maceral groups or microlithotypes can also be estimated based on developed correlations. Size distribution determined from petrographic analysis proved to be a better estimate than that determined from the HGI. Mill power can be estimated from petrographic analysis, but the HGI was found to be a better predictor of mill power. 19 refs., 4 figs., 1 tab.

  9. Categorización de la germinación y la latencia en semillas de chirimoya (Annona cherimola L. y guanábana (Annona muricata L., como apoyo a programas de conservación de germoplasma

    Directory of Open Access Journals (Sweden)

    Lobo Mario

    2007-12-01

    Full Text Available

    Se estudió la latencia y germinación de semillas de guanábana y chirimoya con el fin de categorizar la latencia de las simientes y desarrollar un protocolo de rompimiento de ésta; conocimiento básico para el establecimiento y monitoreo de un duplicado de seguridad en las colecciones de campo, por la vía de almacenamiento a largo plazo de las unidades de propagación sexuales. No se detectó latencia exógena, a través de la imbibición obtenida por las semillas. Se encontró, a través de pruebas de viabilidad, con tetrazolio, que en cada uno de los taxa existe alrededor de un 20% de unidades no viables en el conjunto de semillas aparentemente normales. La estratificación caliente húmeda, por espacio de 90 días, produjo rompimiento de la latencia, al igual que la imbibición con AG3, con obtención del mejor resultado al imbibir la simiente en 800 ppm de la hormona. En chirimoya se obtuvo efectos sinérgicos al combinar el tratamiento de 800 ppm de AG3 y estratificación caliente húmeda durante 90 días, lo cual no fue evidente en el caso de la guanábana. A partir de los resultados se clasificó el bloqueo de la germinación de las semillas de las dos especies, como latencia morfofisiológica simple, no profunda. La caracterización definida, junto con el protocolo de remoción, apoyan el establecimiento de un duplicado de seguridad de la colección de campo, por la vía de semilla, con un concepto dinámico que se esboza en este escrito.

  10. A Review on Annona squamosa L.: Phytochemicals and Biological Activities.

    Science.gov (United States)

    Ma, Chengyao; Chen, Yayun; Chen, Jianwei; Li, Xiang; Chen, Yong

    2017-01-01

    Annona squamosa L. (Annonaceae) is a fruit tree with a long history of traditional uses. A. squamosa is an evergreen plant mainly located in tropical and subtropical regions. Srikayas, the fruits of A. squamosa, are extensively used to prepare candies, ice creams and beverages. A wide range of ethno-medicinal uses has been related to different portions of A. squamosa, such as tonic, apophlegmatisant, cool medicine, abortient and heart sedative. Numerous research projects on A. squamosa have found that it has anticancer, anti-oxidant, antidiabetic, antihypertensive, hepatoprotective, antiparasitic, antimalarial, insecticidal, microbicidel and molluscicidal activities. Phytochemistry investigations on A. squamosa have considered annonaceous acetogenins (ACGs), diterpenes (DITs), alkaloids (ALKs) and cyclopeptides (CPs) as the main constituents. Until 2016, 33 DITs, 19 ALKs, 88 ACGs and 13 CPs from this species were reported. On the basis of the multiple researches on A. squamosa, this review strives to integrate available information on its phytochemicals, folklore uses and bioactivities, hoping to promote a better understanding of its medicinal values.

  11. Characterization and development of marolo (Annona crassiflora, Mart.

    Directory of Open Access Journals (Sweden)

    Edson Pablo da Silva

    2013-12-01

    Full Text Available The objectives of this study was the physical, chemical, and physiological characterization of marolo (Annona crassiflora, Mart. during its development. The fruits were harvested 12 Km off Itumirim, Southern Minas Gerais, Brazil, at 20-d intervals from anthesis to fruit maturity. The first fruits were harvested within 60 days. The total development of the fruit took 140 days starting from anthesis. At 140 days after anthesis, the fruit reached its maximum size, with mass of 1.380g, transverse diameter of 13.0 cm, and longitudinal diameter of 11.5 cm. During its development, the fruit showed increase in mass and in traverse and longitudinal diameters. The changes during maturation and ripening, such as: pH reduction and starch degradation, pectic solubilization, and increase in total sugars, soluble solids (ºB, respiratory rate (CO2, titratable acidity, vitamin C, and β-caroteno were observed from the 120th day of marolo development. A decrease in ability to sequester free radicals was observed up the 120th day, followed by an increase. The volatile compounds identified at the end of the development included the esters group only.

  12. Liriodenine alkaloid in Annona diversifolia during early development.

    Science.gov (United States)

    de la Cruz Chacón, I; González-Esquinca, A R

    2012-01-01

    Plants of the Annonaceae family produce a series of alkaloids, including liriodenine oxoaporphine. Its distribution in these primitive angiosperms suggests that it plays an important role, but very little is known about which plant organs it accumulates in, or in which developmental stages it is synthesised. Accordingly, liriodenine production was studied during the early stages of germination and seedling development in Annona diversifolia Saff. Liriodenine samples were obtained from the roots and were characterised on the basis of spectroscopic data. Quantification was done by HPLC in the organs and tissues of newly collected seeds, seeds following 1-, 2-, 5- and 10-day imbibitions, upon emergence of the radicle and at the seedling stage. According to our results, liriodenine could not have originated from the parent plant, nor during embryogenesis because it appears for the first time in the endosperm approximately 5 days after the start of imbibition. Therefore, its synthesis does not depend directly on photosynthesis. During the seedling stage it is found in the root and the stem but it is absent from the cotyledonary leaves and the first true leaves. Liriodenine biosynthesis begins during the early stages of development in the endosperm and seed radicles.

  13. Respiration during Postharvest Development of Soursop Fruit, Annona muricata L

    Science.gov (United States)

    Bruinsma, Johan; Paull, Robert E.

    1984-01-01

    Fruit of soursop, Annona muricata L., showed increased CO2 production 2 days after harvest, preceding the respiratory increase that coincided with autocatalytic ethylene evolution and other ripening phenomena. Experiments to alter gas exchange patterns of postharvest fruit parts and tissue cylinders had little success. The respiratory quotient of tissue discs was near unity throughout development. 2,4-Dinitrophenol uncoupled respiration more effectively than carbonylcyanide m-chlorophenylhydrazone; 0.4 millimolar KCN stimulated, 4 millimolar salicylhydroxamic acid slightly inhibited, and their combination strongly inhibited respiration, as did 10 millimolar NaN3. Tricarboxylic acid cycle members and ascorbate were more effective substrates than sugars, but acetate and glutarate strongly inhibited. Disc respiration showed the same early peak as whole fruit respiration; this peak is thus an inherent characteristic of postharvest development and cannot be ascribed to differences between ovaries of the aggregatetype fruit. The capacity of the respiratory apparatus did not change during this preclimacteric peak, but the contents of rate-limiting malate and citrate increased after harvest. It is concluded that the preclimacteric rise in CO2 evolution reflects increased mitochondrial respiration because of enhanced supply of carboxylates as a substrate, probably induced by detachment from the tree. The second rise corresponds with the respiration during ripening of other climacteric fruits. PMID:16663783

  14. In vitro antioxidant studies in leaves of Annona species.

    Science.gov (United States)

    Baskar, R; Rajeswari, V; Kumar, T Sathish

    2007-05-01

    Antioxidant potential of leaves of three different species of Annona was studied by using different in vitro models eg., 1,1-diphenyl-2-picryl hydrazyl (DPPH), 2,2-azinobis-(3-ethylbenzothizoline-6-sulphonate) (ABTS), nitric oxide, superoxide, hydroxy radical and lipid peroxidation. The ethanolic extract of A. muricata at 500 microg/ml showed maximum scavenging activity (90.05%) of ABTS radical cation followed by the scavenging of hydroxyl radical (85.88%) and nitric oxide (72.60%) at the same concentration. However, the extract showed only moderate lipid peroxidation inhibition activity. In contrast, the extract of A. reticulata showed better activity in quenching DPPH (89.37%) and superoxide radical (80.88%) respectively. A.squamosa extract exhibited least inhibition in all in vitro antioxidant models excepting hydroxyl radical (79.79%). These findings suggest that the extracts of A. muricata possess potent in vitro antioxidant activity as compared to leaves of A. squamosa and A. reticulata suggesting its role as an effective free radical scavenger, augmenting its therapeutic

  15. Soursop (Annona muricata) vinegar production and its chemical compositions

    Science.gov (United States)

    Ho, Chin Wai; Lazim, Azwan Mat; Fazry, Shazrul; Zaki, Umi Kalsum Hj Hussain; Lim, Seng Joe

    2016-11-01

    Vinegar is a liquid product that undergoes double fermentations, which are alcoholic and acetous fermentation. Sugar source was converted to ethanol in alcoholic fermentation, meanwhile ethanol was oxidised to acetic acid during acetous fermentation. Soursop (Annona muricata) was the starting material in this study, as it is easily available in Malaysia. Its highly aromatic, juicy and distinctive flavours enables the production of high quality vinegar. The objective of this research is to produce good quality soursop vinegar as an innovative method to preserve and utilise the soursop fruit in Malaysia and to determine its chemical compositions. It was found that the sugar content reduces over time, and it is inversely proportional to the ethanol concentration, due to the production of ethanol from sugar. Acetic acid was also found to increase with increasing fermentation time. pH showed no significant difference (p>0.05) in the reduction of sugar and the production of ethanol. However, significantly higher (p 0.05) in Vitamin C contents in all soursop vinegar samples produced using different treatments.

  16. [Chemical constituents of an endophytic fungus from Annona muricata].

    Science.gov (United States)

    Ge, Hanlin; Dai, Jungui

    2010-12-01

    To investigate the chemical constituents of an endophytic fungus, F-31, from Annona muricata and search antitumor natural products. After scaling up, the fermentation broth and mycelia were extracted by macroporous resin and chromatographied by silica gel column, Sephadex LH-20 gel column and semi-preparative HPLC. The structures of compounds were determined by the means of extensive spectroscopic data The activity of the compounds were evaluated through MTT assay. Six compounds were isolated from the fermentation broth and mycelia of this fungus, their structures were identified as 5-(3-hydroxybutyl)furan-2(5H)-one(1), chloranthalactone E(2), 5, 7-dimethyl-6-hydroxycoumarin(3), 1, 2, 4-triazole-(1'R, 2'R, 3'R, 4'R)-nucleosides(4), L-tryptophan(5), L-phenylalanine(6). The in vitro pharmalogical evaluation results displayed that the above compounds exhibited no inhibitory effects on the proliferation of six tumor cell lines (HCT-8, Bel-7402, BGC-823, A549, A2780 and MCF-7). Among these obtained compounds, compound 1 was a new compound.

  17. Flooding, root temperature, physiology and growth of two Annona species.

    Science.gov (United States)

    Ojeda, Maritza; Schaffer, Bruce; Davies, Frederick S

    2004-09-01

    The effects of root zone temperature (RZT) and flooding on physiology and growth of Annona glabra L. (pond apple) and A. muricata L. (soursop) were investigated. Trees planted in containers were exposed to RZTs of 5, 10, 20, 25 or 35 degrees C in controlled root temperature chambers. Trees at each RZT were either non-flooded (control) or continuously flooded. There were four replications over time for each treatment combination. Pond apple was more flood-tolerant than soursop. A combination of flooding and RZTs of 5 and 10 degrees C resulted in tree mortality of both species by Week 4. Only trees that appeared to develop morphological adaptations survived continuous flooding. In both species, net CO2 assimilation (A) decreased to nearly zero within 1 week following exposure to RZTs of 5 or 10 degrees C and became consistently negative over the remaining experimental period. Flooding reduced leaf chlorophyll index (measured with a SPAD meter), A and plant growth, and increased root electrolyte leakage from soursop. Optimum growth occurred at RZTs of 25 to 35 degrees C for non-flooded pond apple trees and at 20 to 25 degrees C for flooded trees. Soursop exhibited maximum growth at RZTs of 35 degrees C under non-flooded conditions and at 25 degrees C under flooded conditions.

  18. Bactericidal Efficiency of Silver Nanoparticles Synthesized from Annona squamosa

    Science.gov (United States)

    Jayavardhanan, R.; Nanda, Anima

    2016-09-01

    Nanotechnology is described as an emerging technology that not only holds promise for society, but also is capable of providing novel approaches to overcome our common problems. The present study focused on the synthesis of silver nanoparticles using the metabolites of Annona squamosa seeds. The biological reduction procedure proposed in this method was considered as better one compared to chemical mediated reduction methods. The advantages include nontoxic to the environment, less energy consuming and highly suitable for further biological applications. The seeds were separated from the fruit pulp, grinded into powder and dissolved in distilled water. The suspension was used as reducing agent and treated with silver nitrate at the concentration of 1mM. The reduction reaction was continuously monitored by UV-visible photo spectrometer. Further the samples were subjected to AFM, SEM and XRD analysis for the confirmation of their size, structure, agglomerations and the arrangements of crystals. Finally the antibacterial properties of nanoparticles were tested against clinically important pathogenic microorganisms using disc diffusion method and compared with the activities of standard antibiotics. The combinational effects of nanoparticles with commercial antibiotics also were tested by the same method.

  19. Phytochemicals Screening and Antioxidant Activity of Annona muricata Aqueous Extracts

    International Nuclear Information System (INIS)

    Rosniza Razali; Hazlina Ahmad Hassali; Arapoc, D.J.

    2016-01-01

    Annona Muricata belongs to the family Annonaceae which is known to have anticancer, anti-inflammatory and many other bio activities. Leaves, twig, fruit and seed of A. muricata were collected from Suhan Biotech and dried. Hot and cold aqueous extracts were prepared for the preliminary screening of phytochemicals and aqueous extracts of A. muricata were evaluated for total phenolic, scavenging assay (DPPH; 1-1-diphenyl-2-picrylhydrazyl) and cytotoxic activities. Phytochemicals screening of leaves extracts revealed the presence of alkaloids, terpenoid, reducing sugar, carbohydrate and anthocyanins. While for twig extracts it revealed the presence of coumarine. Antra quinones, terpenoid, flavonoid, reducing sugar, lipids and coumarine were found in fruit and seed extracts. The total phenolic content was found to be 2.372±0.922 μg GAE/ g, 85.85±6.23 μg GAE/ g, 53.56±8.39 μg GAE/ g and 54.67±13.33 μg GAE/ g for leaves, twig, fruit and seed respectively. On the other hand, all extract have showed IC 50 value more than 500 μg/ mL in DPPH scavenging assay. Cytotoxic evaluation of all extracts against HTB43, MCF-7 and MDAMB231 cell lines showed IC 50 value more than 250 μg/ mL. In conclusion, the results showed that aqueous extract of A.muricata was inappropriate as anticancer agen (author)

  20. Safety of Annona muricata Extract Supplementation for Colorectal Cancer Patients

    Directory of Open Access Journals (Sweden)

    Lili Indrawati

    2016-12-01

    Full Text Available Background: People have used Annona muricata leaves traditionally as tea drinks. Traditional use of A. muricata leaves is as an infusion which is closed to water extract. The potential health benefit of A. muricata tea leaves that is traditionally used for maintaining health which lately is being used by cancer patients. Therefore it is urgent to verify the safety of A. muricata leaves extract. Method: A randomized double blind placebo controlled trial was conducted on 30 colorectal cancer out patients who had undergone primary tumor resection. Twenty eight subjects completed the study, divided into two groups, namely ethanol-soluble fraction of A. muricata leaves water extract (ESFAM (n = 14, and placebo (n = 14 for 8 weeks. Peripheral blood samples were withdrawn from subjects by venipuncture at baseline and at the end of the study period. Results: The effect on bone marrow can be considered to be safe. The measure in indices of organs function, i.e liver and kidney also showed similar results and within normal range after supplementation. The dose given to the subjects is safe and highly tolerable, as shown by very few (6.7% of patients complained intolerable adverse effects. Conclusion: This study indicates the safety of ESFAM supplementation

  1. Antitumour Activity of the Microencapsulation of Annona vepretorum Essential Oil.

    Science.gov (United States)

    Bomfim, Larissa M; Menezes, Leociley R A; Rodrigues, Ana Carolina B C; Dias, Rosane B; Rocha, Clarissa A Gurgel; Soares, Milena B P; Neto, Albertino F S; Nascimento, Magaly P; Campos, Adriana F; Silva, Lidércia C R C E; Costa, Emmanoel V; Bezerra, Daniel P

    2016-03-01

    Annona vepretorum Mart. (Annonaceae), popularly known as 'bruteira', has nutritional and medicinal uses. This study investigated the chemical composition and antitumour potential of the essential oil of A. vepretorum leaf alone and complexed with β-cyclodextrin in a microencapsulation. The essential oil was obtained by hydrodistillation using a Clevenger-type apparatus and analysed using GC-MS and GC-FID. In vitro cytotoxicity of the essential oil and some of its major constituents in tumour cell lines from different histotypes was evaluated using the alamar blue assay. Furthermore, the in vivo efficacy of essential oil was demonstrated in mice inoculated with B16-F10 mouse melanoma. The essential oil included bicyclogermacrene (35.71%), spathulenol (18.89%), (E)-β-ocimene (12.46%), α-phellandrene (8.08%), o-cymene (6.24%), germacrene D (3.27%) and α-pinene (2.18%) as major constituents. The essential oil and spathulenol exhibited promising cytotoxicity. In vivo tumour growth was inhibited by the treatment with the essential oil (inhibition of 34.46%). Importantly, microencapsulation of the essential oil increased in vivo tumour growth inhibition (inhibition of 62.66%). © 2015 Nordic Association for the Publication of BCPT (former Nordic Pharmacological Society).

  2. Contents of constituents and antioxidant activity of seed and pulp extracts of Annona coriacea and Annona sylvatica.

    Science.gov (United States)

    Benites, R S R; Formagio, A S N; Argandoña, E J S; Volobuff, C R F; Trevizan, L N F; Vieira, M C; Silva, M S

    2015-08-01

    The antioxidant potential of fruit pulp and seeds of extracts of the Annona coriacea, and A. sylvatica (Annonaceae) were investigated, as well contents total phenolics, flavonoids, condensed tannins and ascorbic acid. Was used to determine the antioxidant activity the 1,1-diphenyl-2-picrylhydrazyl free radical (DPPH), β-carotene bleaching and ABTS radical cation method. The total phenol, total flavonoid, condensed tannin, and ascorbic acid contents were measured spectrophotometrically. In this study, the pulp and seeds of the fruits were extracted using methanol/water (8:2) for maceration. The seed extracts of A. coriacea demonstrated a moderate antioxidant effect with free radical scavenging activity of 31.53%, by the DPPH test, 51.59% by the β-carotene bleaching test and 159.50 µM trolx/g of extract in the ABTS assay. We found that the hydromethanolic seed extract of A. coriacea had high total phenol (147.08 ± 4.20 mg of GAE/g of extract) and flavonoid (131.18 ± 2.31 mg of QE/g of extract) content. This indicated that the antioxidant activity of the extracts was related to the contents of these constituents.

  3. Pre-harvest deterioration of Sour sop (Annona muricata) at Ibadan ...

    African Journals Online (AJOL)

    The etiology of pre-harvest deterioration of Soursop (Annona muricata) fruit in Ibadan, southwestern Nigeria and the effects on its nutrient composition was investigated. Four fungal pathogens including Botryodiplodia theobromae, Fusarium sp., Rhizopus stolonifer and Aspergillus niger were found associated with the ...

  4. Molecular diversity of Annona species and proximate fruit composition of selected genotypes.

    Science.gov (United States)

    Anuragi, Hirdayesh; Dhaduk, Haresh L; Kumar, Sushil; Dhruve, Jitendra J; Parekh, Mithil J; Sakure, Amar A

    2016-12-01

    Understanding the genetic variation in germplasm is of utmost importance for crop improvement. Therefore, efforts were made to analyse the molecular marker based genetic diversity of 20 Annona genotypes from five different species of family Annonaceae. During analysis, a set of 11 RAPD primers yielded a total of 152 bands with 80.01 % polymorphism and PIC for RAPD ranged from 0.86 to 0.92 with a mean of 0.89. With 93.05 % polymorphism, 12 SSR primers produced 39 amplicons. The PIC for SSRs ranged from 0.169 to 0.694 with of average of 0.339. The dendrogram produced from pooled molecular data of 11 RAPD and 12 SSR primers showed seven clusters at a cutoff value of 0.78. The dendrogram discriminated all the Annona genotypes suggesting that significant genetic diversity was present among the genotypes. Proximate fruit composition study of nine fruiting genotypes of Annona revealed that A. squamosa possessed significantly higher amount of most of studies biochemical which gives an opportunity to fruit breeders to improve the other Annona species. Likewise, A. muricata being rich in seed oil content can be exploited in oil industries.

  5. Flowering and Fruiting Times on Four Species of Annona (Annonaceae in Purwodadi Botanic Garden

    Directory of Open Access Journals (Sweden)

    Dewi Ayu Lestari

    2015-01-01

    Full Text Available Annona is a genus belongs to Annonaceae family, consisting of numerous species that produce edible fruit. Four species namely A. glabra, A. montana, A. muricata and A. squamosa collections of Purwodadi Botanic Garden were recorded for its flowering and fruiting times, since November 2010 to April 2013. The data were scored and complemented with climate data (temperature, rainfall intensity, humidity then analyzed using multiple linear regression analysis. The result showed that humidity was the most affected climate factors on the flowering and fruiting times of those species. Specifically, rainfall intensity (0-550 mm affected to Annona muricata, temperature (25,56-28,33°C and humidity (66,83-85,02% to Annona squamosa, and humidity to A. glabra (71,62-85,02% and A. montana (71,62 to 82,94 % as well. Flowering time of A. glabra occurs three times a year in wet and dry, and fruiting occurs twice a year in the same month. Annona muricata is flowering throughout the year and fruiting twice a year in wet. A. montana and A. squamosa recorded one a year during the wet month.

  6. In vitro evaluation of the antimicrobial activity of plant extracts from Ruta graveolens and Annona muricata

    OpenAIRE

    Portilla, Y.; Carro Travieso, Mª Dolores; Milian, G.; Camacho, C.; Valdivia, A.; Díaz, A.; Saro, C.; Mateos, I.; Ranilla, María José

    2015-01-01

    Resistance of microorganisms to commercial drugs is increasing worldwide, and therefore the search for new antimicrobial agents is a key issue. The aim of this study was to identify the potential of plant extracts from Ruta graveolens and Annona muricata as candidates for the development of new antimicrobials.

  7. Coronin from roots of Annona muricata, a putative intermediate in acetogenin biosynthesis (1).

    Science.gov (United States)

    Gleye, C; Akendengue, B; Laurens, A; Hocquemiller, R

    2001-08-01

    A novel acetogenin, coronin, was isolated from the roots of Annona muricata L. The structure was elucidated by a combination of chemical and spectral methods including MS and NMR measurements. Coronin is probably an intermediate in the biosynthetic pathway of bis-tetrahydrofuran acetogenins, and is proposed as a biogenetic precursor of neoannonin-B.

  8. Oil and mucilage cells in Annona (Annonaceae) and their systematic significance

    NARCIS (Netherlands)

    Bakker, M.E.; Gerritsen, A.F.

    1992-01-01

    The morphology and distribution patterns of oil and/or mucilage cells, i.e. idioblasts, in the leaf of 37 Annona species are described. Idioblasts are always present in the spongy parenchyma in all species and in most cases also in the palisade parenchyma. Usually both oil cells and mucilage cells

  9. Application of thermal barrier coating for improving the suitability of Annona biodiesel in a diesel engine

    Directory of Open Access Journals (Sweden)

    Ramalingam Senthil

    2016-01-01

    Full Text Available The Annona biodiesel was produced from Annona oil through transesterification process. The aim of the present study is to analyze the performance and emission characteristics of a single cylinder, direct injection, compression ignition engine using a annona methyl ester as a fuel. They are blended together with the Neat diesel fuel such as 20%, 40%, 60%, 80%, and Neat biodiesel. The performance, emission and combustion characteristics are evaluated by operating the engine at different loads. The performance parameters such as brake thermal efficiency, brake specific fuel consumption. The emission constituents such as carbon monoxide, unburned hydrocarbons, oxides of nitrogen, and smoke were recorded. Then the piston and both exhaust and intake valves of the test engine were coated with 100 µm of NiCrAl as lining layer. Later the same parts were coated with 400 µm material of coating that was the mixture of 88% of ZrO2, 4% of MgO, and 8% of Al2O3. After the engine coating process, the same fuels is tested in the engine at the same engine operation. The same performance and emission parameters were evaluated. Finally, these parameters are compared with uncoated engine in order to find out the changes in the performance and emission parameters of the coated engine. It is concluded that the coating engine resulting in better performance, especially in considerably lower brake specific fuel consumption values. The engine emissions are lowered both through coating and annona methyl ester biodiesel expect the nitrogen oxides emission.

  10. Fabrication of nanoparticles using Annona squamosa leaf and assessment of its effect on liver (Hep G2) cancer cell line

    Science.gov (United States)

    Vanitha, V.; Hemalatha, S.; Pushpabharathi, N.; Amudha, P.; Jayalakshmi, M.

    2017-04-01

    Annona squamosa is a fruit bearing plant possesses potent bioactive compounds in all its part. In this present investigation iron oxide nanoparticle was synthesized from hydroethanol extract of Annona squamosa leaves at 60°C temperature. Production of iron oxide nanoparticles in extraction is detected by UV-V spectrophotometer, Scanning electron microscopy was employed to analyse the structure of nanoparticles. Fourier transform infrared spectroscopy (FT-IR) analysis were performed, in order to determine the functional groups on Annona squamosa leaves extract. The synthesized Fe3O4 NPs shows potential cytotoxicity against liver carcinoma cell line (HepG2), and there is no toxicity on the normal liver cell line. Our reports confirmed that the Annona squamosa leaf is a very good eco-friendly and nontoxic bioreductant for the synthesis of Iron oxide nanoparticle and opens up further opportunities for fabrication of drugs towards cancer therapy.

  11. In vitro cytotoxic, antifungal, trypanocidal and leishmanicidal activities of acetogenins isolated from Annona cornifolia A. St. -Hil. (Annonaceae)

    OpenAIRE

    LIMA, LUCIANA A.R.S.; ALVES, TÂNIA M.A.; ZANI, CARLOS L.; SALES JÚNIOR, POLICARPO A.; ROMANHA, ALVARO J.; JOHANN, SUSANA; CISALPINO, PATRÍCIA S.; PIMENTA, LÚCIA P.S.; BOAVENTURA, MARIA AMÉLIA D.

    2014-01-01

    Annona cornifolia A. St. -Hil. is a small annual perennial tree found in the Brazilian savannah; their green fruit is popularly used in the treatment of ulcers. The acetogenins isolated from the seeds of Annona cornifolia previously showed to possess antioxidant activity. In continuation of our investigations on the biological activities of acetogenins, four binary mixtures and ten pure adjacent bis-tetrahydrofuran annonaceous acetogenins were evaluated: the cytotoxic (against three human tum...

  12. Ellagic acid and Annona muricata in the chemoprevention of HPV-related pre-neoplastic lesions of the cervix

    OpenAIRE

    Morosetti, Giulia; Criscuolo, Anna Angela; Santi, Flavia; Perno, Carlo Federico; Piccione, Emilio; Ciotti, Marco

    2017-01-01

    Ellagic acid is a phenolic compound naturally present in nuts and berries. Several studies have demonstrated that this bioactive compound has antioxidant, chemopreventive and antiviral activity. Annona muricata is a type of fruit tree with a long history of traditional use. A number of properties have been attributed to different parts of the plant, including anticancer and antioxidant activities. In the current study, a complex based on ellagic acid, Annona Muricata and antioxidant factors (...

  13. Anti-cancer effect of Annona Muricata Linn Leaves Crude Extract (AMCE) on breast cancer cell line

    OpenAIRE

    Syed Najmuddin, Syed Umar Faruq; Romli, Muhammad Firdaus; Hamid, Muhajir; Alitheen, Noorjahan Banu; Nik Abd Rahman, Nik Mohd Afizan

    2016-01-01

    Background Annona muricata Linn which comes from Annonaceae family possesses many therapeutic benefits as reported in previous studies and to no surprise, it has been used in many cultures to treat various ailments including headaches, insomnia, and rheumatism to even treating cancer. However, Annona muricata Linn obtained from different cultivation area does not necessarily offer the same therapeutic effects towards breast cancer (in regards to its bioactive compound production). In this stu...

  14. Screening of medicinal plants from Suriname for 5-HT(1A) ligands: Bioactive isoquinoline alkaloids from the fruit of Annona muricata.

    Science.gov (United States)

    Hasrat, J A; Pieters, L; De Backer, J P; Vauquelin, G; Vlietinck, A J

    1997-06-01

    Plants from Suriname (South-America) and several Annona species, including A. muricata, A. ckerimolia, A. montana and A. glabra were screened for 5-HT(1A) receptor binding activity by ligand-binding-studies (LBS). Crude extracts of all Annona species and from Hibiscus bifurcatus, Irlbarchia purpurascens and Scoparia dulcis showed high activity. The isoquinoline alkaloids asimilobine (1), nornuciferine (2), and annonaine (3) were isolated as the active principles from the fruit of Annona muricata. These results may partially explain the use of Hibiscus bifurcatus and Annona muricata in traditional medicine in Suriname. Copyright © 1997 Gustav Fischer Verlag. Published by Elsevier GmbH.. All rights reserved.

  15. The Value of Caspase-3 after the Application of Annona muricata Leaf Extract in COLO-205 Colorectal Cancer Cell Line

    Science.gov (United States)

    Syam, Ari Fahrial; Meilany, Sofy; Laksono, Bayu; Prabu, Oryza Gryagus; Bekti, Heri Setiyo; Indrawati, Lili; Makmun, Dadang

    2017-01-01

    Annona muricata, commonly known as soursop, contains annonacin, acetogenin, and polyphenol which are known to have chemopreventive effects on cancer. In this study, we tend to evaluate the apoptosis-inducing effect of soursop (Annona muricata) leaf extract on the colorectal cancer cell line COLO-205 through the activities of caspase-3 which is a marker of cell apoptosis. Cell cultures were incubated with soursop leaf with a concentration of 10 μg/ml and then compared with those of the incubated positive control leucovorin 10 μg/ml and placebo as a negative control. The apoptotic activity of caspase-3 was measured with ELISA. After the administration of each treatment in the colorectal cancer cell line COLO-205, the expression of caspase-3 activity was 1422 ng/ml after incubation with the extract of Annona muricata leaves, 1373 ng/ml after the administration of leucovorin, and 1297 ng/ml in the one with placebo. Annona muricata leaf extract elevated caspase-3 by 1.09 times compared to that of the pure cell line. Annona muricata leaf extract had a higher value of caspase-3 activity than leucovorin and placebo in the COLO-205 colorectal cancer cell line. These results may suggest that Annona muricata leaf extract had anticancer properties by enhancing caspase-3 activity which is a proapoptotic marker. PMID:28487731

  16. The Value of Caspase-3 after the Application of Annona muricata Leaf Extract in COLO-205 Colorectal Cancer Cell Line.

    Science.gov (United States)

    Abdullah, Murdani; Syam, Ari Fahrial; Meilany, Sofy; Laksono, Bayu; Prabu, Oryza Gryagus; Bekti, Heri Setiyo; Indrawati, Lili; Makmun, Dadang

    2017-01-01

    Annona muricata , commonly known as soursop, contains annonacin, acetogenin, and polyphenol which are known to have chemopreventive effects on cancer. In this study, we tend to evaluate the apoptosis-inducing effect of soursop ( Annona muricata ) leaf extract on the colorectal cancer cell line COLO-205 through the activities of caspase-3 which is a marker of cell apoptosis. Cell cultures were incubated with soursop leaf with a concentration of 10  μ g/ml and then compared with those of the incubated positive control leucovorin 10  μ g/ml and placebo as a negative control. The apoptotic activity of caspase-3 was measured with ELISA. After the administration of each treatment in the colorectal cancer cell line COLO-205, the expression of caspase-3 activity was 1422 ng/ml after incubation with the extract of Annona muricata leaves, 1373 ng/ml after the administration of leucovorin, and 1297 ng/ml in the one with placebo. Annona muricata leaf extract elevated caspase-3 by 1.09 times compared to that of the pure cell line. Annona muricata leaf extract had a higher value of caspase-3 activity than leucovorin and placebo in the COLO-205 colorectal cancer cell line. These results may suggest that Annona muricata leaf extract had anticancer properties by enhancing caspase-3 activity which is a proapoptotic marker.

  17. The Value of Caspase-3 after the Application of Annona muricata Leaf Extract in COLO-205 Colorectal Cancer Cell Line

    Directory of Open Access Journals (Sweden)

    Murdani Abdullah

    2017-01-01

    Full Text Available Annona muricata, commonly known as soursop, contains annonacin, acetogenin, and polyphenol which are known to have chemopreventive effects on cancer. In this study, we tend to evaluate the apoptosis-inducing effect of soursop (Annona muricata leaf extract on the colorectal cancer cell line COLO-205 through the activities of caspase-3 which is a marker of cell apoptosis. Cell cultures were incubated with soursop leaf with a concentration of 10 μg/ml and then compared with those of the incubated positive control leucovorin 10 μg/ml and placebo as a negative control. The apoptotic activity of caspase-3 was measured with ELISA. After the administration of each treatment in the colorectal cancer cell line COLO-205, the expression of caspase-3 activity was 1422 ng/ml after incubation with the extract of Annona muricata leaves, 1373 ng/ml after the administration of leucovorin, and 1297 ng/ml in the one with placebo. Annona muricata leaf extract elevated caspase-3 by 1.09 times compared to that of the pure cell line. Annona muricata leaf extract had a higher value of caspase-3 activity than leucovorin and placebo in the COLO-205 colorectal cancer cell line. These results may suggest that Annona muricata leaf extract had anticancer properties by enhancing caspase-3 activity which is a proapoptotic marker.

  18. PENGARUH MASKER DAUN SIRSAK (ANNONA MURICATA LINN) TERHADAP KULIT WAJAH BERJERAWAT

    OpenAIRE

    Barcelona Tampubolon, Nining

    2017-01-01

    Abstract This study aims to analyze whether there is any effect of the use of soursop leaf (Annonamuricata Linn) mask that is applied as a facial mask skin care for people with acne (Acne vulgaris).This study applied quasi experimental research methods, woods lamp as the tool to identify the client have Acne or not. and measurement criteria was used as the instrument. A full facial mask added with soursop leaf (Annona muricata Linn). After obtaining the data, analysis requirement test ...

  19. Ekstraksi Acetogenin dari Daun Sirsak (Annona muricata L) dengan Pelarut Aseton

    OpenAIRE

    Nurhayani

    2016-01-01

    Soursop leaf (Annona muricata L) contains flavonoids, tannins, phytosterols, calcium oxalate, alkaloids and acetogenyn. Acetogenyn which was synthesized through reaction between polyketide derived-acetic acid with 35-39 carbon atom in fatty acid, is the secondary metabolite of Annonaceae plant. This research aims to determine the variables that influence in soursop leaf extraction so that high % yield value can be obtained and to prove the presence of acetogenyn compound qua...

  20. PENGARUH EKSTRAK DAUN SIRSAK Annona muricata L TERHADAP PERIODE MENGHISAP DARAH NYAMUK Aedes aegypti

    OpenAIRE

    Pangadongan, Acice T.

    2016-01-01

    Telah dilakukan penelitian tentang pengaruh ekstrak daun sirsak Annona muricata L terhadap periode menghisap darah nyamuk Aedes aegypti. Penelitian ini bersifat eksperimental menggunakan ekstrak daun sirsak dalam bentuk spray konsentrasi 3,7%, 7,5%, 15% dan 30% yang disemprotkan ke tangan. Selanjutnya dimasukkan ke dalam kandang yang telah berisi sampel uji nyamuk betina sebanyak 20 ekor, pengamatan dimulai pukul 08.00-18.00 WITA. Aktivitas ekstrak dihitung dengan cara menghitung jumlah nyam...

  1. Annonamine, a new aporphine alkaloid from the leaves of Annona muricata.

    Science.gov (United States)

    Matsushige, Ayano; Kotake, Yaichiro; Matsunami, Katsuyoshi; Otsuka, Hideaki; Ohta, Shigeru; Takeda, Yoshio

    2012-01-01

    Atypical Parkinsonism in the Caribbean Island Guadeloupe is thought to be associated with the consumption of plants of the Annonaceae family, especially Annona muricata (soursop). In this study, a new aporphine alkaloid named annonamine (1) was isolated from the leaves of A. muricata L. together with four known benzylisoquinoline alkaloids (2-5). The structures of the isolated compounds were elucidated by the spectroscopic method.

  2. UPLC–QTOF–MS and NMR analyses of graviola (Annona muricata) leaves

    OpenAIRE

    Moraes, Ingrid Vieira Machado de; Ribeiro, Paulo Riceli Vasconcelos; Schmidt, Flávio Luis; Canuto, Kirley Marques; Zocolo, Guilherme Julião; Brito, Edy Sousa de; Luo, Rensheng; Richards, Kristy M.; Tran, Kevin; Smith, Robert E.

    2016-01-01

    ABSTRACT Graviola leaves (Annona muricata L., Annonaceae) are used by some people to try to treat or even cure cancer, even though over-consumption of the fruit, which contains the neurotoxins annonacin and squamocin has caused an atypical form of Parkinson's disease. In previous analyses, the fruits were extracted with methanol under ambient conditions before analyses. In the present study, UPLC–QTOF–MS and NMR were used to analyze freeze-dried graviola leaves that were extracted using dry m...

  3. Microspore development in Annona (Annonaceae): differences between monad and tetrad pollen.

    Science.gov (United States)

    Lora, Jorge; Herrero, Maria; Hormaza, Jose I

    2014-09-01

    • Permanent tetrads are the most common form of pollen aggregation in flowering plants. The production of pollen in monads is plesiomorphic in angiosperms, but the aggregation into tetrads has arisen independently different times during the evolution of flowering plants. The causes behind the recurrent evolution of pollen aggregation from monads remain elusive. Permanent tetrad pollen is quite common in the Annonaceae, the largest family in the early-divergent order Magnoliales. In some genera, such as Annona, both tetrad- and monad-producing species can be found.• In this comparative study of pollen development, we use immunolocalization, cytological characterization, and enzymatic assays of four species in the genus Annona and one species in its closely related genus Asimina that release pollen in tetrads and two species in the genus Annona that release pollen in monads.• The main difference between species with tetrad and monad pollen is a delayed digestion of callose and cellulose at the pollen aperture sites that resulted in nonlayering of the exine in these areas, followed by a rotation and binding of the young microspores at the aperture sites.• Small changes in development resulted in clear morphological changes on pollen dispersal time and open a window on the possible selective advantage of the production of aggregated pollen. © 2014 Botanical Society of America, Inc.

  4. Uranium mining and milling

    International Nuclear Information System (INIS)

    Floeter, W.

    1976-01-01

    In this report uranium mining and milling are reviewed. The fuel cycle, different types of uranium geological deposits, blending of ores, open cast and underground mining, the mining cost and radiation protection in mines are treated in the first part of this report. In the second part, the milling of uranium ores is treated, including process technology, acid and alkaline leaching, process design for physical and chemical treatment of the ores, and the cost. Each chapter is clarified by added figures, diagrams, tables, and flowsheets. (HK) [de

  5. Uranium mill tailings

    International Nuclear Information System (INIS)

    McLaren, L.H.

    1982-11-01

    This bibliography contains information on uranium mill tailings included in the Department of Energy's Energy Data Base from January 1981 through October 1982. The abstracts are grouped by subject category as shown in the table of contents. Entries in the subject index also facilitate access by subject, e.g., Mill Tailings/Radiation Hazards. Within each category the arrangement is by report number for reports, followed by nonreports in reverse chronological order. These citations are to research reports, journal articles, books, patents, theses, and conference papers from worldwide sources. Five indexes, each preceded by a brief description, are provided: Corporate Author, Personal Author, Subject, Contract Number, and Report Number. (335 abstracts)

  6. Characterization of the chemical composition of the essential oils from Annona emarginata (Schltdl. H. Rainer 'terra-fria' and Annona squamosa L.

    Directory of Open Access Journals (Sweden)

    Felipe Girotto Campos

    2014-01-01

    Full Text Available The objective of this study was to characterize the chemical composition of the essential oil from the leaves of Annona emarginata (Schltdl. H. Rainer 'terra-fria' and Annona squamosa L. The species were grown in a greenhouse for 18 months, which nutrient solution was applied weekly; the plants were then harvested and the leaves dried to extract the essential oil. The essential oil was analyzed by gas chromatography and mass spectrometry to study its chemical profiles. Eleven substances were found in the essential oil of A. emarginata, primarily (E-caryophyllene (29.29%, (Z-caryophyllene (16.86%, γ-muurolene (7.54%, α-pinene (13.86%, and tricyclene (10.04%. Ten substances were detected in the oil from A. squamosa, primarily (E-caryophyllene (28.71%, (Z-caryophyllene (14.46%, α-humulene (4.41%, camphene (18.10%, α-pinene (7.37%, β-pinene (8.71%, and longifolene (5.64%. Six substances were common to both species: (E-caryophyllene, (Z-caryophyllene, α-humulene, camphene, α-pinene, and β-pinene.

  7. Thermal Processing Alters the Chemical Quality and Sensory Characteristics of Sweetsop (Annona squamosa L.) and Soursop (Annona muricata L.) Pulp and Nectar.

    Science.gov (United States)

    Baskaran, Revathy; Ravi, Ramasamy; Rajarathnam, Somasundaram

    2016-01-01

    The objective of this study was to investigate the effect of thermal processing on the chemical quality and sensory characteristics of Annona squamosa L. and Annona muricata L. fruit pulps and nectar. The fruit pulps were pasteurized at 85 °C for 20 min and nectar prepared as per Food Safety and Standards Authority of India (FSSAI) specifications. The chemical composition of fresh and heated pulps of A. squamosa and A. muricata showed that compared to fresh, the chemical profile and sensory profile changed in heated samples and nectar. The free and bound phenolics of A. squamosa increased in heated pulp (127.61 to 217.22 mg/100 g and 150.34 to 239.74 mg/100 g, respectively), while in A. muricata, free phenolics increased very marginally from 31.73 to 33.74 mg/100 g and bound phenolics decreased from 111.11 to 86.91 mg/100 g. This increase in phenolic content may be attributed to the perception of bitterness and astringency in A. squamosa pulp on heating. In electronic tongue studies, principal component analysis (PCA) confirmed that the fresh and heated pulps had different scores, as indicated by sensory analysis using qualitative descriptive analysis (QDA). E-tongue analysis of samples discriminated the volatile compounds released from the heated A. squamosa and A. muricata fruit pulps and nectar in their respective PCA plots by forming different clusters. © 2015 Institute of Food Technologists®

  8. An Evaluation Of Anti Cancer Potential Of Annona Muricata Linn (Durian Belanda) Tea Product

    International Nuclear Information System (INIS)

    Muhammad Fakhrurazi Ahmad Fadzil; Zainah Adam; Shafii Khamis

    2014-01-01

    Though the number of cancer survivors continues to increase due to the improvements in early detection, cancer incidence and deaths still escalating each year. Even though there are major advancement in medicine technology such as chemotherapy, radiotherapy and nuclear medicine, people in developing countries especially in Asian countries are looking towards natural product as an alternative medicine especially in cancer treatment and prevention; primarily because of the general belief that herbal drugs are without any side effects besides being cheap and locally available. One of them is the leaves of Annona Muricata L. from the Annonaceae family is well known for their anti cancer activity by the local people in Malaysia and is commonly known as Soursoup or in local name of Durian Belanda. In the local market the most of the product of Annona Muricata L. is in the form of tea bag. This present study was aimed to evaluate the anti cancer potential of the extract of Annona Muricata L. The tea bag of Annona Muricata L. was obtain from a local market and was physically identified and confirmed by botanist as the leaves of Annona Muricata L. Sequential extraction was done using hexane, chloroform, methanol and hot aqueous. All of these extracts will be screen for alkaloid, saponin, cardiac glucoside and flavonoid. Then quantitative estimation of phenolics adn flavonoid content was conducted. These extract are also being tested on MDPA-MB-435S (human breast carcinoma cells) and HTB-43 (head and neck cancer) by MTT assay. These extract was also evaluated for their reducing power and DPPH radical scavenging assay. The parameters obtained from the test was IC50 values, a value that produce inhibitory cancer cells by 50 % and a value that produce radical scavenging at 50 % for both MTT assay and DPPH assay. Results revealed that the IC50 of hexane, chloroform, methanol and aqueous extract for MDA-MB-435S (human breast carcinoma cells) was 35.1μg/ml, 26.8 μg/ml, 19.1

  9. Effects of antioxidant additives on exhaust emissions reduction in compression ignition engine fueled with methyl ester of annona oil

    Directory of Open Access Journals (Sweden)

    Ramalingam Senthil

    2016-01-01

    Full Text Available In this present study, biodiesel is a cleaner burning alternative fuel to the Neat diesel fuel. However, several studies are pointed out that increase in NOx emission for biodiesel when compared with the Neat diesel fuel. The aim of the present study is to analyze the effect of antioxidant (p-phenylenediamine on engine emissions of a Diesel engine fuelled with methyl ester of annona oil. The antioxidant is mixed in various concentrations (0.010 to 0.040% (w/w with methyl ester of annona oil. Result shows that antioxidant additive mixture (MEAO+P200 is effective in control of NOx and HC emission of methyl ester of annona oil fuelled engine without doing any engine modification.

  10. Elliptic Yang-Mills equation.

    Science.gov (United States)

    Tian, Gang

    2002-11-26

    We discuss some recent progress on the regularity theory of the elliptic Yang-Mills equation. We start with some basic properties of the elliptic Yang-Mills equation, such as Coulomb gauges, monotonicity, and curvature estimates. Next we discuss singularity of stationary Yang-Mills connections and compactness theorems on Yang-Mills connections with bounded L(2) norm of curvature. We also discuss in some detail self-dual solutions of the Yang-Mills equation and describe a compactification of their moduli space.

  11. Elliptic Yang–Mills equation

    OpenAIRE

    Tian, Gang

    2002-01-01

    We discuss some recent progress on the regularity theory of the elliptic Yang–Mills equation. We start with some basic properties of the elliptic Yang–Mills equation, such as Coulomb gauges, monotonicity, and curvature estimates. Next we discuss singularity of stationary Yang–Mills connections and compactness theorems on Yang–Mills connections with bounded L2 norm of curvature. We also discuss in some detail self-dual solutions of the Yang–Mills equation and describe a compactification of the...

  12. AcEST: DK957853 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 229 7e-59 tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona... 228 3e-58 tr|A9NLB7|A9NLB7_PI...an endotransglycosylase OS=Annona cherimola GN=XET3 PE=2 SV=1 Length = 294 Score = 228 bits (580), Expect =

  13. AcEST: DK958676 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 298 2e-79 tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona... 29...|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona cherimola GN=XET3 PE=2 SV=1 Length = 294 Score = 296

  14. AcEST: DK956897 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _POPTR Putative uncharacterized protein OS=Popul... 241 2e-62 tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona..._ANNCH Xyloglucan endotransglycosylase OS=Annona cherimola GN=XET3 PE=2 SV=1 Length = 294 Score = 239 bits (

  15. AcEST: DK955310 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -44 tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona... 175 1e-42 tr|A9PHP9|A9PHP9_POPTR Put...159 >tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona cherimola GN=XET3 PE=2 SV=1 Length = 2

  16. The Value of Caspase-3 after the Application of Annona muricata Leaf Extract in COLO-205 Colorectal Cancer Cell Line

    OpenAIRE

    Abdullah, Murdani; Syam, Ari Fahrial; Meilany, Sofy; Laksono, Bayu; Prabu, Oryza Gryagus; Bekti, Heri Setiyo; Indrawati, Lili; Makmun, Dadang

    2017-01-01

    Annona muricata, commonly known as soursop, contains annonacin, acetogenin, and polyphenol which are known to have chemopreventive effects on cancer. In this study, we tend to evaluate the apoptosis-inducing effect of soursop (Annona muricata) leaf extract on the colorectal cancer cell line COLO-205 through the activities of caspase-3 which is a marker of cell apoptosis. Cell cultures were incubated with soursop leaf with a concentration of 10 μg/ml and then compared with those of the incubat...

  17. Shear Roll Mill Reactivation

    Science.gov (United States)

    2012-09-13

    pneumatically operated paste dumper and belt conveyor system , the loss in weight feeder system , the hydraulically operated shear roll mill, the pellet...out feed belt conveyor , and the pack out system comprised of the metal detector, scale, and pack out empty and full drum roller conveyors . Page | 4...process equipment sprinkler protection systems , and the 5 psig steam supply serving the building heating and make-up air systems . It also included

  18. [Evaluation of the anti-inflammatory activity and phytochemical screening of Annona senegalensis leaves].

    Science.gov (United States)

    Yeo, Dodehe; Dinica, Rodica; Yapi, Houphouet Felix; Furdui, Bianca; Praisler, Mirela; Djaman, Allico Joseph; N'Guessan, Jean David

    2011-01-01

    This study aims to highlight the anti-inflammatory activity of ethanol extract of Annona senegalensis and do its phytochemical screening. Rats were divided into three groups. The first group received only saline injection and instillation by intraperitoneal injection on days D0 and D7. This phase was the sensitization of that group. Then, on days D21, D22 and D23, the rats of the same group (Group 1) were injected with saline under anesthesia. The second group (Group 2) was composed of rats had not undergone treatment with the extract of Annona senegalensis. The rats in this batch have been sensitized by intraperitoneal injection (50 μL) of a solution of albumin (50 mg/rat) dissolved in aluminum hydroxide on days 0 and 7. Then during the challenge phase, saline containing 0.9% sodium chloride were injected intraperitoneally on days D21, D22 and D23. The sacrifice took place at D24 or 24 hours after the last challenge to ovalbumin. Similarly, rats of the third group (Group 3) have been sensitized by ovalbumin combined with aluminum hydroxide on days D0 and day D7. Then during the stage of provocation, rats in this batch received at days D21, D22 and D23, conjugated injection of albumin and ethanol extract of Annona senegalensis (injection of 0.4 mL of 7.10(-2) mg/kg body weight). The aqueous extract of Annona senegalensis has been previously prepared in saline. Twenty four hours after the last injection corresponding to D23, the rats were sacrificed under anesthesia. Secondary metabolites have been characterized by physico-chemical properties. Rats in the control (Group 1) gave an average of 24 ± 0.02 mast cells, 7 ± 0.1 macrophages, 9 ± 0.05 eosinophils. In the control group was not revealed the presence of neutrophils. Following the steps of provocation and awareness albumin (Group 2), we observed a significant increase in the number of inflammatory cells compared to control group (p Annona senegalensis (7.10(-2) mg/kg) induced a significant decrease in the

  19. PROSPECÇÃO TECNOLÓGICA DO GÊNERO ANNONA (ANNONACEAE

    Directory of Open Access Journals (Sweden)

    Jackson Roberto Guedes da Silva Almeida

    2014-09-01

    Full Text Available O gênero Annona L. pertence à família Annonaceae e compreende aproximadamente 162 espécies de árvores e arbustos. É considerado o principal gênero desta família, por apresentar espécies frutíferas de importante valor comercial, mas também por apresentar espécies com propriedades biológicas interessantes. O objetivo deste estudo foi realizar uma prospecção tecnológica do gênero Annona, analisando a participação do país nos depósitos de pedido de patente em bases nacionais e internacionais até o momento. Para isso, a prospecção foi realizada no Banco Europeu de Patentes, no banco da Organização Mundial de Propriedade Intelectual, no Banco Americano de Marcas e Patentes e no banco de dados do Instituto Nacional de Propriedade Industrial do Brasil. Os resultados mostraram que o Tratado de Cooperação de Patentes (PCT, os Estados Unidos e o Escritório Europeu de Patentes (EPO são os principais depositários de documentos envolvendo espécies de Annona. O maior número de patentes foi depositado em 2010. A classificação internacional mais abundante nessa prospecção foi C12N, seguida por A01H e A61K.

  20. Exhaust emissions reduction from diesel engine using combined Annona-Eucalyptus oil blends and antioxidant additive

    Science.gov (United States)

    Senthil, R.; Silambarasan, R.; Pranesh, G.

    2017-03-01

    The limited resources, rising petroleum prices and depletion of fossil fuel have now become a matter of great concern. Hence, there is an urgent need for researchers to find some alternate fuels which are capable of substituting partly or wholly the higher demanded conventional diesel fuel. Lot of research work has been conducted on diesel engine using biodiesel and its blends with diesel as an alternate fuel. Very few works have been done with combination of biodiesel-Eucalypts oil without neat diesel and this leads to lots of scope in this area. The aim of the present study is to analyze the performance and emission characteristics of a single cylinder, direct injection, compression ignition engine using eucalyptus oil-biodiesel as fuel. The presence of eucalyptus oil in the blend reduces the viscosity and improves the volatility of the blends. The methyl ester of Annona oil is blended with eucalypts oil in 10, 20, 30, 40 and 50 %. The performance and emission characteristics are evaluated by operating the engine at different loads. The performance characteristics such as brake thermal efficiency, brake specific fuel consumption and exhaust gas temperature are evaluated. The emission constituents measured are Carbon monoxide (CO), unburned hydrocarbons (HC), Oxides of nitrogen (NOx) and Smoke. It is found that A50-Eu50 (50 Annona + 50 % Eucalyptus oil) blend showed better performance and reduction in exhaust emissions. But, it showed a very marginal increase in NOx emission when compared to that of diesel. Therefore, in order to reduce the NOx emission, antioxidant additive (A-tocopherol acetate) is mixed with Annona-Eucalyptus oil blends in various proportions by which NOx emission is reduced. Hence, A50-Eu50 blend can be used as an alternate fuel for diesel engine without any modifications.

  1. Proximate composition, phytochemical analysis, and in vitro antioxidant potentials of extracts of Annona muricata (Soursop).

    Science.gov (United States)

    Agu, Kingsley C; Okolie, Paulinus N

    2017-09-01

    Numerous bioactive compounds and phytochemicals have been reported to be present Annona muricata (Soursop). Some of these chemical compounds have been linked to the ethnomedicinal properties of the plant and its antioxidant properties. The aim of this study was to assess the proximate composition, phytochemical constituents and in vitro antioxidant properties of A. muricata using standard biochemical procedures. The defatted Annona muricata crude methanolic extracts of the different parts of the plant were used for the estimation of proximate composition and phytochemical screening. The crude methanolic extracts of the different parts of the plant were also fractionated using solvent-solvent partitioning. Petroleum ether, chloroform, ethyl acetate, methanol, and methanol-water (90:10) were the solvents used for the fractionation. The different fractions obtained were then used to perform in vitro antioxidant analyses including, 1, 1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging ability, ferric reducing properties, and hydroxyl radical scavenging ability. The leaf methanolic extract had a higher lipid content, whereas its chloroform fraction demonstrated a better ability to quench DPPH free radical. The root-bark methanol-water, leaf methanol, fruit pulp chloroform, and leaf petroleum ether fractions demonstrated potent ferric reducing properties. The leaf and stem-bark petroleum ether fractions demonstrated better hydroxyl-free radical scavenging abilities. The leaf and fruit pulp of Annona muricata have a very potent antioxidant ability compared to the other parts of the plant. This can be associated with the rich phytochemicals and other phytoconstituents like phenols, flavonoids, alkaloids, and essential lipids, etc. Significant correlations were observed between the antioxidant status and phytochemicals present. These results thus suggest that some of the reported ethnomedicinal properties of this plant could be due to its antioxidant potentials.

  2. Three new antitumor annonaceous acetogenins from the seeds of Annona squamosa.

    Science.gov (United States)

    Ma, Chengyao; Wang, Qiwen; Shi, Yeye; Li, Yue; Wang, Xunan; Li, Xiang; Chen, Yong; Chen, Jianwei

    2017-09-01

    Two new annonaceous acetogenins squamocin P (2) and annosquatin III (3) and one new ACG precursor dieporeticenin B (1) along with five known precursors (4-8) were isolated from the seeds of Annona squamosa. Their structures were ascertained by chemical methods and various spectral evidences. These compounds showed inhibitory effects against three multidrug-resistant (MDR) cancer cell lines. Compound 2 and 3 displayed selective cytotoxicity against SMMC 7721/T (IC 50 0.435 and 1.79 μM) and MCF-7/ADR (IC 50 values 3.34 and 4.04 μM).

  3. MALDI-TOF MS Profiling of Annonaceous Acetogenins in Annona muricata Products for Human Consumption

    Directory of Open Access Journals (Sweden)

    Vincent Guérineau

    2009-12-01

    Full Text Available Annonaceous acetogenins are proposed as environmental neurotoxicants consumed through medicinal and alimentary habits and responsible for atypical parkinsonian syndromes observed in tropical areas. Potential sources of exposure still have to be determined, as, to date, only a few batches of products for human consumption were searched for these compounds. To assess the presence of acetogenins, we propose a fast, sensitive and accurate method of screening, using MALDI-TOF MS, with minimal sample preparation. Development of the technique is discussed. Its application to leaves of herbal tea, pulp and bottled nectar of Annona muricata is presented.

  4. Antiproliferative activity and induction of apoptosis by Annona muricata (Annonaceae) extract on human cancer cells

    OpenAIRE

    Pieme, Constant Anatole; Kumar, Santosh Guru; Dongmo, Mireille Sylviane; Moukette, Bruno Moukette; Boyoum, Fabrice Fekam; Ngogang, Jeanne Yonkeu; Saxena, Ajit Kumar

    2014-01-01

    Background Annona muricata (A. muricata) is widely distributed in Asia, Africa and South America. Different parts of this plant are used to treat several diseases in Cameroon. The aim of this study is to determine the in vitro anti-proliferative effects and apoptotic events of A. muricata extracts on HL-60 cells as well as to quantify its phenols content. Methods The cell viability was measured by using 3-(4, 5-dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT) assay while the chang...

  5. Montacin and cis-montacin, two new cytotoxic monotetrahydrofuran annonaceous acetogenins from Annona montana.

    Science.gov (United States)

    Liaw, Chih-Chuang; Chang, Fang-Rong; Wu, Yang-Chang; Wang, Hui-Kang; Nakanishi, Yuka; Bastow, Kenneth F; Lee, Kuo-Hsiung

    2004-11-01

    Two new monotetrahydrofuran Annonaceous acetogenins, montacin (1), and cis-montacin (2), along with four known acetogenins, annonacin, cis-annonacin, annomontacin, and cis-annomontacin, were isolated from the seeds of Annona montana. The structures of the new isolates were elucidated by spectral and chemical methods. The new acetogenins exhibited moderate in vitro cytotoxic activity against the 1A9 human ovarian cancer cell line. Interestingly, when Ca(2+) was present, compounds 1 and 2 became 3- to 10-fold more active against 1A9 cells and the PTX10 subline.

  6. Study on the spatial structure of annomuricatin A, a cyclohexapeptide from the seeds of Annona muricata

    Science.gov (United States)

    Wu, Li; Lu, Yang; Zheng, Qi-Tai; Tan, Ning-Hua; Li, Chao-Ming; Zhou, Jun

    2007-02-01

    A cyclic hexapeptide, annomuricatin A (the molecular formula: C 27H 38N 6O 7), was isolated from the seeds of Annona muricata. The types and sequence of the amino acids were confirmed by X-ray diffraction analysis. The stereochemistry of the title cyclopeptide was clarified by X-ray crystallographic study. The backbone contains two β-turns, one is type I β-turn and the other is type II, which are stabilized by two transannular 4 → 1 backbone hydrogen bonds between Ala and Phe. There are intermolecular hydrogen bonds between the cyclopeptide and the solvent molecules which maintained the steady spatial arrangement in crystal.

  7. PENGARUH EKSTRAK DAUN SIRSAK (Annona muricata L. TERHADAP SIKLUS REPRODUKSI PADA MENCIT PUTIH DARA

    Directory of Open Access Journals (Sweden)

    E. T. Margawati

    2012-09-01

    Full Text Available The effect of Annona muricata leaves extract on the estrous cycle was studied. Four treatments of this extract were caried out with 0%, 5%, 10% and 15% concentrations respectively. Vaginal smears were used to determine the estrous cycle by microscopic examination of the epithet cells. The result showed that 10% dosages of A. muricata leaf extract is the most effective in shorting the estrous cycle of mice, namely 3.75 days, whereas the other dosages showed much longer estrous cycles of more than 4 days.

  8. MALDI-TOF MS profiling of annonaceous acetogenins in Annona muricata products for human consumption.

    Science.gov (United States)

    Champy, Pierre; Guérineau, Vincent; Laprévote, Olivier

    2009-12-15

    Annonaceous acetogenins are proposed as environmental neurotoxicants consumed through medicinal and alimentary habits and responsible for atypical parkinsonian syndromes observed in tropical areas. Potential sources of exposure still have to be determined, as, to date, only a few batches of products for human consumption were searched for these compounds. To assess the presence of acetogenins, we propose a fast, sensitive and accurate method of screening, using MALDI-TOF MS, with minimal sample preparation. Development of the technique is discussed. Its application to leaves of herbal tea, pulp and bottled nectar of Annona muricata is presented.

  9. Biosynthesis, Characterization, and Antidermatophytic Activity of Silver Nanoparticles Using Raamphal Plant (Annona reticulata) Aqueous Leaves Extract

    OpenAIRE

    Shivakumar Singh, P.; Vidyasagar, G. M.

    2014-01-01

    The present work investigated the biosynthesis of silver nanoparticles using Annona reticulata leaf aqueous extract. The biosynthesised silver nanoparticles were confirmed by visual observation and UV-Vis spectroscopy. Appearance of dark brown colour indicated the synthesis of silver in the reaction mixture. The silver nanoparticles were found to be spherical, rod, and triangular in shape with variable size ranging from 23.84 to 50.54 nm, as evident by X-ray diffraction studies, TEM. The X-ra...

  10. 7 CFR 868.310 - Grades and grade requirements for the classes Long Grain Milled Rice, Medium Grain Milled Rice...

    Science.gov (United States)

    2010-01-01

    ... Grain Milled Rice, Medium Grain Milled Rice, Short Grain Milled Rice, and Mixed Milled Rice. (See also Â... Milled Rice Principles Governing Application of Standards § 868.310 Grades and grade requirements for the classes Long Grain Milled Rice, Medium Grain Milled Rice, Short Grain Milled Rice, and Mixed Milled Rice...

  11. Polyketide Derivatives from Annona muricata Linn Leaves as Potencial Anticancer Material by Combination Treatment With Doxorubicin on Hela Cell Line

    Science.gov (United States)

    Artanti, A. N.; Astirin, O. P.; Prayito, A.; Widiyaningsih, R. F.; Prihapsara, F.

    2017-02-01

    One of the compounds found effication as an anticancer agent on cervical cancer is acetogenin, a polyketide compound that is abundant in Annona muricata L. leaves. This study has been done to examine polyketide derivatives was isolated from Annona muricata L. which has potency to induce apoptosis by p53 expression on hela cell line. An approach recently develop to overcome side effect of chemoterapeutic agent is used of combined chemoterapeutic agent, i.e doxorubicin. The determination of cytotoxic combination activity from polyketide derivative and doxorubicin was evaluated using MTT assay to obtain the value of CI (combination index). The expression of p53 profile was evaluated by immunohistochemistry on hela cell line. Data analysis showed that combination of polyketide derivative from Annona muricata L. (38,5 µg/ml) and doxorubicin with all of concentration performed synergistic effect on hela cell line with CI value from 0,33 - 0,65. The analysis on immucytochemistry showed that polyketide derivative from Annona muricata L. leaves could enhance p53 pathway significantly on hela cell line.

  12. Uranium-mill appraisal program

    International Nuclear Information System (INIS)

    Everett, R.J.; Cain, C.L.

    1982-08-01

    The results of special team appraisals at NRC-licensed uranium mills in the period May to November 1981 are reported. Since the Three Mile Island accident, NRC management has instituted a program of special team appraisals of radiation protection programs at certain NRC-licensed facilities. These appraisals were designed to identify weaknesses and strengths in NRC-licensed programs, including those areas not covered by explicit regulatory requirements. The regulatory requirements related to occupational radiation protection and environmental monitoring at uranium mills have been extensively upgraded in the past few years. In addition, there was some NRC staff concern with respect to the effectiveness of NRC licensing and inspection programs. In response to this concern and to changes in mill requirements, the NRC staff recommended that team appraisals be conducted at mills to determine the adequacy of mill programs, the effectiveness of the new requirements, and mill management implementation of programs and requirements. This report describes the appraisal scope and methodology as well as summary findings and conclusions. Significant weaknesses identified during the mill appraisals are discussed as well as recommendations for improvements in uranium mill programs and mill licensing and inspection

  13. Annona squamosa Linn: cytotoxic activity found in leaf extract against human tumor cell lines.

    Science.gov (United States)

    Wang, De-Shen; Rizwani, Ghazala H; Guo, Huiqin; Ahmed, Mansoor; Ahmed, Maryam; Hassan, Syed Zeeshan; Hassan, Amir; Chen, Zhe-Sheng; Xu, Rui-Hua

    2014-09-01

    Cancer is a common cause of death in human populations. Surgery, chemotherapy and radiotherapy still remain the corner stone of treatment. However, herbal medicines are gaining popularity on account of their lesser harmful side effects on non-targeted human cells and biological environment. Annona squamosa Linn is a common delicious edible fruit and its leaf have been used for the treatment in various types of diseases. The objective of present study is to determine the anticancer potential of the organic and aqueous extracts of leaf of Annona squamosa L. MTT (3-(4, 5-dimethylthiazole-2yl)-2, 5-biphenyl tetrazolium bromide) assay against hepatocellular carcinoma cell line BEL-7404, lung cancer line H460, human epidermoid carcinoma cell line KB-3-1, prostatic cancer cell line DU145, breast carcinoma cell line MDA-MB-435, and colon cancer cell line HCT-116 Human primary embryonic kidney cell line HEK293 as control were used for the study. The crude extract (Zcd) and Ethyl acetate extract (ZE) were found significant anticancer activity only on human epidermoid carcinoma cell line KB-3-1 and colon cancer cell line HCT-116.

  14. Aqueous extract of Annona macroprophyllata: a potential α-glucosidase inhibitor.

    Science.gov (United States)

    Brindis, F; González-Trujano, M E; González-Andrade, M; Aguirre-Hernández, E; Villalobos-Molina, R

    2013-01-01

    Annona genus contains plants used in folk medicine for the treatment of diabetes. In the present study, an aqueous extract prepared from Annona macroprophyllata (Annonaceae, also known as A. diversifolia) leaves was evaluated on both the activity of yeast α -glucosidase (an in vitro assay) and sucrose tolerance in Wistar rats. The results have shown that the aqueous extract from A. macroprophyllata inhibits the yeast α -glucosidase with an IC₅₀ = 1.18 mg/mL, in a competitive manner with a K(i) = 0.97 mg/mL, a similar value to that of acarbose (K(i) = 0.79 mg/mL). The inhibitory activity of A. macroprophyllata was reinforced by its antihyperglycemic effect, at doses of 100, 300, and 500 mg/kg in rats. Chromatographic analysis identified the flavonoids rutin and isoquercitrin in the most polar fractions of A. macroprophyllata crude extract, suggesting that these flavonoids are part of the active constituents in the plant. Our results support the use of A. macroprophyllata in Mexican folk medicine to control postprandial glycemia in people with diabetes mellitus, involving active constituents of flavonoid nature.

  15. Aqueous Extract of Annona macroprophyllata: A Potential α-Glucosidase Inhibitor

    Directory of Open Access Journals (Sweden)

    F. Brindis

    2013-01-01

    Full Text Available Annona genus contains plants used in folk medicine for the treatment of diabetes. In the present study, an aqueous extract prepared from Annona macroprophyllata (Annonaceae, also known as A. diversifolia leaves was evaluated on both the activity of yeast α-glucosidase (an in vitro assay and sucrose tolerance in Wistar rats. The results have shown that the aqueous extract from A. macroprophyllata inhibits the yeast α-glucosidase with an IC50 = 1.18 mg/mL, in a competitive manner with a Ki = 0.97 mg/mL, a similar value to that of acarbose (Ki = 0.79 mg/mL. The inhibitory activity of A. macroprophyllata was reinforced by its antihyperglycemic effect, at doses of 100, 300, and 500 mg/kg in rats. Chromatographic analysis identified the flavonoids rutin and isoquercitrin in the most polar fractions of A. macroprophyllata crude extract, suggesting that these flavonoids are part of the active constituents in the plant. Our results support the use of A. macroprophyllata in Mexican folk medicine to control postprandial glycemia in people with diabetes mellitus, involving active constituents of flavonoid nature.

  16. Fatty Acids Analysis, Antioxidant and Biological Activity of Fixed Oil of Annona muricata L. Seeds

    Directory of Open Access Journals (Sweden)

    Zaha A. Elagbar

    2016-01-01

    Full Text Available The total oil yield and the fatty acid composition were determined in the Annona muricata L. fixed oil using organic solvent extraction and GC-FID. The seeds were found to contain about ~21.5% of crude fixed oil on a dry weight basis. The crude oil containing fatty acid was converted into methyl esters and analysed by GC-FID. Fourteen fatty acids were identified using GC-FID. The major monounsaturated and saturated fatty acids were oleic acid (39.2% and palmitic acid (19.1–19.2%, respectively, whereas the α-linolenic acid (1.2% and linoleic acid (34.9% were polyunsaturated fatty acid. The other saturated acids were stearic acid (3.3%, arachidic acid (0.4%, myristic acid (0.1%, heptadecanoic acid (0.1%, behenic acid (0.1%, and lignoceric acid (0.1%. Some of the fatty acids have not been reported earlier from the oil of Annona muricata L. Fixed oil exhibited significant free radical scavenging activity which was measured using DPPH and is also known to inhibit the gastrointestinal motility significantly.

  17. In Vitro Protective Potentials of Annona muricata Leaf Extracts Against Sodium Arsenite-induced Toxicity.

    Science.gov (United States)

    George, Vazhappilly Cijo; Kumar, Devanga Ragupathi Naveen; Suresh, Palamadai Krishnan; Kumar, Rangasamy Ashok

    2015-01-01

    Sodium arsenite (NaAsO2) is a metalloid which is present widely in the environment and its chronic exposure can contribute to the induction of oxidative stress, resulting in disturbances in various metabolic functions including liver cell death. Hence, there is a need to develop drugs from natural sources, which can reduce arsenic toxicity. While there have been reports regarding the antioxidant and protective potentials of Annona muricataleaf extracts, our study is the first ofits kind to extend these findings by specifically evaluating its ability to render protection against sodium arsenite (NaAsO2) induced toxicity (10 μM) in WRL-68 (human hepatic cells) and human erythrocytes by employing XTT and haemolysis inhibition assays respectively. The methanolic extract exhibited higher activity than the aqueous extract in both assays. The results showed a dose-dependent decrease in arsenic toxicity in both WRL-68 cells and erythrocytes, suggesting the protective nature of Annona muricatato mitigate arsenic toxicity. Hence the bioactive extracts can further be scrutinized for the identification and characterization of their principal contributors.

  18. Japan steel mill perspective

    Energy Technology Data Exchange (ETDEWEB)

    Murase, K. [Kobe Steel Ltd., Tokyo (Japan)

    2004-07-01

    The international and Japan's steel industry, the coking coal market, and Japan's expectations from Canada's coal industry are discussed. Japan's steel mills are operating at full capacity. Crude steel production for the first half of 2004 was 55.8 million tons. The steel mills are profitable, but costs are high, and there are difficulties with procuring raw materials. Japan is trying to enhance the quality of coke, in order to achieve higher productivity in the production of pig iron. Economic growth is rising disproportionately in the BRICs (Brazil, Russia, India, and China), with a large increase in coking coal demand from China. On the supply side, there are several projects underway in Australia and Canada to increase production. These include new developments by Elk Valley Coal Corporation, Grande Cache Coal, Western Canadian Coal, and Northern Energy and Mining in Canada. The Elga Mine in the far eastern part of Russia is under development. But the market is expected to remain tight for some time. Japan envisions Canadian coal producers will provide a stable coal supply, expansion of production and infrastructure capabilities, and stabilization of price. 16 slides/overheads are included.

  19. Einstein-Yang-Mills from pure Yang-Mills amplitudes

    OpenAIRE

    Nandan, Dhritiman; Plefka, Jan; Schlotterer, Oliver; Wen, Congkao

    2016-01-01

    We present new relations for scattering amplitudes of color ordered gluons and gravitons in Einstein-Yang-Mills theory. Tree-level amplitudes of arbitrary multiplicities and polarizations involving up to three gravitons and up to two color traces are reduced to partial amplitudes of pure Yang-Mills theory. In fact, the double-trace identities apply to Einstein-Yang-Mills extended by a dilaton and a B-field. Our results generalize recent work of Stieberger and Taylor for the single graviton ca...

  20. Determining energy costs for milling solid matter

    Science.gov (United States)

    Guangbin, Yu., Dr.; Kuznetsova, M. M.; Marakhovskii, M. B.; Aleksina, A. A.

    2015-05-01

    The article provides findings of analytical research into the process of milling friable matter in a ball mill. We have received an expression to determine energy cost of milling with the account of the method of milling and the characteristics of the material to be ground.

  1. Chemical constituents of the volatile oil from leaves of Annona coriacea and in vitro antiprotozoal activity

    Directory of Open Access Journals (Sweden)

    Carlos A. T. Siqueira

    2011-02-01

    Full Text Available The essential oil of the leaves from Annona coriacea Mart., Annonaceae, was extracted by hydrodistillation in a Clevenger apparatus and analyzed by GC/MS and GC/FID. The oil yield was 0.05% m/m. Sixty compounds were identified, in a complex mixture of sesquiterpenes (76.7%, monoterpenes (20.0% and other constituents (3.3%. Bicyclogermacrene was its major compound (39.8% followed by other sesquiterpenes. Most of the monoterpenes were in low concentration (<1%. Only β-pinene and pseudolimonene presented the highest level of 1.6%. The volatile oil presented anti-leishmanial and trypanocidal activity against promastigotes of four species of Leishmania and trypomastigotes of Trypanosoma cruzi, showing to be more active against Leishmania (L. chagasi (IC50 39.93 µ g/mL (95% CI 28.00-56.95 µ g/mL.

  2. Chemical constituents of the volatile oil from leaves of Annona coriacea and in vitro antiprotozoal activity

    Directory of Open Access Journals (Sweden)

    Carlos A. T. Siqueira

    2010-11-01

    Full Text Available The essential oil of the leaves from Annona coriacea Mart., Annonaceae, was extracted by hydrodistillation in a Clevenger apparatus and analyzed by GC/MS and GC/FID. The oil yield was 0.05% m/m. Sixty compounds were identified, in a complex mixture of sesquiterpenes (76.7%, monoterpenes (20.0% and other constituents (3.3%. Bicyclogermacrene was its major compound (39.8% followed by other sesquiterpenes. Most of the monoterpenes were in low concentration (<1%. Only β-pinene and pseudolimonene presented the highest level of 1.6%. The volatile oil presented anti-leishmanial and trypanocidal activity against promastigotes of four species of Leishmania and trypomastigotes of Trypanosoma cruzi, showing to be more active against Leishmania (L. chagasi (IC50 39.93 µ g/mL (95% CI 28.00-56.95 µ g/mL.

  3. Ent-Kaurane diterpenes from Annona glabra and their cytotoxic activities.

    Science.gov (United States)

    Anh, Hoang Le Tuan; Hien, Nguyen Thi Thu; Hang, Dan Thi Thuy; Ha, Tran Minh; Nhiem, Nguyen Xuan; Hien, Truong Thi Thu; Thu, Vu Kim; Thao, Do Thi; Van Minh, Chau; Kiem, Phan Van

    2014-12-01

    A new ent-kaurane glycoside, annoglabasin H (1), and three known ent-kauranes, annoglabasin E (2), annoglabasin B (3), and 19-nor-ent-kaurent-4-ol-17-oic acid (4) were isolated from the fruits of Annona glabra. Their structures were determined by the combination of spectroscopic and chemical methods, including 1D- and 2D-NMR spectroscopy, as well as by comparison with the NMR data reported in the literature. The cytotoxic activities of these compounds were evaluated on four human cancer cell lines, LU-1, MCF-7, SK-Mel2, and KB. Compound 1 exhibited significant cytotoxic activity on all tested human cancer cell lines with IC50 values ranging from 3.7 to 4.6 μM.

  4. In vivo antimalarial efficacy of acetogenins, alkaloids and flavonoids enriched fractions from Annona crassiflora Mart.

    Science.gov (United States)

    Pimenta, Lúcia Pinheiro Santos; Garcia, Giani Martins; Gonçalves, Samuel Geraldo do Vale; Dionísio, Bárbara Lana; Braga, Erika Martins; Mosqueira, Vanessa Carla Furtado

    2014-01-01

    Annona crassiflora and Annonaceae plants are known to be used to treat malaria by traditional healers. In this work, the antimalarial efficacy of different fractions of A. crassiflora, particularly acetogenin, alkaloids and flavonoid-rich fractions, was determined in vivo using Plasmodium berghei-infected mice model and toxicity was accessed by brine shrimp assay. The A. crassiflora fractions were administered at doses of 12.5 mg/kg/day in a 4-day test protocol. The results showed that some fractions from woods were rich in acetogenins, alkaloids and terpenes, and other fractions from leaves were rich in alkaloids and flavonoids. The parasitaemia was significantly (p < 0.05, p < 0.001) reduced (57-75%) with flavonoid and alkaloid-rich leaf fractions, which also increased mean survival time of mice after treatment. Our results confirm the usage of this plant in folk medicine as an antimalarial remedy.

  5. Detoxification of Echis ocellatus venom-induced toxicity by Annona senegalensis Pers.

    Science.gov (United States)

    Emmanuel, Amlabu; Ebinbin, Ajagun; Amlabu, Wandayi

    2014-06-01

    Different fractions (I-V) of the methanolic leaf extracts of Annona senegalensis were assessed for their anti-snake venom activities. Fractions III neutralized lethal toxicity induced by Echis ocellatus venom and manifested the same potency as the crude extracts against the venom. The anti-snake venom activity of fraction III was clearly shown by the complete abrogation of venom-induced haemorrhage and the 75% record of surviving mice which were injected with a pre-incubate of venom and extract in the ratio 1:30 w/w after a 24 h. Also, fraction III exhibited a weak inhibitory effect on fibrinogen clotting activity of this venom. The key phytochemicals mediating the activity of this fraction are flavonoids and tannins. The detoxification of this venom by fraction III and the possible mode of action in the pathology of snake envenoming is discussed in this report.

  6. Biosynthesis of gold nanoparticles by Pseudomonas veronii AS41G inhabiting Annona squamosa L.

    Science.gov (United States)

    Baker, Syed; Satish, Sreedharamurthy

    2015-11-05

    Biogenic principles to nanotechnology have generated tremendous attention in recent past owing eco friendly benign process for synthesis of nanoparticles. Present investigation reports extracellular synthesis of gold nanoparticles using cell free supernatant of Pseudomonas veronii AS 41G, a novel endophyte isolated from Annona squamosa L. Gold nanoparticles formation was confirmed with UV-Visible spectrophotometer. FTIR analysis predicted various functional groups responsible for reduction of metal salts and stabilization of gold nanoparticles. Nanoparticles were crystalline in nature as shown in XRD pattern. TEM analysis revealed morphological characteristics of nanoparticles with different size. Thus the present study attributes for facile process for synthesis of gold nanoparticles as an alternative for conventional methods. The study also highlights the new role of novel bacterium Pseudomonas veronii AS41G which will be very valuable as a record for the researchers working on it. Copyright © 2015 Elsevier B.V. All rights reserved.

  7. Annona reticulata Linn. (Bullock's heart: Plant profile, phytochemistry and pharmacological properties

    Directory of Open Access Journals (Sweden)

    Prasad G. Jamkhande

    2015-07-01

    Full Text Available From the beginning of human civilization plants and plant based chemicals are the most important sources of medicines. Phytochemical and different products obtained from plant are used as medicines, pharmaceuticals, cosmetics and food supplements. Annona reticulata Linn. (牛心果 niú xīn guǒ; Bullock's heart is a versatile tree and its fruits are edible. Parts of A. reticulata are used as source of medicine and also for industrial products. It possesses several medicinal properties such as anthelmintic, analgesic, anti-inflammatory, antipyretic, wound healing and cytotoxic effects. It is widely distributed with phytochemicals like tannins, alkaloids, phenols, glycosides, flavonoids and steroids. Present article is an attempt to highlight over taxonomy, morphology, geographical distribution, phytoconstituents and pharmacological activities of A. reticulata reported so far.

  8. INHIBITION TEST OF METHANOL EXTRACT FROM SOURSOP LEAF (Annona muricata Linn. AGAINST Streptococcus mutans BACTERIA

    Directory of Open Access Journals (Sweden)

    Raudhatul Jannah

    2017-03-01

    Full Text Available Dental caries is a disease with a high prevalence of caries in Indonesia is caused by the bacterium Streptococcus mutans. The leaves of the soursop (Annona muricata Linn. is one of the herbs that can remove dental plaque. This study aims to determine the chemical content and measure the inhibitory antibacterial soursop leaft methanol extractin inhibiting the growth of Streptococcus mutans bacteria. Phytochemical screening stated that the leaf of the soursop contains flavonoids, alkaloids, tannins, steroids, glycosides and saponins. Test of inhibition were measured using paper disc diffusion method with variation concentrations of 5, 10, 15 20, and 25%, positive control is tetrasilkin 30 µg, and a negative control is methanol. Antibacterial test results showed that the methanol extract of soursop leaves have antibacterial activity against Streptococcus mutans at concentrations of 5, 10, 15, 20 and 25% with inhibitory diameter of 9,1; 10,57; 11,53; 12,01 and 13,75 mm respectively.

  9. Quantification of acetogenins in Annona muricata linked to atypical parkinsonism in guadeloupe.

    Science.gov (United States)

    Champy, Pierre; Melot, Alice; Guérineau Eng, Vincent; Gleye, Christophe; Fall, Djibril; Höglinger, Gunter U; Ruberg, Merle; Lannuzel, Annie; Laprévote, Olivier; Laurens, Alain; Hocquemiller, Reynald

    2005-12-01

    Atypical parkinsonism in Guadeloupe has been associated with the consumption of fruit and infusions or decoctions prepared from leaves of Annona muricata L. (Annonaceae), which contains annonaceous acetogenins, lipophilic inhibitors of complex I of the mitochondrial respiratory chain. We have determined the concentrations of annonacin, the major acetogenin in A. muricata, in extracts of fruit and leaves by matrix-assisted laser desorption-ionization mass spectrometry. An average fruit is estimated to contain about 15 mg of annonacin, a can of commercial nectar 36 mg, and a cup of infusion or decoction 140 microg. As an indication of its potential toxicity, an adult who consumes one fruit or can of nectar a day is estimated to ingest over 1 year the amount of annonacin that induced brain lesions in rats receiving purified annonacin by intravenous infusion.

  10. A flavonol triglycoside and investigation of the antioxidant and cell stimulating activities of Annona muricata Linn.

    Science.gov (United States)

    Nawwar, Mahmoud; Ayoub, Nahla; Hussein, Sahar; Hashim, Amani; El-Sharawy, Reham; Wende, Kristian; Harms, Manuela; Lindequist, Ulrike

    2012-05-01

    Chemical investigation on leaves of Annona muricata resulted in the isolation of the flavonol triglycoside, quercetin 3-O-α-rhamnosyl-(1″″ → 6″)-β-sophoroside, together with twelve known phenolics. The structures of these compounds were established by 1D- and 2D-nuclear magnetic resonance spectroscopic techniques and mass spectrometry data. The in vitro antioxidant studies of the investigated aqueous ethanol extract and its column fractions were accomplished using the oxygen radical absorbance capacity (ORAC) method. A stimulating effect on HaCaT human keratinocytes by the leaf extract was also assessed. Il-6 production after UV irradiation was not influenced by A. muricata leaf extract.

  11. Acetogenins and alkaloids during the initial development of Annona muricata L. (Annonaceae).

    Science.gov (United States)

    Riley-Saldaña, Christian Anabí; Cruz-Ortega, María Del Rocío; Martínez Vázquez, Mariano; De-la-Cruz-Chacón, Iván; Castro-Moreno, Marisol; González-Esquinca, Alma Rosa

    2017-10-26

    In plants, the presence and distribution of specialized metabolites during the early stages of development are not documented enough, even though their biosynthesis is one of the most important strategies for survival. In this study, five alkaloids and four acetogenins were detected in Annona muricata L. during early development seedling, including three phases of root emergence and three of seedling formation. Hexane and alkaloid extracts were obtained from each organ, which were analyzed in a gas-mass chromatograph and in a high-performance liquid chromatograph coupled with a photodiode array UV detector (HPLC-DAD). This research shows the presence of the acetogenins cis-uvarimicin IV, mosinone, muricina B, and cis-annonacin-10-one, as well as of the alkaloids reticuline, coreximine, anonaine, asimilobine, and nornuciferine, both groups with a variable organ-specific distribution, related with the formation of organs and tissues.

  12. Diversity in the Stem Anatomy and Tissues of Several Species of Annona (Annonaceae in Nigeria

    Directory of Open Access Journals (Sweden)

    Abayomi Ezekiel FOLORUNSO

    2011-08-01

    Full Text Available Comparative study of the stem anatomy of Annona trees was carried out to facilitate identification of taxa when their reproductive parts are not available. Stem specimens of four out of the five species categorized as important under-utilized species were collected and subjected to anatomical studies. Macerated materials followed Schutze�s method of maceration and the transverse sections of the stem were cut using Reichert Sledge Microtome. Intrageneric characters observed are: epidermal layer uniseriate with round, oval to polygonal collenchyma cells. Wood is diffuse-porous, vessel elements are diffuse, vessels are of two types, that is, short/wide with simple pits and long/narrow with bordered pits. Diagnostic characters for the identification of each of the species are also reported.

  13. Diversity in the Stem Anatomy and Tissues of Several Species of Annona (Annonaceae in Nigeria

    Directory of Open Access Journals (Sweden)

    Abayomi Ezekiel FOLORUNSO

    2011-08-01

    Full Text Available Comparative study of the stem anatomy of Annona trees was carried out to facilitate identification of taxa when their reproductive parts are not available. Stem specimens of four out of the five species categorized as important under-utilized species were collected and subjected to anatomical studies. Macerated materials followed Schutzes method of maceration and the transverse sections of the stem were cut using Reichert Sledge Microtome. Intrageneric characters observed are: epidermal layer uniseriate with round, oval to polygonal collenchyma cells. Wood is diffuse-porous, vessel elements are diffuse, vessels are of two types, that is, short/wide with simple pits and long/narrow with bordered pits. Diagnostic characters for the identification of each of the species are also reported.

  14. Essential oil from the leaves of Annona vepretorum: chemical composition and bioactivity.

    Science.gov (United States)

    Costa, Emmanoel Vilaça; Dutra, Lívia Macedo; Nogueira, Paulo Cesar de Lima; Moraes, Valéria Regina de Souza; Salvador, Marcos José; Ribeiro, Luis Henrique Gonzaga; Gadelha, Fernanda Ramos

    2012-02-01

    The essential oil from the leaves of Annona vepretorun was obtained by hydrodistillation using a Clevenger-type apparatus and analyzed by GC-MS and GC-FID. Eighteen compounds representing 98.1% of the crude essential oil were identified. The major compounds identified were bicyclogermacrene (43.7%), spathulenol (11.4%), alpha-felandrene (10.0%), alpha-pinene (7.1%), (E)-beta-ocimene (6.8%), germacrene D (5.8%), and p-cymene (4.2%). The trypanocidal activity against Trypanosoma cruzi epimastigote forms, as well as, the antimicrobial and antioxidant proprieties was investigated. The essential oil showed a potent trypanocidal activity with IC50 value of 31.9 +/-1.3 microg x mL(-1). For antimicrobial activity, the best result was observed against Candida tropicalis with a MIC value of 100 microg x mL(-1). For antioxidant capacity the essential oil showed weak activity.

  15. Cryogenic Milling of Titanium Powder

    Directory of Open Access Journals (Sweden)

    Jiří Kozlík

    2018-01-01

    Full Text Available Ti Grade 2 was prepared by cryogenic attritor milling in liquid nitrogen and liquid argon. Two types of milling balls were used—stainless steel balls and heavy tungsten carbide balls. The effect of processing parameters on particle size and morphology, contamination of powder and its microhardness was investigated. Milling in liquid nitrogen was not feasible due to excessive contamination by nitrogen. Minor reduction of particle size and significant alterations in particle morphology depended on type of milling balls and application of stearic acid as processing control agent. Heavily deformed ultra-fine grained (UFG internal microstructure of powder particles was observed by the method of “transmission Kikuchi diffraction”.

  16. PENGARUH KONSENTRASI AIR REBUSAN DAUN SIRSAK (Annona muricata Linn TERHADAP PERTUMBUHAN LARVA NYAMUK Aedes aegypti

    Directory of Open Access Journals (Sweden)

    Diah Ariana

    2016-02-01

    Abstract Leaves of the soursop (Annona muricata Linn Indonesia is known as a medicinal plant that can treat a variety of diseases other than as a cure soursop leaves is also an insecticide-producing plants are bioactive compounds known as acetogenin which are bioactive compounds in high concentrations can be toxic to insects, thus may cause the insects will not eat. At low concentrations of toxic by oral administration stomach and can cause death. Soursop leaves are pesticides from natural elements that can be decided by the Aedes aegypti mosquito generation above background can be taken formulation of the problem Is there any effect of the concentration of soursop leaves boiled water (Annona muricata Linn on the growth of mosquito larvae of Aedes aegypti? This study aimed to determine the effect of water concentration on the growth of soursop leaf decoction Aedes aegypti mosquito larvae.The design of this study used an experimental design with laboratory testing, soursop leaf decoction obtained by weigh 100 g and dissolved in 100 ml of distilled water generated lau soursop leaves boiled water. The inhibition assay performed on boiled water boiling water concentration 100%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10% and visits by the number of larvae of Aedes aegypti mosquitoes that die in 24 hours after treatment. Statistical analysis using Annova test with significance level 0.05 for determining the presence or absence of the influence of water concentration on the growth of soursop leaf decoction mosquito Aedes aegypti and subsequent Tukey HSD test was done to see the differences in each concentration. The results showed concentrations of 10% to 100% can inhibit the growth of mosquito larvae of Aedes aegypti, so it can be concluded that the soursop leaves can inhibit the growth of mosquito larvae of Aedes aegypti and efficient soursop leaves is used for patients with antibacterial, antifungal, anticonvulsant, and anti-inflammatory. Keyword :  larvae of Aedes

  17. Mycoflora and production of wine from fruits of soursop (Annona Muricata L.

    Directory of Open Access Journals (Sweden)

    Raphael N Okigbo

    2008-12-01

    Full Text Available Raphael N Okigbo1, Omokaro Obire21Department of Botany, Nnamdi Azikiwe University, Awka, Anambra State, Nigeria; 2Department of Applied and Environmental Biology, Rivers State University of Science and Technology, Port Harcourt, NigeriaAbstract: An investigation was conducted on the mycoflora associated with the different parts of fresh and rotten fruits of soursop (Annona muricata L. and the potential of using both indigenous yeast flora and commercial yeast extract for wine production. Isolation of fungi and pathogenicity test were carried out with Sabouraud dextrose agar. Mycoflora were more in the rotten fruits than in the fresh fruits. Botryodiplodia theobromae was isolated only from the rotten fruits (skin while Trichoderma viride was isolated only from the fresh fruits. Penicillium sp., was the most dominant in all the fruit part of fresh soursop fruit with Rhizopus stolonifer having the highest percentage occurrence (36.39% in the rotten fruit. Most of the isolated fungi indicated occurrence of such common airborne fungi on soursop fruits and the potential to induce rot in fresh healthy fruits of soursop in storage. Soursop juice was fermented for 10 days and wine was obtained. There was a significant difference (P < 0.05 in the alcoholic content of the wines obtained from the indigenous and commercial yeasts. The wine obtained from the pasteurized, ameliorated soursop juice inoculated with propagated indigenous yeast yielded the highest alcoholic content. Based on the level of the nutritional composition of soursop juice, the ability to support yeast growth, the high alcoholic content and palatability of the wine, the Annona muricata is good source for wine production and single-cell protein.Keywords: fermentation, fruit yeast, fungi, incidence, rot

  18. Mechanisms of analgesic and anti-inflammatory properties of Annona muricata Linn. (Annonaceae) fruit extract in rodents.

    Science.gov (United States)

    Ishola, Ismail O; Awodele, Olufunsho; Olusayero, Abayomi Micheal; Ochieng, Charles O

    2014-12-01

    Unripe fruit of Annona muricata Linn. (Annonaceae) (soursop) is used in traditional African medicine for the treatment of neuralgia, rheumatism, and arthritic pain. This study sought to investigate the analgesic and anti-inflammatory effects of lyophilized fruit extract of Annona muricata (AM) in rodents. The analgesic activity was evaluated using the mouse writhing, formalin, and hot-plate tests while the anti-inflammatory action was investigated using the carrageenan-induced rat paw edema and xylene-induced ear edema tests. Pretreatment with AM (50, 100, and 200 mg/kg, p.o.) produced dose-dependent (Pmuricata possesses analgesic effect through interaction with opioidergic pathway and anti-inflammatory property through inhibition of chemical mediators of inflammation.

  19. Revealing the potency of Annona muricata leaves extract as FOXO1 inhibitor for diabetes mellitus treatment through computational study.

    Science.gov (United States)

    Damayanti, Dini Sri; Utomo, Didik Huswo; Kusuma, Chandra

    2016-12-01

    FOXO1 protein inactivation in the nucleus is one of targets for the treatment of diabetes mellitus. Annona muricata leaves contain flavonoid and phenolic compound alkaloids that were known to be able to increase pancreatic β cell proliferation in animal experiment. This research aimed to predict the active compound ability of the Annona muricata leaves to bind and inhibit FOXO1 protein through in silico study. Analysis of molecular docking was performed by using Autodock Vina PyRx. this research proved that anonaine, rutin, muricatocin a, isolaureline, xylopine, and kaempferol 3-O-rutinoside had an equal or smaller free binding energy compared to the control compound. Rutin and Muricatocin A had the same binding ability toward 66% amino acid residues, compared to control compound with hydrogen bond type, while xylopine, anonaine, isolaureline, kaempferol 3-O-rutinoside had a similar binding ability towards 33% amino acid residues compared to control compound with hydrogen bond type.

  20. Uranium mill tailings stabilization

    International Nuclear Information System (INIS)

    Hartley, J.N.; Koehmstedt, P.L.; Esterl, D.J.; Freeman, H.D.

    1980-02-01

    Uranium mill tailings pose a potential radiation health hazard to the public. Therefore, stabilization or disposal of these tailings in a safe and environmentally sound way is needed to minimize radon exhalation and other environmental hazards. One of the most promising concepts for stabilizing U tailings is the use of asphalt emulsion to contain radon and other hazardous materials within uranium tailings. This approach is being investigated at the Pacific Northwest Laboratory. Results of these studies indicate that a radon flux reduction of greater than 99% can be obtained using either a poured-on/sprayed-on seal (3.0 to 7.0 mm thick) or an admixture seal (2.5 to 12.7 cm thick) containing about 18 wt % residual asphalt. A field test was carried out in June 1979 at the Grand Junction tailings pile in order to demonstrate the sealing process. A reduction in radon flux ranging from 4.5 to greater than 99% (76% average) was achieved using a 15.2-cm (6-in.) admix seal with a sprayed-on top coat. A hydrostatic stabilizer was used to apply the admix. Following compaction, a spray coat seal was applied over the admix as the final step in construction of a radon seal. Overburden was applied to provide a protective soil layer over the seal. Included in part of the overburden was a herbicide to prevent root penetration

  1. Protective effect of methanolic extract of Annona squamosa Linn in isoniazid-rifampicin induced hepatotoxicity in rats.

    Science.gov (United States)

    Thattakudian Sheik Uduman, Mohamed Saleem; Sundarapandian, Ramkanth; Muthumanikkam, Azagusundharam; Kalimuthu, Gnanaprakash; Parameswari S, Angala; Vasanthi Srinivas, Thiruvengada Rajan; Karunakaran, Gauthaman

    2011-04-01

    The present study was made to investigate the protective effect of methanolic extract of Annona squamosa on isoniazid-rifampicin-induced hepatotoxicity in rats. Rats were divided into five different groups (n=6), group 1 served as a control, Group 2 received isoniazid (100 mg/kg, i.p.) and co-administered with rifampicin (100 mg/kg, i.p.), in sterile water, group 3 and 4 served as extract treatment groups and received 250 & 500 mg/kg bw, p.o methanolic extract of Annona squamosa and group 5 served as standard group and received silymarin 2.5 mg/kg bw, p.o. All the treatment protocols followed 21 days and after rats were sacrificed blood and liver were used for biochemical and histological studies, respectively. Administration of isoniazid and rifampicin caused a significant elevation in the levels of liver marker enzymes and thiobarbituric acid reactive substances (TBARS, oxidative stress markers) in experimental rats. Administration of methanolic extracts of Annona squamosa significantly prevented isoniazid-rifampicin-induced elevation in the levels of serum diagnostic liver marker enzymes (alanine amino transferase (ALT), aspartate amino transferase (AST), alkaline phosphatase (ALP) and gamma glutamate transpeptidase (γ-GT)), serum bilirubin, and TBARS level in experimental groups of rats. Moreover, total protein and reduced glutathione (GSH) levels were significantly increased in treatment group. The effect of extract was compared with a standard drug, silymarin. The changes in biochemical parameters were supported by histological profile. It is to be concluded that the methanolic extract of Annona squamosa protects against isoniazid and rifampicin-induced oxidative liver injury in rats.

  2. Flavonoids from Annona dioica leaves and their effects in Ehrlich carcinoma cells, DNA-topoisomerase I and II

    OpenAIRE

    Vega,Maria R. G.; Esteves-Souza,Andressa; Vieira,Ivo J. C.; Mathias,Leda; Braz-Filho,Raimundo; Echevarria,Aurea

    2007-01-01

    Chemical investigation of methanol extract leaves from Annona dioica (Annonaceae) resulted in the identification of flavonoids kaempferol (1), 3-O-[3",6"-di-O-p-hydroxycinnamoyl]-beta-galactopyranosyl-kaempferol (2), 6"-O-p-hydroxycinnamoyl-beta-galactopyranosyl-kaempferol (3) and 3-O-beta-galactopyranosyl-kaempferol (4). The structures were unequivocally characterized by ¹H and 13C NMR spectroscopic analyses using 1D and 2D experiments. The cytotoxic effects of the flavonoids and flavonoid f...

  3. Antioxidant Capacity Comparison of Ethanolic Extract of Soursop (Annona muricata Linn.) Leaves and Seeds as Cancer Prevention Candidate

    OpenAIRE

    Dyah Ayu Widyastuti; Praptining Rahayu

    2017-01-01

    Annona muricata Linn. (soursop) is one of  tropical plants which have relatively complete chemical compounds. It has flavonoid, tannin, phytosterol, alkaloid, etc. The high antioxidant compound in soursop is believed as cancer prevention so the cancer threat in the world can be minimized. The antioxidant compound in soursop can be found not only in its fruit, but also in other parts like leaves, seeds, etc. Based on that potency, this study aimed to compare antioxidant capacity of soursop lea...

  4. Antiproliferative activity and caspase enhancement properties of Annona muricata leaves extract against colorectal cancer cells

    OpenAIRE

    Lili Indrawati; Purwantyastuti Ascobat; Budiman Bela; Murdani Abdullah; Ingrid S. Surono; Suwijiyo Pramono

    2016-01-01

    Background: The prevalence of colorectal cancer is rising in Asia including Indonesia. Annona muricata tea leaves, that is traditionally used for maintaining health, and lately being used by cancer patients. The objectives of this study is to investigate its effects in human colorectal cancer cell in vitro and ex vivo.Methods: Thirty patients with colorectal cancer (CRC) were enrolled in a randomized double-blind placebo-controlled trial. They were equally divided into two groups: those treat...

  5. Efek antigenotoksik ekstrak etanolik daun sirsak (Annona muricata Linn) terhadap frekuensi mikronukleus mukosa bukal tikus Sprague Dawley

    OpenAIRE

    Prihatiningsih, Tyas; Haniastuti, Tetiana; Agustina, Dewi

    2017-01-01

    The effect of soursop leaves (Annona uricata linn) ethanolic extract on micronucleus frequency  of buccal mucosa epithelium of Sprague dawley rats. Polycyclic aromatic hydrocarbons is one of the largest  groups of carcinogen in environment. 7,12-Dimetillbez (α) antransena is a compound of PAH class that has genotoxic carcinogen potency. One of the most frequently applied genotoxicity tests is micronucleus test. Soursop is a plant that can grow well in Indonesia. Its leaves contain avonoid an...

  6. Three new anti-proliferative Annonaceous acetogenins with mono-tetrahydrofuran ring from graviola fruit (Annona muricata).

    Science.gov (United States)

    Sun, Shi; Liu, Jingchun; Kadouh, Hoda; Sun, Xiuxiu; Zhou, Kequan

    2014-06-15

    Bioassay-guided fractionation of the fruit powder of graviola (Annona muricata) yielded three novel compounds: muricins J, K, and L. The compounds are all C35 Annonaceous acetogenins with a mono-tetrahydrofuran ring and four hydroxyls. Their structures were elucidated by spectral methods and chemical modification after isolation via chromatographic techniques and HPLC purification. These three acetogenins demonstrated an antiproliferative against human prostate cancer PC-3 cells. Copyright © 2014. Published by Elsevier Ltd.

  7. Induction of Mitochondria Mediated Apoptosis in Human Breast Cancer Cells (T-47D) by Annona reticulata L. Leaves Methanolic Extracts.

    Science.gov (United States)

    Roham, Pratiksha H; Kharat, Kiran R; Mungde, Priyanka; Jadhav, Mahadev A; Makhija, Surinder J

    2016-01-01

    Annona reticulata Linn. (Common name: Bullock's-heart) (Annonaceae family) is a semi-evergreen and small deciduous tree. The extracts of various parts of Annona reticulata L. have been reported as cytotoxic to many cancer cells. Annona reticulata L. leaves' methanolic extract (ARME) was prepared and used against the breast cancer cells. The breast cancer cells (T-47D) viability and IC50 were evaluated by Vybrant® MTT Cell Proliferation Assay Kit. Detection of phosphatidylserine on membranes of apoptotic cells was done by Attune flow cytometer. RNA transcripts were quantified in ARME treated and untreated cells. Finally, the Vybrant® FAM Poly Caspases assay kit was used for analysis of polycaspases activity in T-47D cells. The IC50 (5 ± 0.5 µg/mL) of the ARME was found against breast cancer cells (T-47D). The Paclitaxel was used as a control standard drug for the study. The downregulation of Bcl-2 and upregulation of Bax and Bak, and caspases activation suggested induction of apoptosis in T-47D cells by ARME through mitochondrial pathway. The cell cycle halted at G2/M phase in the ARME treated cells. The ARME was found to be effective against Breast cancer cells (T-47D).

  8. Low cost guinea fowl bone derived recyclable heterogeneous catalyst for microwave assisted transesterification of Annona squamosa L. seed oil

    International Nuclear Information System (INIS)

    Singh, Veena; Sharma, Yogesh Chandra

    2017-01-01

    Highlights: • Discarded guinea fowl bone used to derive catalyst for biodiesel production. • High conversion of 95.82 ± 0.2% achieved in 20 min by microwave assisted transesterification of Annona Squamosa L. seed oil. • Catalyst was stable and can be reused up to five times by activation with >80% conversion. • Complete process is cheap, eco-friendly and fulfils ASTM standard limits. - Abstract: Guinea fowl bone derived heterogeneous catalyst was utilized for biodiesel production for the first time on microwave heating system from Annona squamosa (custard apple seed) oil. Synthesized catalyst was characterized by TGA, XRD, FTIR, SEM, EDS, BET surface area and basicity. Optimization for various reaction conditions on FAME conversion was explored. Maximum conversion of 95.82 ± 0.2% FAME was attained at 1:18 M ratio of oil: methanol, 4 wt% of catalyst at 800 W microwave power and 65 °C reaction temperatures for 20 min. Custard apple seed oil was studied by GCMS, whereas synthesized FAME was analysed by 1 H FTNMR spectroscopy. Catalyst was reused up to five times with maximum conversion of >80%. Physicochemical properties of synthesized FAME were studied as per ASTM standards. Results displayed that catalyst derived from guinea fowl bone showed better reusability and has enormous potential to be used for biodiesel production under microwave irradiated transesterification of Annona squamosa L. (custard apple seed) oil within a short reaction time.

  9. Einstein-Yang-Mills from pure Yang-Mills amplitudes

    International Nuclear Information System (INIS)

    Nandan, Dhritiman; Plefka, Jan; Schlotterer, Oliver; Wen, Congkao

    2016-01-01

    We present new relations for scattering amplitudes of color ordered gluons and gravitons in Einstein-Yang-Mills theory. Tree-level amplitudes of arbitrary multiplicities and polarizations involving up to three gravitons and up to two color traces are reduced to partial amplitudes of pure Yang-Mills theory. In fact, the double-trace identities apply to Einstein-Yang-Mills extended by a dilaton and a B-field. Our results generalize recent work of Stieberger and Taylor for the single graviton case with a single color trace. As the derivation is made in the dimension-agnostic Cachazo-He-Yuan formalism, our results are valid for external bosons in any number of spacetime dimensions. Moreover, they generalize to the superamplitudes in theories with 16 supercharges.

  10. Einstein-Yang-Mills from pure Yang-Mills amplitudes

    Energy Technology Data Exchange (ETDEWEB)

    Nandan, Dhritiman; Plefka, Jan [Institut für Physik and IRIS Adlershof, Humboldt-Universität zu Berlin,Zum Großen Windkanal 6, D-12489 Berlin (Germany); Schlotterer, Oliver [Max-Planck-Institut für Gravitationsphysik, Albert-Einstein-Institut,Am Mühlenberg 1, D-14476 Potsdam (Germany); Wen, Congkao [I.N.F.N. Sezione di Roma Tor Vergata,Via della Ricerca Scientifica, 00133 Roma (Italy)

    2016-10-14

    We present new relations for scattering amplitudes of color ordered gluons and gravitons in Einstein-Yang-Mills theory. Tree-level amplitudes of arbitrary multiplicities and polarizations involving up to three gravitons and up to two color traces are reduced to partial amplitudes of pure Yang-Mills theory. In fact, the double-trace identities apply to Einstein-Yang-Mills extended by a dilaton and a B-field. Our results generalize recent work of Stieberger and Taylor for the single graviton case with a single color trace. As the derivation is made in the dimension-agnostic Cachazo-He-Yuan formalism, our results are valid for external bosons in any number of spacetime dimensions. Moreover, they generalize to the superamplitudes in theories with 16 supercharges.

  11. Anti-cancer effect of Annona Muricata Linn Leaves Crude Extract (AMCE) on breast cancer cell line.

    Science.gov (United States)

    Syed Najmuddin, Syed Umar Faruq; Romli, Muhammad Firdaus; Hamid, Muhajir; Alitheen, Noorjahan Banu; Nik Abd Rahman, Nik Mohd Afizan

    2016-08-24

    Annona muricata Linn which comes from Annonaceae family possesses many therapeutic benefits as reported in previous studies and to no surprise, it has been used in many cultures to treat various ailments including headaches, insomnia, and rheumatism to even treating cancer. However, Annona muricata Linn obtained from different cultivation area does not necessarily offer the same therapeutic effects towards breast cancer (in regards to its bioactive compound production). In this study, anti-proliferative and anti-cancer effects of Annona muricata crude extract (AMCE) on breast cancer cell lines were evaluated. A screening of nineteen samples of Annona muricata from different location was determined by MTT assay on breast cancer cell lines (MCF-7, MDA-MB-231, and 4 T1) which revealed a varied potency (IC50) amongst them. Then, based on the IC50 profile from the anti-proliferative assay, further downward assays such as cell cycle analysis, Annexin V/FITC, AO/PI, migration, invasion, and wound healing assay were performed only with the most potent leaf aqueous extract (B1 AMCE) on 4 T1 breast cancer cell line to investigate its anti-cancer effect. Then, the in vivo anti-cancer study was conducted where mice were fed with extract after inducing the tumor. At the end of the experiment, histopathology of tumor section, tumor nitric oxide level, tumor malondialdehyde level, clonogenic assay, T cell immunophenotyping, and proteome profiler analysis were performed. Annona muricata crude extract samples exhibited different level of cytotoxicity toward breast cancer cell lines. The selected B1 AMCE reduced the tumor's size and weight, showed anti-metastatic features, and induced apoptosis in vitro and in vivo of the 4 T1 cells. Furthermore, it decreased the level of nitric oxide and malondialdehyde in tumor while also increased the level of white blood cell, T-cell, and natural killer cell population. The results suggest that, B1 AMCE is a promising candidate for cancer

  12. Influência da temperatura na germinação de sementes de Annona Montana Influence of the temperature on seed germination of Annona Montana

    Directory of Open Access Journals (Sweden)

    Inez Vilar de Morais Oliveira

    2005-08-01

    Full Text Available Com o objetivo de avaliar a influência da temperatura sobre a porcentagem de germinação e o índice de velocidade de germinação (IVG de sementes de Annona montana, conhecida como falsa graviola, espécie com potencial para porta-enxerto das variedades comerciais, testaram-se quatro temperaturas (20; 25; 30 e 35ºC. O trabalho foi desenvolvido em laboratório em câmaras de germinação tipo BOD, utilizando-se de sementes de três plantas provenientes do Banco de Germoplasma do Departamento de Produção Vegetal da Faculdade de Ciências Agrárias e Veterinárias - UNESP, Câmpus de Jaboticabal-SP. O delineamento experimental foi o inteiramente casualizado, com quatro repetições, com dez sementes cada. Pelos resultados obtidos, tem-se que tanto para o parâmetro porcentagem de germinação como para o IVG, os maiores valores observados foram para as sementes na temperatura de 30ºC (55% de germinação e IVG = 0,153, seguido da temperatura de 25ºC (25% de germinação e IVG = 0,088. Para as temperaturas de 20ºC e 35ºC, não foi observada ocorrência de germinação. A análise estatística dos dados de porcentagem de germinação foi transformada em arc-sen square root (x/100 e as médias foram comparadas pelo teste de Tukey, a 5% de probabilidade.With the objective to evaluate the influence of the temperature in percentage of germination and the germination velocity index (GVI of seeds of Annona montana, a potencial specie for a rootstock to the comercial varieties, were tested four temperatures (20, 25, 30 and 35ºC. The research was carried in conditions of laboratory, in chamber of germination type BOD using seeds of tree plants that came from the Germplasm Bank of the Department of Vegetable Production of the Faculdade de Ciências Agrárias e Veterinárias UNESP, Campus of Jaboticabal, São Paulo state, Brazil. The experimental delineation was entirely randomized, and four replications with ten seeds in each one. By the obtained

  13. Physicochemical characterization and thermal behavior of guanabana (Annona muricata) seed almond oil; Caracterizacion fisicoquimica y comportamiento termico del aceite de almendra de guanabana (Annona muricata, L)

    Energy Technology Data Exchange (ETDEWEB)

    Solis-Fuentes, J. A.; Amador-Hernandez, C.; Hernandez-Medel, M. R.; Duran-de-Bazua, M. C.

    2010-07-01

    In this work some physicochemical properties and the thermal behavior and stability of sour sop or guanabana (Annona muricata) seed almond oil were studied by means of chemical, DSC and TG analysis. The results showed that the almond has 2.5% ash, 17.9% crude fiber, 15.7% protein, 26.0% de carbohydrates and 37.7% oil (dry base). The composition of almond oil showed 68.5% unsaturated fatty acids, mainly oleic and linoleic, and some palmitoleic acids, and 31.5% saturated, principally palmitic and stearic fatty acids; refraction index was 1.468 and saponification and iodine value were 168.2 and 87.0, respectively. DSC thermal analysis showed that oil crystallization initiates at -4.5 degree centigrade and ends at -79.0 degree centigrade with a crystallization enthalpy of 48.2 J/g; the oil melts in a temperature range from -42.4 to -16.9 degree centigrade, with a maximum peak at -15 degree centigrade and a fusion enthalpy of 80.5 J/g. The oil remained liquid at refrigeration temperatures with minimal SFC and free of crystals at temperatures over 10 degree centigrade. TG analysis showed that the thermal decomposition of the oil in a N{sub 2} atmosphere starts at 380 degree centigrade and ends at 442 degree centigrade, with a maximum decomposition rate at 412 degree centigrade. Under oxidizing conditions its decomposition begins at 206 degree centigrade and concludes at 567 degree centigrade. In accordance with this study, sour sop almond seed contains large amounts of an oil that possesses similar characteristics to those of salad and cooking oils. (Author) 28 refs.

  14. Soil Carbon 4 per mille

    Science.gov (United States)

    Minasny, Budiman; van Wesemael, Bas

    2017-04-01

    The '4 per mille Soils for Food Security and Climate' was launched at the COP21 aiming to increase global soil organic matter stocks by 4 per mille (or 0.4 %) per year as a compensation for the global emissions of greenhouse gases by anthropogenic sources. This paper surveyed the soil organic carbon (SOC) stock estimates and sequestration potentials from 20 regions in the world (New Zealand, Chile, South Africa, Australia, Tanzania, Indonesia, Kenya, Nigeria, India, China Taiwan, South Korea, China Mainland, United States of America, France, Canada, Belgium, England & Wales, Ireland, Scotland, and Russia) and asked whether the 4 per mille initiative is feasible. This study highlights region specific efforts and scopes for soil carbon sequestration. Reported soil C sequestration rates generally show that under best management practices, 4 per mille or even higher sequestration rates can be accomplished. High C sequestration rates (up to 10 per mille) can be achieved for soils with low initial SOC stock (topsoil less than 30 t C ha-1), and at the first twenty years after implementation of best management practices. In addition, areas that have reached equilibrium but not at their saturation level will not be able to further increase their sequestration. We found that most studies on SOC sequestration globally only consider topsoil (up to 0.3 m depth), as it is considered to be most affected by management techniques. The 4 per mille initiative was based on a blanket calculation of the whole global soil profile C stock, however the potential to increase SOC is mostly on managed agricultural lands. If we consider 4 per mille on global topsoil of agricultural land, SOC sequestration is about 3.6 Gt C per year, which effectively offset 40% of global anthropogenic greenhouse gas emissions. As a strategy for climate change mitigation, soil carbon sequestration buys time over the next ten to twenty years while other effective sequestration and low carbon technologies become

  15. Evaluation of the anti-mycobacterium tuberculosis activity and in vivo acute toxicity of Annona sylvatic.

    Science.gov (United States)

    Araujo, Rafaele C P; Neves, Francisco A R; Formagio, Anelise S N; Kassuya, Candida A L; Stefanello, Maria E A; Souza, Vanessa V; Pavan, Fernando R; Croda, Julio

    2014-06-28

    The recent emergence of extensively multidrug-resistant Mycobacterium tuberculosis strains has further complicated the control of tuberculosis. There is an urgent need for the development of new molecular candidates antitubercular drugs. Medicinal plants have been an excellent source of leads for the development of drugs. The aim of this study was to evaluate the in vitro activity of 28 alcoholic extracts and essential oils of native and exotic Brazilian plants against Mycobacterium tuberculosis and to further study these extracts through chemical fractionation, the isolation of their constituents, and an evaluation of the in vivo acute toxicity of the active extracts. To the best of our knowledge this is the first chemical characterization, antituberculosis activity and acute toxicity evaluation of Annona sylvatica. The anti-mycobacterial activity of these extracts and their constituent compounds was evaluated using the resazurin reduction microtiter assay (REMA). To investigate the acute toxicity of these extracts in vivo, female Swiss mice were treated with the extracts at doses of 500, 1000 and 2000 mg · kg(-1) of body weight. The extracts were characterized by LC-MS, and the constituents were isolated and identified by chromatographic analysis of spectroscopic data. Of the 28 extracts, the methanol extract obtained from the leaves of Annona sylvatica showed anti-mycobacterial activity with an minimal inhibitory concentration (MIC) of 184.33 μg/mL, and the ethyl acetate fraction (EAF) resulting from liquid-liquid partitioning of the A. sylvatica extract showed an MIC of 115.2 μg/mL. The characterization of this extract by LC-MS identified flavonoids and acetogenins as its main constituents. The phytochemical study of the A. sylvatica EAF resulted in the isolation of quercetin, luteolin, and almunequin. Among the compounds isolated from the EAF, luteolin and almunequin were the most promising, with MICs of 236.8 μg/mL (827.28 μM) and 209.9 μg/mL (328

  16. Extratos Cymbopogon citratus e Annona muricata como inibidores do crescimento micelial de fungos fitopatogênicos

    Directory of Open Access Journals (Sweden)

    Heloísa da Silva Bibiano

    2017-07-01

    Full Text Available Produtos alternativos vêm sendo utilizados para manejo de fitopatógenos com extratos ou óleos essenciais. A utilização de óleos essenciais é promissora para o desenvolvimento de agentes antimicrobianos por oferecer propriedades antibacterianas e antifúngicas. O presente trabalho teve por objetivo avaliar os efeitos inibitórios in vitro do óleo essencial do capim-limão (Cymbopogon citratus e do hidrolato de graviola (Annona muricata sobre desenvolvimento de fungos fitopatogênicos. Os extratos vegetais foram extraídos pela técnica de arraste a vapor e testados nas concentrações de 0,05 %, 1 %, 5 %, 10 %, 15 %, 25 %, 35 %, 45 %, 50 % e 100 %. Os fitopatógenos utilizados foram Pestalotiopsis sp., Monilinia sp. e Rhizopus spp. Todos os micro-organismos foram obtidos da coleção de micro-organismos da Universidade do Vale do Sapucaí (Univás em Pouso Alegre (MG. O óleo essencial do capim-limão inibiu o crescimento dos fungos testados nas concentrações de 50 % e 100 %. Houve inibição total do crescimento micelial de Pestalotiopsis sp. nas concentrações de 35 % a 100 %; nas concentrações abaixo de 25 %, houve inibição parcial. Com o fungo Rhizopus spp., houve crescimento parcial nas concentrações de 0,05 % a 45 %; nas concentrações de 50 % e 100 %, houve inibição total do crescimento fúngico. A Monilinia sp. obteve inibição total a partir da concentração de 35 %; abaixo da concentração de 25 %, o crescimento fúngico foi parcial. Com relação ao hidrolato da graviola (Annona muricata, os resultados indicam que não houve inibição no desenvolvimento micelial dos fungos testados, independentemente da concentração utilizada. Portanto o óleo essencial do capim-limão pode ser utilizado como alternativa ao controle desses patógenos.

  17. Integration of micro milling highspeed spindle on a microEDM-milling machine set-up

    DEFF Research Database (Denmark)

    De Grave, Arnaud; Hansen, Hans Nørgaard; Andolfatto, Loic

    2009-01-01

    In order to cope with repositioning errors and to combine the fast removal rate of micro milling with the precision and small feature size achievable with micro EDM milling, a hybrid micro-milling and micro-EDM milling centre was built and tested. The aim was to build an affordable set-up, easy...

  18. First report and morphological redescription of Teleonemia morio (Stål (Hemiptera, Tingidae in Annona squamosa L. (Annonaceae in Brazil

    Directory of Open Access Journals (Sweden)

    Sônia M. F. Broglio

    2012-03-01

    Full Text Available First report and morphological redescription of Teleonemia morio (Stål (Hemiptera, Tingidae in Annona squamosa L. (Annonaceae in Brazil. This is the first report of a severe attack of Teleonemia morio (Stål, 1855 (Hemiptera, Heteroptera, Tingidae on Annona squamosa L. (custard apple, causing up to 80% of losses of infested trees. In order to facilitate the identification of this insect pest, the adult female of T. morio is redescribed based on specimens collected in Palmeira dos Índios, Alagoas, Brazil.

  19. Estudos ToxicolÃgicos PrÃ-ClÃnicos e Antitumorais do Extrato AcetÃnico das Folhas de Annona muricata L.

    OpenAIRE

    CecÃlia Carvalho de Oliveira

    2012-01-01

    Annona muricata, conhecida popularmente como gravioleira no Brasil, Ã uma planta usada amplamente na medicina popular na forma de chÃs e infusÃes para o tratamento de diversas doenÃas, incluindo o cÃncer. O trabalho teve como objetivo avaliar o perfil toxicolÃgico, genotoxicolÃgico e antitumoral do extrato acetÃnico das folhas de Annona muricata e foi realizado utilizando ensaios de curta e longa duraÃÃo in vivo e in vitro. Inicialmente foi avaliada a citotoxicidade in vitro contra vÃrias lin...

  20. The expression of p53 and hsp70 proteins after treatment with Annona muricata Linn leaf for activating apoptotic and lead to homeostasis program of Raji cells

    Directory of Open Access Journals (Sweden)

    Okid Parama Astirin

    2014-03-01

    Full Text Available Purpose: Organic extracts of plant Annonaceae enhances apoptosis in animal cells and get the drives to reach a new homeostasis. The incidence rate of nasopharyngeal cancer in Indonesia is quite high. Protein 53Kd (p53 play a role in apoptosis process, being heat shock protein 70 (hsp70 play a role in homeostasis. The aim of this research is to identify the apoptotic effects of Annona muricata Linn leaf toward Raji cells by observing the p53 and hsp70 expression.Methods: Apoptotic assay was performed in 24 wells micro-culture plate. Raji cells were prepared as 2 × 104 cells in 100 ml RPMI media per well. Roswell Park Memorial Institute (RPMI medium was created and solvent was controlled with Dimethyl Sulfoxide (DMSO solvent 0.25. Apoptotic test was performed by calculating trypan-blue-dye exclution. The cells were then grown in micro-culture plate with media plus extract non-lethal concentration of partition and fractionation of Annona muricata Linn leaf. The sampling was performed for 24 hours. The number of living cells was calculated in each of these well and incubation time were determined. Immunohistochemical staining was done to identify the expression of p53 and hsp70.Results: The results showed that Raji cells treated with partition of Annona muricata Linn leaf in ethyl acetate solvent 133.00 % resulted in higher apoptosis. Another results showed that Raji cells treated with fractionation Annona muricata Linn leaf in ethyl acetate solvent 103.20 % resulted in higher apoptosis. The expression of p53 after treatment with fractionation Annona muricata Linn leaf was higher than before while hsp70 expression after treatment with fractionation Annona muricata Linn leaf was lower. Conclusion: The conclusion is the higher the dose of Annona muricata Linn the higher the p53 expression thereby activates apoptosis process The higher dose of Anonna muricata Linn also leads to lower hsp70 expression indicating stable homeostasis of Raji cells

  1. Machine Shop. Module 6: Milling. Instructor's Guide.

    Science.gov (United States)

    Walden, Charles H.

    This document consists of materials for a 12-unit course on the following topics: (1) introduction to milling; (2) structure and accessories; (3) safety and maintenance; (4) cutting-tool variables; (5) basic set-up activities; (6) squaring a workpiece; (7) hole-making operations; (8) form milling; (9) machining keyways; (10) milling angular…

  2. On deformations of Yang-Mills algebras

    OpenAIRE

    Movshev, M.

    2005-01-01

    This is a next paper from a sequel devoted to algebraic aspects of Yang-Mills theory. We undertake a study of deformation theory of Yang-Mills algebra YM - a ``universal solution'' of Yang-Mills equation. We compute (cyclic) (co)homology of YM.

  3. Ground beetle populations near a kraft mill

    Energy Technology Data Exchange (ETDEWEB)

    Freitag, R.; Hastings, L.; Mercer, W.R.; Smith, A.

    1973-02-01

    Twenty species of ground beetles (Family Carabidae) and one species of carrion beetle (Family Silphidae) were collected in six stations east of a kraft paper mill in Thunder Bay, Ontario, from May to August, 1971. The beetle population decreased markedly towards the mill. There was no apparent statistical difference in size variation of specimens near the mill and those further away.

  4. Understanding milling induced changes: Some results

    Indian Academy of Sciences (India)

    Unknown

    Milling is identified as one of the robust processing routes for synthesizing a variety of materials. Commonly applied to the materials in solid state, the most noticeable change with milling is the reduction in the particle size, generally to nanoscale. In addition to size refinement, milling has received wide acceptability due to its ...

  5. Atualidades e perspectivas das Anonáceas no mundo

    OpenAIRE

    São José,Abel Rebouças; Pires,Mônica de Moura; Freitas,Afonso Lúcio Gomes Estrela de; Ribeiro,Denis Pereira; Perez,Luis Alfonso Aguilar

    2014-01-01

    Várias espécies da família Annonaceae produzem frutos comestíveis cultivados em pomares comerciais ou coletados de forma extrativista, em diversas partes do mundo. O gênero Annona possui elevado número de espécies nativas, no entanto poucas produzem frutos comestíveis. Algumas são cultivadas comercialmente, outras são obtidas de forma extrativista. As principais anonáceas cultivadas no mundo são: Annona muricata, Annona squamosa e Annona cherimola, com destaque também para a atemoia (híbrido ...

  6. Soil carbon 4 per mille

    NARCIS (Netherlands)

    Mulder, V.L.

    2017-01-01

    The ‘4 per mille Soils for Food Security and Climate’ was launched at the COP21 with an aspiration to increase global soil organic matter stocks by 4 per 1000 (or 0.4 %) per year as a compensation for the global emissions of greenhouse gases by anthropogenic sources. This paper surveyed the soil

  7. Massive Yang-Mills fields

    NARCIS (Netherlands)

    Veltman, M.J.G.; Reiff, J.

    1969-01-01

    Two problems are studied in the paper: (i) the relation between Lagrangian and Feynman rules if the Lagrangian contains derivative couplings and/or vector meson fields and (ii) the behaviour of certain two closed loop diagrams in the perturbation theory of Yang-Mills fields. With respect to ( i ) .

  8. Avaliação da atividade citotóxica das sementes de Annona cornifolia A. St.-Hil. (Annonaceae Evaluation of the cytotoxic activity of seeds of Annona cornifolia A. St.-Hil. (Annonaceae

    Directory of Open Access Journals (Sweden)

    L.A.R.S. Lima

    2012-01-01

    Full Text Available Na família Annonaceae, especialmente o gênero Annona é muito apreciado por fornecer frutos comestíveis. Espécies desse gênero são utilizadas na medicina popular contra diabetes, malária e infecções. Muitas dessas atividades biológicas têm sido relacionadas às acetogeninas de anonáceas. O objetivo deste estudo foi avaliar a atividade citotóxica dos grupos e de uma acetogenina pura (cornifolina obtidos a partir do extrato etanólico das sementes de Annona cornifolia A. St.-Hil. (Annonaceae. Esta atividade foi avaliada pelo ensaio colorimétrico MTT. Cornifolina (1, a única substância pura testada, apresentou citotoxicidade positiva sobre todas as linhagens tumorais avaliadas. Os grupos testados, todos caracterizados por espectroscopia no infravermelho (IV, apresentaram 68,7% dos valores de CI50 menores que 20,0 µg mL-1, sendo também considerados citotóxicos. As amostras testadas foram mais ativas que o taxol sobre melanoma humano (MeWo e, ainda, o grupo G10-5 apresentou melhor atividade sobre fibroblasto tumorigênico de camundongo (L929. Além disso, os grupos mostraram menor citotoxidade do que o taxol sobre a linhagem normal (CHO.The family Annonaceae, especially the genus Annona, is greatly appreciated for providing edible fruits. Species of this genus are used in folk medicine against diabetes, malaria and infections. Many of these biological activities have been related to annonaceous acetogenins. The aim of this study was to evaluate the cytotoxic activity of groups and a pure acetogenin (cornifolin obtained from the ethanol extract of the seeds of Annona cornifolia A. St.-Hil. (Annonaceae. This activity was evaluated by using MTT colorimetric assay. Cornifolin (1, the only tested substance that was pure, showed positive cytotoxicity on all evaluated tumor cell lines. The tested groups, all characterized by infrared spectroscopy (IR, showed 68.7% of the IC50 values lower than 20.0 µg mL-1, also considered cytotoxic. The

  9. Chemical constituents and antioxidant activity of the essential oil from leaves of Annona vepretorum Mart. (Annonaceae)

    Science.gov (United States)

    Araújo, Camila de Souza; de Oliveira, Ana Paula; Lima, Rafaely Nascimento; Alves, Péricles Barreto; Diniz, Tâmara Coimbra; da Silva Almeida, Jackson Roberto Guedes

    2015-01-01

    Background: Annona vepretorum (AV) is a native tree from Caatinga biome (semiarid region of Brazil) popularly known as “araticum” and “pinha da Caatinga.” Objective: This study was carried out to evaluate the chemical constituents and antioxidant activity (AA) of the essential oil from the leaves from AV (EO-Av) collected in Petrolina, Pernambuco, Brazil. Materials and Methods: Fresh leaves of AV were cut into pieces, and subjected to distillation for 2 h in a clevenger-type apparatus. Gas chromatograph (GC) analyses were performed using a mass spectrometry/flame ionization detector. The identification of the constituents was assigned on the basis of comparison of their relative retention indices. The antioxidant ability of the EO was investigated through two in vitro models such as radical scavenging activity using 2,2-diphenyl-1-picrylhydrazyl method and β-carotene-linoleate-model system. The positive controls (ascorbic acid, butylated hydroxyanisole and butylated hydroxytoluene) were those using the standard solutions. Assays were carried out in triplicate. Results: The oil showed a total of 21 components, and 17 were identified, representing 93.9% of the crude EO. Spathulenol (43.7%), limonene (20.5%), caryophyllene oxide (8.1%) and α-pinene (5.5%) were found to be the major individual constituents. Spathulenol and caryophyllene oxide could be considered chemotaxonomic markers of these genera. The EO demonstrated weak AA. PMID:26246740

  10. Population structure of Annona crassiflora: an endemic plant species of the Brazilian Cerrado.

    Science.gov (United States)

    Gwinner, R; Setotaw, T A; Rodrigues, F A; França, D V C; da Silveira, F A; Pio, L A S; Pasqual, M

    2016-12-23

    Habitat fragmentation has numerous consequences, particularly to endemic species, and has a negative impact on the genetic diversity of neglected species, leading to genetic drift. Annona crassiflora Mart. is a species that is endemic to Brazil, and its incidence in the Cerrado biome has decreased. The identification and characterization of its remaining diversity is necessary for its conservation. Our aim was to study the population structure of A. crassiflora populations from different Cerrado regions in Minas Gerais State, Brazil (Corinto, Curvelo, Carmo da Mata, Boa Esperança, and Paraguaçu) using inter-simple sequence repeat (ISSR) markers and DNA content. Nuclear DNA content was estimated by flow cytometry using 10 individuals from each population. ISSR markers were used for genotyping accessions in order to study their genetic diversity and population structures. We found considerable genetic variation among populations, with the highest variability observed in the Curvelo population. There was a significant positive correlation between DNA content and latitude (r = 0.46, P = 0. 0003). A Bayesian-based cluster analysis grouped the populations into three clusters, which followed their geographical origins. There was some level of genetic diversity and differentiation among the populations, suggesting the need for a conservation plan for this species. The ISSR markers and DNA content analysis were effective in studying the genetic diversity and population structure of A. crassiflora.

  11. Stenospermy and seed development in the "Brazilian seedless" variety of sugar apple (Annona squamosa).

    Science.gov (United States)

    Dos Santos, Rayane C; Ribeiro, Leonardo M; Mercadante-Simões, Maria Olívia; Costa, Márcia R; Nietsche, Silvia; Pereira, Marlon C T

    2014-12-01

    Stenospermy was identified in naturally occurring sugar-apple (Annona squamosa) mutants with great potential for use in genetic improvement programs. However, to date, there have been no detailed studies of the development of aspermic fruit in this species. The aim of the present study was to characterize the anatomy of developing fruit in the 'Brazilian Seedless' mutant. Flower buds in pre-anthesis and developing fruits were subjected to common plant anatomy techniques. The abnormal ovules are unitegmic and orthotropic and have a long funiculus. There is evidence of fertilization, including the presence of embryos in early development and the proliferation of starch grains in the embryo sac. However, the embryos and embryo sac degenerate, although this does not affect pericarp development. Ovule abortion does not occur. The perisperm, which is formed from the peripheral layers of the nucellus, fills the cavity left by the embryo sac. The mature fruit contains numerous small sterile seeds with abundant perisperm and unlignified integument that is restricted to the micropylar region. The majority of perisperm cells are living and appear to be metabolically active in the periphery. Therefore, stenospermy leads to the formation of sterile seeds in A. squamosa, and the perisperm possibly play an important role in fruit development.

  12. Orofacial antinociceptive effect of the ethanolic extract of Annona vepretorum Mart. (Annonaceae).

    Science.gov (United States)

    Silva, Juliane C; Macedo, Larissa A R O; Souza, Grasielly R; Oliveira-Junior, Raimundo G; Lima-Saraiva, Sarah R G; Lavor, Érica M; Silva, Mariana G; Souza, Marilia T S; Bonjardim, Leonardo R; Quintans-Júnior, Lucindo J; Mendes, Rosemairy L; Almeida, Jackson R G S

    Annona vepretorum Mart. (Annonaceae) is a species popularly known in Brazil as "araticum" and "pinha da Caatinga". We have evaluated the antinociceptive effects of A. vepretorum in formalin-, capsaicin-, and glutamate-induced orofacial nociception in mice. Male Swiss mice were pretreated with either saline (p.o.), A. vepretorum ethanol extract (Av-EtOH 25, 50 and 100 mg/kg, p.o.), or morphine (10 mg/kg, i.p.), before formalin, capsaicin, or glutamate was injected into the right upper lip. Pre-treatment with Av-EtOH at all doses produced a reduction in face-rubbing behavior induced by formalin in both phases, and these pre-treatments also produced a significant antinociceptive effect in the capsaicin and glutamate tests. Pre-treatment with naloxone (1.5 mg/kg, i.p.) did not reverse the antinociceptive activity of the extract at the dose of 100 mg/kg in the first phase of this test. Our results suggest that Av-EtOH might be useful in the treatment of orofacial pain.

  13. Isolation, characterization and bioactivities of a new polysaccharide from Annona squamosa and its sulfated derivative.

    Science.gov (United States)

    Tu, Wensong; Zhu, Jianhua; Bi, Sixue; Chen, Dehong; Song, Liyan; Wang, Lishan; Zi, Jiachen; Yu, Rongmin

    2016-11-05

    A new water-soluble polysaccharide, designated as ASPW80-1, was first isolated from the fruit pulp of Annona squamosa. The structure of ASPW80-1 was elucidated based on the physicochemical and instrumental analyses. The results indicated that ASPW80-1 was a homogeneous heteropolysaccharide with an average molecular weight of 2.29×10(5)Da. Another novel modified polysaccharide, the sulfated derivative of ASPW80-1 namely as ASPW80-M1, was also synthesized. The ultra-structures of both ASPW80-1 and ASPW80-M1 were further characterized by scanning electron microscopy and atomic force microscopy. The antioxidant assays showed that ASPW80-1 and ASPW80-M1 exhibited DPPH and hydroxyl radicals scavenging activities. The results of immunomodulatory assays in vitro showed that ASPW80-1 and ASPW80-M1 could markedly promote the proliferation of mouse splenocytes. These results proposed that ASPW80-M1 might be proposed to be developed as a potential value-added product with the activities of immunomodulator and free-radical inhibitors. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. IS Annona emarginata CAPABLE OF ACCUMULATE ESSENTIAL HEAVY METALS WITHOUT DAMAGES IN THE METABOLISM?

    Directory of Open Access Journals (Sweden)

    DANIEL BARON

    2017-09-01

    Full Text Available ABSTRACT This study aimed to evaluate if ionic strength variation causes differential accumulation of heavy metals in plants of Annona emarginata (Schltdl. H. Rainer var. ‘terra-fria’, modifying gas exchange and dry matter production. The seedlings were cultivated under different ionic strengths of the ‘Hoagland and Arnon’s’ nutrient solution (75% I, 50% I and 25% I. At 180 days after the application of the treatments, the effects of the essential heavy metals on the physiological parameters and foliar ionic concentration were assessed. The leaf gas exchanges and vegetative growth were affected by the variation in the essential heavy metals, with positive effects on the plants that were treated with 75%I. The seedlings that were grown under 75% I presented higher concentrations of Zn (24.2mg kg-1. On the other hand Fe (453mg kg-1 e Mn (803.5mg kg-1 accumulated more under 25% I, but gas exchanges and vegetative growth were reduced, compared to 50%I and 75%I. We can conclude that the ionic strength variation alters gas exchange and the dry matter accumulation, causing differential accumulation of Fe, Mn and Zn in A. emarginata, occurring inverse relationship between increased ionic strength and Fe and Mn content, besides directly relationship to the Zn content.

  15. Influence of seasonal variation on the phenology and liriodenine content of Annona lutescens (Annonaceae).

    Science.gov (United States)

    Castro-Moreno, Marisol; Tinoco-Ojangurén, Clara Leonor; Cruz-Ortega, Ma Del Rocío; González-Esquinca, Alma Rosa

    2013-07-01

    Annona lutescens Saff. (Annonaceae) grows as a native tree in Chiapas, Mexico in Tropical Dry Forest habitat. Like most Annonaceae, it biosynthesizes benzylisoquinoline alkaloids, mostly liriodenine. To determine the influence of seasonal changes in the accumulation of liriodenine, the monthly variation of liriodenine content in roots, stems and leaves of mature and young trees was observed. These parts of young and mature A. lutescens trees were collected monthly over a 1 year period and the alkaloids were extracted; the liriodenine was quantified by high-resolution liquid chromatography. The phenological stages of the species were also assessed (leaf development, flowering and fruiting) using the Biologische Bundesanstalt, Bundessortenamt und Chemische Industrie (BBCH) scale. The analysis of both young and mature trees showed a significant increase in the liriodenine concentration occurs within roots during the dry season, which coincides with leaf fall. A significant decrease also occurred at the beginning of the rainy season (the period of leaf growth); the liriodenine content for the next rainy season did not reach the levels of the previous dry season. The climatic variation induced phenological and physiological changes in this species.

  16. Annona muricata (Annonaceae: A Review of Its Traditional Uses, Isolated Acetogenins and Biological Activities

    Directory of Open Access Journals (Sweden)

    Soheil Zorofchian Moghadamtousi

    2015-07-01

    Full Text Available Annona muricata is a member of the Annonaceae family and is a fruit tree with a long history of traditional use. A. muricata, also known as soursop, graviola and guanabana, is an evergreen plant that is mostly distributed in tropical and subtropical regions of the world. The fruits of A. muricata are extensively used to prepare syrups, candies, beverages, ice creams and shakes. A wide array of ethnomedicinal activities is contributed to different parts of A. muricata, and indigenous communities in Africa and South America extensively use this plant in their folk medicine. Numerous investigations have substantiated these activities, including anticancer, anticonvulsant, anti-arthritic, antiparasitic, antimalarial, hepatoprotective and antidiabetic activities. Phytochemical studies reveal that annonaceous acetogenins are the major constituents of A. muricata. More than 100 annonaceous acetogenins have been isolated from leaves, barks, seeds, roots and fruits of A. muricata. In view of the immense studies on A. muricata, this review strives to unite available information regarding its phytochemistry, traditional uses and biological activities.

  17. Effect of extracts from araticum (Annona crassiflora on CCl4-induced liver damage in rats

    Directory of Open Access Journals (Sweden)

    Roberta Roesler

    2011-03-01

    Full Text Available The influence of ethanolic extracts of Annona crassiflora on the activities of hepatic antioxidant enzymes was examined. Extracts of A. crassiflora seeds and peel were administered orally (50 mg of galic acid equivalents.kg-1 to Wistar rats for 14 consecutive days followed by a single oral dose of carbon tetrachloride (CCl4, 2 g.kg-1. Lipid peroxidation and the activities of hepatic catalase (CAT, cytochromes P450 (CP450 and b5, glutathione peroxidase (GPx, glutathione reductase (GRed, superoxide dismutase (SOD, and the content of glutathione equivalents (GSH were evaluated. The treatment with CCl4 increased lipid peroxidation, the level of GSH equivalents and the content of cytochrome b5 by 44, 140 and 32%, respectively, with concomitant reductions of 23, 34 and 39% in the activities of CAT, SOD, and CP450, respectively. The treatment with A. crassiflora seeds and peel extracts alone inhibited lipid peroxidation by 27 and 22%, respectively without affecting the CP450 content. The pretreatment with the A. crassiflora extracts prevented the lipid peroxidation, the increase in GSH equivalents and the decrease in CAT activity caused by CCl4, but it had no effect on the CCl4-mediated changes in CP450 and b5 and SOD. These results show that A. crassiflora seeds and peel contain antioxidant activity in vivo that could be of potential therapeutic use.

  18. Characterization of chemical and mineral composition of marolo (Annona crassiflora Mart during physiological development

    Directory of Open Access Journals (Sweden)

    Edson Pablo da SILVA

    2016-01-01

    Full Text Available Abstract Maroleiro (Annona crassiflora Mart, belonging to the family of Annonaceae is a typical specie of the Cerrado and has occurred in most states. For fruit characteristics “sui generis”, with significant nutritional value. This study aimed to characterize the marolo (Anonna crasiflora Mart during fruit development, through the evaluation of its proximal and mineral composition. The fruits 2012/2013 season, were picked to 12Km from the city of Itumirim, southern Minas Gerais, in intervals of 20 days from anthesis to maturity, and the first fruits were harvested 60 days after anthesis. The flowering marolo began in late September 2012, with fruiting initially observed at the end of October, with peak production at the end of February and beginning of March 2013 The fruits were harvested in the morning and carried to the laboratory, where followed up the moisture, ether extract, protein, ash, fiber and high sugar fraction beyond mineral quantification of them. During development reductions in moisture content and protein increments of ether extract, crude fiber and high sugar fraction and an oscillation in the mineral along the developmental stages was observed.

  19. Characterization of chemical and mineral composition of marolo (Annona crassiflora Mart during physiological development

    Directory of Open Access Journals (Sweden)

    Edson Pablo da SILVA

    Full Text Available Abstract Maroleiro (Annona crassiflora Mart, belonging to the family of Annonaceae is a typical specie of the Cerrado and has occurred in most states. For fruit characteristics “sui generis”, with significant nutritional value. This study aimed to characterize the marolo (Anonna crasiflora Mart during fruit development, through the evaluation of its proximal and mineral composition. The fruits 2012/2013 season, were picked to 12Km from the city of Itumirim, southern Minas Gerais, in intervals of 20 days from anthesis to maturity, and the first fruits were harvested 60 days after anthesis. The flowering marolo began in late September 2012, with fruiting initially observed at the end of October, with peak production at the end of February and beginning of March 2013 The fruits were harvested in the morning and carried to the laboratory, where followed up the moisture, ether extract, protein, ash, fiber and high sugar fraction beyond mineral quantification of them. During development reductions in moisture content and protein increments of ether extract, crude fiber and high sugar fraction and an oscillation in the mineral along the developmental stages was observed.

  20. Chemical constituents and antioxidant activity of the essential oil from leaves of Annona vepretorum Mart. (Annonaceae).

    Science.gov (United States)

    Araújo, Camila de Souza; de Oliveira, Ana Paula; Lima, Rafaely Nascimento; Alves, Péricles Barreto; Diniz, Tâmara Coimbra; da Silva Almeida, Jackson Roberto Guedes

    2015-01-01

    Annona vepretorum (AV) is a native tree from Caatinga biome (semiarid region of Brazil) popularly known as "araticum" and "pinha da Caatinga." This study was carried out to evaluate the chemical constituents and antioxidant activity (AA) of the essential oil from the leaves from AV (EO-Av) collected in Petrolina, Pernambuco, Brazil. Fresh leaves of AV were cut into pieces, and subjected to distillation for 2 h in a clevenger-type apparatus. Gas chromatograph (GC) analyses were performed using a mass spectrometry/flame ionization detector. The identification of the constituents was assigned on the basis of comparison of their relative retention indices. The antioxidant ability of the EO was investigated through two in vitro models such as radical scavenging activity using 2,2-diphenyl-1-picrylhydrazyl method and β-carotene-linoleate-model system. The positive controls (ascorbic acid, butylated hydroxyanisole and butylated hydroxytoluene) were those using the standard solutions. Assays were carried out in triplicate. The oil showed a total of 21 components, and 17 were identified, representing 93.9% of the crude EO. Spathulenol (43.7%), limonene (20.5%), caryophyllene oxide (8.1%) and α-pinene (5.5%) were found to be the major individual constituents. Spathulenol and caryophyllene oxide could be considered chemotaxonomic markers of these genera. The EO demonstrated weak AA.

  1. Minimum number of measurements for evaluating soursop (Annona muricata L.) yield.

    Science.gov (United States)

    Sánchez, C F B; Teodoro, P E; Londoño, S; Silva, L A; Peixoto, L A; Bhering, L L

    2017-05-31

    Repeatability studies on fruit species are of great importance to identify the minimum number of measurements necessary to accurately select superior genotypes. This study aimed to identify the most efficient method to estimate the repeatability coefficient (r) and predict the minimum number of measurements needed for a more accurate evaluation of soursop (Annona muricata L.) genotypes based on fruit yield. Sixteen measurements of fruit yield from 71 soursop genotypes were carried out between 2000 and 2016. In order to estimate r with the best accuracy, four procedures were used: analysis of variance, principal component analysis based on the correlation matrix, principal component analysis based on the phenotypic variance and covariance matrix, and structural analysis based on the correlation matrix. The minimum number of measurements needed to predict the actual value of individuals was estimated. Principal component analysis using the phenotypic variance and covariance matrix provided the most accurate estimates of both r and the number of measurements required for accurate evaluation of fruit yield in soursop. Our results indicate that selection of soursop genotypes with high fruit yield can be performed based on the third and fourth measurements in the early years and/or based on the eighth and ninth measurements at more advanced stages.

  2. Nutritional and sensory quality of stirred soursop (Annona muricata L.) yoghurt.

    Science.gov (United States)

    Lutchmedial, Maria; Ramlal, Reshma; Badrie, Neela; Chang-Yen, Ivan

    2004-08-01

    Soursops (Annona muricata L.) are highly aromatic fruits with white juicy flesh and are native to tropical North and South America. The ripe fruits are highly perishable, as they become soft and easily bruised. The objectives of the study were to incorporate soursop nectar at 0%, 5%, 10% and 15% in stirred yoghurts and to analyse the products for chemical and sensory quality. A focus group evaluated the initial yoghurts for process modifications. Yoghurts were evaluated on sensory attributes of appearance and colour, body and texture, flavour and aroma, and overall quality. Yoghurts with 10% and 15% soursop nectar had the highest (P<0.05) overall quality scores (12.60/20 and 12.75/20, respectively) but differed (P<0.05) in flavour and aroma from plain yoghurt and 5% soursop yoghurt. Most panelists would consider purchase of 10% and 15% soursop yoghurts over 0% and 5% soursop yoghurts. These yoghurts provided high percentage daily values of zinc, phosphorus and calcium and a good level of protein.

  3. Antioxidant, DNA protective efficacy and HPLC analysis of Annona muricata (soursop) extracts.

    Science.gov (United States)

    George, V Cijo; Kumar, D R Naveen; Suresh, P K; Kumar, R Ashok

    2015-04-01

    Annona muricata is a naturally occurring edible plant with wide array of therapeutic potentials. In India, it has a long history of traditional use in treating various ailments. The present investigation was carried out to characterize the phytochemicals present in the methanolic and aqueous leaf extracts of A. muricata, followed by validation of its radical scavenging and DNA protection activities. The extracts were also analyzed for its total phenolic contents and subjected to HPLC analysis to determine its active metabolites. The radical scavenging activities were premeditated by various complementary assays (DRSA, FRAP and HRSA). Further, its DNA protection efficacy against H2O2 induced toxicity was evaluated using pBR322 plasmid DNA. The results revealed that the extracts were highly rich in various phytochemicals including luteolin, homoorientin, tangeretin, quercetin, daidzein, epicatechin gallate, emodin and coumaric acid. Both the extracts showed significant (p < 0.05) radical scavenging activities, while methanolic extract demonstrated improved protection against H2O2-induced DNA damage when compared to aqueous extract. A strong positive correlation was observed for the estimated total phenolic contents and radical scavenging potentials of the extracts. Further HPLC analysis of the phyto-constituents of the extracts provides a sound scientific basis for compound isolation.

  4. Evaluation of anti-inflammatory activities of ethanolic extract of Annona muricata leaves

    Directory of Open Access Journals (Sweden)

    Chan Pit Foong

    2012-08-01

    Full Text Available Traditionally, the leaves of Annona muricata L., Annonaceae, are used to treat headaches, fever, toothache, cough and asthma. The decoction of the leaves has parasiticide, antirheumatic and antineuralgic effects when used internally, while the cooked leaves, applied topically, fight rheumatism and abscesses. The aim of this study was to investigate acute and chronic anti-inflammatory potential of an ethanolic leaf extract of A. muricata (AML in animal models. The ethanolic extract of A. muricata leaf extract was prepared and administered orally to experimental animals used. The anti-inflammatory activity was determined by xylene-induced ear edema in mice and Complete Freund's adjuvant (CFA-induced arthritis in rats. The results demonstrated that AML is effective for both acute and chronic inflammation. It also significantly attenuated both TNF-α and IL-1β levels in CFA-induced arthritis model. Thus, these results have suggested that AML possesses both anti-inflammatory and anti-arthritic activities. The findings also suggest that AML presents notable anti-arthritic activity that may be mediated by suppressing pro-inflammatory cytokines.

  5. Estudo in vitro do potencial citotóxico da Annona muricata L.

    Directory of Open Access Journals (Sweden)

    Egidi Mayara Firmino Silva

    2015-10-01

    Full Text Available O presente trabalho tem como objetivo avaliar a atividade citotóxica do extrato etanólico da casca do caule (AMC e folha (AMF da Annona muricata Linn. Para a realização desse estudo, inicialmente foi verificada a atividade do extrato etanólico nas concentrações de 1000, 800, 600, 200 e 100 μgmL-1 para AMF e concentrações de 200, 150, 100, 50, 10 μgmL-1 para AMC através do ensaio de Artemia salina Leach que é considerado um bioensaio preliminar no estudo de extratos com forte atividade biológica e permite realizar a avaliação da toxicidade envolvendo apenas um parâmetro: vida ou morte. Posteriormente foi realizado o ensaio de citotoxicidade através do método do MTT (3-(4,5-dimetiltiazol-2yl-2,5-difenil brometo de tetrazolina em linhagens de SF-295 (glioblastoma - humano, OVCAR-8 (ovário HCT-116 (colón e HL-60 (leucemia pormielocítica. Os extratos foram testados na concentração de 50 μg/mL para o teste de citotoxicidade de concentração única para verificar ausência ou presença de atividade. Para a determinação da concentração inibitória (CI50, todas as amostras foram testadas em concentrações seriadas que variaram de 0,09 a 50 μg/mL utilizando 2 como fator de diluição. No presente estudo, as duas amostras utilizadas através do ensaio de Artemia salina Leach apresentaram concentração letal (CL50 superiores a 80 μgmL-1. A folha apresentou CL50 = 324, 07μgmL-1 e a casca do caule apresentou CL50 = 196, 04μgmL-1. Já através do teste do MTT os valores de concentração inibitória (CI50 variaram de 12,81 a 22,65 μg/mL para AMF e de 0,09 a <5 μg/mL para AMC, frente as diferentes linhagens tumorais avaliadas. Diante dos resultados obtidos para a casca e folhas de A. muricata, avaliadas neste trabalho através dos bioensaios de toxicidade com Artemia salina Leach e com as células tumorais SF- 295, OVCAR-8, HCT-116 e HL-60, pode-se verificar o potencial tóxico de ambas as amostras, destacando-se mais as

  6. Antinociceptive and anti-ulcerogenic activities of the ethanolic extract of Annona muricata leaf

    Directory of Open Access Journals (Sweden)

    Roslida Abd Hamid

    2012-06-01

    Full Text Available Ethanolic extract of Annona muricata L., Annonaceae, leaf (AML was used to investigate its antinociceptive and anti-ulcerogenic activities and the involvement of the mechanism of ethanolic leaves extract of AML in various animal models. Antinociceptive activity of AML extract was done using acetic acid-induced abdominal writhing in mice, formalin test in rats and hot plate test in mice. Furthermore, the anti-ulcerogenic effect of AML extract was studied in ethanol-induced ulcer model in rats, ethanol-induced gastric lesions in L-NAME-pre-treated rats as well as ethanol-induced gastric lesions in NEM-pre-treated rats test model to determine its mechanism. AML exhibited significant and dose-dependent antinociceptive activity. It also significantly decreased the ulcerative lesion produced by ethanol in rats in a dose-dependent manner. Pre-treatment with N-ethymaleimide, a thiol blocker, including mucosal nonprotein sulfhydryl groups, reduced the anti-ulcerogenic effect of AML extract in the same ulcer model, suggesting that AML extract may have active substances such as tannins, flavanoids and triterpenes that increase the mucosal nonprotein sulfhydryl group content.

  7. Acetogenins from Annona muricata as potential inhibitors of antiapoptotic proteins: a molecular modeling study.

    Science.gov (United States)

    Antony, Priya; Vijayan, Ranjit

    2016-01-01

    Apoptosis is a highly regulated process crucial for maintaining cellular homeostasis and development. The B-cell lymphoma 2 (Bcl-2) family of proteins play a crucial role in regulating apoptosis. Overexpressed Bcl-2 proteins are associated with the development and progression of several human cancers. Annona muricata is a tropical plant that belongs to the Annonaceae family and is well known for its anticancer properties. In this study, molecular docking and simulations were performed to investigate the inhibitory potential of phytochemicals present in A. muricata against antiapoptotic proteins of the Bcl-2 family including Bcl-2, B-cell lymphoma extra-large (Bcl-Xl), and Mcl-1. Docking results revealed that the acetogenins, such as annomuricin A, annohexocin, muricatocin A, annomuricin-D-one, and muricatetrocin A/B, exhibited strong binding interactions with Bcl-Xl when compared to Bcl-2 and Mcl-1. Binding score and interactions of these acetogenins were notably better than those of currently available synthetic and natural inhibitors. Molecular dynamics simulations of the top-scoring lead molecules established that these molecules could bind strongly and consistently in the active site of Bcl-Xl. These results suggest that acetogenins could be explored as selective natural inhibitors of Bcl-Xl that could assist in promoting the intrinsic pathway of apoptosis.

  8. Antibacterial Activity of Leaf Extract of Annona muricata and Simarouba glauca on Enterococcus faecalis.

    Science.gov (United States)

    Mathew, Jain; George, Reshmi; Theruvil, Robin; Padavil, Tobin C; Tomy, Lincy; Kurian, Anil

    2016-08-01

    To determine the antimicrobial effect of water extracts of leaves of Annona muricata and Simarouba glauca on Enterococcus faecalis using agar diffusion method. Dried leaves of A. muricata and S. glauca were powdered and extracted in a soxhlet apparatus. Enterococcus faecalis was grown overnight in Trypticase soy agar plates. About 10 μl of each extract was placed on agar plates and incubated overnight. The zone of inhibition was measured after 24 hours. About 1% sodium hypochlorite and distilled water were used as positive and negative controls. The leaf extract of A. muricata showed similar effectiveness as that of sodium hypochlorite, whereas the leaf extract of S. glauca showed only a slight reduction in growth of E. faecalis. Leaf extract of A. muricata can be developed as an alternative to sodium hypochlorite for root canal irrigants. Success of endodontic treatment depends on complete disinfection of the root canals. Root canal irrigants have a major role in complete disinfection of the root canals. Chemical root canal irrigants are more or less toxic to the oral environment. In this study, naturally derived leaf extracts of A. muricata and S. glauca are compared with sodium hypochlorite for its effectiveness against E. faecalis - the most common pathogen found in the root canals.

  9. Annona muricata (Annonaceae): A Review of Its Traditional Uses, Isolated Acetogenins and Biological Activities.

    Science.gov (United States)

    Moghadamtousi, Soheil Zorofchian; Fadaeinasab, Mehran; Nikzad, Sonia; Mohan, Gokula; Ali, Hapipah Mohd; Kadir, Habsah Abdul

    2015-07-10

    Annona muricata is a member of the Annonaceae family and is a fruit tree with a long history of traditional use. A. muricata, also known as soursop, graviola and guanabana, is an evergreen plant that is mostly distributed in tropical and subtropical regions of the world. The fruits of A. muricata are extensively used to prepare syrups, candies, beverages, ice creams and shakes. A wide array of ethnomedicinal activities is contributed to different parts of A. muricata, and indigenous communities in Africa and South America extensively use this plant in their folk medicine. Numerous investigations have substantiated these activities, including anticancer, anticonvulsant, anti-arthritic, antiparasitic, antimalarial, hepatoprotective and antidiabetic activities. Phytochemical studies reveal that annonaceous acetogenins are the major constituents of A. muricata. More than 100 annonaceous acetogenins have been isolated from leaves, barks, seeds, roots and fruits of A. muricata. In view of the immense studies on A. muricata, this review strives to unite available information regarding its phytochemistry, traditional uses and biological activities.

  10. In vitro establishment of nodal segments of Annona muricata L. young plants

    Directory of Open Access Journals (Sweden)

    Leyanis García-Águila

    2012-10-01

    Full Text Available The use of tissue in vitro culture for plant propagation of soursop (Annona muricata L. promissory trees can help increasing the availability of plants for developing field plantations. Considering these aspect, this work aimed to establish in vitro nodal segments of young plants of soursop. Nodal segments with 1.5 cm of length were superficially disinfected with 70% ethanol during one minute and with sodium hypochlorite (0.5, 1.0, 1.5 and 2.0% during 15 minutes. The presence of microbial contamination and the number of segments with axillary buds were evaluated after 15 and 25 days of culture. The length (cm of buds was also determined. Results showed a low incidence of microbial contamination in the explants because the presence of fungi in treatments was not observed. However, 3.8% segments were contaminated with bacteria in the treatment with lower concentration of sodium hypochlorite. Axillary shoots were observed in 73.0% of explants when 1.0% of sodium hypochlorite was used, without significant differences using 1.5%. Shoots development with first expanded leaves and a length ranged between 0.8 and 1.5 cm was observed after 25 days of culture. Increasing culture time, plants showed leaf abscission. These results demonstrate that in vitro culture can be used for the propagation of soursop. However, we must make emphasis in the study of the culture conditions for the multiplication phase. Key words: in vitro culture, microbial contamination, phenolic oxidation, shoot production.

  11. Chemopreventive potential of Annona muricata L leaves on chemically-induced skin papillomagenesis in mice.

    Science.gov (United States)

    Hamizah, Sulaiman; Roslida, A H; Fezah, O; Tan, K L; Tor, Y S; Tan, C I

    2012-01-01

    Annona muricata L (Annonaceae), commonly known as soursop has a long, rich history in herbal medicine with a lengthy recorded indigenous use. It had also been found to be a promising new anti-tumor agent in numerous in vitro studies. The present investigation concerns chemopreventive effects in a two-stage model of skin papillomagenesis. Chemopreventive effects of an ethanolic extract of A. muricata leaves (AMLE) was evaluated in 6-7 week old ICR mice given a single topical application of 7,12-dimethylbenza(α)anthracene (DMBA 100 μg/100 μl acetone) and promotion by repeated application of croton oil (1% in acetone/ twice a week) for 10 weeks. Morphological tumor incidence, burden and volume were measured, with histological evaluation of skin tissue. Topical application of AMLE at 30, 100 and 300 mg/kg significantly reduced DMBA/croton oil induced mice skin papillomagenesis in (i) peri-initiation protocol (AMLE from 7 days prior to 7 days after DMBA), (ii) promotion protocol (AMLE 30 minutes after croton oil), or (iii) both peri-initiation and promotion protocol (AMLE 7 days prior to 7 day after DMBA and AMLE 30 minutes after croton oil throughout the experimental period), in a dose dependent manner (pmuricata leaves extract was able to suppress tumor initiation as well as tumor promotion even at lower dosage.

  12. Antiproliferative activity and induction of apoptosis by Annona muricata (Annonaceae) extract on human cancer cells.

    Science.gov (United States)

    Pieme, Constant Anatole; Kumar, Santosh Guru; Dongmo, Mireille Sylviane; Moukette, Bruno Moukette; Boyoum, Fabrice Fekam; Ngogang, Jeanne Yonkeu; Saxena, Ajit Kumar

    2014-12-24

    Annona muricata (A. muricata) is widely distributed in Asia, Africa and South America. Different parts of this plant are used to treat several diseases in Cameroon. The aim of this study is to determine the in vitro anti-proliferative effects and apoptotic events of A. muricata extracts on HL-60 cells as well as to quantify its phenols content. The cell viability was measured by using 3-(4, 5-dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT) assay while the changes in morphology of HL-60 cells, membrane mitochondrial potential (MMP) and the cell cycle were used for assessment apoptosis induction. The results show that the concentration of phenols, flavonoids and flavonols in the extracts varied depending on the part of the plant. All the extracts tested inhibited the proliferation of HL-60 cells in a concentration dependent manner with IC50 varied from 6-49 μg/mL. The growth inhibition of the cells by extracts was associated with the disruption of MMP, reactive oxygen species (ROS) generation and the G0/G1 cell arrest. These findings suggest that the extracts from A. muricata have strong antiproliferation potential and can induce apoptosis through loss of MMP and G0/G1 phase cell arrest.

  13. Acetogenins from Annona muricata as potential inhibitors of antiapoptotic proteins: a molecular modeling study

    Science.gov (United States)

    Antony, Priya; Vijayan, Ranjit

    2016-01-01

    Apoptosis is a highly regulated process crucial for maintaining cellular homeostasis and development. The B-cell lymphoma 2 (Bcl-2) family of proteins play a crucial role in regulating apoptosis. Overexpressed Bcl-2 proteins are associated with the development and progression of several human cancers. Annona muricata is a tropical plant that belongs to the Annonaceae family and is well known for its anticancer properties. In this study, molecular docking and simulations were performed to investigate the inhibitory potential of phytochemicals present in A. muricata against antiapoptotic proteins of the Bcl-2 family including Bcl-2, B-cell lymphoma extra-large (Bcl-Xl), and Mcl-1. Docking results revealed that the acetogenins, such as annomuricin A, annohexocin, muricatocin A, annomuricin-D-one, and muricatetrocin A/B, exhibited strong binding interactions with Bcl-Xl when compared to Bcl-2 and Mcl-1. Binding score and interactions of these acetogenins were notably better than those of currently available synthetic and natural inhibitors. Molecular dynamics simulations of the top-scoring lead molecules established that these molecules could bind strongly and consistently in the active site of Bcl-Xl. These results suggest that acetogenins could be explored as selective natural inhibitors of Bcl-Xl that could assist in promoting the intrinsic pathway of apoptosis. PMID:27110097

  14. analysis of gear milling at vari gear milling at various gear milling

    African Journals Online (AJOL)

    eobe

    f), gave coefficients β0, β1 and β2 as 0.281, being significant to the adopted model and ignificant to .... roughness and tool wear in the cases of both hot and room temperature machining. Alberti, et al. [9] developed ... machining processes in milling operations, a reduction in processing times for both conventional and high.

  15. Anti-microbial Efficacy of Soursop Leaf Extract (Annona muricata) on Oral Pathogens: An In-vitro Study.

    Science.gov (United States)

    Pai, Bh Mithun; Rajesh, Gururagavendra; Shenoy, Ramya; Rao, Ashwini

    2016-11-01

    Annona muricata also called as Soursop is a, flowering evergreen tree native to Mexico, Cuba, Central America and parts of India. The miracle tree as it is widely known as a natural cancer killer that is 10,000 times stronger than chemotherapy. Based on these miraculous claims, the leaves of these plants were used as an extract at varying concentrations as an antibacterial agent against oral pathogens. The aim of the study was to assess antimicrobial efficacy of Soursop leaf extarct ( Annona muricata ) on Streptococcus mutans , Streptococcus mitis , Porphyromonas gingivalis , Prevotella intermedia and Candida albicans using disc diffusion method. Extracts of Annona muricata leaves of concentrations of 1%, 5%, 10%, 15% and 20% were prepared. The anti-microbial efficacy was evaluated using disc diffusion method against Streptococcus mutans , Streptococcus mitis , Porphyromonas gingivalis , Prevotella intermedia and Candida albicans on agar plates. All concentrations of extracts were effective on the microbiota except for the P. Intermedia . The Soursop extract was highly effective on Candida species, with all concentrations exhibiting bactericidal and fungicidal property. The extracts at different concentration were effective when compared to the gold standard controls and the effect was statistically significant (p<0.05). Data obtained was analysed using one way analysis of variance (ANOVA) and Tukey's post-hoc test. The Soursop extracts were efficient for all test organisms expect P. intermedia . The present study demonstrated the in-vitro efficacy of Soursop was highest against S. mutans followed by C. albicans and least on P. intermedia . Hence, this study proves to an extent that the Soursop extract when used against oral microbiota has sufficient anti-microbial and fungicidal property.

  16. Antiproliferative activity of aqueous leaf extract of Annona muricata L. on the prostate, BPH-1 cells, and some target genes.

    Science.gov (United States)

    Asare, George Awuku; Afriyie, Dan; Ngala, Robert A; Abutiate, Harry; Doku, Derek; Mahmood, Seidu A; Rahman, Habibur

    2015-01-01

    Annona muricata L. has been reported to possess antitumor and antiproliferative properties. Not much work has been done on its effect on BPH-1 cell lines, and no in vivo studies targeting the prostate organ exist. The study determined the effect of A muricata on human BPH-1 cells and prostate organ. The MTT assay was performed on BPH-1 cells using the aqueous leaf extract of A muricata. Cells (1 × 10(5) per well) were challenged with 0.5, 1.0, and 1.5 mg/mL extract for 24, 48, and 72 hours. Cell proliferation and morphology were examined microscopically. BPH-1 cells (1 × 10(4) per well) were seeded into 6-well plates and incubated for 48 hours with 0.5, 1.0, and 1.5 mg/mL A muricata extract. Reverse transcriptase polymerase chain reaction was performed using mRNA extracted from the cells. Possible target genes, Bax and Bcl-2, were examined. Twenty F344 male rats (≈200 g) were gavaged 30 mg/mL (10 rats) and 300 mg/mL (10 rats) and fed ad libitum alongside 10 control rats. Rats were sacrificed after 60 days. The prostate, seminal vesicles, and testes were harvested for histological examination. Annona muricata demonstrated antiproliferative effects with an IC50 of 1.36 mg/mL. Best results were obtained after 48 hours, with near cell extinction at 72 hours. Bax gene was upregulated, while Bcl-2 was downregulated. Normal histological architecture was observed for all testes. Seminal vesicle was significantly reduced in test groups (P Annona muricata has antiproliferative effects on BPH-1 cells and reduces prostate size, possibly through apoptosis. © The Author(s) 2014.

  17. Influence of milling process on efavirenz solubility

    Directory of Open Access Journals (Sweden)

    Erizal Zaini

    2017-01-01

    Full Text Available Introduction: The aim of this study was to investigate the influence of the milling process on the solubility of efavirenz. Materials and Methods: Milling process was done using Nanomilling for 30, 60, and 180 min. Intact and milled efavirenz were characterized by powder X-ray diffraction, scanning electron microscopy (SEM, spectroscopy infrared (IR, differential scanning calorimetry (DSC, and solubility test. Results: The X-ray diffractogram showed a decline on peak intensity of milled efavirenz compared to intact efavirenz. The SEM graph depicted the change from crystalline to amorphous habit after milling process. The IR spectrum showed there was no difference between intact and milled efavirenz. Thermal analysis which performed by DSC showed a reduction on endothermic peak after milling process which related to decreasing of crystallinity. Solubility test of intact and milled efavirenz was conducted in distilled water free CO2with 0.25% sodium lauryl sulfate media and measured using high-performance liquid chromatography method with acetonitrile: distilled water (80:20 as mobile phases. The solubility was significantly increased (P < 0.05 after milling processes, which the intact efavirenz was 27.12 ± 2.05, while the milled efavirenz for 30, 60, and 180 min were 75.53 ± 1.59, 82.34 ± 1.23, and 104.75 ± 0.96 μg/mL, respectively. Conclusions: Based on the results, the solubility of efavirenz improved after milling process.

  18. Identification of chemical compounds present in different fractions of Annona reticulata L. leaf by using GC-MS.

    Science.gov (United States)

    Rout, Soumya P; Kar, Durga M

    2014-01-01

    GC-MS analysis of fractions prepared from hydro-alcoholic extract of Annona reticulata Linn (Family Annonaceae) leaf revealed the presence of 9,10-dimethyltricyclo[4.2.1.1(2,5)]decane-9,10-diol; 4-(1,5-dihydroxy-2,6,6-trimethylcyclohex-2-enyl)but-3-en-2-one; 3,7-dimethyl-6-nonen-1-ol acetate; 9-octadecenamide,(Z)-; glycerine; D-glucose,6-O-α-D-galactopyranosyl-; desulphosinigrin and α-methyl-D-mannopyranoside as few of the major compounds in different fractions. The presence of these compounds in the plant has been identified for the first time.

  19. DAYA LARVASIDA EKSTRAK BIJI SRIKAYA (ANNONA SQUAMOSA DENGAN RENTANG WAKTU PENYIMPANAN YANG BERBEDA TERHADAP LARVA CULEX QUINQUEFASCIATUS

    Directory of Open Access Journals (Sweden)

    Wisnu Satria A.K.

    2013-03-01

    Full Text Available Abstract. Synthetic insecticide have been used to control Culex quinquefasciatus, but the prolonged usage of synthetic insecticide has a bad impact on the environment and may caused resistance. Sugar apple’s (Annona squamosa seeds which contain alkaloid can be used as an alternative insecticide that was safe for environment. This research aims is to know the effect of sugar apple’s seeds with different length of storage as C. quinquefasciatus larvacide. This research was an experimental study with a randomized controlled trial group design approach. The test material was an extract of sugar apple’s seeds which have been kept for 0, 1, 2, and 3 week with LC50 (0,47 ppm was used. Each treatment used 25 C. quinquefasciatus larvae from third instar larvae stage and replicated five times. After exposed for 24 hours, dead larvae counted. The result confirmed that the extract of sugar apple’s seeds which has been stored in 0, 1, 2, and 3 week did not showed any significant different on larvae mortality. Extract of sugar apple’s seeds which have been stored in 0, 1, 2, and 3 week have an equal activity as Culex quinquefasciatus larvicide. Key Word: Sugar apple (Annona squamosa, seeds, larvicide, Culex quinquefasciatus, length of storage Abstrak. Insektisida sintetik telah banyak digunakan untuk mengontrol Culex quinquefasciatus, tetapi penggunaan insektisida sintetik terus-menerus berdampak buruk terhadap lingkungan dan mengakibatkan resistensi. Fakta ini menjadi alasan biji srikaya (Annona squamosa yang mengandung alkaloid digunakan sebagai insektisida alternatif yang aman bagi lingkungan. Penelitian ini bertujuan untuk mengetahui pengaruh biji srikaya dengan perbedaan lama penyimpanan terhadap larva C. quinquefasciatus. Penelitian ini merupakan penelitian eksperimental dengan desain rancangan acak kelompok. Bahan uji adalah ekstrak biji srikaya yang telah disimpan selama 0, 1, 2, dan 3 minggu. Sampel penelitian ini adalah larva instar ketiga

  20. PULPA CUBA MILL ENERGY ASSESSMENT

    Directory of Open Access Journals (Sweden)

    Juan Pedro Hernández Touset

    2015-10-01

    Full Text Available An energy study was performed at Pulpa Cuba Paper Mill, located in Sancti Spiritus, where an energy management system was applied according to NC: ISO 50001, in order to assess the energy system by applying energy management systems for energy and water reduction in the paper mill, in which the current steam generation, distribution and consumption system is diagnosed. The proposal of a modified energy scheme with 1 MW Backpressure Steam Turbine Generator and rehabilitation of the original boiler or installing a lower capacity boiler contributes to save financial resources by the concept of water, fuel and electricity. The implementation of four projects will save 3,095,574 CUC / y and an average payback period of about 1 year is expected.

  1. Soil carbon 4 per mille

    OpenAIRE

    Minasny, B.; Malone, B. P.; McBratney, A. B.; Angers, D. A.; Arrouays, D.; Chambers, A.; Chaplot, Vincent; Chen, Z. S.; Cheng, K.; Das, B. S.; Field, D. J.; Gimona, A.; Hedley, C. B.; Hong, S. Y.; Mandal, B.

    2017-01-01

    The '4 per mille Soils for Food Security and Climate' was launched at the COP21 with an aspiration to increase global soil organic matter stocks by 4 per 1000 (or 0.4 %) per year as a compensation for the global emissions of greenhouse gases by anthropogenic sources. This paper surveyed the soil organic carbon (SOC) stock estimates and sequestration potentials from 20 regions in the world (New Zealand, Chile, South Africa, Australia, Tanzania, Indonesia, Kenya, Nigeria, India, China Taiwan, S...

  2. Rolling Mill Hill, Nashville, TN

    Science.gov (United States)

    Rolling Mill Hill was the home to Nashville General Hospital from 1890 to the 1990s and encompassed several buildings and structures. These existing buildings of historical significance were re-used in the form of apartments. The original Trolley Barns on the site are now artists’ lofts and are home to several companies and non-profit offices. Nance Place, which entails additional buildings built on-site, is a Tax Credit Workforce Housing Development and is Platinum LEED certified.

  3. Mill performance of coal blends

    Energy Technology Data Exchange (ETDEWEB)

    P.A. Bennett; G. O' Brien; D. Holcombe [CoalTech Pty Ltd. (Australia)

    2005-07-01

    Evaluating the potential performance of coal blends for use as pulverised fuel (PF) in power plants and pulverised coal injection (PCI) into blast furnaces requires knowledge of the size distribution of the organic and mineral matter components of a blend, especially when there are significant differences in the Hardgrove Grindability Index (HGI) of the component coals. The size distribution of the organic matter impacts on combustibility of thermal and PCI coal blends and handleability of PCI coal blends. Petrography techniques were used to examine four size fractions from the PF of single coals and blends to measure the size distribution of maceral groups. For most coals, a good estimate of a blend's size distribution can be made assuming that the size distribution of the individual coals, milled under the same conditions, are added together in the proportions of the blend. The exception is when a very soft coal (HGI 90) is blended with a very hard coal (HGI 35). In this case preferential milling (more reporting to the smaller size fractions) of the softer coal occurred. All coals studied in this project show some sign of preferential grinding of the softer maceral group when the coal was milled individually or in a blend. It is only when there is a large difference in the relative strength of the maceral groups of the coals blended that the preferential milling of a coal in a blend is observed in the size distribution of the blend. The results indicate that the breakage characteristics (change in size reduction per unit of energy) of maceral groups in individual coals do not change when they are blended with other coals. 12 refs., 5 figs., 2 tabs.

  4. In vitro seed germination and seedling development of Annona crassiflora Mart. Germinação de sementes e desenvolvimento in vitro de plântulas de Annona crassiflora Mart.

    Directory of Open Access Journals (Sweden)

    Márcia de Nazaré Oliveira Ribeiro

    2009-06-01

    Full Text Available Annona crassiflora Mart known as 'araticum', 'marolo' or 'field araticum' is a typical fruit from the Cerrado biome of Brazil with socio-economic and medicinal importance. Normally, Annona crassiflora is propagated through seeds. However, due to a deep dormancy that the seeds display at dispersion and the difficulty to obtain uniform plants in a short time period, micropropagation may be a feasible alternative. Concentrations of gibberellic acid (GA3 and naphthalene-acetic acid (NAA and their interactive effects on in vitro seed germination and seedling development of Annona crassiflora were studied. Mature fruits of Annona crassiflora were depulped and the seeds washed in clear water and dried at room temperature. Seed coat was removed and the seeds were placed on Murashige & Skoog (MS medium supplemented with gibberellic acid (GA3 and naphthalene-acetic acid (NAA, 30 g L-1 sucrose and 6 g L-1 agar-agar. Seeds were kept under these conditions for 30 days. After this period, seedlings were kept for another 90 days on Wood Plant Medium (WPM with 20 g L-1 sucrose and 5 g L-1 agar-agar supplemented with the same GA3 and NAA concentrations. Cultures were incubated under controlled conditions at 25 ± 2°C temperature, 16: 8 (light: dark photoperiod of 32 µmol m-2 s-1 irradiance provided by cool white fluorescent tubes (Philips. Use of WPM medium supplemented with 25-32 mg L-1 GA3 or MS with 26-30 mg L-1 GA3 and 2 mg L-1 NAA promoted rooting and plant growth.O araticum ou marolo (Annona crassiflora Mart. é uma fruta típica de Cerrado com grande importância sócio-econômico e medicinal. Sua propagação pode ser feita através de sementes, porém devido à dormência das sementes e dificuldade de se obterem plantas uniformes e em curto espaço de tempo, a micropropagação poderá ser uma alternativa. Estudaram-se os efeitos do GA3 associado ao ANA sobre a germinação de sementes e desenvolvimento in vitro de marolo. Frutos maduros foram

  5. Online SAG Mill Pluse Measurement and Optimization

    Energy Technology Data Exchange (ETDEWEB)

    Raj Rajamani; Jose Delgadillo; Vishal Duriseti

    2007-06-30

    The grinding efficiency of semi autogenous milling or ball milling depends on the tumbling motion of the total charge within the mill. Utilization of this tumbling motion for efficient breakage of particles depends on the conditions inside the mill. However, any kind of monitoring device to measure the conditions inside the mill shell during operation is virtually impossible due to the severe environment presented by the tumbling charge. An instrumented grinding ball, which is capable of surviving a few hours and transmitting the impacts it experiences, is proposed here. The spectrum of impacts collected over 100 revolutions of the mills presents the signature of the grinding environment inside mill. This signature could be effectively used to optimize the milling performance by investigating this signature's relation to mill product size, mill throughput, make-up ball size, mill speed, liner profile and ball addition rates. At the same time, it can also be used to design balls and liner systems that can survive longer in the mill. The technological advances made in electronics and communication makes this leap in instrumentation certainly viable. Hence, the instrumented grinding ball offers the ability to qualitatively observe and optimize the milling environment. An instrumented load cell package that can measure the force of impacts inside the grinding chamber of a mill is developed here. The signal from the instrumented load cell package is interpreted in terms of a histogram termed as an impact spectrum which is a plot of the number of impacts at a specific energy level against the energy. It reflects on the average force regime of the mill. The instrumented load cell package was calibrated against the ultra fast load cell which has been unanimously accepted as a standard to measure single breakage events. The load cell package was successfully used to produce impact spectra in an 8.5 inch lab scale mill. The mill speed and the ball size were varied to

  6. Biocide activity of Annona coriacea seeds extract on Rhodnius neglectus (Hemiptera: Reduviidae

    Directory of Open Access Journals (Sweden)

    Ângela Pinheiro Carneiro

    2013-03-01

    Full Text Available The use of synthetic insecticides for insect control may lead to different kind of problems, such as vector resistance to insecticides. To avoid these problems, a new research area to study botanical products as possible disease vectors controls, has become a feasible alternative. The purpose of this research was to evaluate the biocide activity of the ethanol extract of seeds of Annona coriacea on Rhodnius neglectus (Chagas disease vector nymphs and adults. For this, different concentrations extracts were evaluated: 25, 50, 100 and 200mg/ mL, and water in DMSO (20% was used as control. The experimental design was completely randomized and we conducted the bioassay with nymphs and adults, with 10 nymphs and 10 adults (five males and five females per treatment. Extract action was evaluated in both bioassays, in order to identify possible effects of mortality and life cycle interruption of nymphs and adults during a 28-day-period. The results obtained showed that the extract of A. coriacea was able to disrupt the development of nymphs and adults of R. neglectus, with a mortality rate of more than 90%, 36% and 100%, at the highest concentrations, respectively. There was also molting inhibition in nymphs, lower reproductive capacity in females, feeding deterrence and morphological changes in nymphs and adults. We concluded that the extract of A. coriacea has insecticide action on nymphs and adults of R. neglectus.La enfermedad de Chagas se convirtió en un problema de salud debido a su importancia epidemiológica, es producida por el protista Trypanosoma cruzi, cuyos insectos vectores son del género Triatoma y Panstrongylus. El objetivo de este estudio fue evaluar la actividad biocida del extracto de Annona coriacea en las ninfas de Rhodnius neglectus y en sus adultos. Se evaluaron 14 concentraciones de 25, 50, 100 y 200mg/ml del extracto etanólico, así como el control, en este caso agua de DMSO (20%. Se utilizo un diseño completamente

  7. Las plantas americanas en la obra de Charles de l'Écluse: primeras citas en las cartas de Juan de Castañeda

    Directory of Open Access Journals (Sweden)

    Ramón-Laca Menéndez de Luarca, Luis

    1999-06-01

    Full Text Available The Flemish botanist Charles de l'Écluse's works contain abundant references to American plants, for example the avocado (Persea americana Mill., the sweet potato [Ipomoea batatas (L. Lam.], the potato (Solanum tuberosum L. and the tobáceo (Nicotiana tabacum L.. Although some of these plants were observed by L'Écluse himself during his expedition to the Iberian Península between 1564 and 1565, the majority of the American plants quoted in his works are related with shipments received from several agents around Europe. In the case of Spain, L'Écluse obtained seeds from Seville thanks to the help of Simón de Tovar and Juan de Castañeda. The latter offers in his letters important innovations: Annona cherimola Mill., Indigofera añil LJI. tinctoria L., Annona muricata L., Mammea americana L.. Annona reticulata L., Dioscorea sp., Aloysia citrodora Palau or Manihot spj M. esculenta Crantz. In most of the cases the mention of these plants represente the first record of cultivation in the Old World. A percentage of this material was used by L'Écluse in his Exoticorum libri decem, published in Antwerp in l605.Las obras del botánico flamenco Charles de l'Écluse contienen infinidad de referencias a plantas americanas, destacando entre ellas el aguacate (Persea americana Mill., las batatas [Ipomoea batatas (L. Lam.], las patatas (Solanum tuberosum L. o el tabaco (Nicotiana tabacum L. . Algunas de ellas fueron observadas por L'Écluse durante la expedición llevada a cabo por la Península Ibérica entre 1564 y 1565. La mayor parte de plantas americanas citadas en sus obras están relacionadas sin embargo con envíos realizados por diversos corresponsales repartidos por Europa. En el caso de España, L'Écluse recibió semillas desde Sevilla gracias a Simón de Tovar y Juan de Castañeda. Este último ofrece en sus cartas importantes novedades, como el "anón" (Annona cherimola Mill., el "añil" (Indigofera añil L./I. tinctoria L., la "guan

  8. Efficacy of Annona squamosa L in the synthesis of glycosaminoglycans and collagen during wound repair in streptozotocin induced diabetic rats.

    Science.gov (United States)

    Ponrasu, Thangavel; Suguna, Lonchin

    2014-01-01

    The aim of this work was to find out the effects of Annona squamosa on the formation of glycosaminoglycans and collagen during wound healing in normal and diabetic rats. Diabetes induced rats were segregated into 4 groups, each containing six animals. Groups I and III served as the normal and diabetic control while groups II and IV served as normal and diabetic treated. The animals were treated with 200 μL of Annona squamosa extract topically. The granulation tissues formed were removed on the 8th day and the amount of glycosaminoglycans (GAGs) and collagen formed was evaluated by sequential extraction and SDSPAGE, respectively. Histological evaluation was also carried out using Masson's trichrome stain. In vitro wound healing efficacy of A. squamosa in human dermal fibroblast culture (HDF) was also carried out. The fibroblasts treated with varying concentrations of A. squamosa were examined for proliferation and closure of the wound area and photographed. A. squamosa increased cellular proliferation in HDF culture. The granulation tissues of treated wounds showed increased levels of glycosaminoglycans (P < 0.05) and collagen which were also confirmed by histopathology. The results strongly substantiate the beneficial effects of A. squamosa on the formation of glycosaminoglycans and collagen during wound healing.

  9. Evaluation of substrates on the emergence of "araticum-de-terra-fria" (Annona emarginata (Schltdl. H. Rainer Seedlings

    Directory of Open Access Journals (Sweden)

    Daniel Baron

    2011-06-01

    Full Text Available Choosing a substrate is the determinant factor for the seedling producer; thus, the aim of this study was to evaluate the effect of different types of substrates on the emergence of "araticum-de-terra-fria" (Annona emarginata (Schltdl. H. Rainer seedlings. The experiment was carried out in a greenhouse and the experimental design was in randomized blocks, with three treatments and five replicates of 72 seeds per plot. The treatments consisted of the following substrates: coconut fiber, vermiculite and Plantmax® Citrus. The number of emerged seedlings was weekly counted for 105 days. Data regarding seedling height were obtained, and the emergence velocity index and mean time, besides total emergence percentage and that over time were calculated. Results from total mean emergence percentage, seedling height, emergence velocity index (EVI, and mean emergence time (MET were subjected to analysis of variance and means were compared by the Tukey's test at 5% significance. The curves concerning the emergence percentage over time were fit by the logistic growth equation for each treatment and the means of each parameter (A, B, C were compared by the Duncan's test at 5% significance. The substrates vermiculite led to the highest values of emergence percentage differing from the PlantMax® Citrus, but not of the coconut fiber, however the vermiculite promoted seedling height in a shorter time; therefore, this substrate is recommended for the initial development of "araticum-de-terra-fria" (Annona emarginata (Schltdl. H. Rainer seedlings.

  10. In vitro cytotoxic, antifungal, trypanocidal and leishmanicidal activities of acetogenins isolated from Annona cornifolia A. St. -Hil. (Annonaceae

    Directory of Open Access Journals (Sweden)

    LUCIANA A.R.S. LIMA

    2014-06-01

    Full Text Available Annona cornifolia A. St. -Hil. is a small annual perennial tree found in the Brazilian savannah; their green fruit is popularly used in the treatment of ulcers. The acetogenins isolated from the seeds of Annona cornifolia previously showed to possess antioxidant activity. In continuation of our investigations on the biological activities of acetogenins, four binary mixtures and ten pure adjacent bis-tetrahydrofuran annonaceous acetogenins were evaluated: the cytotoxic (against three human tumor cell lines, antifungal (against Paracoccidioides brasiliensis, trypanocidal (against Trypanosoma cruzi and leishmanicidal (against Leishmania amazonensis activities. Acetogenins presented cytotoxic activity confirming their potential use in anti-cancer therapy. Regarding leishmanicidal and trypanocidal activities, an inhibition of 87% of L. amazonensis amastigotes and 100% of T. cruzi amastigotes and trypomastigotes was observed, when tested at the concentration of 20 µg mL–1. Moreover, six acetogenins showed more activity against all the three tested isolates of P. brasiliensis than trimethoprim-sulfamethoxazole, a drug used for treating paracoccidioidomycosis. Thus, acetogenins may be an alternative in treating a number of diseases that have a huge impact on millions of people worldwide. This paper reports for the first time the antifungal, leishmanicidal and trypanocidal activities for these acetogenins.

  11. Annona muricata leaves extracts prevent DMBA/TPA-induced skin tumorigenesis via modulating antioxidants enzymes system in ICR mice.

    Science.gov (United States)

    Md Roduan, Mohd Rohaizad; Hamid, Roslida Abd; Sulaiman, Hamizah; Mohtarrudin, Norhafizah

    2017-10-01

    Annona muricata, locally known as soursop has been reported to exhibit antiproliferative activities against various cancer cell lines. In this current study, we have investigated the antitumor promotion of various fractions of Annona muricata leaves (AML); hexane (AMLH), dichloromethane (AMLD) and methanol (AMLM) fraction respectively on 7, 12-dimethylbenz[α]anthracene (DMBA) induced and 12-0-tetradecaboylphorbol-13-acetate (TPA) promoted skin tumorigenesis in mice via morphological assessment, biochemical analysis and histopathological evaluation. The results of the study revealed significant inhibition in tumor incidence, tumor burden and tumor volume in the groups received AMLH and AMLD, respectively, and suppressive effects in group received AMLM compared with carcinogen control group at week 21. Superoxide dismutase, catalase, and lipid peroxidation levels were returned to near normal by administration of AML to DMBA/TPA-induced mice. The above findings were supported by histopathological studies, in which the extensive epidermal hyperplasia in carcinogen control group was restored to normal in AML treated groups. Whilst, annonacin, a major annaonaceous acetogenin was found to be the highest in AMLH and AMLD. From the present study, it can be inferred that AML supressed DMBA/TPA-induced skin tumor and this antitumor-promoting activity may be linked to the antioxidant/free radical-scavenging constituents of the extract and annonacin contained in the extracts. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  12. Peltatoside Isolated from Annona crassiflora Induces Peripheral Antinociception by Activation of the Cannabinoid System.

    Science.gov (United States)

    Oliveira, Cristina da Costa; Veloso, Clarice de Carvalho; Ferreira, Renata Cristina Mendes; Lage, Gisele Avelar; Pimenta, Lúcia Pinheiro Santos; Duarte, Igor Dimitri Gama; Romero, Thiago Roberto Lima; Perez, Andrea de Castro

    2017-02-01

    Peltatoside is a natural compound isolated from leaves of Annona crassiflora Mart., a plant widely used in folk medicine. This substance is an analogue of quercetin, a flavonoid extensively studied because of its diverse biological activities, including analgesic effects. Besides, a previous study suggested, by computer structure analyses, a possible quercetin-CB 1 cannabinoid receptor interaction. Thus, the aim of this work was to assess the antinociceptive effect of peltatoside and analyze the cannabinoid system involvement in this action. The mouse paw pressure test was used and hyperalgesia was induced by intraplantar injection of carrageenan (200 µg/paw). All used drugs were administered by intraplantar administration in Swiss male mice (n = 6). Peltatoside (100 µg/paw) elicited a local inhibition of hyperalgesia. The peripheral antinociceptive action of peltatoside was antagonized by the CB 1 cannabinoid antagonist AM251 (160 µg/paw), but not by CB 2 cannabinoid antagonist AM630 (100 µg/paw). In order to assess the role of endocannabinoids in this peripheral antinociceptive effect, we used (i) [5 Z ,8 Z ,11 Z ,14 Z ]-5,8,11,14-eicosatetraenyl-methyl ester phosphonofluoridic acid, an inhibitor of anandamide amidase; (ii) JZL184, an inhibitor for monoacylglycerol lipase, the primary enzyme responsible for degrading the endocannabinoid 2-arachidonoylglycerol; and (iii) VDM11, an endocannabinoid reuptake inhibitor. MAFP, JZL184, and VDM11 did not induce antinociception, respectively, at the doses 0.5, 3.8, and 2.5 µg/paw, however, these three drugs were able to potentiate the peripheral antinociceptive effect of peltatoside at an intermediary dose (50 µg/paw). Our results suggest that this natural substance is capable of inducing analgesia through the activation of peripheral CB 1 receptors, involving endocannabinoids in this process. Georg Thieme Verlag KG Stuttgart · New York.

  13. Chemical Characterization and Cytoprotective Effect of the Hydroethanol Extract from Annona coriacea Mart. (Araticum)

    Science.gov (United States)

    Júnior, José G. A. S.; Coutinho, Henrique D. M.; Boris, Ticiana C. C.; Cristo, Janyketchuly S.; Pereira, Nara L. F.; Figueiredo, Fernando G.; Cunha, Francisco A. B.; Aquino, Pedro E. A.; Nascimento, Polyana A. C.; Mesquita, Francisco J. C.; Moreira, Paulo H. F.; Coutinho, Sáskia T. B.; Souza, Ivon T.; Teixeira, Gabriela C.; Ferreira, Najla M. N.; Farina, Eleonora O.; Torres, Cícero M. G.; Holanda, Vanderlan N.; Pereira, Vandbergue S.; Guedes, Maria I. F.

    2016-01-01

    Introduction: Annona coriacea Mart. (araticum) is a widely distributed tree in the cerrado. Its value is attributed principally to the consumption of its fruit which possesses a large nutritive potential. The objective was to identify the chemical profile and evaluate the antimicrobial and cytoprotective activity of the hydroethanol extract of A. coriacea Mart. (HEAC) leaves against the toxicity of mercury chloride. Materials and Methods: The characterization of components was carried out using high-performance liquid chromatography (HPLC). The minimum inhibitory concentration (MIC) was determined by microdilution method in broth with strains of Staphylococcus aureus, Escherichia coli, and Pseudomonas aeruginosa. For evaluation of the modulatory and cytoprotective activity of aminoglycoside antibiotics (gentamicin and amikacin) and mercury chloride (HgCl2), the substances were associated with the HEAC at subinhibitory concentrations (MIC/8). Results and Discussion: The HPLC analysis revealed the presence of flavonoids such as Luteolin (1.84%) and Quercetin (1.19%) in elevated concentrations. The HEAC presented an MIC ≥512 μg/mL and significant antagonistic action in aminoglycosides modulation, and it also showed cytoprotective activity to S. aureus (significance P < 0.0001) and E. coli (significance P < 0.05) bacteria against the mercury chloride heavy metal with significance, this action being attributed to the chelating properties of the flavonoids found in the chemical identification. Conclusions: The results acquired in this study show that the HEAC presents cytoprotective activity over the tested strains in vitro and can also present antagonistic effect when associated with aminoglycosides, reinforcing the necessity of taking caution when combining natural and pharmaceutical products. SUMMARY The hydroalcoholic extract of A. coriacea Mart. presents in vitro cytoprotective activity against the toxic effect of Hg. Abbreviations Used: HPLC-DAD: High

  14. Histochemical detection of acetogenins and storage molecules in the endosperm of Annona macroprophyllata Donn Sm. seeds.

    Science.gov (United States)

    Laguna Hernández, G; Brechú-Franco, A E; De la Cruz-Chacón, I; González-Esquinca, A R

    2015-07-09

    Acetogenins (ACGs) are bioactive compounds with cytotoxic properties in different cell lines. They are antitumoural, antiparasitic, antimalarial, insecticidal, antimicrobial, antifungal and antibacterial. These secondary metabolites function in plant defence and are found in specific organelles and specific cells, thereby preventing toxicity to the plant itself and permitting site-specific defence. The aim of this work was to histochemically determine the in situ localisation of ACGs in the endosperm of Annona macroprophyllata seeds using Kedde's reagent. Additionally, the colocalisation of ACGs with other storage molecules was analysed. The seeds were analysed after 6 and 10 days of imbibition, when 1 or 2 cm of the radicle had emerged and metabolism was fully established. The seeds were then transversally cut in half at the midline and processed using different histological and histochemical techniques. Positive reactions with Kedde's reagent were only observed in fresh, unfixed sections that were preserved in water, and staining was found only in the large cells (the idioblasts) at the periphery of the endosperm. The ACGs' positive reaction with Sudan III corroborated their lipid nature. Paraffin sections stained with Naphthol Blue Black showed reactions in the endosperm parenchyma cells and stained the proteoplasts blue, indicating that they might correspond to storage sites for albumin-like proteins. Lugol's iodine, which is similar in chemical composition to Wagner's reagent, caused a golden brown reaction product in the cytoplasm of the idioblasts, which may indicate the presence of alkaloids. Based on these results, we propose that Kedde's reagent is an appropriate histochemical stain for detecting ACGs in situ in idioblasts and that idioblasts store ACGs and probably alkaloids. ACGs that are located in idioblasts found in restricted, peripheral areas of the endosperm could serve as a barrier that protects the seeds against insects and pathogen attack.

  15. Annona muricata leaves accelerate wound healing in rats via involvement of Hsp70 and antioxidant defence.

    Science.gov (United States)

    Moghadamtousi, Soheil Zorofchian; Rouhollahi, Elham; Hajrezaie, Maryam; Karimian, Hamed; Abdulla, Mahmood Ameen; Kadir, Habsah Abdul

    2015-06-01

    Annona muricata, a member of the Annonaceae family, is commonly known as soursop and graviola. The leaves of this tropical fruit tree are widely used in folk medicine against skin diseases and abscesses, however there is no scientific evidence justifying the use of A. muricata leaves. The aim of the present study is to evaluate the wound healing potential of ethyl acetate extract of A. muricata leaves (EEAM) towards excisional wound models in rats. Sprague Dawley rats (24) were randomly divided into four groups, viz. (A) vehicle control, (B) low dose of EEAM (5% w/w), (C) high dose of EEAM (10% w/w) and (D) positive control with excisional wound created on the neck area. Wounds were topically dressed twice a day for 15 days. On the 15th day, animals were sacrificed and then processed for immunohistochemical and histological evaluations, including Hematoxylin & Eosin and Masson Trichrome stainings. The activity of antioxidants, namely catalase, glutathione peroxidase and superoxide dismutase, and malondialdehyde (MDA) was measured in wound tissue homogenate. Macroscopic and microscopic analysis of wounds demonstrated a significant wound healing activity shown by EEAM at two doses. Treatment of wounds with ointment containing EEAM caused significant surge in antioxidants activities and decrease in the MDA level of wound tissues compared with vehicle control. The immunohistochemical evaluation revealed conspicuous up-regulation of Hsp70 in treated wounds with EEAM, suggesting the anti-inflammatory effect of EEAM. EEAM exhibited a promising wound healing potential towards excisional wound models in rats. Copyright © 2015. Published by Elsevier Ltd.

  16. In Vivo Antimalarial Activity of Annona muricata Leaf Extract in Mice Infected with Plasmodium berghei.

    Science.gov (United States)

    Somsak, Voravuth; Polwiang, Natsuda; Chachiyo, Sukanya

    2016-01-01

    Malaria is one of the most important infectious diseases in the world. The choice for the treatment is highly limited due to drug resistance. Hence, finding the new compounds to treat malaria is urgently needed. The present study was attempted to evaluate the antimalarial activity of the Annona muricata aqueous leaf extract in Plasmodium berghei infected mice. Aqueous leaf extract of A. muricata was prepared and tested for acute toxicity in mice. For efficacy test in vivo, standard 4-day suppressive test was carried out. ICR mice were inoculated with 10(7) parasitized erythrocytes of P. berghei ANKA by intraperitoneal injection. The extracts (100, 500, and 1000 mg/kg) were then given orally by gavage once a day for 4 consecutive days. Parasitemia, percentage of inhibition, and packed cell volume were subsequently calculated. Chloroquine (10 mg/kg) was given to infected mice as positive control while untreated control was given only distilled water. It was found that A. muricata aqueous leaf extract at doses of 100, 500, and 1000 mg/kg resulted in dose dependent parasitemia inhibition of 38.03%, 75.25%, and 85.61%, respectively. Survival time was prolonged in infected mice treated with the extract. Moreover, no mortality to mice was observed with this extract up to a dose of 4000 mg/kg. In conclusion, the A. muricata aqueous leaf extract exerted significant antimalarial activity with no toxicity and prolonged survival time. Therefore, this extract might contain potential lead molecule for the development of a new drug for malaria treatment.

  17. Toxicological evaluation of the lyophilized fruit juice extract of Annona muricata Linn. (Annonaceae) in rodents.

    Science.gov (United States)

    Awodele, Olufunsho; Ishola, Ismail O; Ikumawoyi, Victor O; Akindele, Abidemi J; Akintonwa, Alade

    2013-12-18

    Abstract Background: Annona muricata Linn. (Annonaceae) (AM) fruit juice is widely consumed either raw or after processing in tropical countries because of its very juicy, creamy and sweet character including its medicinal importance. The safety of AM fruit was investigated in Sprague-Dawley rats for acute and 60-day subchronic toxicity effects. Methods: Rats were administered distilled water (DW) and AM daily at doses of 80, 400 and 2000 mg/kg orally for 60 days. At the end of the study, blood samples were assayed for biochemical and hematological parameters. Vital organs were harvested and assessed for antioxidants and histopathology. Results: There was no mortality recorded up to 2000 mg/kg following acute administration. There were no significant changes in vital organ weights and hematological and biochemical parameters. However, significant (p<0.05) reduction in platelet count and packed cell volume was observed at 2000 and 400 mg/kg, respectively, which was reversed after cessation of treatment. Interestingly, subchronic oral administration of AM (80, 400 or 2000 mg/kg) significantly (p<0.001) increased sperm count and motility in comparison to vehicle-treated control. AM long-term treatment induced significant (p<0.05, <0.01 and <0.001) increases in the levels of glutathione, superoxide dismutase (SOD) and catalase, respectively, in the liver and kidney. Conversely, AM (2000 mg/kg) produced significant (p<0.001) increase in malondialdehyde level with decreased (p<0.05) SOD activity in the brain. Conclusions: The study established that AM did not induce any significant toxic effect, indicating that it is safe in rats following oral administration for 60 consecutive days.

  18. Experimental Lachesis muta rhombeata envenomation and effects of soursop (Annona muricata) as natural antivenom.

    Science.gov (United States)

    Cremonez, Caroline Marroni; Leite, Flávia Pine; Bordon, Karla de Castro Figueiredo; Cerni, Felipe Augusto; Cardoso, Iara Aimê; Gregório, Zita Maria de Oliveira; de Souza, Rodrigo Cançado Gonçalves; de Souza, Ana Maria; Arantes, Eliane Candiani

    2016-01-01

    In the Atlantic forest of the North and Northeast regions of Brazil, local population often uses the fruit juice and the aqueous extract of leaves of soursop (Annona muricata L.) to treat Lachesis muta rhombeata envenomation. Envenomation is a relevant health issue in these areas, especially due to its severity and because the production and distribution of antivenom is limited in these regions. The aim of the present study was to evaluate the relevance of the use of soursop leaf extract and its juice against envenomation by Lachesis muta rhombeata. We evaluated the biochemical, hematological and hemostatic parameters, the blood pressure, the inflammation process and the lethality induced by Lachesis muta rhombeata snake venom. We also assessed the action of the aqueous extract of leaves (AmL) and juice (AmJ) from A. muricata on the animal organism injected with L. m. rhombeata venom (LmrV) in the laboratory environment. LmrV induced a decrease of total protein, albumin and glucose; and increase of creatine kinase, aspartate aminotransferase, and urea concentrations. It provoked hemoconcentration followed by reduction of hematocrit, an increase in prothrombin time and partial thromboplastin time and a decrease of the blood pressure. LmrV induced the release of interleukin-6, an increase in neutrophils and changes in the serum protein profile, characteristic of the acute inflammatory process. LD50 values were similar for the groups injected with LmrV and treated or untreated with AmJ and AmL. Both treatments play a role on the maintenance of blood glucose, urea and coagulation parameters and exert a protective action against the myotoxicity. However, they seem to worsen the hypotension caused by LmrV. The treatments with AmJ and AmL present some beneficial actions, but they might intensify some effects of the venom. Therefore, additional studies on A. muricata are necessary to enable its use as natural antivenom for bushmaster snakebite.

  19. Larvicidal activity of Annona senegalensis and Boswellia dalzielii leaf fractions against Aedes aegypti (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Younoussa Lame

    2014-12-01

    Full Text Available The purpose of the present study was to evaluate the larvicidal activity of leaf fractions of Annona senegalensis and Boswellia dalzielii against fourth instar larvae of Aedes aegypti. Fourth instar larvae of Ae. aegypti were exposed for 24 hours to various concentrations (312.5-2500 mg/L of methanolic crude extract and its fractions obtained with n-hexane, chloroform, ethyl-acetate and methanol solvents, following WHO method. The mortalities recorded were subjected to ANOVA test for mean comparison and Probit analysis to determine LC50. Preliminary phytochemical screening test for some components of the plants assessed were also evaluated. The phytochemical screening of the two plants revealed the presence of alkaloids, steroids, phenolic compounds, terpenoids, fats and oils in the crude extracts which, after splitting were most distributed in n-hexane and chloroform fractions. Apart from methanol fraction, all products used showed a significant (P<0.001 concentration-dependent toxicity against Ae. aegypti larvae. The LC50 recorded with crude extract were 759.6 and 830.4 mg/L for A. senegalensis and B. dalzielli respectively. After fractionation, n-hexane and chloroform fractions of A. senegalensis revealed more effective activity than others with CL50 values of 379.3 and 595.2 mg/L respectively. As for B. dalzielli, n-hexane (LC50=537.1 mg/L and chloroform (LC50=585.5 mg/L fractions were also the most effective. These results suggest that the n-hexane and chloroform fractions of these plants as a promising larvicide against Ae. aegypti and can constitute the best basic and vital step in the development of a botanical insecticide source.

  20. UPLC–QTOF–MS and NMR analyses of graviola (Annona muricata leaves

    Directory of Open Access Journals (Sweden)

    Ingrid Vieira Machado de Moraes

    Full Text Available ABSTRACT Graviola leaves (Annona muricata L., Annonaceae are used by some people to try to treat or even cure cancer, even though over-consumption of the fruit, which contains the neurotoxins annonacin and squamocin has caused an atypical form of Parkinson's disease. In previous analyses, the fruits were extracted with methanol under ambient conditions before analyses. In the present study, UPLC–QTOF–MS and NMR were used to analyze freeze-dried graviola leaves that were extracted using dry methanol and ethanol at 100 ºC and 10 MPa (100 atm pressure in a sealed container. Methanol solubilized 33% of the metabolites in the lyophilized leaves. Ethanol solubilized 41% of metabolites in the lyophilized leaves. The concentrations of total phenolic compounds were 100.3 ± 2.8 and 93.2 ± 2.0 mg gallic acid equivalents per g of sample, for the methanolic and ethanolic extracts, respectively. Moreover, the toxicophore (unsaturated γ-lactone that is present in neurotoxic acetogenins was found in the lipophilic portion of this extract. The concentrations of the neurotoxins annonacin and squamocin were found by UPLC–QTOF–MS to be 305.6 ± 28.3 and 17.4 ± 0.89 µg/g-dw, respectively, in the dried leaves. Pressurized methanol solubilized more annonacin and squamocin than ethanol. On the other hand, a hot, aqueous infusion solubilized only 0.213% of the annonacin and too little of the squamocin to be detected. So, graviola leaves contain significant amounts of the neurotoxins annonacin and squamocin, as well as some potentially healthy phenolic compounds. Finally, the potential neurotoxicity of whole leaves in dietary supplements could be much higher than that of a tea (hot aqueous infusion that is made from them.

  1. Synergistic interactions among flavonoids and acetogenins in Graviola (Annona muricata) leaves confer protection against prostate cancer.

    Science.gov (United States)

    Yang, Chunhua; Gundala, Sushma Reddy; Mukkavilli, Rao; Vangala, Subrahmanyam; Reid, Michelle D; Aneja, Ritu

    2015-06-01

    Phytochemical complexity of plant extracts may offer health-promoting benefits including chemotherapeutic and chemopreventive effects. Isolation of 'most-active fraction' or single constituents from whole extracts may not only compromise the therapeutic efficacy but also render toxicity, thus emphasizing the importance of preserving the natural composition of whole extracts. The leaves of Annona muricata, commonly known as Graviola, are known to be rich in flavonoids, isoquinoline alkaloids and annonaceous acetogenins. Here, we demonstrate phytochemical synergy among the constituents of Graviola leaf extract (GLE) compared to its flavonoid-enriched (FEF) and acetogenin-enriched (AEF) fractions. Comparative quantitation of flavonoids revealed enrichment of rutin (~7-fold) and quercetin-3-glucoside (Q-3-G, ~3-fold) in FEF compared to GLE. In vivo pharmacokinetics and in vitro absorption kinetics of flavonoids revealed enhanced bioavailability of rutin in FEF compared to GLE. However, GLE was more effective in inhibiting in vitro prostate cancer proliferation, viability and clonogenic capacity compared to FEF. Oral administration of 100mg/kg bw GLE showed ~1.2-fold higher tumor growth-inhibitory efficacy than FEF in human prostate tumor xenografts although the concentration of rutin and Q-3-G was more in FEF. Contrarily, AEF, despite its superior in vitro and in vivo efficacy, resulted in death of the mice due to toxicity. Our data indicate that despite lower absorption and bioavailability of rutin, maximum efficacy was achieved in the case of GLE, which also comprises of other phytochemical groups including acetogenins that make up its natural complex environment. Hence, our study emphasizes on evaluating the nature of interactions among Graviola leaf phytochemcials for developing favorable dose regimen for prostate cancer management to achieve optimal therapeutic benefits. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions

  2. Antiproliferative activity and caspase enhancement properties of Annona muricata leaves extract against colorectal cancer cells

    Directory of Open Access Journals (Sweden)

    Lili Indrawati

    2016-10-01

    Full Text Available Background: The prevalence of colorectal cancer is rising in Asia including Indonesia. Annona muricata tea leaves, that is traditionally used for maintaining health, and lately being used by cancer patients. The objectives of this study is to investigate its effects in human colorectal cancer cell in vitro and ex vivo.Methods: Thirty patients with colorectal cancer (CRC were enrolled in a randomized double-blind placebo-controlled trial. They were equally divided into two groups: those treated with 300 mg A. muricata leaf extract and placebo daily for 8 weeks. Serum from supplemented CRC patients of both groups was compared for caspase 9 and caspase 8 enhancement activity. Antiproliferative effect of water extract of A. muricata leaves and its fractions were evaluated against colorectal cancer cell line (DLD-1 and COLO 205 compared with 5-fluorouracil and placebo, the dose range was 62.5-2,000 µg/mL. Method used was 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay. Data were analyzed by Mann-Whitney U test. The p value was set at 0.05.Results: Ethanol-soluble fraction of A. muricata leaves extract water extract (ESFAM leaves extract had cytotoxicity effects on DLD-1 as well as COLO 205 cell line, as shown by the lower IC50 compared to 5-fluorouracil and placebo, 20.59 μg/mL and 654.9μg/mL, respectively. Serum of subjects supplemented with extract significantly induced caspase 9 (p=0.001 activity of DLD-1 colorectal cancer cell line, but not for caspase 8 activity (p=0.372.Conclusion: The study's results suggest the cytotoxicity potential of  A. muricata  leaves extract  in in vitro and ex vivo studies.

  3. Mechanical alloying and reactive milling in a high energy planetary mill

    International Nuclear Information System (INIS)

    Jiang Xianjin; Trunov, Mikhaylo A.; Schoenitz, Mirko; Dave, Rajesh N.; Dreizin, Edward L.

    2009-01-01

    Powder refinement in a planetary mill (Retsch PM 400-MA) is investigated experimentally and analyzed using discrete element modeling (DEM). Refinement is defined as the average size of the individual components in a composite powder. The specific milling dose, defined as the product of charge ratio and milling time, is used as an experimental parameter tracking the progress of the material refinement. This parameter is determined experimentally for milling of boron and titanium powders, for which the time of initiation of a self-sustained reaction is measured under different milling conditions. It is assumed that the reaction becomes self-sustaining when the same powder refinement is achieved. The DEM calculations established that the milling balls primarily roll along the milling container's perimeter. The inverse of the rate of energy dissipation resulting from this rolling motion is used as the DEM analog of the specific milling dose. The results correlate well with experimental observations.

  4. GEOMETRICAL CHARACTERIZATION OF MICRO END MILLING TOOLS

    DEFF Research Database (Denmark)

    Borsetto, Francesca; Bariani, Paolo

    /lubricants, milling strategies and controls. Moreover the accuracy of tool geometry directly affects the performance of the milling process influencing the dimensional tolerances of the machined part, the surface topography, the chip formation, the cutting forces and the tool-life. The dimensions of certain...... report is to develop procedures for the geometrical characterization of micro end milling tools in order to define a method suitable for the quality assurance in the micro cutting field....

  5. Mill, Liberty And The Facts Of Life

    OpenAIRE

    Stimson, Shannon C.; Milgate, Murray

    2001-01-01

    This paper examines John Stuart Mill's discussion of economic liberty and individual liberty, and his view of the relationship between the two. It explores how, and how effectively, Mill developed his arguments about the two liberties; reveals the lineages of thought from which they derived; and considers how his arguments were altered by political economists not long after his death. It is argued that the distinction Mill drew between the two liberties provided him with a framework of conc...

  6. Tooling Design of Milling Compounding Machine

    Directory of Open Access Journals (Sweden)

    Shan Wen Ju

    2016-01-01

    Full Text Available Professional tooling design is one of the most important part of the Milling Compounding Machine design. This paper mainly introduces the fundamental process of the tooling Design of Milling Compounding Machine, which includes the choosing of tooling material, the development and the chosen principle of tooling structure, the chosen principle of the milling cutters, and the geometry design of the cutters etc. it has certain significance for the practice production discussed.

  7. Focused ion beam milling of carbon fibres

    International Nuclear Information System (INIS)

    Huson, Mickey G.; Church, Jeffrey S.; Hillbrick, Linda K.; Woodhead, Andrea L.; Sridhar, Manoj; Van De Meene, Allison M.L.

    2015-01-01

    A focused ion beam has been used to mill both individual carbon fibres as well as fibres in an epoxy composite, with a view to preparing flat surfaces for nano-indentation. The milled surfaces have been assessed for damage using scanning probe microscopy nano-indentation and Raman micro-probe analysis, revealing that FIB milling damages the carbon fibre surface and covers surrounding areas with debris of disordered carbon. The debris is detected as far as 100 μm from the milling site. The energy of milling as well as the orientation of the beam was varied and shown to have an effect when assessed by Raman spectroscopy. - Highlights: • Focused ion beam (FIB) milling was used to mill flat surfaces on carbon fibres. • Raman spectroscopy showed amorphous carbon was generated during FIB milling. • The amorphous debris is detected as far as 100 μm from the milling site. • This surface degradation was confirmed by nano-indentation experiments.

  8. Particle deformation during stirred media milling

    Science.gov (United States)

    Hamey, Rhye Garrett

    Production of high aspect ratio metal flakes is an important part of the paint and coating industry. The United States Army also uses high aspect ratio metal flakes of a specific dimension in obscurant clouds to attenuate infrared radiation. The most common method for their production is by milling a metal powder. Ductile metal particles are initially flattened in the process increasing the aspect ratio. As the process continues, coldwelding of metal flakes can take place increasing the particle size and decreasing the aspect ratio. Extended milling times may also result in fracture leading to a further decrease in the particle size and aspect ratio. Both the coldwelding of the particles and the breakage of the particles are ultimately detrimental to the materials performance. This study utilized characterization techniques, such as, light scattering and image analysis to determine the change in particle size as a function of milling time and parameters. This study proved that a fundamental relationship between the milling parameters and particle deformation could be established by using Hertz's theory to calculate the stress acting on the aluminum particles. The study also demonstrated a method by which milling efficiency could be calculated, based on the amount of energy required to cause particle deformation. The study found that the particle deformation process could be an energy efficient process at short milling times with milling efficiency as high as 80%. Finally, statistical design of experiment was used to obtain a model that related particle deformation to milling parameters, such as, rotation rate and milling media size.

  9. Superação da dormência em sementes de atemóia e fruta-do-conde Overcoming atemoya and custard apple seed dormancy

    Directory of Open Access Journals (Sweden)

    Neusa Maria Colauto Stenzel

    2003-08-01

    Full Text Available As anonáceas cultivadas comercialmente têm sido propagadas através de enxertia, sendo o porta-enxerto obtido por sementes. Entretanto, as sementes dessas plantas apresentam substâncias inibidoras de germinação que, juntamente com um tegumento resistente e impermeável, dificultam a germinação. Este trabalho teve como objetivo avaliar a germinação de sementes de fruta-do-conde (Annona squamosa L. e dos cultivares de atemóia 'PR-1', 'PR-3' e 'Gefner' (Annona cherimola Mill. X Annona squamosa L., que foram escarificadas com lixa e submetidas aos seguintes tratamentos por 24 horas: ácido giberélico (GA3 a 50 ppm; GA3 a 100 ppm; água a 5ºC; água a 30ºC. A testemunha não recebeu nenhum tipo de tratamento. As sementes das cultivares de atemóia tratadas a 50 e 100 ppm de GA3 não apresentaram diferença entre si, proporcionando 55 a 67 % de germinação para 'Gefner' e 'PR-3', significativamente superiores aos demais tratamentos, que tiveram de 1 a 21 %. Para 'PR-1' esta diferença também foi verificada, com germinação de 35 a 36 % para os tratamentos com GA3 e 1,25 a 2,5 % para os demais. O tratamento de 50 ppm de GA3 foi significativamente superior aos demais tratamentos para a fruta-do-conde, com 75 % de germinação, enquanto que em 100 ppm de GA3 apresentou 44 % e os demais tiveram de 2,5 a 3,7 %. O índice de velocidade de germinação foi significativamente maior para sementes tratadas com GA3 a 50 e 100 ppm.Annonas are propagated mainly by grafting and rootstocks are obtained usually by seeds. Their seeds have substances that inhibit germination and the seed coat also difficults seedling emergence. This trial evaluated the germination of seeds of custard apple (Annona squamosa L. and of atemoya cultivars 'PR-1', 'PR-3', and 'Gefner' (Annona cherimola Mill. X Annona squamosa L. with treatments as follows (soaking during 24 hours: gibberellic acid (GA3 50 ppm; GA3 100 ppm; water 5ºC; water 30ºC; and control. All treatments

  10. Maximally Supersymmetric Yang-Mills Theory: The Story of N = 4 Yang-Mills Theory

    Science.gov (United States)

    Brink, Lars

    The following sections are included: * History * Dual Models * Supersymmetric Field Theories and Supergravity * Maximally Supersymmetric Yang-Mills Theories * The Light-Cone Gauge Formulation of N = 4 Yang-Mills Theory * The Perturbative Finiteness N = 4 Yang-Mills Theory * References

  11. Considerations Concerning the Dynamics of Vibratory Mills Used in Powders’ Mechanical Milling Process

    Directory of Open Access Journals (Sweden)

    Radu Panaitescu-Liess

    2010-01-01

    Full Text Available Dynamic mechanical milling process in a powder mill was studied by analyzing the vibratory effects of vibration and shock phenomena on the material microstructure ground. During the milling process, there were noticed both distinct modes of ball motion: the one generated by the periodic vibration and the one produced by chaotic vibration.

  12. Pilot experiment to control Medfly, Ceratitis capitata (Wied.) (Diptera: Tephritidae) using mass trapping technique in a custard apple (Annona cherimolia Mill.) orchard

    International Nuclear Information System (INIS)

    Ros, J.P.; Escobar, I.; Garcia Tapia, F.J.; Aranda, G.

    2000-01-01

    Recently, as a result of assays coordinated by the International Atomic Energy Agency (and participated by Spain), it was decided that ammonium acetate, putrescine and trimethylamine be included in low release polyetilene bag dispensers (Biolure, Consep, Co) as the Mediterranean fruit fly (Medfly) females were greatly attracted by them. These synthetic substances are placed in traps at the frequency of one and a half months to two months. If Tephry traps are used, one DDVP wafer (containing Vapona or a similar substance) is enough to kill the flies that enter them. These attractants make it unnecessary to replenish the liquids in the Mcphail traps and remain effective throughout the entire fruit season. The Caja Rural de Granada (a bank of farmers) encourages all techniques that increase crop profits for farmers. It is even more desirable if such crop profitability can be achieved without the application of insecticides which may result in the likely presence of toxic residues. In the light of the results achieved by the attractants with regard to female Medflies, the Caja Rural de Granada, together with the National Institute of Agricultural Research Counselling (Agricultural Department), performed an experiment on mass trapping to confirm whether it is possible to protect a fruit plantation with the application of this biotechnical method. Due to the great risk of this initial experiment, the farmers were free to use insecticides as often as they deemed necessary so that no damages due to any plague could be blamed on the experiment

  13. Yield and Fruit Quality Traits of Atemoya Cultivars Grown in Puerto Rico

    Science.gov (United States)

    The demand for tropical fruits has increased more than 33% during the last decade as consumers seek healthy and more diverse food products. There is a lack of formal experimentation to determine yield performance and fruit quality traits of atemoya (Annona squamosa x A. cherimola) cultivars. Six a...

  14. Dicty_cDB: Contig-U09111-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1( FJ664269 |pid:none) Annona cherimola syntaxin-71 (SYP7... 44 0.011 (Q9SF29) RecName: Full=Syntaxin-71; Sh...ivar-gr... 45 0.009 AM494954_67( AM494954 |pid:none) Leishmania braziliensis chromosom... 44 0.011 FJ664269_

  15. Attraction of pollinators to atemoya (Magnoliales: Annonaceae) in Puerto Rico: A synergetic approach using multiple nitidulid lures

    Science.gov (United States)

    Atemoya, a cross between Annona squamosa and A. cherimola (Annonaceae), has the potential to be a major fruit crop in tropical and subtropical areas. A major setback to production throughout the world is low fruit-set due to inadequate visits by pollinators, typically beetles in the family Nitidulid...

  16. Yield and fruit quality traits of atemoya hybrids grown in Puerto Rico

    Science.gov (United States)

    As consumers seek healthy and more diverse food products the demand for tropical fruits has increased significantly during the past 15 years. There is a lack of formal experimentation to determine yield performance and fruit quality traits of atemoya (Annona squamosa x A. cherimola) hybrids. Six a...

  17. Isolation and characterization of three cyclopeptides from the seeds ...

    African Journals Online (AJOL)

    This paper describes the isolation and structure elucidation of three cytotoxic cyclopeptides, named glaucacyclopeptide B (2), cherimolacyclopeptide G (1) and H (2), from the seeds of Annona glauca and A. cherimola. Techniques used in the structure determination included MS/MS fragmentation using a QTOF mass ...

  18. AcEST: DK951051 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Annona... 271 2e-71 tr|A7QUM9|A7QU...RGGL+K +W+ APFVS Sbjct: 180 FFPNEKPMYLFSSIWNADDWATRGGLEKTDWKKAPFVS 217 >tr|B8XXI5|B8XXI5_ANNCH Xyloglucan endotransglycosylase OS=Ann...ona cherimola GN=XET3 PE=2 SV=1 Length = 294 Score = 271

  19. Dicty_cDB: Contig-U00193-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0_1( EU080840 |pid:none) Phytophthora ipomoeae isolate PD_0... 37 0.29 FJ664264_1( FJ664264 |pid:none) Ann...ona cherimola enolase mRNA, com... 37 0.29 EU080805_1( EU080805 |pid:none) Phytopht

  20. Dicty_cDB: VHH274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1( AY081315 |pid:none) Arabidopsis thaliana 4-alpha-gluca... 88 8e-17 FJ664262_1( FJ664262 |pid:none) Anno...na cherimola disproportionatin... 87 1e-16 AE005176_696( AE005176 |pid:none) Lactoc

  1. Isozymetic Polymorphisms of Mango Cultivars in Bangladesh

    African Journals Online (AJOL)

    user

    2012-10-30

    Oct 30, 2012 ... some exotic varieties under commercial cultivation. For the continuous improvement of mango .... phosphate, dibasic 11.36 g were mixed with 800 ml distilled water. Then, 50 mg of fast blue BB salt was added to ..... avocados, date palms, mango, cherimoyas (Annona cherimola). The specific co-dominant ...

  2. Fatty Acid And Essential Oil Compositions Of The Seed Oil Of Five ...

    African Journals Online (AJOL)

    The fatty acid and essential oil compositions of the seed oil of Annona cherimola, A. muricata, A. reticulata, A. senegalensis and A. squamosa were investigated by GC and GC/MS spectra. About eleven fatty acids were identified of which oleic, gondoic, palmitic and stearic acids predominated in each sample, and others ...

  3. KSC ADVANCED GROUND BASED FIELD MILL V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Advanced Ground Based Field Mill (AGBFM) network consists of 34 (31 operational) field mills located at Kennedy Space Center (KSC), Florida. The field mills...

  4. milled degermed maize products for tropical countries

    African Journals Online (AJOL)

    STORAGESEVER

    2009-01-19

    Jan 19, 2009 ... processing of maize flour, which meets consumer demand for quality and achieves extended shelf life. One traditional soft cultivar was .... duplicate after extraction with 95% ethanol (ISO, 1986) and expressed as mg KOH ..... In addition, the hammer mill appears much more efficient than the disc mill, giving ...

  5. Uranium ore purchase and custom milling agreements

    International Nuclear Information System (INIS)

    Dolan, B.T.

    1976-01-01

    Important considerations involved in structuring agreements for ore sale or other disposition are discussed. Payment provisions in ore purchase agreements and custom milling agreement provisions are considered. Proposed forms of Ore Purchase Agreement and Custom Milling Agreement are included as appendices

  6. Computer-aided design of rolling mills

    Indian Academy of Sciences (India)

    In the design of rolling mills equipment, computer-aided design has been widely used. The available software, which covers both steady state and dynamic analysis of items such as mill stands, drive systems, manipulators, cooling beds, roll cooling, and automatic gauge control systems, is reviewed with special reference to ...

  7. Radiological health aspects of uranium milling

    International Nuclear Information System (INIS)

    Fisher, D.R.; Stoetzel, G.A.

    1983-05-01

    This report describes the operation of conventional and unconventional uranium milling processes, the potential for occupational exposure to ionizing radiation at the mill, methods for radiological safety, methods of evaluating occupational radiation exposures, and current government regulations for protecting workers and ensuring that standards for radiation protection are adhered to. In addition, a survey of current radiological health practices is summarized

  8. ( Rosa damascena Mill.) by microbial inoculation

    African Journals Online (AJOL)

    This study was carried out to determine the effects of microbial inoculation in breaking seed dormancy and on the germination of Rosa damascena Mill. Seeds of R. damascena Mill. are the most used scented rose species in rose oil production. The most important production centers around the world are Turkey and ...

  9. Optimisation of milling parameters using neural network

    Directory of Open Access Journals (Sweden)

    Lipski Jerzy

    2017-01-01

    Full Text Available The purpose of this study was to design and test an intelligent computer software developed with the purpose of increasing average productivity of milling not compromising the design features of the final product. The developed system generates optimal milling parameters based on the extent of tool wear. The introduced optimisation algorithm employs a multilayer model of a milling process developed in the artificial neural network. The input parameters for model training are the following: cutting speed vc, feed per tooth fz and the degree of tool wear measured by means of localised flank wear (VB3. The output parameter is the surface roughness of a machined surface Ra. Since the model in the neural network exhibits good approximation of functional relationships, it was applied to determine optimal milling parameters in changeable tool wear conditions (VB3 and stabilisation of surface roughness parameter Ra. Our solution enables constant control over surface roughness parameters and productivity of milling process after each assessment of tool condition. The recommended parameters, i.e. those which applied in milling ensure desired surface roughness and maximal productivity, are selected from all the parameters generated by the model. The developed software may constitute an expert system supporting a milling machine operator. In addition, the application may be installed on a mobile device (smartphone, connected to a tool wear diagnostics instrument and the machine tool controller in order to supply updated optimal parameters of milling. The presented solution facilitates tool life optimisation and decreasing tool change costs, particularly during prolonged operation.

  10. Airborne effluent control at uranium mills

    International Nuclear Information System (INIS)

    Sears, M.B.

    1976-01-01

    The Oak Ridge National Laboratory has made an engineering cost--environmental benefit study of radioactive waste treatment systems for decreasing the amount of radioactive materials released from uranium ore processing mills. This paper summarizes the results of the study which pertain to the control and/or abatement of airborne radioactive materials from the mill processes. The tailings area is not included. Present practices in the uranium milling industry, with particular emphasis on effluent control and waste management, have been surveyed. A questionnaire was distributed to each active mill in the United States. Replies were received from about 75 percent of the mill operators. Visits were made to six operating uranium mills that were selected because they represented the different processes in use today and the newest, most modern in mill designs. Discussions were held with members of the Region IV Office of NRC and the Grand Junction Office of ERDA. Nuclear Science Abstracts, as well as other sources, were searched for literature pertinent to uranium mill processes, effluent control, and waste management

  11. Radiological health aspects of uranium milling

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.; Stoetzel, G.A.

    1983-05-01

    This report describes the operation of conventional and unconventional uranium milling processes, the potential for occupational exposure to ionizing radiation at the mill, methods for radiological safety, methods of evaluating occupational radiation exposures, and current government regulations for protecting workers and ensuring that standards for radiation protection are adhered to. In addition, a survey of current radiological health practices is summarized.

  12. Preliminary Test of Upgraded Conventional Milling Machine into PC Based CNC Milling Machine

    International Nuclear Information System (INIS)

    Abdul Hafid

    2008-01-01

    CNC (Computerized Numerical Control) milling machine yields a challenge to make an innovation in the field of machining. With an action job is machining quality equivalent to CNC milling machine, the conventional milling machine ability was improved to be based on PC CNC milling machine. Mechanically and instrumentally change. As a control replacing was conducted by servo drive and proximity were used. Computer programme was constructed to give instruction into milling machine. The program structure of consists GUI model and ladder diagram. Program was put on programming systems called RTX software. The result of up-grade is computer programming and CNC instruction job. The result was beginning step and it will be continued in next time. With upgrading ability milling machine becomes user can be done safe and optimal from accident risk. By improving performance of milling machine, the user will be more working optimal and safely against accident risk. (author)

  13. Investigation of the toxic potential of crude ethanol extract of Annona coriacea (araticum seeds in acute exposed mice

    Directory of Open Access Journals (Sweden)

    Guilherme Nobre L. do Nascimento

    2012-01-01

    Full Text Available In this study, Annona coriacea Mart., Annonaceae, was examined for possible toxic effects on brain, liver and kidney of mice exposed to crude extract of the seeds (CESAN of this plant. CESAN was administered by gavage for four days at doses of 12.5, 25, 50, and 100 mg/kg/day. Significant changes on liver were observed, which showed reduction in the number of hepatocytes per area and increase the apoptotic index in the exposed groups, and changes in the cytoplasm and nucleus of these cells and reduced consumption of water and feed in these animals. For the other studied areas, brain and kidneys showed no changes in the parameters used in this study. The results suggest hepatotoxic effects of CESAN, but without damage to brain and kidneys in this experiment, showing a toxic potential to this species, as to the Annonaceae family.

  14. Aporphine alkaloid contents increase with moderate nitrogen supply in Annona diversifolia Saff. (Annonaceae) seedlings during diurnal periods.

    Science.gov (United States)

    Orozco-Castillo, José Agustín; Cruz-Ortega, Rocío; Martinez-Vázquez, Mariano; González-Esquinca, Alma Rosa

    2016-10-01

    Aporphine alkaloids are secondary metabolites that are obtained in low levels from species of the Annonaceae family. Nitrogen addition may increase the alkaloid content in plants. However, previous studies published did not consider that nitrogen could change the alkaloid content throughout the day. We conducted this short-term study to determine the effects of nitrogen applied throughout the diurnal period on the aporphine alkaloids via measurements conducted on the roots, stems and leaves of Annona diversifolia seedlings. The 60-day-old seedlings were cultured with the addition of three levels of nitrogen (0, 30 and 60 mM), and alkaloid extracts were analysed using high-performance liquid chromatography. The highest total alkaloid content was measured in the treatment with moderate nitrogen supply. Further, the levels of aporphine alkaloids changed significantly in the first few hours of the diurnal period. We conclude that aporphine alkaloid content increased with moderate nitrogen supply and exhibited diurnal variation.

  15. Environmental effect of antioxidant additives on exhaust emission reduction in compression ignition engine fuelled with Annona methyl ester.

    Science.gov (United States)

    Senthil, R; Silambarasan, R

    2015-01-01

    The aim of the present study is to analyse the effect of antioxidant l-ascorbic acid on engine performance and emissions of a diesel engine fuelled with methyl ester of Annona oil (MEAO). The antioxidant is mixed in various concentrations (100-400 mg) with MEAO. Result shows that the antioxidant additive mixture (MEAO+LA200) is effective in control of nitrogen oxides (NOx) and hydrocarbon (HC) emission of MEAO-fuelled engine without doing any engine modification. In this study by using MEAO, the NOx emission is reduced by about 23.38% at full load while compared with neat diesel fuel. Likewise there is a reduction in carbon monoxide, smoke, and HC by about 48%, 28.57% and 29.71% at full load condition compared with neat diesel fuel.

  16. Studies on chemical constituents and anti-hepatoma effects of essential oil from Annona squamosa L. pericarps.

    Science.gov (United States)

    Chen, Ya-Yun; Peng, Chen-Xiao; Hu, Yan; Bu, Chen; Guo, Shu-Chen; Li, Xiang; Chen, Yong; Chen, Jian-Wei

    2017-06-01

    Annona squamosa L. fruit played great anti-neoplastic activities. Its pericarps were discarded as waste. In this study, essential oil extracted from A. squamosa L. pericarps (APEO) was obtained by hydrodistillation and analysed by GC-MS. Furthermore, the anti-hepatoma activities and the underlying mechanism of the oil were firstly described. A total of 59 compounds were identified by Gas chromatography-mass spectrometry (GC-MS). The major compound in the oil was (-)-spathulenol (32.51%). The APEO demonstrated anti-hepatoma activity against SMMC-7721 hepatoma cell line with IC 50 lower than 55 μg/mL. At the same time, nucleus shrinkage or broken were found in cells incubated with APEO through fluorescent microscope. In addition, pro-apoptosis and cell cycle arrest effects were confirmed by flow cytometry analysis.

  17. Influence of Compression Ratio on the Performance and Emission Characteristics of Annona Methyl Ester Operated DI Diesel Engine

    Directory of Open Access Journals (Sweden)

    Senthil Ramalingam

    2014-09-01

    Full Text Available This study aims to find the optimum performance and emission characteristics of single cylinder variable compression ratio (VCR engine with different blends of Annona methyl ester (AME as fuel. The performance parameters such as specific fuel consumption (SFC, brake thermal efficiency (BTE, and emission levels of HC, CO, Smoke, and NOx were compared with the diesel fuel. It is found that, at compression ratio of 17: 1 for A20 blended fuel (20% AME + 80% Diesel shows better performance and lower emission level which is very close to neat diesel fuel. The engine was operated with different values of compression ratio (15, 16, and 17 to find out best possible combination for operating engine with blends of AME. It is also found that the increase of compression ratio increases the BTE and reduces SFC and has lower emission without any engine in design modifications.

  18. Renewable Oil Extracted from Indonesian Srikaya’s (Annona squamosa sp. Seed: Another Potent Source for Biodiesel

    Directory of Open Access Journals (Sweden)

    Masruri Masruri

    2012-10-01

    Full Text Available This study looks at the wastes derived from Indonesian fruit as prospect for biofuels. This report investigates the chemical composition of Srikaya (Annona squamosal sp. seed, which is disposed as waste products from traditional markets. The seeds were extracted with various extraction methods and the oil obtained was analysed by means of gas chromatography (GC/FID, gas chromatography-mass spectrometry (GC/MS, infra-red spectrometry and ultra-violet-visible spectrometry. It was found 2 h extraction using soxhlet apparatus with diethyl ether as solvent gave the optimum time extraction. Moreover, five major components were isolated from i.e.: ethyl hexadecanoate, ethyl hexadec-9-enoate, ethyl octadecanoate, 2-hydroxy-1,3-propanediyl hexadecanoate, octadec-9-enaldehyde, and unknown compound, respectively.

  19. Possible mechanisms of action of the hypotensive effect of Annona muricata (soursop) in normotensive Sprague-Dawley rats.

    Science.gov (United States)

    Nwokocha, Chukwuemeka R; Owu, Daniel U; Gordon, Angeline; Thaxter, Karen; McCalla, Garsha; Ozolua, Raymond I; Young, Lauriann

    2012-11-01

    Annona muricata Linn (Annonaceae) (soursop) is a food plant reported to have antihypertensive properties. We investigated the blood pressure reducing effect of its aqueous leaf extract and the possible mechanisms that may be responsible. Intravenous administration of an aqueous leaf extract (9.17-48.5 mg/kg) of A. muricata on the mean arterial pressure and heart rate were recorded invasively on anaesthetized, normotensive Sprague-Dawley rats. Contractile responses of rat aortic rings to the extract (0.5-4.0 mg/mL) were studied using standard organ bath techniques. A. muricata (9.17-48.5 mg/kg) caused significant (p muricata leaf aqueous extract significantly (p muricata are not mediated through muscarinic, histaminergic, adrenergic and nitric oxide pathways, but through peripheral mechanisms involving antagonism of Ca(2+).

  20. Antibacterial effect (in vitro) of Moringa oleifera and Annona muricata against Gram positive and Gram negative bacteria.

    Science.gov (United States)

    Viera, Gustavo Hitzschky Fernandes; Mourão, Jozeanne Alves; Angelo, Angela Maria; Costa, Renata Albuquerque; Vieira, Regine Helena Silva dos Fernandes

    2010-01-01

    Antibacterial effects of aqueous and ethanolic extracts of seeds of moringa (Moringa oleifera) and pods of soursop (Annona muricata) in the concentration of 1:5 and 1:10 in volumes 50, 100, 150 and 200 microL were examined against Staphylococcus aureus, Vibrio cholerae, Escherichia coli (isolated from the organism and the aquatic environment) and Salmonella Enteritidis. Antibacterial activity (inhibition halo > 13 mm) against S. aureus, V. cholerae and E. coli isolated from the whiteleg shrimp, Litopenaeus vannmaei, was detected in aqueous and ethanolic extracts of moringa. E. coli isolated from tilapiafish, Oreochromis niloticus, was sensitive to the ethanolic extract of moringa. The aqueous extracts of soursop showed an antibacterial effect against S. aureus and V. cholerae, but the antibacterial activity by the ethanol extracts of this plant was not demonstrated.

  1. Estimates of repeatability coefficients and the number of the optimum measure to select superior genotypes in Annona muricata L.

    Science.gov (United States)

    Sanchéz, C F B; Alves, R S; Garcia, A D P; Teodoro, P E; Peixoto, L A; Silva, L A; Bhering, L L; Resende, M D V

    2017-09-21

    The aim of this study was to evaluate repeated measures over the years to estimate repeatability coefficient and the number of the optimum measure to select superior genotypes in Annona muricata L. The fruit production was evaluated over 16 years in 71 genotypes without an experimental design. The estimation of variance components and the prediction of the permanent phenotypic value were performed using REML/BLUP proceedings. The coefficient of determination, accuracy, and selective efficiency increased when measures increased. The coefficient of determination of 80% was reached beyond 8 crop seasons with high accuracy and selective efficiency. Thus, the evaluation of 8 crop seasons can be suitable to select superior genotypes in the A. muricata L. breeding program. Predicted selection gain had a high magnitude for fruit production indicating that it is possible to take a progressive genetic advance for this trait over cycle breeding.

  2. Beetle pollination and flowering rhythm of Annona coriacea Mart. (Annonaceae) in Brazilian cerrado: Behavioral features of its principal pollinators.

    Science.gov (United States)

    Costa, Marilza Silva; Silva, Ricardo José; Paulino-Neto, Hipólito Ferreira; Pereira, Mônica Josene Barbosa

    2017-01-01

    The conservation and sustainable management of Annona coriacea requires knowledge of its floral and reproductive biology, and of its main pollinators and their life cycles. In this work, we analyzed these aspects in detail. Floral biology was assessed by observing flowers from the beginning of anthesis to senescence. The visiting hours and behavior of floral visitors in the floral chamber were recorded, as were the sites of oviposition. Excavations were undertaken around specimens of A. coriacea to determine the location of immature pollinators. Anthesis was nocturnal, starting at sunset, and lasted for 52-56 h. The flowers were bisexual, protogynous and emitted a strong scent similar to the plant´s own ripe fruit. There was pronounced synchrony among all floral events (the period and duration of stigmatic receptivity, release of odor, pollen release and drooping flowers) in different individuals, but no synchrony in the same individuals. All of the flowers monitored were visited by beetle species of the genera Cyclocephala and Arriguttia. Beetles arrived at the flowers with their bodies covered in pollen and these pollen grains were transferred to the stigmata while foraging on nutritious tissues at the base of the petals. With dehiscence of the stamens and retention within the floral chamber, the bodies of the floral visitors were again covered with pollen which they carried to newly opened flowers, thus promoting the cycle of pollination. After leaving the flowers, female beetles often excavated holes in the soil to lay eggs. Larvae were found between the leaf litter and the first layer of soil under specimens of A. coriacea. Cyclocephala beetles were the main pollinators of A. coriacea, but Arriguttia brevissima was also considered a pollinator and is the first species of this genus to be observed in Annonaceae flowers. Annona coriacea was found to be self-compatible with a low reproductive efficiency in the area studied. The results of this investigation

  3. Removal of malachite green from aqueous solution by activated carbon prepared from the Annona squmosa seed by adsorption

    Directory of Open Access Journals (Sweden)

    T. Santhi

    2010-12-01

    Full Text Available The use of low -cost, locally available, highly efficient and eco-friendly adsorbents has been investigated as an ideal alternative to the current expensive methods of removing dyes from wastewater. This study investigates the potential use of activated carbon prepared from the Annona squmosa seed for the removal of malachite green (MG dye from simulated wastewater. The effects of different system variables, adsorbent dosage, initial dye concentration, pH and contact time were investigated and optimal experimental conditions were ascertained. The results showed that as the amount of the adsorbent is increased, the percentage of dye removal increase accordingly. Optimum pH value for dye adsorption was 7.0. Maximum dye was sequestered within 50 min from the start of every experiment. The adsorption of malachite green followed the pseudo-second –order rate equation and fits the Langmuir, Freundlich, Dubinin-Radushekevich (D-R and Tempkin equations well. The maximum removal of MG was obtained at pH 7 as 86.11% for adsorbent dose of 0.2 g/ 50 mL and 25 mg L -1 initial dye concentration at room temperature. Furthermore, adsorption kinetics of MG was studied and the rate of adsorption was found to conform to pseudo-second –order kinetics with a good correlation (R2 > 0.99 with intraparticle diffusion as one of the rate determining steps. Activated carbon developed from the Annona squmosa seed can be an attractive option for dye removal from diluted industrial effluents since test reaction made on simulated dyeing wastewater showed better removal percentage of MG.

  4. 1 H qNMR Quantification of Annonaceous Acetogenins in Crude Extracts of Annona muricata L. Fruit Pulp.

    Science.gov (United States)

    Bonneau, Natacha; Cynober, Timothé; Jullian, Jean-Christophe; Champy, Pierre

    2017-07-01

    Annonaceous acetogenins (AAGs) constitute a group of environmental neurotoxins, possibly implicated in sporadic atypical Parkinsonism/dementia complexes. The recent evidencing of complex mixtures of AAGs in edible fruits and derived food products requires efficient and practical analytical tools for an estimation of human exposure. To develop a simple method for the direct quantitation of the majority of AAGs (sub-types 1a and 1b) within crude extracts, using commonly available 1 H-NMR spectrometers, for food control. Method development was carried out on 400 MHz and 300 MHz spectrometers, for routine application on fruits crude extracts of Annona muricata L. The method was validated with annonacin and squamocin as reference compounds. Two internal standards (ISs), fumaric acid and dimethyl fumarate, were successfully used, in deuterated methanol (CD 3 OD) and deuterated chloroform (CDCl 3 ), respectively. Quantitation was carried out using signals corresponding to the deshielded ethylenic protons characterising most AAGs, at δ 7.18 or δ 6.98 ppm in CDCl 3 . The limit of quantification (LOQ) was 2.5 mM, with acceptable accuracy, and the limit of detection (LOD) was 0.5 mM. The AAGs contents measured in seven distinct fruit samples of Annona muricata ranged from 14 μmol to 226 μmol of AAGs per 100 g fresh pulp (i.e. 0.14 mmol to 1.3 mmol of AAGs per fruit). A simple, accurate and specific method for quantification of AAGs content was developed and validated for routine application to fruit pulp crude extracts. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  5. Evaluation of the acute toxicity, phytochemical constituents and anti - ulcer properties of methanolic leaf extract of Annona muricata in mice

    Directory of Open Access Journals (Sweden)

    Valentine Uneojo Omoja

    2014-02-01

    Full Text Available This study investigated the acute toxicity, phytochemical constituents and anti - ulcer properties of methanolic leaf extract of Annona muricata in mice. The anti - ulcer activity was evaluated using absolute ethanol-induced ulcer and aspirin-induced ulcer models in mice. An LD50 of 354.8 +/- 8 mg/kg body weight, bw of the extract was obtained on oral administration. Investigation of the phytochemical constituents of the plant extract revealed the presence of saponins, alkaloids and traces of tannins. All doses of the extract (50, 75 and 100 mg/kg used for the study significantly reduced (p<0.05 the mean number of ulcers in both ulcer models when compared to the untreated group A (10 ml/kg distil water. Optimum antiulcer activity of the extract against absolute ethanol-induced ulcer was noted at 50 mg/kg bw. At this 50 mg/kg, the mean number of ulcers and mean ulcer index of the extract was significantly lower (p<0.05 than that of Cimetidine at 100 mg/kg (3.60 +/- 0.51: 5.00 +/- 0.32; 1.5+/-0.05: 0.98+/-0.03, the treated control group whereas the protective index of the extract was higher than that of cimetidine (50.51 %: 24.24 %. The results obtained from this study strongly suggest that methanolic leaf extract of Annona muricata can be effectively used for the treatment of ulcer in low doses and can provide better therapeutic effect than cimetidine if used in ulcers caused by alcoholism and related agents. [J Intercult Ethnopharmacol 2014; 3(1.000: 37-43

  6. Ellagic acid and Annona muricata in the chemoprevention of HPV-related pre-neoplastic lesions of the cervix

    Science.gov (United States)

    Morosetti, Giulia; Criscuolo, Anna Angela; Santi, Flavia; Perno, Carlo Federico; Piccione, Emilio; Ciotti, Marco

    2017-01-01

    Ellagic acid is a phenolic compound naturally present in nuts and berries. Several studies have demonstrated that this bioactive compound has antioxidant, chemopreventive and antiviral activity. Annona muricata is a type of fruit tree with a long history of traditional use. A number of properties have been attributed to different parts of the plant, including anticancer and antioxidant activities. In the current study, a complex based on ellagic acid, Annona Muricata and antioxidant factors (an ellagic acid complex) was administered to a group of human papilloma virus (HPV) infected women with and without cervical lesions, for 12 months. Its effect on HPV clearance and cervical cytological outcomes was assessed and a group of women with the same clinical features who did not receive the ellagic acid complex served as a control. A positive correlation was observed between intake of ellagic acid complex and negative Pap test following 6 and 12 months of treatment (χ2 test: 0.041 and 0.014, respectively). Women treated with the ellagic acid complex were less likely to be diagnosed with an abnormal Pap smear at 6 months [Odds ratio (OR): 0.39; 95% confidence interval (CI) 0.14–1.06] and 12 months (OR: 0.35; 95% CI 0.13–0.89), compared with the control group. After adjusting for confounding factors including age and smoking habit, this association remained significant. No effect was observed on HPV clearance or viral integration. The data from the current study suggest a protective effect of the ellagic acid complex on cervical cells, possibly through apoptosis, cell cycle arrest and repair mechanisms. PMID:28454338

  7. EFEKTIFITAS TEPUNG DAUN SIRSAK (Annona muricata UNTUK MENGENDALIKAN KUMBANG BUBUK KEDELAI (Callosobruchus analis F. PADA BIJI KEDELAI (Glycine max L.

    Directory of Open Access Journals (Sweden)

    Yos Wahyu Harinta

    2013-09-01

    Full Text Available Penelitian bertujuan untuk : mengetahui pengaruh tepung daun sirsak terhadap pengendalian hama Callosobruchus analis pada biji kedelai. Penelitian ini dilaksanakan secara eksperimen, yang terdiri dari dua tahap, 1.Efektifitas tepung daun sirsak terhadap mortalitas kumbang C. analis dan peletakan telur dan 2. Pengaruh tepung daun sirsak terhadap perkembangan populasi kumbang C. analis. Penelitian menggunakan Rancangan Lengkap ( RAL/CRD .  Sebagai perlakuan adalah : ( A Tepung daun sirsak , dosis 1 g / 100 g; ( B Tepung daun sirsak, dosis 0,50 g / 100 g. ; C Tepung daun sirsak , dosis 0,25 g / 100 g.  D Kontrol / Tanpa Perlakuan.  Tiap Perlakuan diulang lima kali. Cara kerja penelitian, adalah : perbanyakan Kumbang Bubuk Kedelai ( C. analis, pembuatan  tepung daun sirsak ( Annona muricata dan pengaruh perlakuan tepung daun sirsak terhadap mortalitas kumbang C. analis dan perkembangan kumbang C.analis, persentase kerusakan biji dan penyusutan bobot biji.  Hasil penelitian menunjukkan bahwa : tepung daun sirsak berpengaruh terhadap mortalitas dan perkembangan C. analis pada biji kedelai ; tepung daun sirsak dapat mengurangi terhadap kerusakan dan penyusutan bobot biji kedelai terhadap serangan C. analis; belum didapat dosis tepung daun sirsak yang efektif untuk mengendalikan kumbang C.analis. Dari hasil penelitian, dapat disimpulkan bahwa : tepung daun sirsak mulai dosis 0,5 g / 100 g biji dapat berpengaruh terhadap peningkatan mortalitas dan penurunan perkembangan kumbang bubuk kedelai (Callosobruchus analis F. pada biji kedelai serta dapat mengurangi kerusakan dan penyusutan bobot biji kedelai akibat serangan kumbang bubuk kedelai (Callosobruchus analis F. di penyimpanan.Kata kunci : tepung daun sirsak (Annona muricata; kumbang bubuk kedelai (Callosobruchus analis F.

  8. Chronic consumption of Annona muricata juice triggers and aggravates cerebral tau phosphorylation in wild-type and MAPT transgenic mice.

    Science.gov (United States)

    Rottscholl, Robert; Haegele, Marlen; Jainsch, Britta; Xu, Hong; Respondek, Gesine; Höllerhage, Matthias; Rösler, Thomas W; Bony, Emilie; Le Ven, Jessica; Guérineau, Vincent; Schmitz-Afonso, Isabelle; Champy, Pierre; Oertel, Wolfgang H; Yamada, Elizabeth S; Höglinger, Günter U

    2016-11-01

    In the pathogenesis of tauopathies, genetic and environmental factors have been identified. While familial clustering led to the identification of mutations in MAPT encoding the microtubule-associated protein tau, the high incidence of a sporadic tauopathy endemic in Guadeloupe was linked to the plant-derived mitochondrial complex I inhibitor annonacin. The interaction of both factors was studied in the present work in a realistic paradigm over a period of 12 months. Mice over-expressing either human wild-type tau or R406W mutant tau as well as non-transgenic mice received either regular drinking water or commercially available tropical fruit juice made of soursop (Annona muricata L.) as dietary source of neurotoxins. HPLC-MS analysis of this juice identified several Annonaceous acetogenins, mainly annonacin (16.2 mg/L), and 41 isoquinoline alkaloids (18.0 mg/L, mainly asimilobine and reticuline). After 12 month of juice consumption, several brain regions showed an increased number of neurons with phosphorylated tau in the somatodendritic compartment of R406W mice and, to a much lesser extent, of non-transgenic mice and mice over-expressing human wild-type tau. Moreover, juice drinking was associated with a reduction in synaptophysin immunoreactivity, as well as an increase in 3-nitrotyrosine (3NT) reactivity in all three genotypes. The increase in 3NT suggests that Annona muricata juice promotes the generation of reactive nitrogen species. This study provides first experimental evidence that long-lasting oral ingestion of a widely consumed environmental factor can induce somatodendritic accumulation of hyperphosphorylated tau in mice expressing rodent or human wild-type tau, and can accelerate tau pathology in R406W-MAPT transgenic mice. © 2016 International Society for Neurochemistry.

  9. Ellagic acid and Annona muricata in the chemoprevention of HPV-related pre-neoplastic lesions of the cervix.

    Science.gov (United States)

    Morosetti, Giulia; Criscuolo, Anna Angela; Santi, Flavia; Perno, Carlo Federico; Piccione, Emilio; Ciotti, Marco

    2017-03-01

    Ellagic acid is a phenolic compound naturally present in nuts and berries. Several studies have demonstrated that this bioactive compound has antioxidant, chemopreventive and antiviral activity. Annona muricata is a type of fruit tree with a long history of traditional use. A number of properties have been attributed to different parts of the plant, including anticancer and antioxidant activities. In the current study, a complex based on ellagic acid, Annona Muricata and antioxidant factors (an ellagic acid complex) was administered to a group of human papilloma virus (HPV) infected women with and without cervical lesions, for 12 months. Its effect on HPV clearance and cervical cytological outcomes was assessed and a group of women with the same clinical features who did not receive the ellagic acid complex served as a control. A positive correlation was observed between intake of ellagic acid complex and negative Pap test following 6 and 12 months of treatment (χ 2 test: 0.041 and 0.014, respectively). Women treated with the ellagic acid complex were less likely to be diagnosed with an abnormal Pap smear at 6 months [Odds ratio (OR): 0.39; 95% confidence interval (CI) 0.14-1.06] and 12 months (OR: 0.35; 95% CI 0.13-0.89), compared with the control group. After adjusting for confounding factors including age and smoking habit, this association remained significant. No effect was observed on HPV clearance or viral integration. The data from the current study suggest a protective effect of the ellagic acid complex on cervical cells, possibly through apoptosis, cell cycle arrest and repair mechanisms.

  10. Environmental planning in uranium milling

    International Nuclear Information System (INIS)

    Bertello, L.F.

    1987-01-01

    Effluents from uranium milling in the Achala region in the province of Cordoba are studied. Liquids from lixiviation-recovery and from precipitation-washing of yellow-cake were analyzed. Separation of both liquids before treatment and disposal is recommended. Data of the hydric environment are presented specially for volumes of flow. The disposal criteria established by the provincial authorities are presented, and discussed. Calculations to define the effects on the environment of two types of effluents (the leaching effluent without treatment and the same after treating it) on two points of the rivers net, are given and the results discussed. A disposal policy for a treated effluent of mean composition is presented, based on two different amounts for the two phases of the river flux; the possible effects on two points of the net were also calculated. In the author's opinion, such policy will result in a disposal without a sensible damage in the receptor. (Author) [es

  11. Repellent activity of the creams formulated from Annona senegalensis and Boswellia dalzielii leaf fractions and essential oils against Anopheles gambiae (Diptera: Culicidae)

    OpenAIRE

    Lame Younoussa; Elias Nchiwan Nukenine; Simon Pierre Yinyang Danga; Charles Okechukwu Esimone

    2016-01-01

    Objective: To investigate the repellent efficacy of the creams formulated from methanol extract and n-hexane, chloroform, ethyl acetate and methanol fractions as well as essential oils of Annona senegalensis (A. senegalensis) and Boswellia dalzielii (B. dalzielii) leaves against the malarial vector Anopheles gambiae (An. gambiae) in the laboratory. Methods: The efficacies of 25% w/w active ingredient creams formulated from the plant-based products were tested. Different concent...

  12. Gastroprotective activity of Annona muricata leaves against ethanol-induced gastric injury in rats via Hsp70/Bax involvement

    OpenAIRE

    Moghadamtousi SZ; Rouhollahi E; Karimian H; Fadaeinasab M; Abdulla MA; Kadir HA

    2014-01-01

    Soheil Zorofchian Moghadamtousi,1 Elham Rouhollahi,2 Hamed Karimian,2 Mehran Fadaeinasab,3 Mahmood Ameen Abdulla,2 Habsah Abdul Kadir1 1Biomolecular Research Group, Biochemistry Program, Institute of Biological Sciences, Faculty of Science, 2Department of Biomedical Science, Faculty of Medicine, 3Department of Chemistry, Faculty of Science, University of Malaya, Kuala Lumpur, Malaysia Abstract: The popular fruit tree of Annona muricata L. (Annonaceae), known as soursop and graviola, is a wi...

  13. Functional proteomic analysis revels that the ethanol extract of Annona muricata L. induces liver cancer cell apoptosis through endoplasmic reticulum stress pathway.

    Science.gov (United States)

    Liu, Na; Yang, Hua Li; Wang, Pu; Lu, Yu Cheng; Yang, Ying Juan; Wang, Lan; Lee, Shao Chin

    2016-08-02

    Annona muricata L. is used to treat cancer in some countries. Extracts of Annona muricata have been shown to cause apoptosis of various cancer cells in vitro, and inhibit tumor growth in vivo in animal models. However, the molecular mechanisms underlying its anti-cancer and apoptotic effects of the herb remain to be explored. The study investigated the molecular mechanisms underlying liver cancer cell apoptosis triggered by the ethanol extract of leaves of Annona muricata L. Liver cancer HepG2 cells were used as experimental model. MTT assay was employed to evaluate cell viability. Flow cytometry and TUNEL assays were performed to confirm apoptosis. We employed functional proteomic analysis to delineate molecular pathways underlying apoptosis triggered by the herbal extract. We showed that the extract was able to reduce viability and trigger apoptosis of the cancer cells. Proteomic analysis identified 14 proteins associated with the extract-elicited apoptosis, which included the increased expression levels of HSP70, GRP94 and DPI-related protein 5. Western blot analysis confirmed that the extract did up-regulated the protein levels of HSP70 and GRP94. Results from bioinformatic annotation pulled out two molecular pathways for the extract, which, notably, included endoplasmic reticulum (ER) stress which was evidenced by the up-regulation of HSP70, GRP94 and PDI-related protein 5. Further examinations of typical protein signaling events in ER stress using western blot analysis have shown that the extract up-regulated the phorsphorelation of PERK and eIF2α as well as the expression level of Bip and CHOP. Our results indicate that the ethanol extract of leaves of Annona muricata L. causes apoptosis of liver cancer cells through ER stress pathway, which supports the ethnomedicinal use of this herb as an alternative or complementary therapy for cancer. Copyright © 2016 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.

  14. Effects of Methanolic Extracts of Annona Species on the Development and Reproduction of Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae).

    Science.gov (United States)

    Freitas, A F; Pereira, F F; Formagio, A S N; Lucchetta, J T; Vieira, M C; Mussury, R M

    2014-10-01

    Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae) causes significant losses in corn crops and necessitates the use of alternative control strategies, such as the application of bioinsecticides. We report the effect of methanolic leaf extracts of Annona dioica, Annona cacans, and Annona coriacea on the development and reproduction of S. frugiperda. A quantitative analysis was carried out to determine the total concentration of phenolics, flavonoids, and condensed tannin (CT) in leaf extracts. Corn leaves were immersed in a 1% methanolic leaf extract solution and fed to second instars of S. frugiperda. Leaf disks dipped in the synthetic insecticide Connect® (Bayer CropScience Ltda) composed of a neonicotinoid (imidacloprid) and a pyrethroid (β-cyfluthrin), which are harmful to S. frugiperda, was used as positive control. Distilled water was used as a negative control treatment. The leaf extract of A. coriacea decreased larval survivorship, arrested pupal development, and affected the weight gain of S. frugiperda. A. dioica also affected larval survivorship, but its effects were more pronounced for the adult stage, as fecundity, fertility, egg hatchability, and embryonic development were severely affected. Leaf extracts from A. cacans had no effect on S. frugiperda. The leaf extracts of A. dioica and A. coriacea showed a higher content of flavonoids and phenols, respectively. Our results indicated that both A. dioica and A. coriacea have the potential for development as botanical insecticides.

  15. Synergistic Cytotoxicity Effect by Combination Treatment of Polyketide Derivatives from Annona muricata Linn Leaves and Doxorubicin as Potential Anticancer Material on Raji Cell Line

    Science.gov (United States)

    Artanti, A. N.; Astirin, O. P.; Prayito, A.; Fisma, R.; Prihapsara, F.

    2018-03-01

    Nasopharynx cancer is one of the most deadly cancer. The main priority of nasopharynx cancer treatment is the use of chemotherapeutic agents, especially doxorubicin. However, doxorubicin might also lead to diverse side effect. An approach recently develop to overcome side effect of doxorubicin is to used of combined chemotherapeutic agent. One of the compounds found effication as an anticancer agent on nasopharynx cancer is acetogenin, a polyketide compound that is abundant in Annona muricata L. leaves. This study has been done to examine polyketide derivatives was isolated from Annona muricata L. which has potency to induce apoptosis by p53 expression on raji cell line. The determination of cytotoxic combination activity from polyketide derivative and doxorubicin was evaluated using MTT assay to obtain the value of CI (combination index). Data analysis showed that combination of polyketide derivative from Annona muricata L. (14,4 µg/ml) and doxorubicin with all of concentration performed synergistic effect on raji cell line with CI value from 0.13 – 0.65.

  16. Environmental design of a uranium mill

    International Nuclear Information System (INIS)

    Quan, C.H.; Ring, R.J.; McNaughton, S.J.

    2002-01-01

    In the frame work of the Cleaner Technology Project for Uranium Mining and Milling, Australian Nuclear and Technology Organization (ANSTO), Environment Division of ANSTO has carried out a programme of research which seeks to identify, investigate and develop cleaner technologies that have the potential to minimize the environmental impact of uranium mining and milling. This paper describes three design options of a new uranium mill that can meet environmental, technical and economical objectives. The feasibility of such an approach was examined in the laboratory and in a pilot plant study. (author)

  17. Coal Moisture Estimation in Power Plant Mills

    DEFF Research Database (Denmark)

    Andersen, Palle; Bendtsen, Jan Dimon; Pedersen, Tom S.

    2009-01-01

    Knowledge of moisture content in raw coal feed to a power plant coal mill is of importance for efficient operation of the mill. The moisture is commonly measured approximately once a day using offline chemical analysis methods; however, it would be advantageous for the dynamic operation...... of the plant if an on-line estimate were available. In this paper we such propose an on-line estimator (an extended Kalman filter) that uses only existing measurements. The scheme is tested on actual coal mill data collected during a one-month operating period, and it is found that the daily measured moisture...

  18. Supersymmetric Proca-Yang-Mills System

    OpenAIRE

    Sezgin, Ergin; Wulff, Linus

    2012-01-01

    We determine the off-shell N=1 supersymmetry transformation rules for a tensor-Yang-Mills system in which the tensor field transforms in a nontrivial representation of the Yang-Mills group, and there is an additional vector multiplet in the same representation. We then show that this system describes a massive tensor multiplet coupled to Yang-Mills in which the additional vector multiplet is eaten by the tensor field. Next, we construct an action which consists of four separately off-shell su...

  19. Gaps of F-Yang-Mills fields on submanifolds

    OpenAIRE

    Jia, Gao-Yang; Zhou, Zhen-Rong

    2012-01-01

    Replacing the integrand of the Yang-Mills functional by F (||R∇||2/2), we define an F-Yang-Mills functional, and hence F-Yang-Mills fields, where F is a non-negative function. The gaps of F-Yang-Mills fields on some submanifolds of the Euclidean spaces and the spheres are investegated in this paper.

  20. Rough mill simulator version 3.0: an analysis tool for refining rough mill operations

    Science.gov (United States)

    Edward Thomas; Joel Weiss

    2006-01-01

    ROMI-3 is a rough mill computer simulation package designed to be used by both rip-first and chop-first rough mill operators and researchers. ROMI-3 allows users to model and examine the complex relationships among cutting bill, lumber grade mix, processing options, and their impact on rough mill yield and efficiency. Integrated into the ROMI-3 software is a new least-...

  1. Uranium Mill and ISL Facility Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — An Excel database on NRC and Agreement State licensed mills providing status, locational/operational/restoration data, maps, and environmental reports including...

  2. Expansion of Einstein-Yang-Mills amplitude

    Science.gov (United States)

    Fu, Chih-Hao; Du, Yi-Jian; Huang, Rijun; Feng, Bo

    2017-09-01

    In this paper, we study from various perspectives the expansion of tree level single trace Einstein-Yang-Mills amplitudes into linear combination of color-ordered Yang-Mills amplitudes. By applying the gauge invariance principle, a programable recursive construction is devised to expand EYM amplitude with arbitrary number of gravitons into EYM amplitudes with fewer gravitons. Based on this recursive technique we write down the complete expansion of any single trace EYM amplitude in the basis of color-order Yang-Mills amplitude. As a byproduct, an algorithm for constructing a polynomial form of the BCJ numerator for Yang-Mills amplitudes is also outlined in this paper. In addition, by applying BCFW recursion relation we show how to arrive at the same EYM amplitude expansion from the on-shell perspective. And we examine the EYM expansion using KLT relations and show how to evaluate the expansion coefficients efficiently.

  3. Holography and noncommutative yang-mills theory

    Science.gov (United States)

    Li; Wu

    2000-03-06

    In this Letter a recently proposed gravity dual of noncommutative Yang-Mills theory is derived from the relations between closed string moduli and open string moduli recently suggested by Seiberg and Witten. The only new input one needs is a simple form of the running string tension as a function of energy. This derivation provides convincing evidence that string theory integrates with the holographical principle and demonstrates a direct link between noncommutative Yang-Mills theory and holography.

  4. Olive Mill wastewater bioremediation towards detoxification

    OpenAIRE

    Paixão, Susana M.; Ribeiro, Belina; Sàágua, M. C.; Baeta-Hall, Lina; Correia, Anabela; Duarte, José Cardoso

    2011-01-01

    Olive oil production is a traditional agricultural industry in Mediterranean countries and Portugal is one of the ten major producers. This industry generates an effluent, olive mill wastewater (OMW), which does not undergo any treatment and, usually, is stored in evaporation lagoons or spread on the land. Disposal of olive oil mill wastewaters is a serious environmental problem due to its high organic loading, presence of polyphenols and tannins, high content in suspended solids and acidity,...

  5. The Yang-Mills Mass Gap Solution

    Science.gov (United States)

    Yablon, Jay R.

    2014-03-01

    The Yang-Mills Mass Gap problem is solved by deriving SU(3)C Chromodynamics as a corollary theory from Yang-Mills gauge theory. The mass gap is filled from finite non-zero eigenvalues of a configuration space inverse perturbation tensor containing vacuum excitations. This results from carefully developing six equivalent views of Yang-Mills gauge theory as having: 1) non-commuting (non-Abelian) gauge fields; 2) gauge fields with non-linear self-interactions; 3) a ``steroidal'' minimal coupling; 4) perturbations; 5) curvature in the gauge space of connections; and 6) gauge fields related to source currents through an infinite recursive nesting. Based on combining classical Yang-Mills electric and magnetic source field equations into a single equation, confinement results from showing how magnetic monopoles of Yang-Mills gauge theory exhibit color confinement and meson flow and have all the color symmetries of baryons, from which we conclude that they are one and the same as baryons. Chiral symmetry breaking results from the recursive behavior of these monopoles coupled with viewing Dirac's gamma matrices as Hamiltonian quaternions extended into spacetime. Finally, with aid from the ``steroidal'' view, the recursive view of Yang-Mills enables polynomial gauge field terms in the Yang-Mills action to be stripped out and replaced by polynomial source current terms prior to path integration. This enables an exact analytical calculation of a non-linear path integral using a closed recursive kernel and yields a non-linear quantum amplitude also with a closed recursive kernel, thus proving the existence of a non-trivial relativistic quantum Yang-Mills field theory on R4 for any simple gauge group G.

  6. VOC Control in Kraft Mills; FINAL

    International Nuclear Information System (INIS)

    Zhu, J.Y.; Chai, X.-S.; Edwards, L.L.; Gu, Y.; Teja, A.S.; Kirkman, A.G.; Pfromm, P.H.; Rezac, M.E.

    2001-01-01

    The formation of volatile organic compounds (VOCs), such as methanol, in kraft mills has been an environmental concern. Methanol is soluble in water and can increase the biochemical oxygen demand. Furthermore, it can also be released into atmosphere at the process temperatures of kraft mill-streams. The Cluster Rule of the EPA now requires the control of the release of methanol in pulp and paper mills. This research program was conducted to develop a computer simulation tool for mills to predict VOC air emissions. To achieve the objective of the research program, much effort was made in the development of analytical techniques for the analysis of VOC and determination of vapor liquid partitioning coefficient of VOCs in kraft mill-streams using headspace gas chromatography. With the developed analytical tool, methanol formation in alkaline pulping was studied in laboratory to provide benchmark data of the amount of methanol formation in pulping in kraft mills and for the validation of VOC formation and vapor-liquid equilibrium submodels. Several millwide air and liquid samplings were conducted using the analytical tools developed to validate the simulation tool. The VOC predictive simulation model was developed based on the basic chemical engineering concepts, i.e., reaction kinetics, vapor liquid equilibrium, combined with computerized mass and energy balances. Four kraft mill case studies (a continuous digester, two brownstock washing lines, and a pre-evaporator system) are presented and compared with mill measurements. These case studies provide valuable, technical information for issues related to MACT I and MACT II compliance, such as condensate collection and Clean-Condensate-Alternatives (CCA)

  7. The Microbiology of Olive Mill Wastes

    Science.gov (United States)

    Ntougias, Spyridon; Bourtzis, Kostas

    2013-01-01

    Olive mill wastes (OMWs) are high-strength organic effluents, which upon disposal can degrade soil and water quality, negatively affecting aquatic and terrestrial ecosystems. The main purpose of this review paper is to provide an up-to-date knowledge concerning the microbial communities identified over the past 20 years in olive mill wastes using both culture-dependent and independent approaches. A database survey of 16S rRNA gene sequences (585 records in total) obtained from olive mill waste environments revealed the dominance of members of Alphaproteobacteria, Betaproteobacteria, Gammaproteobacteria, Firmicutes, and Actinobacteria. Independent studies confirmed that OMW microbial communities' structure is cultivar dependant. On the other hand, the detection of fecal bacteria and other potential human pathogens in OMWs is of major concern and deserves further examination. Despite the fact that the degradation and detoxification of the olive mill wastes have been mostly investigated through the application of known bacterial and fungal species originated from other environmental sources, the biotechnological potential of indigenous microbiota should be further exploited in respect to olive mill waste bioremediation and inactivation of plant and human pathogens. The implementation of omic and metagenomic approaches will further elucidate disposal issues of olive mill wastes. PMID:24199199

  8. Effects of Dry-Milling and Wet-Milling on Chemical, Physical and Gelatinization Properties of Rice Flour

    Directory of Open Access Journals (Sweden)

    Jitranut Leewatchararongjaroen

    2016-09-01

    Full Text Available Rice flour from nine varieties, subjected to dry- and wet-milling processes, was determined for its physical and chemical properties. The results revealed that milling method had an effect on properties of flour. Wet-milling process resulted in flour with significantly lower protein and ash contents and higher carbohydrate content. Wet-milled flour also tended to have lower lipid content and higher amylose content. In addition, wet-milled rice flour contained granules with smaller average size compared to dry-milled samples. Swelling power at 90 °C of wet-milled samples was higher while solubility was significantly lower than those of dry-milled flour. Dry milling process caused the destruction of the crystalline structure and yielded flour with lower crystallinity compared to wet-milling process, which resulted in significantly lower gelatinization enthalpy.

  9. Fertilización en frutales con énfasis en el cultivo de guanábano Annona muricata L. Fruit tree fertilization with enmphasis on soursop Annona muricata L.

    Directory of Open Access Journals (Sweden)

    Zárate Reyes Rubén Darío

    1990-12-01

    Full Text Available Se da la información general sobre la importancia de los frutales y específicamente del guanábano (Annona muricata L.. Se relacionan los elementos nutricionales indispensables para los frutales y sus funciones. Se describe el proceso de absorción de agua y nutrientes. Se plantean los casos de sinergismo y antagonismo y su importancia en la fertilización de las especies frutícolas. Se aclara lo relativo a la distribución del fertilizante y la respuesta de la planta. Se discute sobre el mecanismo de absorción foliar. Se relacionan las dificultades para determinar los requerimientos nutricionales en frutales y aplicar la Ley de Restitución. Se precisa que en guanábano el orden posible de requerimientos nutricionales es K > N > Ca > P > Mg. Se describen los síntomas de deficiencias de N, P, K, Ca, Mg y S en plántulas de guanábano en soluciones nutritivas y se comparan los análisis de tejidos de plantas con síntomas y plantas en el campo. Se determinan como etapas importantes para fertilizar guanábano: vivero, transplante, desarrollo en huerto y etapa productiva. Se dan recomendaciones generales para cada una de ellas. Se hacen recomendaciones con base en el diámetro de la copa del árbol y la profundidad de raíces; el contenido de M.O, de P205 y K2O del suelo y la edad de los árboles y la región donde se establezca el cultivo.A general survey of the importance of fruit crops, especially soursop (Annona muricata L. is presented. The roles of essential elements and water absortion are described chemical synergisms and antagonisms are discussed in relation to plant nutrition. The absortion mechanism is discussed, so are the difficulties te determine nutritional requirements’ in fruit trees in order to apply the restitution law. Priority of elernent absortion is probably K > N > Ca > P > Mg. Deficiency sympton as they appear in nutrient solutions and in the field are described for seedlings and mature trees and are related to

  10. Influence of rice sample preparation and milling procedures on milling quality appraisals

    Science.gov (United States)

    The objective of this research was to investigate the effect of sample preparation and milling procedure on milling quality appraisals of rough rice. Samples of freshly harvested medium-grain rice (M202) with different initial moisture contents (MCs) ranging from 20.2% to 25.1% (w.b.) were used for...

  11. Improving milling and production of a dust-producing unit equipped with hammer mills

    Energy Technology Data Exchange (ETDEWEB)

    Vorotnikov, Ye.G.; Nikiforov, A.A.; Rasputin, O.V.; Sukhunin, V.I.

    1982-01-01

    This paper presents generalized experience for deriving coarse ground coal dust in hammer mills by providing comparison data on improving efficiency of operation of the unit when switching to a coarser-type grind of the fuel. Need to have more precise formulas to calculate grinding potential of hammer mills when using a coarser grind is shown.

  12. Recent Developments with Degree Mills: Accreditation Mills and Counterfeit Diploma and Transcript Operations

    Science.gov (United States)

    Ezell, Allen

    2009-01-01

    This article updates developments regarding Diploma Mills, Accreditation Mills, and Counterfeit Diploma & Transcript operations. It will cover identification & prosecution, to new entities now appearing in these growth industries with annual revenues over one billion dollars. This article will address federal and state laws, a new Federal…

  13. Learning Activity Packets for Milling Machines. Unit I--Introduction to Milling Machines.

    Science.gov (United States)

    Oklahoma State Board of Vocational and Technical Education, Stillwater. Curriculum and Instructional Materials Center.

    This learning activity packet (LAP) outlines the study activities and performance tasks covered in a related curriculum guide on milling machines. The course of study in this LAP is intended to help students learn to identify parts and attachments of vertical and horizontal milling machines, identify work-holding devices, state safety rules, and…

  14. Reclamation of uranium mining and milling disturbances

    International Nuclear Information System (INIS)

    Farmer, E.E.; Schuman, G.E.

    1987-01-01

    Since 1945 the history of uranium mining and milling in the US has been a story of wide fluctuations in market prices and in mining and milling capacity. The late 1960's and the 1970's saw a sizeable reduction in the production of yellowcake because of an earlier over-supply, a leveling off of the military demand, and a failure of the nuclear electric power industry to create the anticipated commercial demand. The decline in the domestic production of yellowcake has continued through the early 1980's to the present. Today, there are five operating uranium mills in the US: one in Wyoming, two in Utah, one in New Mexico, and one in Texas. Of these five mills, three are operating on a reduced schedule, as little as three days a month. A significant portion of the current US production of uranium goes overseas to fulfill Japanese, French, and other European contracts. There is still a sizeable reclamation job to be accomplished on old uranium wastes, both tailings impoundments and overburden embankments. Before the Uranium Mill Tailings Control Act of 1978 (PL 95-604), reclamation was frequently omitted altogether, or else done in a haphazard fashion. We do not know the total area of unreclaimed, radioactive, uranium overburden wastes in the western US, but the area is large, probably several thousand hectares. Fortunately, these overburden wastes are almost entirely located in remote areas. Mill tailings are more difficult to reclaim than overburden, and tailings represent a more serious health hazards. There are approximately 25 million metric tons of unreclaimed uranium mill tailings, with variable health hazards, located in the US

  15. Beetle pollination and flowering rhythm of Annona coriacea Mart. (Annonaceae in Brazilian cerrado: Behavioral features of its principal pollinators.

    Directory of Open Access Journals (Sweden)

    Marilza Silva Costa

    Full Text Available The conservation and sustainable management of Annona coriacea requires knowledge of its floral and reproductive biology, and of its main pollinators and their life cycles. In this work, we analyzed these aspects in detail. Floral biology was assessed by observing flowers from the beginning of anthesis to senescence. The visiting hours and behavior of floral visitors in the floral chamber were recorded, as were the sites of oviposition. Excavations were undertaken around specimens of A. coriacea to determine the location of immature pollinators. Anthesis was nocturnal, starting at sunset, and lasted for 52-56 h. The flowers were bisexual, protogynous and emitted a strong scent similar to the plant´s own ripe fruit. There was pronounced synchrony among all floral events (the period and duration of stigmatic receptivity, release of odor, pollen release and drooping flowers in different individuals, but no synchrony in the same individuals. All of the flowers monitored were visited by beetle species of the genera Cyclocephala and Arriguttia. Beetles arrived at the flowers with their bodies covered in pollen and these pollen grains were transferred to the stigmata while foraging on nutritious tissues at the base of the petals. With dehiscence of the stamens and retention within the floral chamber, the bodies of the floral visitors were again covered with pollen which they carried to newly opened flowers, thus promoting the cycle of pollination. After leaving the flowers, female beetles often excavated holes in the soil to lay eggs. Larvae were found between the leaf litter and the first layer of soil under specimens of A. coriacea. Cyclocephala beetles were the main pollinators of A. coriacea, but Arriguttia brevissima was also considered a pollinator and is the first species of this genus to be observed in Annonaceae flowers. Annona coriacea was found to be self-compatible with a low reproductive efficiency in the area studied. The results of this

  16. Efeito de citocininas na senescência e abscisão foliar durante o cultivo in vitro de Annona glabra L. Effect of cytokinins on senescence and foliar abscision during in vitro Annona glabra L. cultivation

    Directory of Open Access Journals (Sweden)

    Lenaldo Muniz de Oliveira

    2007-04-01

    Full Text Available A micropropagação de anonáceas tem sido limitada pela abscisão foliar precoce nas brotações, o que dificulta a manutenção e o desenvolvimento das plantas in vitro. Esse fato se deve, principalmente, ao acúmulo de etileno nos tubos fechados e à relação etileno/citocinina nas folhas. Assim sendo, avaliaram-se o efeito de fontes de citocinina sobre o retardo da senescência foliar em brotações de Annona glabra L. e suas implicações sobre o seu desenvolvimento. Segmentos nodais foram cultivados em tubo de ensaio contendo 15 mL do meio WPM, suplementado com 30g L-1 de sacarose, 500mg L-1 de benomyl e 1g L-1 de carvão ativado. A esse meio adicionaram-se 6-benzilaminopurina, thidiazuron, cinetina e zeatina, todos na concentração de 1mg L-1. Decorridos 45 dias após a inoculação, plantas foram submetidas à senescência em ambiente escuro, por um período de 9 dias, coletando-se folhas a cada três dias para quantificação de clorofila "a", clorofila "b", carotenóides, proteínas e açúcares solúveis totais. No final das fases de multiplicação e enraizamento, quantificaram-se a matéria seca, a área foliar e o número de folhas que sofreram abscisão nas plantas que não foram submetidas à senescência. Adotou-se o delineamento em blocos casualizados, sendo que cada período de senescência constituiu um bloco, com quatro repetições por tratamento. Os resultados mostraram que cinetina e zeatina, seguidas de thidiazuron e 6-benzilaminopurina, preservam maior teor de clorofilas "a", "b" e de carotenóides durante todo o período de senescência induzida. 6-benzilaminopurina e cinetina promoveram maior retenção da área foliar durante as fases de multiplicação e enraizamento de Annona glabra L.The micropropagation of Annonaceae has been limited by early foliar abscission in shoots, which makes the maintenance and development of plants in vitro environment difficult. This is mainly due to ethylene accumulation in closed

  17. Practitioner Profile: An Interview With Amanda Mills

    Directory of Open Access Journals (Sweden)

    Amanda Mills

    2012-01-01

    Full Text Available For more than 25 years, Amanda Mills has been working with arts organizations across Canada and with artists of all kinds to assist them in achieving financial sanity. She has taught business management at the University of Victoria and has prepared thousands of tax returns for writers, visual artists, choreographers, actors, filmmakers, broadcasters, and creative entrepreneurs. Ten years ago, bringing together her work on trauma, with twenty years of business management, Mills founded Loose Change Financial Therapy – the place where money and feelings meet. Mills has presented Loose Change workshops for social workers, teachers, psychotherapists, artists, anti-poverty activists, sex trade workers, women’s groups, and the general public.  She has been a guest on major Canadian radio and television broadcasts and profiled in many major Canadian newspapers and periodicals. Mills is also a crisis counselor and co-wrote a bestselling book on recovering from trauma. A tax professional and business manager, she is certified as a financial counselor under the Bankruptcy and Insolvency Act. Mills is also currently completing a certificate in mediation.

  18. The postharvest of mill olives

    Directory of Open Access Journals (Sweden)

    Yousfi, Khaled

    2006-03-01

    Full Text Available The greatest deterioration of olive oil is due to poor handling of the olives during the time between harvesting and processing. Storage of olive fruits is carried out by simple heaping in fruit piles, waiting their processing. These fruits develop all kinds of degenerative processes in a short period of time. Oils obtained from them show characteristics hydrolytic and oxidative deteriorations confirmed by their high acidity values, peroxide value or ultraviolet absorbance at 232 and 270 nm. To avoid this situation, the industry is currently reducing the interval between harvesting and processing, through an increase in milling capacity. However, the equipment necessary for preventing the accumulation of fruit in January would be unnecessary for the rest of the season. In this chapter, refrigeration of the olive fruits, or the use of physical treatments, to allow the processing of unripe fruits, are analysed as possible alternatives.El mayor deterioro del aceite de oliva es debido a la inadecuada manipulación de las aceitunas durante el tiempo que media entre su cosecha y su procesado. El almacenamiento de las aceitunas se lleva acabo mediante el simple amontonamiento del fruto, esperando su procesamiento. Estos frutos desarrollan toda clase de procesos degenerativos en un corto periodo de tiempo. Los aceites obtenidos a partir de estos frutos exhiben deterioros hidrolíticos y oxidativos característicos, confirmados por sus valores altos de acidez, de índice de peróxidos o de absorbancia en la región ultravioleta a 232 y 270 nm. Para evitar esta situación, la industria intenta reducir al máximo el intervalo entre la cosecha y el procesado del fruto, mediante un aumento de la capacidad de molturación. Sin embargo, el equipo necesario para prevenir la acumulación de fruto en Enero no se precisa para el resto de la campaña. En este capítulo, la refrigeración de las aceitunas o el uso de tratamientos físicos, que permiten el procesado

  19. Recycling of mill scale in sintering process

    Directory of Open Access Journals (Sweden)

    El-Hussiny N.A.

    2011-01-01

    Full Text Available This investigation deals with the effect of replacing some amount of Baharia high barite iron ore concentrate by mill scale waste which was characterized by high iron oxide content on the parameters of the sintering process., and investigation the effect of different amount of coke breeze added on sintering process parameters when using 5% mill scale waste with 95% iron ore concentrate. The results of this work show that, replacement of iron ore concentrate with mill scale increases the amount of ready made sinter, sinter strength and productivity of the sinter machine and productivity at blast furnace yard. Also, the increase of coke breeze leads to an increase the ready made sinter and productivity of the sintering machine at blast furnace yard. The productivity of the sintering machine after 5% decreased slightly due to the decrease of vertical velocity.

  20. Higher derivative super Yang-Mills theories

    International Nuclear Information System (INIS)

    Bergshoeff, E.; Rakowski, M.; Sezgin, E.

    1986-11-01

    The most general higher derivative Yang-Mills actions of the type (F 2 +α2F 4 ) which are globally supersymmetric up to order α 2 in six and ten dimensional spacetimes are given. The F 4 -terms turn out to occur in the combination α 2 (tr F 4 - 1/4(tr F 2 ) 2 ), where the trace is over the Lorentz indices. This result agrees with the low energy limit of the open superstring in ten dimensions, where α is the string tension. Surprisingly, the transformation rules of the Yang-Mills multiplet receive order α 2 corrections even in the off-shell formulation. For the case of Abelian Yang-Mills group, the action is expressed in Born-Infeld form with a metric generically given by (1+α 2 F 2 +...). (author)

  1. Antioxidant Capacity Comparison of Ethanolic Extract of Soursop (Annona muricata Linn. Leaves and Seeds as Cancer Prevention Candidate

    Directory of Open Access Journals (Sweden)

    Dyah Ayu Widyastuti

    2017-04-01

    Full Text Available Annona muricata Linn. (soursop is one of  tropical plants which have relatively complete chemical compounds. It has flavonoid, tannin, phytosterol, alkaloid, etc. The high antioxidant compound in soursop is believed as cancer prevention so the cancer threat in the world can be minimized. The antioxidant compound in soursop can be found not only in its fruit, but also in other parts like leaves, seeds, etc. Based on that potency, this study aimed to compare antioxidant capacity of soursop leaves and seeds, also to study about the utilization of soursop parts which is usually not used. This research began with maceration to extract leaves and seeds with 96% ethanol. Ethanolic extract of soursop leaves and seeds were then tested for antioxidant capacity with DPPH (1,1-diphenyl-2-picrylhydrazyl method. The result showed that antioxidant capacity of soursop leaves and seeds are 85,66875% and 39,0166, respectively. The antioxidant capacity of leaves is higher than seeds due to seed’s extraction difficulty so its antioxidant compound could not be extracted optimally. However, either leaves or seeds extract in this study are potential as antioxidant resources because there are no significant differences between antioxidant capacity of both extract.

  2. Optimization of Ultrasound-Assisted Extraction of Natural Antioxidants from Sugar Apple (Annona squamosa L.) Peel Using Response Surface Methodology.

    Science.gov (United States)

    Deng, Gui-Fang; Xu, Dong-Ping; Li, Sha; Li, Hua-Bin

    2015-11-17

    Sugar apple (Annona squamosa L.) is a popular tropical fruit and its peel is a municipal waste. An ultrasound-assisted extraction method was developed for the recovery of natural antioxidants from sugar apple peel. Central composite design was used to optimize solvent concentration (13.2%-46.8%), ultrasonic time (33.2-66.8 min), and temperature (43.2-76.8 °C) for the recovery of natural antioxidants from sugar apple peel. The second-order polynomial models demonstrated a good fit of the quadratic models with the experimental results in respect to total phenolic content (TPC, R²=0.9524, pextraction conditions were 20:1 (mL/g) of solvent-to-solid ratio, 32.68% acetone, and 67.23 °C for 42.54 min under ultrasonic irradiation. Under these conditions, the maximal yield of total phenolic content was 26.81 (mg GA/g FW). The experimental results obtained under optimal conditions agreed well with the predicted results. The application of ultrasound markedly decreased extraction time and improved the extraction efficiency, compared with the conventional methods.

  3. Genetic Diversity and Structure of Populations of Annona crassiflora Mart. of Brazilian Savanna and Its Association with Chemical Variability.

    Science.gov (United States)

    Egydio-Brandão, Anary Priscila Monteiro; Furlan, Claudia Maria; Dos Santos, Déborah Yara Alves Cursino

    2016-08-01

    Annona crassiflora Mart. is a native tree from Brazilian savanna. Isoquinoline alkaloids are characteristic of species of Annonaceae. This work aimed to assess the magnitude of genetic diversity among different populations of A. crassiflora using AFLP markers, and verify the existence of any correlation between the AFLP data and previous reported alkaloid composition. A. crassiflora from eight populations in the states of São Paulo, Goiás, Minas Gerais, and Distrito Federal were analyzed. The data suggest a low, moderate, and high level of genetic diversity from different populations of A. crassiflora. Concentration of alkaloids was significantly correlated with AFLP data, suggesting interaction between chemical and molecular markers in A. crassiflora. The data of association between the chemical and genetic differentiation of A. crassiflora may be useful to establish cultivation areas allowing the definition of strategies to preserve their genetic diversity with an interest in specific chemotypes for genetic improvement programs focused on sustainable utilization of this specie. © 2016 Wiley-VHCA AG, Zürich.

  4. Anti-angiogenic potential of an ethanol extract of Annona atemoya seeds in vitro and in vivo.

    Science.gov (United States)

    Yi, Jin-Mu; Park, Jong-Shik; Lee, Jun; Hong, Jin Tae; Bang, Ok-Sun; Kim, No Soo

    2014-09-23

    Angiogenesis, which is initiated by certain tumor micro-environmental conditions and diverse protein factors, plays a pivotal role during tumor development and metastasis. Therefore, many efforts have been made to develop effective anti-angiogenic agents as anticancer therapeutics. In the current study, we investigated the anti-angiogenic potential of an ethanol extract of Annona atemoya seeds (EEAA) in vitro and in vivo. The anti-angiogenic potential of EEAA was evaluated using various in vitro/in vivo models, including cell proliferation, migration, and tube formation by human umbilical vascular endothelial cells (HUVECs); a Matrigel plug assay; and tumor-induced angiogenesis. The expression of hypoxia-inducible factors (HIFs) and vascular endothelial growth factor (VEGF) was investigated using reverse transcription-polymerase chain reaction, immunoassays, and western blotting. EEAA was able to significantly inhibit the angiogenic properties of HUVECs in vitro as well as angiogenic factor-induced blood vessel formation in vivo. EEAA down-regulated the expression of VEGF and HIF-1alpha/2alpha at the mRNA and protein levels, respectively, in cancer cells under hypoxic conditions. EEAA shows a strong anti-angiogenic potential in both in vitro and in vivo systems, and we suggest that EEAA may be a valuable herbal source for anticancer drug development.

  5. Antinociceptive and Anti-Inflammatory Activities of the Ethanol Extract of Annona muricata L. Leaves in Animal Models

    Science.gov (United States)

    de Sousa, Orlando Vieira; Vieira, Glauciemar Del-Vechio; de Jesus R. G. de Pinho, José; Yamamoto, Célia Hitomi; Alves, Maria Silvana

    2010-01-01

    Antinociceptive and anti-inflammatory activities of the ethanol extract from Annona muricata L. leaves were investigated in animal models. The extract delivered per oral route (p.o.) reduced the number of abdominal contortions by 14.42% (at a dose of 200 mg/kg) and 41.41% (400 mg/kg). Doses of 200 and 400 mg/kg (p.o) inhibited both phases of the time paw licking: first phase (23.67% and 45.02%) and the second phase (30.09% and 50.02%), respectively. The extract (p.o.) increased the reaction time on a hot plate at doses of 200 (30.77% and 37.04%) and 400 mg/kg (82.61% and 96.30%) after 60 and 90 minutes of treatment, respectively. The paw edema was reduced by the ethanol extract (p.o.) at doses of 200 (23.16% and 29.33%) and 400 mg/kg (29.50% and 37.33%) after 3 to 4 h of application of carrageenan, respectively. Doses of 200 and 400 mg/kg (p.o.), administered 4 h before the carrageenan injection, reduced the exudate volume (29.25 and 45.74%) and leukocyte migration (18.19 and 27.95%) significantly. These results suggest that A. muricata can be an active source of substances with antinociceptive and anti-inflammatory activities. PMID:20559502

  6. Extracellular synthesis of silver nanoparticles by novel Pseudomonas veronii AS41G inhabiting Annona squamosa L. and their bactericidal activity

    Science.gov (United States)

    Baker, Syed; Mohan Kumar, K.; Santosh, P.; Rakshith, D.; Satish, S.

    2015-02-01

    In present investigation extracellular synthesis of silver nanoparticles were synthesized using cell free supernatant of Pseudomonas veronii AS41G isolated from Annona squamosa L. The bacterium significantly reduced silver nitrate to generate silver nanoparticles which was characterized with hyphenated techniques. Synthesis of silver nanoparticles preliminary confirmed by UV-Visible spectrophotometry with the intense peak at 410 nm, Further FTIR analysis revealed the possible role of biomolecules in the supernatant responsible for mediating the nanoparticles formation. The XRD spectra exhibited the characteristic Bragg peaks of 1 0 0, 1 1 1, 2 0 0, and 2 2 0 facets of the face centred cubic symmetry of nanoparticles suggesting that these nanoparticles were crystalline in nature. TEM microgram showed polydispersity of nanoparticles with size ranging from 5 to 50 nm. Synthesized silver nanoparticles showed antibacterial activity against human and environmental pathogens including MRSA. The study enlightens the role of biosynthesized silver nanoparticles as an emerging alternative for drug resistant microorganisms. The obtained results are promising enough to pave the environmentally benign nanoparticle synthesis processes without use of any toxic chemicals and also envision the emerging role of endophytes towards synthesis of nanoparticles. With scanty reports available on P.veronii species, a new role has been reported in this study which will be very valuable for future researchers working on it.

  7. Efficient phyto-synthesis and structural characterization of rutile TiO2 nanoparticles using Annona squamosa peel extract

    Science.gov (United States)

    Roopan, Selvaraj Mohana; Bharathi, A.; Prabhakarn, A.; Abdul Rahuman, A.; Velayutham, K.; Rajakumar, G.; Padmaja, R. D.; Lekshmi, Mohan; Madhumitha, G.

    2012-12-01

    In the present study, the biosynthesis of rutile TiO2 nanoparticles (TiO2 NPs) was achieved by a novel, biodegradable and convenient procedure using fruit peel Annona squamosa aqueous extract. This is the first report on the new, simple, rapid, eco-friendly and cheaper methods for the synthesis of rutile TiO2 NPs at lower temperature using agricultural waste. Rutile TiO2 NPs were characterized by UV, XRD, SEM, TEM and EDS studies. The UV-Vis spectrophotometer results were promising and showed a rapid production of TiO2 NPs with a surface plasmon resonance occurring at 284 nm. The formation of the TiO2 NPs as observed from the XRD spectrum is confirmed to be TiO2 particles in the rutile form as evidenced by the peaks at 2θ = 27.42°, 36.10°, 41.30° and 54.33° when compared with the literature. The TEM images showed polydisperse nanoparticles with spherical shapes and size 23 ± 2 nm ranges.

  8. Identificación de temperatura y humedad en un prototipo deshidratador de pulpa de Annona Muricata

    Directory of Open Access Journals (Sweden)

    Paula Andrea Torres Amaya

    2015-10-01

    Full Text Available La industria de alimentos, es considerada como una de las actividades económicas con mayor participación en Colombia, la cual para continuar con su proceso de producción, se han enfrentado con problemas de desperdicios debido a falta de infraestructura y métodos de conservación de alimentos que no altere las propiedades físico – químicas del producto a comercializar. Por ende, se ha presentado la necesidad de desarrollar metodologías orientadas a la extracción de agua, sin alterar sus nutrientes y así prolongar el periodo de degradación del fruto. En el presente artículo, se expone los resultados del análisis en temperatura y humedad que son necesarios para realizar el proceso de deshidratación de la Annona Muricata, la cual presenta un alto contenido de agua (83 por cada 100 gramos de fruta. El desarrollo de este proyecto se enfocó en permitir a los productores frutícolas, tener la capacidad de ofrecer frutos tropicales de degradación rápida, a mercados nacionales y posiblemente internacionales. Cuyos resultados se observan en la conservación de alimentos por largos periodos de tiempo, disminuyendo las perdidas, fomentando el consumo y el desarrollo económico del productor agrícola.

  9. Flavonoids from Annona dioica leaves and their effects in Ehrlich carcinoma cells, DNA-topoisomerase I and II

    International Nuclear Information System (INIS)

    Vega, Maria R.G.; Esteves-Souza, Andressa; Echevarria, Aurea; Vieira, Ivo J.C.; Mathias, Leda; Braz-Filho, Raimundo

    2007-01-01

    Chemical investigation of methanol extract leaves from Annona dioica (Annonaceae) resulted in the identification of flavonoids kaempferol (1), 3-O-[3'',6''-di-O-p-hydroxycinnamoyl]-β- galactopyranosyl-kaempferol (2), 6''-O-p-hydroxycinnamoyl-β-galactopyranosyl-kaempferol (3) and 3-O-β-galactopyranosyl-kaempferol (4). The structures were unequivocally characterized by 1 H and 13 C NMR spectroscopic analyses using 1D and 2D experiments. The cytotoxic effects of the flavonoids and flavonoid fraction (FF) were evaluated by MTT (3-(4,5-dimethylthiazole-2- yl)-2,5-diphenyltetrazolium bromide) assay against Ehrlich carcinoma cells. The results indicated that 1, 2, 3 and FF exhibit significant antiproliferative action when compared to quercetin. The inhibitory action on DNA-topoisomerase I and II of all the flavonoids was evaluated by relaxation assays on pBR322 plasmid DNA. The results indicated the inhibitory and non-selective effects of the flavonoids on DNA-topoisomerase I and II. (author)

  10. Flavonoids from Annona dioica leaves and their effects in Ehrlich carcinoma cells, DNA-topoisomerase I and II

    Energy Technology Data Exchange (ETDEWEB)

    Vega, Maria R.G.; Esteves-Souza, Andressa; Echevarria, Aurea [Universidade Federal Rural do Rio de Janeiro (UFRRJ), Seropedica, RJ (Brazil). Dept. de Quimica]. E-mail: echevarr@ufrrj.br; Vieira, Ivo J.C.; Mathias, Leda; Braz-Filho, Raimundo [Universidade Estadual do Norte Fluminense (UENF), Campos dos Goytacases, RJ (Brazil). Lab. de Ciencias Quimicas

    2007-07-01

    Chemical investigation of methanol extract leaves from Annona dioica (Annonaceae) resulted in the identification of flavonoids kaempferol (1), 3-O-[3'',6''-di-O-p-hydroxycinnamoyl]-{beta}- galactopyranosyl-kaempferol (2), 6''-O-p-hydroxycinnamoyl-{beta}-galactopyranosyl-kaempferol (3) and 3-O-{beta}-galactopyranosyl-kaempferol (4). The structures were unequivocally characterized by {sup 1}H and {sup 13}C NMR spectroscopic analyses using 1D and 2D experiments. The cytotoxic effects of the flavonoids and flavonoid fraction (FF) were evaluated by MTT (3-(4,5-dimethylthiazole-2- yl)-2,5-diphenyltetrazolium bromide) assay against Ehrlich carcinoma cells. The results indicated that 1, 2, 3 and FF exhibit significant antiproliferative action when compared to quercetin. The inhibitory action on DNA-topoisomerase I and II of all the flavonoids was evaluated by relaxation assays on pBR322 plasmid DNA. The results indicated the inhibitory and non-selective effects of the flavonoids on DNA-topoisomerase I and II. (author)

  11. Production of Nutritious Flour from Residue Custard Apple (Annona squamosa L. for the Development of New Products

    Directory of Open Access Journals (Sweden)

    Felipe Thiago Caldeira Souza

    2018-01-01

    Full Text Available Currently, the fruit processing industry generates a high volume of waste in fruits that have not reached a quality standard for consumption or by-products generated throughout the production process. To reduce this waste, mitigating measures, such as reuse in food formulations, have been proposed. In this work the custard apple bagasse flour (Annona squamosa L. (CAB was produced and incorporated into cookie formulations in different proportions (5 to 50% evaluating its acceptability. The CAB flour was characterized by physicochemical analysis, proximate composition, mineral analysis, determination of the phenolic content, and antioxidant capacity. The results of the physicochemical and proximate characterizations show that the processed flour presents values and specifications suitable for food formulations. The mineral composition of the CAB flour responds to more than 20% of the daily intake of nutrients, highlighting the Cu, Fe, Mn, Zn, Ca, and Mg. The composition of phenolic compounds for CAB flour and cookies formulations presented values ranging from 200 to 658 mg GAE/100 g, similar to flour and formulations prepared of residues tropical fruit, while DPPH• inhibition showed a variation of 9.68–10.75%. Cookies made from the CAB flour showed high acceptability making the flour promising in the nutritional incorporation in food formulations.

  12. Optimization of Ultrasound-Assisted Extraction of Natural Antioxidants from Sugar Apple (Annona squamosa L. Peel Using Response Surface Methodology

    Directory of Open Access Journals (Sweden)

    Gui-Fang Deng

    2015-11-01

    Full Text Available Sugar apple (Annona squamosa L. is a popular tropical fruit and its peel is a municipal waste. An ultrasound-assisted extraction method was developed for the recovery of natural antioxidants from sugar apple peel. Central composite design was used to optimize solvent concentration (13.2%–46.8%, ultrasonic time (33.2–66.8 min, and temperature (43.2–76.8 °C for the recovery of natural antioxidants from sugar apple peel. The second-order polynomial models demonstrated a good fit of the quadratic models with the experimental results in respect to total phenolic content (TPC, R2 = 0.9524, p < 0.0001, FRAP (R2 = 0.9743, p < 0.0001, and TEAC (R2 = 0.9610, p < 0.0001 values. The optimal extraction conditions were 20:1 (mL/g of solvent-to-solid ratio, 32.68% acetone, and 67.23 °C for 42.54 min under ultrasonic irradiation. Under these conditions, the maximal yield of total phenolic content was 26.81 (mg GA/g FW. The experimental results obtained under optimal conditions agreed well with the predicted results. The application of ultrasound markedly decreased extraction time and improved the extraction efficiency, compared with the conventional methods.

  13. Effectivity of Sugar-Apple (Annona squamosa Seed Extract with a Different Length of Storage against Culec quinquefasciatus Larvae

    Directory of Open Access Journals (Sweden)

    Heni Prasetyowati

    2012-06-01

    Full Text Available Synthetic insecticide have been used to control Culex quinquefasciatus, but the prolonged usage of synthetic insecticide has a bad impact on the environment and may caused resistance. Sugar apple’s (Annona squamosa seeds which contain alkaloid can be used as an alternative insecticide that was safe for environment. This research aims is to know the effect of sugar apple’s seeds with different length of storage as C. quinquefasciatus larvacide. This research was an experimental study with a randomized controlled trial group design approach. The test material was an extract of sugar apple’s seeds which have been kept for 0, 1, 2, and 3 week with LC50 (0,47 ppm was used. Each treatment used 25 C. quinquefasciatus larvae from third instar larvae stage and replicated five times. After exposed for 24 hours, dead larvae counted. The result confirmed that the extract of sugar apple’s seeds which has been stored in 0, 1, 2, and 3 week did not showed any significant different on larvae mortality. Extract of sugar apple’s seeds which have been stored in 0, 1, 2, and 3 week have an equal activity as Culex quinquefasciatus larvicide.

  14. Genotoxicity investigation of araticum(Annona crassiflora Mart., 1841, Annonaceae using SOS-Inductest and Ames test

    Directory of Open Access Journals (Sweden)

    JB. Vilar

    Full Text Available Although the use of medicinal plants or natural products has increased in recent decades all over the world, little information is available on their potential risk to health. Annona crassiflora Mart., a plant commonly known as araticum in Brazil, has been widely used in folk medicine for a long time since its seeds and leaves are often utilised in the treatment of cancer, snake bites, and venereal diseases, its fruits are consumed as tonic and astringent, and its bark powder has anti-fungal and anti-rheumatic properties. To evaluate the genotoxic and mutagenic properties induced by the ethanolic extract of araticum leaves, we performed the prophage λ induction (Inductest and bacterial mutagenicity assays. We used Escherichia coli WP2s(λ and RJF013 strains in the lysogenic induction test, whereas the mutagenic studies were carried out using Salmonella typhimurium histidine auxotroph strains TA97a, TA98, TA100, and TA102. Each experiment was performed three times in duplicate and included positive and negative controls. No statistically significant (p > 0.05 positive results were obtained for any of the strains tested, which suggests that the ethanolic extract of araticum leaves did not exhibit direct mechanisms of genotoxicity or mutagenicity that could be detected by the tests used in the present work.

  15. Antinociceptive and anti-inflammatory activities of the ethanol extract of Annona muricata L. leaves in animal models.

    Science.gov (United States)

    de Sousa, Orlando Vieira; Vieira, Glauciemar Del-Vechio; de Jesus R G de Pinho, José; Yamamoto, Célia Hitomi; Alves, Maria Silvana

    2010-05-06

    Antinociceptive and anti-inflammatory activities of the ethanol extract from Annona muricata L. leaves were investigated in animal models. The extract delivered per oral route (p.o.) reduced the number of abdominal contortions by 14.42% (at a dose of 200 mg/kg) and 41.41% (400 mg/kg). Doses of 200 and 400 mg/kg (p.o) inhibited both phases of the time paw licking: first phase (23.67% and 45.02%) and the second phase (30.09% and 50.02%), respectively. The extract (p.o.) increased the reaction time on a hot plate at doses of 200 (30.77% and 37.04%) and 400 mg/kg (82.61% and 96.30%) after 60 and 90 minutes of treatment, respectively. The paw edema was reduced by the ethanol extract (p.o.) at doses of 200 (23.16% and 29.33%) and 400 mg/kg (29.50% and 37.33%) after 3 to 4 h of application of carrageenan, respectively. Doses of 200 and 400 mg/kg (p.o.), administered 4 h before the carrageenan injection, reduced the exudate volume (29.25 and 45.74%) and leukocyte migration (18.19 and 27.95%) significantly. These results suggest that A. muricata can be an active source of substances with antinociceptive and anti-inflammatory activities.

  16. In vitro anthelmintic activity of aqueous leaf extract of Annona muricata L. (Annonaceae) against Haemonchus contortus from sheep.

    Science.gov (United States)

    Ferreira, L E; Castro, P M N; Chagas, A C S; França, S C; Beleboni, R O

    2013-07-01

    Despite the overall progress of sheep farming in Brazil, infections with the gastrointestinal parasite Haemonchus contortus represent one the most important problems in sheep production, aggravated by the increasing resistance of nematodes to traditional anthelmintic drugs caused by inadequate sheep flock management by breeders. Ethnopharmacological data indicate Annona muricata as a promising alternative for the control of gastrointestinal nematodes because of its general anthelmintic properties. The aim of this work was to evaluate the in vitro anthelmintic effects of A. muricata aqueous leaf extract against eggs, infective larvae and adult forms of parasitic nematode H. contortus. At higher doses, A. muricata extract showed 84.91% and 89.08% of efficacy in egg hatch test (EHT) and larval motility test (LMT), respectively. In the adult worm motility test, worms were completely immobilized within the first 6-8h of nematode exposition to different dilutions of extract. Phytochemical analysis indicated the presence of phenolic compounds in A. muricata aqueous leaf extract that may be responsible for the anthelmintic effects observed. Moreover those results validate the traditional use of A. muricata as a natural anthelmintic and then the pharmacological potential of its compounds for future in vivo investigations. Copyright © 2013 Elsevier Inc. All rights reserved.

  17. Proximate composition and selected physicochemical properties of the seed, pulp and oil of sour sop (Annona muricata).

    Science.gov (United States)

    Onimawo, I A

    2002-01-01

    Proximate composition and physicochemical analyses were carried out on the seed, pulp and extracted oil of sour sop (Annona muricata). The results showed that the seed contained 8.5% moisture, 2.4% crude protein, 13.6% ash, 8.0% crude fiber, 20.5% fat and 47.0% carbohydrate. The seed also contained 0.2% water soluble ash, 0.79% titratable acidity and 17.0 mg calcium/100 g. The pulp was found to contain 81% moisture, 3.43% titratable acidity and 24.5% non-reducing sugar. Selected physicochemical characteristics included refractive indices of 1.335 for the seed and 1.356 for the pulp, specific gravities of 1.250 for the seed and 1.023 for the pulp, pH values of 8.34 for the seed and 4.56 for the pulp, and soluble solids contents of 1.5 degrees Brix for the seed and 15 degrees Brix for the pulp. The extracted oil (20.5% yield) had a 60.43% unsaponifiable value, 23.54 KOH/g acid value, 100.98 KOH/g saponification value, 1.1 KOH/g peroxide value, 1.464 refractive index, 5.77 pH, 69.5 degrees Brix sosluble solids and 0.2900 specific gravity.

  18. Different susceptibilities of Leishmania spp. promastigotes to the Annona muricata acetogenins annonacinone and corossolone, and the Platymiscium floribundum coumarin scoparone.

    Science.gov (United States)

    Vila-Nova, Nadja Soares; de Morais, Selene Maia; Falcão, Maria José Cajazeiras; Alcantara, Terezinha Thaize Negreiros; Ferreira, Pablito Augusto Travassos; Cavalcanti, Eveline Solon Barreira; Vieira, Icaro Gusmão Pinto; Campello, Cláudio Cabral; Wilson, Mary

    2013-03-01

    Leishmaniasis is a zoonotic disease that can manifest itself in visceral and cutaneous form. The aim of this study was to search for new leishmanicidal compounds. Preliminarily, Artemia salina assay was applied to compounds from two plants found in Northeastern Brazil, Platymiscium floribundum and Annona muricata. Then these compounds were tested against three Leishmania species (Leishmania donovani, Leishmania mexicana and Leishmania major). A screening assay using luciferase-expressing promastigote form were used to measure the viability of promastigote One coumarin, scoparone, isolated from P. floribundum and two acetogenins, annonacinone and corossolone isolated from A. muricata showed leishmanicidal activity in all species tested. Nevertheless, Leishmania species indicated different susceptibilities in relation to the tested compounds: L. mexicana was more sensitive to scoparone followed by L. major and L. donovani. The three species presented similar inhibition to corossolone and annonacinone. Acetogenin annonacinone (EC(50)=6.72-8.00 μg/mL) indicated high leishmanicidal activity; corossolone (EC(50)=16.14-18.73 μg/mL) and scoparone (EC(50)=9.11-27.51 μg/mL) moderate activity. A. saline larvae were less sensitive to the coumarin scoparone and acetogenin corossolone was the most toxic. In conclusion, the leishmanicidal activity demonstrated by the coumarin and acetogenins indicate these compounds for further studies aiming the development of new leishmanicidal agents. Copyright © 2012 Elsevier Inc. All rights reserved.

  19. Enhanced extraction yields and mobile phase separations by solvent mixtures for the analysis of metabolites in Annona muricata L. leaves.

    Science.gov (United States)

    Ribeiro de Souza, Eloana Benassi; da Silva, Renata Reis; Afonso, Sabrina; Scarminio, Ieda Spacino

    2009-12-01

    The effects of five extraction solvents and their mixtures on the yield of metabolites in crude and fractionated extracts of Annona muricata L. leaves were investigated by direct comparison. Extraction media were prepared using simplex centroid mixtures of ethanol, ethyl acetate, dichloromethane, acetone, and chloroform. The effects of the mobile phase solvent strength and the analysis wavelength on the chromatographic separation were also investigated. Solvent mixtures rather than pure solvents were found to be the most efficient extractors for the different fractions. The results indicated that the mobile phase composed of methanol/acetonitrile/water (26:27:47 v/v/v) was most suitable for the basic fraction analysis at 254 nm, whereas the mobile phase composed of methanol/acetonitrile/water (35:35:30 v/v/v) was the most adequate for the organic fraction analysis at 254 nm. The results indicated that the chromatographic profiles and number of peaks were affected by the mobile phase strength and analysis wavelength.

  20. Purificação da enzima polifenoloxidase (PFO de polpa de pinha (Annona squamosa L. madura

    Directory of Open Access Journals (Sweden)

    LIMA Eliza Dorotea Pozzobon de A.

    2001-01-01

    Full Text Available A PFO (EC 1.10.3.2 extraída de polpa de pinha madura (Annona squamosa L., foi parcialmente purificada por fracionamento em sulfato de amônio a 80% e purificada 411 (Fração I e 118 (Fração II vezes após cromatografia em coluna de troca iônica em DEAE-Toyopearl 650M, e 566 vezes em coluna de Toyopearl HW55F. A enzima da fração mais ativa foi caracterizada bioquimicamente. Quanto aos parâmetros cinéticos, a enzima apresentou valores de Km e Vmax de 7,14mM e 302,0 unidades/min/ml para catecol e 25,0mM e 180,2 unidades/min/ml para L-dopa respectivamente, substratos que demonstraram maior especificidade. O peso molecular foi estimado em 90.700 daltons através de filtração em gel Sephadex G-200. O teor de cobre da enzima purificada encontrado foi de 11ppm/peso da amostra liofilizada. Quanto à composição de aminoácidos, a PFO apresentou maiores teores de ácido aspártico, ácido glutâmico e lisina e menores teores de metionina, arginina e tirosina, com ausência de cisteína.

  1. Structural Characterisation of Acetogenins from Annona muricata by Supercritical Fluid Chromatography Coupled to High-Resolution Tandem Mass Spectrometry.

    Science.gov (United States)

    Laboureur, Laurent; Bonneau, Natacha; Champy, Pierre; Brunelle, Alain; Touboul, David

    2017-11-01

    Acetogenins are plant polyketides known to be cytotoxic and proposed as antitumor candidates. They are also suspected to be alimentary neurotoxins. Their occurrence as complex mixtures renders their dereplication and structural identification difficult using liquid chromatography coupled to tandem mass spectrometry and efforts are required to improve the methodology. To develop a supercritical fluid chromatography (SFC) high-resolution tandem mass spectrometry method, involving lithium post-column cationisation, for the structural characterisation of Annonaceous acetogenins in crude extracts. The seeds of Annona muricata L. were extracted with methanol. Supercritical fluid chromatography of the extract, using a 2-ethylpyridine stationary phase column, was monitored using a high-resolution quadrupole time-of-flight mass spectrometer. Lithium iodide was added post-column in the make-up solvent. For comparison, the same extract was analysed using high-pressure liquid chromatography coupled to the same mass spectrometer, with a column based on solid core particles. Sensitivity was similar for both HPLC and SFC approaches. Retention behaviour and fragmentation pathways of three different isomer groups are described. A previously unknown group of acetogenins was also evidenced for the first time. The use of SFC-MS/MS allows the reduction of the time of analysis, of environmental impact and an increase in the chromatographic resolution, compared to liquid chromatography. This new methodology enlightened a new group of acetogenins, isomers of montanacin-D. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  2. The effect of an Annona muricata leaf extract on nutritional status and cytotoxicity in colorectal cancer: a randomized controlled trial.

    Science.gov (United States)

    Indrawati, Lili; Ascobat, Purwantyastuti; Bela, Budiman; Abdullah, Murdani; Surono, Ingrid S

    Annona muricata leaf infusion has traditionally been consumed to maintain health, but is now considered for use in treating cancer patients. The objective of this study was to elucidate the effects of A. muricata leaf extract in humans and human cell lines. Thirty outpatients with colorectal cancer who had undergone primary tumor resection were enrolled in a randomized double-blind placebo- controlled pre-post-trial. They were divided into two groups: those who ingested A. muricata leaf extract (n=14) and those who ingested a placebo (n=14) daily for 8 weeks. Twenty-eight subjects completed the trial; they were equally distributed between the two groups. Serum from patients of both groups was compared for cytotoxicity against colorectal cancer cell lines. The nutritional status of patients was monitored throughout the study. Ex vivo and clinical studies showed higher cytotoxicity in the supplemented group compared with the placebo group. Further research is required to investigate the long-term effect of A.muricata leaf extract, particularly on parameters directly related to cytotoxic activity toward colorectal cancer cells and nutrition status.

  3. Magnetic properties of barium ferrite after milling by high energy milling (hem

    Directory of Open Access Journals (Sweden)

    Idayanti Novrita

    2017-01-01

    Full Text Available Magnetic properties of barium ferrite that were mashed by High Energy Milling (HEM has been characterized. The starting iron oxide powder (Fe2O3 and barium carbonate (BaCO3 were prepared by powder metallurgy technique by the stages of mixing, calcining, milling, compacting, and sintering. Weight ratio of Fe2O3: BaCO3 was 88.74 wt% : 17.52 wt%. Some additives such as calcium oxide (CaO, silicon dioxide (SiO2, and polyvinyl alcohol (PVA were added after calcining process. Milling by HEM was varied at 30, 60, 90, 120, and 150 minutes. The ball and container of HEM were made of stainless steel. Characterization micro structure by SEM showed that the milling time affect the grain size of the magnetic powder. The longer of milling time, the grain size was smaller and uniform. Characterization by using magnetic instrument Permagraph showed that the grain size will affect the magnetic properties of barium ferrite. Induction of remanence (Br, coercivity (HcJ, and product energy maximum (BHmax values increased with increasing milling time. The optimal magnetic properties were obtained at the time of milling 120 minutes with value of Hc = 1.97 kG, HcJ = 2.314 kOe, and BHmax = 0.64 MGOe.

  4. CO2 laser milling of hard tissue

    Science.gov (United States)

    Werner, Martin; Ivanenko, Mikhail; Harbecke, Daniela; Klasing, Manfred; Steigerwald, Hendrik; Hering, Peter

    2007-02-01

    Drilling of bone and tooth tissue belongs to recurrent medical procedures (screw- and pin-bores, bores for implant inserting, trepanation etc.). Small round bores can be in general quickly produced with mechanical drills. Problems arise however by angled drilling, by the necessity to fulfill the drilling without damaging of sensitive soft tissue beneath the bone, or by the attempt to mill precisely noncircular small cavities. We present investigations on laser hard tissue "milling", which can be advantageous for solving these problems. The "milling" is done with a CO2 laser (10.6 μm) with pulse duration of 50 - 100 μs, combined with a PC-controlled galvanic beam scanner and with a fine water-spray, which helps to avoid thermal side-effects. The damaging of underlying soft tissue can be prevented through control of the optical or acoustical ablation signal. The ablation of hard tissue is accompanied with a strong glowing, which is absent during the laser beam action on soft tissue. The acoustic signals from the diverse tissue types exhibit distinct differences in the spectral composition. Also computer image analysis could be a useful tool to control the operation. Laser "milling" of noncircular cavities with 1 - 4 mm width and about 10 mm depth is particularly interesting for dental implantology. In ex-vivo investigations we found conditions for fast laser "milling" of the cavities without thermal damage and with minimal tapering. It included exploration of different filling patterns (concentric rings, crosshatch, parallel lines and their combinations), definition of maximal pulse duration, repetition rate and laser power, optimal position of the spray. The optimized results give evidences for the applicability of the CO2 laser for biologically tolerable "milling" of deep cavities in the hard tissue.

  5. PODER CALORÍFICO Y MATERIAL INORGÁNICO EN LA CORTEZA DE SEIS ÁRBOLES FRUTALES

    Directory of Open Access Journals (Sweden)

    Ricardo Martínez-Pérez

    2012-01-01

    Full Text Available El poder calorífico y el contenido de sustancias minerales (cenizas se determinaron en la corteza de seis especies arbóreas frutales (Annona cherimola Mill., Citrus aurantifolia Swingle, Malus domestica Borkh., Psidium guajava L., Prunus dulcis [Mill.] D. A. Webb y Tamarindus indica L.. Las cenizas obtenidas fueron analizadas mediante rayos X. Los valores encontrados de poder calorífico variaron de 3,453.49 kcal•kg-1 en T. indica a 4,076.10 kcal•kg-1 en P. guajava. En el caso de las cenizas, los resultados fluctuaron de 5.76 % en P. guajava a 21.93 % en T. indica. Se observó que un contenido mayor de minerales en las cortezas tiende a disminuir su poder calorífico. Los elementos químicos comunes en las muestras analizadas fueron calcio, potasio, magnesio, fósforo y azufre. No se detectaron metales pesados en las muestras de la corteza.

  6. Einstein-Yang-Mills-Lorentz black holes

    Energy Technology Data Exchange (ETDEWEB)

    Cembranos, Jose A.R.; Gigante Valcarcel, Jorge [Universidad Complutense de Madrid, Departamento de Fisica Teorica I, Madrid (Spain)

    2017-12-15

    Different black hole solutions of the coupled Einstein-Yang-Mills equations have been well known for a long time. They have attracted much attention from mathematicians and physicists since their discovery. In this work, we analyze black holes associated with the gauge Lorentz group. In particular, we study solutions which identify the gauge connection with the spin connection. This ansatz allows one to find exact solutions to the complete system of equations. By using this procedure, we show the equivalence between the Yang-Mills-Lorentz model in curved space-time and a particular set of extended gravitational theories. (orig.)

  7. Classical solutions of Yang-Mills theory

    International Nuclear Information System (INIS)

    Mitter, H.

    1983-01-01

    This paper reviews classical, static solutions of the Yang Mills field equations in the presence of charge and current sources. The full Yang Mills equations are given. Abelian solutions are considered, but the paper really concentrates on nonabelian solutions describing spherically symmetric situations. A situation is called spherically symmetric if any deviation from the symmetry can be gauged away. The discussed solutions can be considered as the simplest non-abelian generalization of the well known Coulomb-Biot-Savart solution in classical electrodynamics

  8. Operating System For Numerically Controlled Milling Machine

    Science.gov (United States)

    Ray, R. B.

    1992-01-01

    OPMILL program is operating system for Kearney and Trecker milling machine providing fast easy way to program manufacture of machine parts with IBM-compatible personal computer. Gives machinist "equation plotter" feature, which plots equations that define movements and converts equations to milling-machine-controlling program moving cutter along defined path. System includes tool-manager software handling up to 25 tools and automatically adjusts to account for each tool. Developed on IBM PS/2 computer running DOS 3.3 with 1 MB of random-access memory.

  9. Gauged supersymmetries in Yang-Mills theory

    International Nuclear Information System (INIS)

    Tissier, Matthieu; Wschebor, Nicolas

    2009-01-01

    In this paper we show that Yang-Mills theory in the Curci-Ferrari-Delbourgo-Jarvis gauge admits some up to now unknown local linear Ward identities. These identities imply some nonrenormalization theorems with practical simplifications for perturbation theory. We show, in particular, that all renormalization factors can be extracted from two-point functions. The Ward identities are shown to be related to supergauge transformations in the superfield formalism for Yang-Mills theory. The case of nonzero Curci-Ferrari mass is also addressed.

  10. Parametric optimization of CNC end milling using entropy ...

    African Journals Online (AJOL)

    Parametric optimization of CNC end milling using entropy measurement technique combined with grey-Taguchi method. ... International Journal of Engineering, Science and Technology ... Keywords: CNC end milling, surface finish, material removal rate (MRR), entropy measurement technique, Taguchi method ...

  11. Electropolishing or chemical milling of beryllium to remove machining defects

    International Nuclear Information System (INIS)

    Helms, J.R.

    1975-12-01

    The techniques of electropolishing and chemical milling to remove machine damage from beryllium are compared. Both techniques are found to be effective; chemical milling is recommended because it is easier to use and control

  12. Investigation of the milling capabilities of the F10 Fine Grind mill using Box-Behnken designs.

    Science.gov (United States)

    Tan, Bernice Mei Jin; Tay, Justin Yong Soon; Wong, Poh Mun; Chan, Lai Wah; Heng, Paul Wan Sia

    2015-01-01

    Size reduction or milling of the active is often the first processing step in the design of a dosage form. The ability of a mill to convert coarse crystals into the target size and size distribution efficiently is highly desirable as the quality of the final pharmaceutical product after processing is often still dependent on the dimensional attributes of its component constituents. The F10 Fine Grind mill is a mechanical impact mill designed to produce unimodal mid-size particles by utilizing a single-pass two-stage size reduction process for fine grinding of raw materials needed in secondary processing. Box-Behnken designs were used to investigate the effects of various mill variables (impeller, blower and feeder speeds and screen aperture size) on the milling of coarse crystals. Response variables included the particle size parameters (D10, D50 and D90), span and milling rate. Milled particles in the size range of 5-200 μm, with D50 ranging from 15 to 60 μm, were produced. The impeller and feeder speeds were the most critical factors influencing the particle size and milling rate, respectively. Size distributions of milled particles were better described by their goodness-of-fit to a log-normal distribution (i.e. unimodality) rather than span. Milled particles with symmetrical unimodal distributions were obtained when the screen aperture size was close to the median diameter of coarse particles employed. The capacity for high throughput milling of particles to a mid-size range, which is intermediate between conventional mechanical impact mills and air jet mills, was demonstrated in the F10 mill. Prediction models from the Box-Behnken designs will aid in providing a better guide to the milling process and milled product characteristics. Copyright © 2014 Elsevier B.V. All rights reserved.

  13. De novo assembly and characterization of transcriptomes of early-stage fruit from two genotypes of Annona squamosa L. with contrast in seed number.

    Science.gov (United States)

    Gupta, Yogesh; Pathak, Ashish K; Singh, Kashmir; Mantri, Shrikant S; Singh, Sudhir P; Tuli, Rakesh

    2015-02-14

    Annona squamosa L., a popular fruit tree, is the most widely cultivated species of the genus Annona. The lack of transcriptomic and genomic information limits the scope of genome investigations in this important shrub. It bears aggregate fruits with numerous seeds. A few rare accessions with very few seeds have been reported for Annona. A massive pyrosequencing (Roche, 454 GS FLX+) of transcriptome from early stages of fruit development (0, 4, 8 and 12 days after pollination) was performed to produce expression datasets in two genotypes, Sitaphal and NMK-1, that show a contrast in the number of seeds set in fruits. The data reported here is the first source of genome-wide differential transcriptome sequence in two genotypes of A. squamosa, and identifies several candidate genes related to seed development. Approximately 1.9 million high-quality clean reads were obtained in the cDNA library from the developing fruits of both the genotypes, with an average length of about 568 bp. Quality-reads were assembled de novo into 2074 to 11004 contigs in the developing fruit samples at different stages of development. The contig sequence data of all the four stages of each genotype were combined into larger units resulting into 14921 (Sitaphal) and 14178 (NMK-1) unigenes, with a mean size of more than 1 Kb. Assembled unigenes were functionally annotated by querying against the protein sequences of five different public databases (NCBI non redundant, Prunus persica, Vitis vinifera, Fragaria vesca, and Amborella trichopoda), with an E-value cut-off of 10(-5). A total of 4588 (Sitaphal) and 2502 (NMK-1) unigenes did not match any known protein in the NR database. These sequences could be genes specific to Annona sp. or belong to untranslated regions. Several of the unigenes representing pathways related to primary and secondary metabolism, and seed and fruit development expressed at a higher level in Sitaphal, the densely seeded cultivar in comparison to the poorly seeded NMK

  14. Immunomodulatory Efficacy of Standardized Annona muricata (Graviola) Leaf Extract via Activation of Mitogen-Activated Protein Kinase Pathways in RAW 264.7 Macrophages

    OpenAIRE

    Kim, Goon-Tae; Tran, Nguyen Khoi Song; Choi, Eun-Hye; Song, Yoo-Jeong; Song, Jae-Hwi; Shim, Soon-Mi; Park, Tae-Sik

    2016-01-01

    Annona muricata, commonly known as Graviola, has been utilized as a traditional medicine to treat various human diseases. The aim of this study was to examine the immune-enhancing activity of Graviola leaf extracts in RAW 264.7 macrophage cells. Active ingredients in Graviola leaf extracts (GE) were identified as kaempferol-3-O-rutinoside and quercetin-3-O-rutinoside by LC-MS/MS. When treated with steam or 50% ethanol GE, cell morphology was altered due to initiation of cell differentiation. ...

  15. Cytotoxicity of methanol extracts of Annona muricata, Passiflora edulis and nine other Cameroonian medicinal plants towards multi-factorial drug-resistant cancer cell lines.

    Science.gov (United States)

    Kuete, Victor; Dzotam, Joachim K; Voukeng, Igor K; Fankam, Aimé G; Efferth, Thomas

    2016-01-01

    Cancer cells rapidly acquire resistance leading to treatment failures. In the present study, we have evaluated the cytotoxicity of 17 methanol extracts from 11 Cameroonian medicinal plants against the sensitive leukemia CCRF-CEM cells and the best ones were further tested on a panel of 8 other human cancer cell lines, including various MDR phenotypes as well as against the normal AML12 hepatocytes. The cytotoxicity of the extracts was determined using a resazurin reduction assay meanwhile flow cytometry was used to measure cell cycle, apoptosis, mitochondrial membrane potential (MMP), and reactive oxygen species. In an initial screening using leukemia CCRF-CEM cells, ten extracts from five plants namely Alchornea floribunda , Annona muricata , Euphorbia prostata , Pachypodanthium staudtii and Passiflora edulis displayed IC 50 values below 20 µg/mL. They were further tested in 8 other cell lines as well as in normal AML12 hepatocytes. All selected extracts were active against leukemia CEM/ADR5000 cells with IC 50 value below 40 µg/mL. IC 50 values ranging from 10.13 µg/mL (towards CEM/ADR5000 cells) to 72.01 µg/mL [towards resistant colon carcinoma HCT116 ( p53 - / - ) cells] for Pachypodanthium staudtii roots and from 0.11 µg/mL (towards CCRF-CEM cells) to 108 µg/mL (towards P-glycoprotein-over-expressing CEM/ADR5000 cells) for doxorubicin were obtained in the eight other cancer cell lines studied. Extracts from Annona muricata leaves (AML) and seeds (AMS), and Passiflora edulis fruit (PEF) had IC 50 values below 1 µg/mL against CCRF-CEM cells and below 10 µg/mL against its MDR subline CEM/ADR5000 cells. AML, AMS and PEF induced MMP-loss-mediated apoptosis in CCRF-CEM cells. Results of the present study suggest that some of the tested plants namely Alchornea floribunda , Annona muricata , Euphorbia prostata , Pachypodanthium staudtii and Passiflora edulis represent a source of anticancer drugs. Annona muricata and Passiflora edulis are good

  16. The expression of p53 and hsp70 proteins after treatment with Annona muricata Linn leaf for activating apoptotic and lead to homeostasis program of Raji cells

    OpenAIRE

    Okid Parama Astirin; Adi Prayitno; Anif Nur Artanti; Meutia Srikandi Fitria; Dyah Ayu Witianingsih; Dwimei Ayudewandari Pranatami; Suhartono Taat Putra

    2014-01-01

    Purpose: Organic extracts of plant Annonaceae enhances apoptosis in animal cells and get the drives to reach a new homeostasis. The incidence rate of nasopharyngeal cancer in Indonesia is quite high. Protein 53Kd (p53) play a role in apoptosis process, being heat shock protein 70 (hsp70) play a role in homeostasis. The aim of this research is to identify the apoptotic effects of Annona muricata Linn leaf toward Raji cells by observing the p53 and hsp70 expression.Methods: Apoptotic assay was ...

  17. Isolation of three new annonaceous acetogenins from Graviola fruit (Annona muricata) and their anti-proliferation on human prostate cancer cell PC-3.

    Science.gov (United States)

    Sun, Shi; Liu, Jingchun; Zhou, Ninghui; Zhu, Wenjun; Dou, Q Ping; Zhou, Kequan

    2016-09-01

    Bioassay-guided fractionation of the fruit powder of Graviola (Annona muricata) was continued to be conducted and yielded three more novel bioactive compounds: C-35 annonaceous acetogenins, muricins M and N, and C-37 annonaceous acetogenins, muricenin. They all contain a mono-tetrahydrofuran ring and four hydroxyl groups. The structures were elucidated by spectral methods and chemical modification after isolation via open column chromatographic separation and HPLC purification. Especially, murices M and N demonstrated more potent anti-proliferative activities against human prostate cancer PC-3 cells. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Mill Designed Bio bleaching Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Institute of Paper Science Technology

    2004-01-30

    generation of laccase has a broad spectrum of operating parameters. Nonetheless, the development of future genetically engineered laccases with enhanced temperature, pH and redox potentials will dramatically improve the overall process. A second challenge for LMS bleaching technologies is the need to develop effective, catalytic mediators. From the literature we already know this is feasible since ABTS and some inorganic mediators are catalytic. Unfortunately, the mediators that exhibit catalytic properties do not exhibit significant delignification properties and this is a challenge for future research studies. Potential short-term mill application of laccase has been recently reported by Felby132 and Chandra133 as they have demonstrated that the physical properties of linerboard can be improved when exposed to laccase without a chemical mediator. In addition, xxx has shown that the addition of laccase to the whitewater of the paper machine has several benefits for the removal of colloidal materials. Finally, this research program has presented important features on the delignification chemistry of LMS{sub NHA} and LMS{sub VA} that, in the opinion of the author, are momentous contributions to the overall LMS chemistry/biochemistry knowledge base which will continue to have future benefits.

  19. 7 CFR 868.301 - Definition of milled rice.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of milled rice. 868.301 Section 868.301... FOR CERTAIN AGRICULTURAL COMMODITIES United States Standards for Milled Rice Terms Defined § 868.301 Definition of milled rice. Whole or broken kernels of rice (Oryza sativa L.) from which the hulls and at...

  20. Preparation of iron sulphides by high energy ball milling

    DEFF Research Database (Denmark)

    Lin, R.; Jiang, Jianzhong; Larsen, R.K.

    1998-01-01

    The reaction of a powder mixture consisting of 50 a.% Fe and 50 a.% S during high energy ball milling has been studied by x-ray diffraction and Mossbauer spectroscopy. After around 19 h of milling FeS2 and FeS havebeen formed. By further milling the FeS compound becomes dominating and only Fe...

  1. ROMI 4.0: Updated Rough Mill Simulator

    Science.gov (United States)

    Timo Grueneberg; R. Edward Thomas; Urs. Buehlmann

    2012-01-01

    In the secondary hardwood industry, rough mills convert hardwood lumber into dimension parts for furniture, cabinets, and other wood products. ROMI 4.0, the US Department of Agriculture Forest Service's ROugh-MIll simulator, is a software package designed to simulate the cut-up of hardwood lumber in rough mills in such a way that a maximum possible component yield...

  2. 40 CFR 61.142 - Standard for asbestos mills.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standard for asbestos mills. 61.142... (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Asbestos § 61.142 Standard for asbestos mills. (a) Each owner or operator of an asbestos mill shall either...

  3. Texture formation in iron particles using mechanical milling with graphite as a milling aid

    International Nuclear Information System (INIS)

    Motozuka, S.; Hayashi, K.; Tagaya, M.; Morinaga, M.

    2015-01-01

    Crystallographically anisotropic platelet iron particles were successfully prepared using a conventional ball mill with addition of graphite (Gp) particles. The morphological and structural changes resulting from the milling were investigated using scanning electron microscopy and X-ray diffraction. The spherical iron particles were plastically deformed into platelet shapes during the milling. Simultaneously, it is suggested that the size of the Gp particles decreased and adhered as nanoparticles on the surface of the iron particles. The adhered Gp particles affected the plastic deformation behavior of the iron particles: the (001) planes of α-iron were oriented parallel to the particle face, and no preferred in-plane orientation was observed. This study not only details the preparation of soft magnetic metal particles that crystallographically oriented to enhance their magnetic properties but also provides new insight into the activities of the well-established and extensively studied mechanical milling method

  4. ( Lycopersicon esculentum Mill.) resistance to Botrytis cinerea

    African Journals Online (AJOL)

    Tomato (Lycopersicon esculentum Mill.) was cultured in Hoagland's solution containing 0, 3 or 8 mM Ca2+, to investigate the responses against Botrytis cinerea infection and the effects of Ca2+ on salicylic acid (SA) biosynthesis and signal transduction. The disease index was significantly lower in 8 mM Ca2+ treatment ...

  5. CVD carbon powders modified by ball milling

    Directory of Open Access Journals (Sweden)

    Kazmierczak Tomasz

    2015-09-01

    Full Text Available Carbon powders produced using a plasma assisted chemical vapor deposition (CVD methods are an interesting subject of research. One of the most interesting methods of synthesizing these powders is using radio frequency plasma. This method, originally used in deposition of carbon films containing different sp2/sp3 ratios, also makes possible to produce carbon structures in the form of powder. Results of research related to the mechanical modification of these powders have been presented. The powders were modified using a planetary ball mill with varying parameters, such as milling speed, time, ball/powder mass ratio and additional liquids. Changes in morphology and particle sizes were measured using scanning electron microscopy and dynamic light scattering. Phase composition was analyzed using Raman spectroscopy. The influence of individual parameters on the modification outcome was estimated using statistical method. The research proved that the size of obtained powders is mostly influenced by the milling speed and the amount of balls. Powders tend to form conglomerates sized up to hundreds of micrometers. Additionally, it is possible to obtain nanopowders with the size around 100 nm. Furthermore, application of additional liquid, i.e. water in the process reduces the graphitization of the powder, which takes place during dry milling.

  6. Lucky Mc Uranium Mill. Draft environmental statement

    International Nuclear Information System (INIS)

    1977-06-01

    The Environmental Impact Statement addressed the following: the existing environment; operations; environmental impacts; environmental effects of accidents; monitoring programs and other mitigating measures; unavoidable adverse environmental impacts; relationship between short-term uses of the environment and long-term productivity; irreversible and irretrievable commitments of resources; alternatives; and NRC benefit-cost summary for the Lucky Mc Mill

  7. Cuttable Ruled Surface Strips for Milling

    DEFF Research Database (Denmark)

    Steenstrup, Kasper Hornbak; Nørbjerg, Toke Bjerge; Søndergaard, Asbjørn

    2016-01-01

    This paper proposes a novel pre-processing method for industrial robotic CNC-milling. The method targets a hybrid machining process, in which the main bulk of material is removed through robotic hot or abrasive wire cutting, after which regular CNC-machining is employed for removal of the remaining...

  8. A class of Yang-Mills solutions

    International Nuclear Information System (INIS)

    Castillejo, L.; Kugler, M.

    1980-09-01

    We investigate a class of solutions of the classical SU(2) Yang-Mills equations. The symmetry of this class prescribes a natural set of gauge invariant degrees of freedom. Using these degrees of freedom we obtain a simple set of equations which enables us to find all the solutions belonging to the class under discussion. (Author)

  9. Carbohydrate metabolism in tomato (Lycopersicon esculentum Mill ...

    African Journals Online (AJOL)

    Jane

    2011-06-27

    Jun 27, 2011 ... In order to clarify carbohydrate content and enzymes activities involved in sugar metabolism in tomato seedling leaves and yield and fruit quality under low night temperature and subsequent recovery, tomatoes (Lycopersicon esculentum Mill. cv. Liaoyuanduoli) were grown in different climatic controlled-.

  10. Radiosensitivity of quince seeds (Cydonia oblonga Mill.)

    International Nuclear Information System (INIS)

    Dall'Orto, F.A.C.; Ojima, M.; Hiroce, R.; Igue, T.; Ferraz, E.S.B.; Nascimento Filho, V.F. do; Menten, J.O.M.; Tulmann Neto, A.; Ando, A.

    1984-01-01

    The investigation with quince seeds (Cydonia oblonga Mill.) radiosensitivity and the mineral composition of the plants obtained for mutation breeding are related. The concentration of some macro and micronutrients in quince seedlings obtained from irradiated seeds are studied. (M.A.C.) [pt

  11. On the bistable zone of milling processes.

    Science.gov (United States)

    Dombovari, Zoltan; Stepan, Gabor

    2015-09-28

    A modal-based model of milling machine tools subjected to time-periodic nonlinear cutting forces is introduced. The model describes the phenomenon of bistability for certain cutting parameters. In engineering, these parameter domains are referred to as unsafe zones, where steady-state milling may switch to chatter for certain perturbations. In mathematical terms, these are the parameter domains where the periodic solution of the corresponding nonlinear, time-periodic delay differential equation is linearly stable, but its domain of attraction is limited due to the existence of an unstable quasi-periodic solution emerging from a secondary Hopf bifurcation. A semi-numerical method is presented to identify the borders of these bistable zones by tracking the motion of the milling tool edges as they might leave the surface of the workpiece during the cutting operation. This requires the tracking of unstable quasi-periodic solutions and the checking of their grazing to a time-periodic switching surface in the infinite-dimensional phase space. As the parameters of the linear structural behaviour of the tool/machine tool system can be obtained by means of standard modal testing, the developed numerical algorithm provides efficient support for the design of milling processes with quick estimates of those parameter domains where chatter can still appear in spite of setting the parameters into linearly stable domains. © 2015 The Authors.

  12. Nitrogen determination on tomato ( Lycopersicon esculentum Mill ...

    African Journals Online (AJOL)

    Nitrogen determination on tomato (Lycopersicon esculentum Mill.) seedlings by color image analysis (RGB). Adán Mercado-Luna, Enrique Rico-García, Alfredo Lara-Herrera, Genaro Soto-Zarazúa, Rosalía Ocampo-Velázquez, Ramón Guevara-González, Gilberto Herrera-Ruiz, Irineo Torres-Pacheco ...

  13. Hidden subsidies in uranium mining and milling

    International Nuclear Information System (INIS)

    Vickery, A.

    1980-01-01

    From the environmental point of view, the regional uranium mining and milling industry imposes a heavy burden on the public. This situation is examined with regard to five hidden subsidies to the industry: lack of stewardship in land management; definition of valuable deposit; air and water contamination; lack of an effective severance tax; the regulatory bureaucracy. Four suggestions are made to improve the situation

  14. Yang-Mills formulation of interacting strings

    International Nuclear Information System (INIS)

    Chan Hongmo; Tsou Sheungtsun

    1988-06-01

    A suggestion that the theory of interacting open bosonic string be reformulated as a generalised Yang-Mills theory is further elucidated. Moreover, a serious reservation regarding the ordering of operators in the earlier 'proof' of equivalence between the new and standard formulations is now removed. (author)

  15. Species status of Mill Creek Elliptio

    Energy Technology Data Exchange (ETDEWEB)

    Davis, G.M. [Academy of Natural Sciences (United States); Mulvey, M. [Savannah River Ecology Lab., Aiken, SC (United States)

    1993-12-31

    This report discusses environmental effects of the Savannah River Plant on aqautic populations in Mill Creek and surrounding tributaries. Of particular concern was the status of Elliptio. Genetics and phenotypic characteristics have shown that the current classification system is not adequate for these populations. The appendices characterize genetic variability at different loci, electrophoretic data, allele frequencies, sympatric species, and anatomical characters.

  16. Cuttable Ruled Surface Strips for Milling

    DEFF Research Database (Denmark)

    Steenstrup, Kasper Hornbak; Nørbjerg, Toke Bjerge; Søndergaard, Asbjørn

    2016-01-01

    This paper proposes a novel pre-processing method for industrial robotic CNC-milling. The method targets a hybrid machining process, in which the main bulk of material is removed through robotic hot or abrasive wire cutting, after which regular CNC-machining is employed for removal of the remaining...... is cuttable by wire cutting....

  17. Yang-Mills and D instantons

    NARCIS (Netherlands)

    Belitsky, A.V.; Vandoren, S.; Nieuwenhuizen, P. van

    2000-01-01

    In these lectures, which are written at an elementary and pedagogical level, we discuss general aspects of (single) instantons in SU(N) Yang-Mills theory, and then specialize to the case of N = 4 supersymmetry and the large N limit. We show how to determine the measure of collective coordinates

  18. Union Spinning Mills - Cleaner Production option report

    DEFF Research Database (Denmark)

    Wenzel, Henrik; Schneider, Zsig

    In October and November 2002 meetings were held between Union Spinning Mills and external consultants from the South African – Danish Cleaner Textile Production Project. Project participants from USM were: • From USM: Operations Director Johan Ferreira, Finishing Manager Anrico (Andrej) Kritzinger...

  19. Understanding milling induced changes: Some results

    Indian Academy of Sciences (India)

    Unknown

    size refinement, milling has received wide acceptability due to its potential to drive the changes at ambient conditions which are either not possible or require vigorous condi- tions in conventional processing routes.1–3 For example, while unfavourable decom- position steps restrict the high temperature chemical reactions ...

  20. VENVAL : a plywood mill cost accounting program

    Science.gov (United States)

    Henry Spelter

    1991-01-01

    This report documents a package of computer programs called VENVAL. These programs prepare plywood mill data for a linear programming (LP) model that, in turn, calculates the optimum mix of products to make, given a set of technologies and market prices. (The software to solve a linear program is not provided and must be obtained separately.) Linear programming finds...

  1. Yang-Mills and some related algebras

    OpenAIRE

    Connes, Alain; Dubois-Violette, Michel

    2004-01-01

    15 pages. Contribution to the Proceedings of Rigorous Quantum Field Theory in the honour of Jacques Bros.; International audience; After a short introduction on the theory of homogeneous algebras we describe the application of this theory to the analysis of the cubic Yang-Mills algebra, the quadratic self-duality algebras, their \\"super\\" versions as well as to some generalization.

  2. Buffalo calves intoxicated with Ageratum houstonianum mill

    Science.gov (United States)

    Ageratum houstonianum Mill, a noxious weed has been reported to contain pyrrolizidine alkaloids, saponins, triterpens and coumarin. It is an invasive weed that is commonly found in the pasturelands of tropical and subtropical regions. The objectives of this work were to verify the toxicity of A. ho...

  3. Avaliação do potencial alelopático de substâncias isoladas em sementes de araticum (Annona crassiflora Allelophatic potential of substances isolated from Annona crassiflora seeds

    Directory of Open Access Journals (Sweden)

    M.H Inoue

    2010-12-01

    Full Text Available Este estudo visou identificar substâncias biologicamente ativas e o potencial alelopático de esteroides glicosilados, provenientes das sementes de Annona crassiflora. O isolamento dos esteroides glicosilados foi realizado com a separação dos constituintes químicos do extrato bruto de acetato de etila em coluna cromatográfica, sendo a completa elucidação estrutural por meio de espectroscopia de RMN ¹H. Testes de germinação com as espécies Euphorbia heterophylla e Ipomoea grandifolia foram conduzidos em câmaras tipo BOD a 25ºC e fotoperíodo de 12 horas, monitorados durante 10 dias com avaliação diária, nas concentrações de 0, 20, 40, 80 e 100 mg L-1 dos materiais isolados. Utilizando as mesmas concentrações, os experimentos de desenvolvimento de radícula e hipocótilo foram mantidos em câmara de germinação a 25ºC e fotoperíodo de 24 horas, com avaliação no décimo dia. Após o extrato de acetato de etila ser submetido ao fracionamento, verificou-se a presença de sinais característicos de fitoesteróis no espectro do RMN ¹H, resultando em uma mistura de estigmasterol glicosilado e sitosterol glicosilado. Os resultados indicam que as substâncias estigmasterol e sitosterol não proporcionaram inibição na germinação e no índice de velocidade de germinação (IVG de E. heterophylla e I. grandifolia. Por outro lado, estigmasterol e sitosterol interferiram no desenvolvimento de radícula e hipocótilo de E. heterophylla.This work aimed to identify substances and the allelopathic potential of steroidal glycosides, isolated from the seeds of Annona crassiflora. Isolation of steroidal glycosides was carried out with the separation of chemical components of ethyl acetate extract in a chromatographic column and identified by 1H NMR. Germination tests with Euphorbia heterophylla and Ipomoea grandifolia were carried out in BOD Germinator at 25ºC and 12 hr photoperiod, monitored for 10 days at concentrations of 0, 20, 40

  4. Some photosynthetic and growth responses of Annona glabra L. seedlings to soil flooding Algumas respostas fotossintéticas e do crescimento de plântulas de Annona glabra L. ao alagamento do solo

    Directory of Open Access Journals (Sweden)

    Marcelo S. Mielke

    2005-12-01

    Full Text Available An experiment was conducted with the aim to analyze the effects of soil flooding and leaf position on net primary productivity and whole plant carbon balance of Annona glabra L. (Annonaceae seedlings, a highly flood-tolerant tree, native to the tropical Americas. All seedlings survived a period of 56 days of flooding without symptoms of stress. Flooding induced significant increments in root, stem and whole-plant biomass (P Um experimento foi conduzido com o objetivo de analisar os efeitos do alagamento e da posição das folhas na produtividade primária líquida e no balanço de carbono em plântulas de Annona glabra L. (Annonaceae, uma espécie altamente tolerante ao alagamento e nativa na América tropical. Todas as plântulas sobreviveram ao período de alagamento de 56 dias sem apresentarem sintomas de estresse. O alagamento induziu incrementos significativos (P <0,01 na biomassa de raízes, caules e planta inteira, e na razão raízes/parte aérea. Medições das trocas gasosas foliares foram conduzidas aos quatro, 11, 18 e 56 dias após o alagamento, na primeira (L1, quarta (L4 e sétima (L7 folha completamente expandida a partir do ápice em cada plântula. Os valores médios da condutância estomática ao vapor de água (g s e da taxa fotossintética líquida (A nas plântulas controle foram 0,26 mol m-2s-1 e 8,8 µmol m-2s-1, respectivamente. Reduções significativas (P <0,05 em A foram observadas entre L1 e L7 nas plântulas controle em todos os três dias de medições. As reduções em A com o aumento da idade foliar também ocorreram nas plantas alagadas, apenas nos dias 4 e 18. O alagamento induziu alterações significativas em gs (P <0,05, alcançando 65% em relação ao controle no dia 4 e 152% em relação ao controle no dia 56. Com base nos resultados obtidos foi possível concluir que as elevadas taxas de sobrevivência e de crescimento de plântulas de A. glabra estão diretamente relacionadas com a capacidade de manter

  5. Biological control agents (Arthropoda - Insecta associated with cultivation of the sugar apple (Annona squamosa L. = Agentes de controle biológico (Arthropoda - Insecta associados ao cultivo da pinha (Annona squamosa L.

    Directory of Open Access Journals (Sweden)

    Laise Malaspina Rossi

    2017-03-01

    Full Text Available Knowledge of biological control agents occurring naturally in agricultural areas is of great importance in adopting methods of integrated pest management. The aim of this work therefore, was to undertake a population survey of biological control agents (Insecta associated with cultivation of Annona squamosa. The research was carried out during the 2015/2016 harvest in a conventional orchard of A. squamosa, located in the town of Tabatinga in the State of São Paulo, Brazil. The biological control agents were captured using yellow sticky traps. The following faunistic indices were calculated: dominance, abundance, frequency and constancy. Population fluctuations in the natural enemies sampled were analysed by histogram. The coccinellid predators, Scymnus sp. (Coleoptera: Coccinellidae and Cycloneda sanguinea (Coleoptera: Coccinellidae were the principal biological control agents sampled during the study, and considered superdominant, superabundant, superfrequent and constant. As for population fluctuation of predominant natural enemies, high population density was seen in Scymnus sp. between September and January 2015, whereas there were three population peaks for C. sanguinea during the study, in September 2015 and January and July 2016. The coccinellids, Scymnus sp. and C. sanguinea, were the predominant biological control agents in the cultivation of A. squamosa, with a higher population density for the genus Scymnus seen in the spring and summer seasons, and no distribution pattern for C. sanguinea observed. = O conhecimento acerca dos agentes de controle biológico presentes naturalmente em áreas agrícolas apresenta grande importância na adoção de metodologias voltadas ao manejo integrado de pragas. Assim, objetivou-se com este trabalho realizar o levantamento da ocorrência populacional de agentes de controle biológico (Insecta associado ao cultivo de Annona squamosa. A pesquisa foi realizada na safra agrícola 2015/2016 em pomar

  6. Viabilidade dos grãos de pólen de flores de pinheira (Annona squamosa em diferentes horários Viability of the sugar apple (Annona squamosa pollen grains at different hours of the day

    Directory of Open Access Journals (Sweden)

    Silvia Nietsche

    2009-04-01

    Full Text Available No manejo do cultivo da pinha (Annona squamosa, a polinização artificial é uma prática preconizada para, obter maior pegamento dos frutos bem como uniformização do formato dos mesmos. Nesse sentido, conduziu-se este trabalho, com o objetivo de avaliar a viabilidade dos grãos de pólen de flores de pinheira em diferentes horários de coleta. O pólen foi obtido a partir de flores no estádio funcionalmente estaminada. Foram avaliados oito horários de coleta de pólen: zero hora, 1 hora, 2 horas, 3 horas, 4 horas, 5 horas, 6 horas e 7 horas da manhã. Foi utilizado meio de cultura padrão para germinação de pólen, com concentração de 10% de sacarose. As flores foram coletadas nos horários estabelecidos e os grãos de pólen foram retirados das anteras com auxílio de um pincel número 2 e em seguida inoculados em placas de Petri contendo o meio de cultura. O delineamento experimental foi inteiramente casualizado com quatro repetições, sendo cada parcela experimental constituída por duas placas Petri. Foram contados 100 grãos de pólen por placa. Após 6 horas de inoculação, os grãos de pólen foram visualizados sob lupa. Foram considerados germinados os grãos de pólen que possuíam tubo polínico com tamanho igual ou superior ao diâmetro do próprio pólen. Não foram observadas diferenças significativas entre o horário de coleta dos grãos de pólen. A percentagem média da germinação variou de 46,75% a 53,62% dos grãos de pólen germinados.In the management of the sugar apple (Annona squamosa crop, the artificial pollination is a preconized practice to obtain higher establishment of the fruits as well as their standardization. This study was carried out to evaluate the viability of sugar apple pollen grains at different collecting times. The pollens were obtained from the flowers at the functional staminate stage. The pollen grains were collected every hour, starting from 00:00am and ending at 07:00am, totalizing 8

  7. Comminution-amorphisation relationships during ball milling of lactose at different milling conditions.

    Science.gov (United States)

    Pazesh, Samaneh; Gråsjö, Johan; Berggren, Jonas; Alderborn, Göran

    2017-08-07

    The purpose of the study was to investigate the relationship between comminution and amorphisation of α-lactose monohydrate particles during ball milling under different milling conditions, including ball-to-powder mass ratio, milling time and ball diameter. The results revealed that at a constant ball filling ratio, ball-to-powder mass ratio of 25:1 resulted in the lowest minimum particle diameter of ∼5μm and the highest degree of apparent amorphous content of 82%. The rate of comminution was high during early stage of milling whereas the degree of apparent amorphous content increased gradually at a slow rate. An increased ball-to-powder mass ratio during milling increased both the rate of comminution and the rate of amorphisation. Using a given ball-to-powder mass ratio, the ball diameter affected the degree of apparent amorphous content of the particles while the particle diameter remained unchanged. The relationship between comminution and amorphisation could be described as consisting of two stages, i.e. comminution dominated and amorphisation dominated stage. It was proposed that the rate constant of comminution and amorphisation are controlled by stress energy distribution in the milling jar and the stress energy distribution is regulated by the ball motion pattern that can be affected by the process parameter used. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  8. Surface Quality of Staggered PCD End Mill in Milling of Carbon Fiber Reinforced Plastics

    Directory of Open Access Journals (Sweden)

    Guangjun Liu

    2017-02-01

    Full Text Available Machined surface quality determines the reliability, wear resistance and service life of carbon fiber reinforced plastic (CFRP workpieces. In this work, the formation mechanism of the surface topography and the machining defects of CFRPs are proposed, and the influence of milling parameters and fiber cutting angles on the surface quality of CFRPs is obtained, which can provide a reference for extended tool life and good surface quality. Trimming and slot milling tests of unidirectional CFRP laminates are performed. The surface roughness of the machined surface is measured, and the influence of milling parameters on the surface roughness is analyzed. A regression model for the surface roughness of CFRP milling is established. A significance test of the regression model is conducted. The machined surface topography of milling CFRP unidirectional laminates with different fiber orientations is analyzed, and the effect of fiber cutting angle on the surface topography of the machined surface is presented by using a digital super depth-of-field microscope and scanning electron microscope (SEM. To study the influence of fiber cutting angle on machining defects, the machined topography under different fiber orientations is analyzed. The slot milling defects and their formation mechanism under different fiber cutting angles are investigated.

  9. Uso de vermicomposto favorece o crescimento de mudas de gravioleira (Annona muricata L. 'Morada' associadas a fungos micorrízicos arbusculares Use of earthworm manure improves growth of soursop seedlings (Annona muricata L. 'Morada' associated with arbuscular mycorrhizal fungi

    Directory of Open Access Journals (Sweden)

    Danielle Karla Alves da Silva

    2008-09-01

    Full Text Available A gravioleira, cujos frutos apresentam elevado potencial para exportação, é de fácil adaptação ao Semi-Árido nordestino, e a sua produção, economicamente importante, vem sendo estimulada. O uso de adubos orgânicos associados à inoculação com fungos micorrízicos arbusculares (FMA pode ser útil na formação de mudas frutíferas, porém o efeito da adição de adubo na simbiose com gravioleira (Annona muricata L. 'Morada' não é conhecido. Foi investigado o efeito de FMA multiplicado em substrato com resíduo orgânico na formação de mudas de gravioleira mantidas em substratos com fertilizante. O delineamento foi inteiramente casualizado, em fatorial de 2×5: 2 substratos (solo sem ou com 10% de vermicomposto e cinco tratamentos de inoculação (Acaulospora longula Spain & Schenck e Gigaspora albida Schenck & Smith produzidos em substratos com ou sem resíduo orgânico e controle não inoculado, com quatro repetições. Após 102 dias, avaliou-se: massa seca da parte aérea e radicular, altura, diâmetro do caule, taxa de crescimento, produção de esporos de FMA e de glomalina, atividade enzimática do solo, respiração microbiana, colonização micorrízica total, arbuscular e hifálica. Em geral, a inoculação com FMA estimulou o crescimento, mas no tratamento adubado as mudas em simbiose com G. albida não foram beneficiadas pela associação. O uso de vermicomposto estimulou a colonização micorrízica, a respiração microbiana, a atividade enzimática e a produção de glomalina no solo, porém reduziu a esporulação de A. longula. A utilização de FMA e vermicomposto pode constituir alternativa na produção de mudas de gravioleira, pois reduziu à metade o tempo de formação das mudas e pode reduzir em 75% a dose de adubo a ser aplicada. No entanto, a escolha de FMA compatíveis com o hospedeiro é indispensável para garantir respostas positivas. A aplicação conjunta de FMA e adubo orgânico também pode

  10. Yang-Mills theory for non-semisimple groups

    CERN Document Server

    Nuyts, J; Nuyts, Jean; Wu, Tai Tsun

    2003-01-01

    For semisimple groups, possibly multiplied by U(1)'s, the number of Yang-Mills gauge fields is equal to the number of generators of the group. In this paper, it is shown that, for non-semisimple groups, the number of Yang-Mills fields can be larger. These additional Yang-Mills fields are not irrelevant because they appear in the gauge transformations of the original Yang-Mills fields. Such non-semisimple Yang-Mills theories may lead to physical consequences worth studying. The non-semisimple group with only two generators that do not commute is studied in detail.

  11. A Standardized Composition Comprised of Extracts from Rosmarinus officinalis, Annona squamosa and Zanthoxylum clava-herculis for Cellulite

    Science.gov (United States)

    Yimam, Mesfin; Lee, Young-Chul; Jiao, Ping; Hong, Mei; Brownell, Lidia; Jia, Qi

    2017-01-01

    Background: Cellulite, characterized by changes in the skin morphology presented as dimpled or puckered skin appearance, is highly prevalent among postadolescent women. Cellulite management ranges from topical cream applications to invasive procedures. While some interventions showed improvements in physical appearances of affected areas, so far, none have reversed the condition to a full recovery. These unsuccessful measures signify the intricate nature of cellulite etiology highlighting its complexity leading to the possibility for a combination treatment approach to target multiple mechanisms. Materials and Methods: We screened our plant library for extracts that reduce cellular lipid accumulation, improve microcirculation, possess high total antioxidant capacity, significant anti-platelet aggregation, and anti-inflammatory activities using lipid accumulation assay in 3T3-L1 cells, Croton oil-induced hemorrhoid test in rats as a model for microcirculation, anti-platelet aggregation assay, nitric oxide (NO) inhibition assay, and 1,1-diphenyl-2-picrylhydrazyl assay. Results: Three known botanicals such as Rosemary officinalis, Annona squamosa and Zanthoxylum clava-herculis were identified as lead extracts in these tests. Treatment of 3T3 cell with A. squamosa at 1 μg/ml resulted in 68.8% reduction in lipid accumulation. In croton oil-induced hemorrhoid study, Z. clava-herculis reduced the recto-anus coefficient by 79.6% at 6 mg/kg indicating improvement in microcirculations. Similarly, R. officinalis caused inhibition of 82%, 71.8%, and 91.8% in platelet aggregation, NO production and free radical generation at 31.25 μg/ml, 6.2 μg/ml, and 40 μg/ml concentrations suggesting its anti-oxidant, and anti-inflammatory activities. Conclusions: Data depicted here suggest that formulation of these well-known botanicals at a specific ratio perhaps may yield a composition with a much wider spectrum of mechanisms of actions to impact the multiple pathways involved in

  12. A Standardized Composition Comprised of Extracts fromRosmarinus officinalis,Annona squamosaandZanthoxylum clava-herculisfor Cellulite.

    Science.gov (United States)

    Yimam, Mesfin; Lee, Young-Chul; Jiao, Ping; Hong, Mei; Brownell, Lidia; Jia, Qi

    2017-01-01

    Cellulite, characterized by changes in the skin morphology presented as dimpled or puckered skin appearance, is highly prevalent among postadolescent women. Cellulite management ranges from topical cream applications to invasive procedures. While some interventions showed improvements in physical appearances of affected areas, so far, none have reversed the condition to a full recovery. These unsuccessful measures signify the intricate nature of cellulite etiology highlighting its complexity leading to the possibility for a combination treatment approach to target multiple mechanisms. We screened our plant library for extracts that reduce cellular lipid accumulation, improve microcirculation, possess high total antioxidant capacity, significant anti-platelet aggregation, and anti-inflammatory activities using lipid accumulation assay in 3T3-L1 cells, Croton oil-induced hemorrhoid test in rats as a model for microcirculation, anti-platelet aggregation assay, nitric oxide (NO) inhibition assay, and 1,1-diphenyl-2-picrylhydrazyl assay. Three known botanicals such as Rosemary officinalis, Annona squamosa and Zanthoxylum clava-herculis were identified as lead extracts in these tests. Treatment of 3T3 cell with A. squamosa at 1 μg/ml resulted in 68.8% reduction in lipid accumulation. In croton oil-induced hemorrhoid study, Z. clava-herculis reduced the recto-anus coefficient by 79.6% at 6 mg/kg indicating improvement in microcirculations. Similarly, R. officinalis caused inhibition of 82%, 71.8%, and 91.8% in platelet aggregation, NO production and free radical generation at 31.25 μg/ml, 6.2 μg/ml, and 40 μg/ml concentrations suggesting its anti-oxidant, and anti-inflammatory activities. Data depicted here suggest that formulation of these well-known botanicals at a specific ratio perhaps may yield a composition with a much wider spectrum of mechanisms of actions to impact the multiple pathways involved in cellulite onset, continuation, or exacerbations. Cellulite

  13. Optimization of adsorption process parameters by response surface methodology for hexavalent chromium removal from aqueous solutions using Annona reticulata Linn peel microparticles.

    Science.gov (United States)

    Saranya, N; Nakeeran, E; Giri Nandagopal, M S; Selvaraju, N

    2017-05-01

    Fruit peel microparticles of Annona reticulata Linn were used as biosorbent for the sequestration of hexavalent chromium (CR(VI)). Characterization of the biosorbent was done using scanning electron microscopy-energy dispersive X-ray spectroscopy (SEM-EDXS), Fourier transfer infrared spectroscopy (FTIR), gas chromatography-mass spectrometry (GCMS), carbon, hydrogen, nitrogen and sulphur (CHNS) elemental analysis, mercury intrusion porosimetry and point of zero charge. Influential parameters were optimized using response surface methodology (RSM) with a total of 17 experimental runs based on the Box-Behnken design and found to be pH 1.0, temperature 25 °C and 100 mg/L initial chromium concentration. pH and concentration were found to be more influential than temperature. The analysis of variance indicated that a second-order polynomial regression equation was the most suitable for fitting the experimental data. The experimental runs showed a good correlation with the predicted responses (R 2 = 0.9956). The biosorption process fitted well with the Langmuir isotherm with an adsorption capacity of 108. 32 mg/g out of the other isotherms such as Freundlich and Dubinin-Radushkevich that were analyzed. Non linear pseudo first order, pseudo second order, and intraparticle diffusion kinetics were applied to describe the interaction between the biosorbent and Cr(VI). Desorption and regeneration performances showed that fruit peels of Annona reticulata Linn can be an environmental friendly option for hexavalent chromium removal from aqueous solutions.

  14. Metabolomics study on the toxicity of Annona squamosa by ultraperformance liquid-chromatography high-definition mass spectrometry coupled with pattern recognition approach and metabolic pathways analysis.

    Science.gov (United States)

    Miao, Yun-Jie; Shi, Ye-Ye; Li, Fu-Qiang; Shan, Chen-Xiao; Chen, Yong; Chen, Jian-Wei; Li, Xiang

    2016-05-26

    Annona squamosa Linn (Annonaceae) is a commonly used and effective traditional Chinese medicine (TCM) especially in the South China. The seeds of Annona squamosa Linn (SAS) have been used as a folk remedy to treat "malignant sores" (cancer) in South of China, but they also have high toxicity on human body. To discover the potential biomarkers in the mice caused by SAS. We made metabonomics studies on the toxicity of SAS by ultraperformance liquid-chromatography high-definition mass spectrometry coupled with pattern recognition approach and metabolic pathways analysis. The significant difference in metabolic profiles and changes of metabolite biomarkers between the Control group and SAS group were well observed. 11 positive ions and 9 negative ions (P<0.05) were indicated based on UFLC-QTOF-HDMS. The metabolic pathways of SAS group are discussed according to the identified endogenous metabolites, and eight metabolic pathways are identified using Kyoto Encyclopedia of Genes and Genomes (KEGG). The present study demonstrates that metabonomics analysis could greatly facilitate and provide useful information for the further comprehensive understanding of the pharmacological activity and potential toxicity of SAS in the progress of them being designed to a new anti-tumor medicine. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  15. Quantitative assessment of the relative antineoplastic potential of the n-butanolic leaf extract of Annona muricata Linn. in normal and immortalized human cell lines.

    Science.gov (United States)

    George, V Cijo; Kumar, D R Naveen; Rajkumar, V; Suresh, P K; Kumar, R Ashok

    2012-01-01

    Natural products have been the target for cancer therapy for several years but there is still a dearth of information on potent compounds that may protect normal cells and selectively destroy cancerous cells. The present study was aimed to evaluate the cytotoxic potential of n-butanolic leaf extract of Annona muricata L. on WRL-68 (normal human hepatic cells), MDA-MB-435S (human breast carcinoma cells) and HaCaT (human immortalized keratinocyte cells) lines by XTT assay. Prior to cytotoxicity testing, the extract was subjected to phytochemical screening for detecting the presence of compounds with therapeutic potential. Their relative antioxidant properties were evaluated using the reducing power and DPPH* radical scavenging assay. Since most of the observed chemo-preventive potential invariably correlated with the amount of total phenolics present in the extract, their levels were quantified and identified by HPLC analysis. Correlation studies indicated a strong and significant (Pcancerous cells (IC50 values of 29.2 μg for MDA-MB-435S and 30.1 μg for HaCaT respectively). The study confirms the presence of therapeutically active antineoplastic compounds in the n-butanolic leaf extract of Annona muricata. Isolation of the active metabolites from the extract is in prospect.

  16. Nanocrystalline titanium characteristics obtained through cryogenic and high energy milling

    International Nuclear Information System (INIS)

    Rojas, P; Zuniga, A; Lavernia, E.J

    2008-01-01

    The microstructure and changes in chemical composition of Ti powders produced by cryogenic milling (modified Atritor) and by high energy milling (Spex mill) were investigated. The effect of high energy milling and cryomilling parameters, such as milling time and ball to powder ratio (BPR), on the particle size, grain size, chemistry, and structure of Ti powders were investigated using x-ray diffraction, scanning electron microscopy, and transmission electron microscopy. The experimental results show that Ti powders with a grain size of approximately 20 nm (nanocrystalline) can be produced using the cryomilling technique. The average particle size increased initially with milling time from the original 55 μm to a maximum value of 125 after milling for 2 hours, and then decreased to 44μm after milling for 8 hours. Both the average particle size and the grain size decreased as the BPR increased. The results using Spex mill show that the particle size and grain size both decreased as the milling time increased. The oxygen, nitrogen and iron content of the powders increased with the milling time (au)

  17. The flavonoid content and antiproliferative, hypoglycaemic, anti-inflammatory and free radical scavenging activities of Annona dioica St. Hill

    Science.gov (United States)

    2013-01-01

    Background Annona dioica St. Hill (Annonacaeae) is a Brazilian plant used in folk medicine for the treatment of several types of rheumatisms and diarrhoea. The focus of this work was to evaluate the in vitro antiproliferative and antioxidant activity and the in vivo hypoglycaemic and anti-inflammatory activity of A. dioica and identify the principal constituents of this plant. Methods The crude methanol extract (EAD) and hexane (HF), chloroform (CF), ethyl acetate (EAF) and hydromethanol fractions (HMF) were evaluated for free radical scavenging activity using the DPPH assay. The EAD and EAF were assayed for hypoglycaemic activity in rats. The EAD was tested in an antiproliferation assay and for anti-inflammatory effects in paw oedema, in addition to myeloperoxidase activity induced by carrageenan (Cg) in mice. The EAF was assayed using chromatographic methods. Results The fractionation of the EAF through chromatographic methods identified derivatives of the flavonoids quercetin and kaempferol. Among all the tested fractions, the ethyl acetate and hydromethanol fractions were the most potent, exhibiting an IC50 of 8.53 and 10.57 μg/mL, respectively, which is comparable to that of the commercial antioxidant butylated hydroxytoluene (BHT). The oral administration of the EAD (100 mg/kg) and EAF (15 mg/kg) inhibited the increase of glucose levels, resulting in a hypoglycaemic effect. The EAD (30 to 300 mg/kg) exhibited an anti-oedematogenic effect in Cg-induced paw oedema in a time- and dose-dependent manner. The results showed a reduction of MPO activity by A. dioica 6 h after the induction of paw oedema at all doses tested with maximal inhibition at 300 mg/kg. Conclusions Our results reveal for the first time that compounds contained in the A. dioica leaves exert anti-inflammatory, hypoglycaemic, antiproliferative, and antioxidant effects. The antioxidant activity may be associated with the presence of flavonoids. PMID:23311341

  18. Antinociceptive and anti-inflammatory activities of the ethanolic extract of Annona vepretorum Mart. (Annonaceae) in rodents.

    Science.gov (United States)

    Silva, Juliane C; Araújo, Camila de S; de Lima-Saraiva, Sarah Raquel G; de Oliveira-Junior, Raimundo G; Diniz, Tâmara C; Wanderley, Carlos Wagner de S; Palheta-Júnior, Raimundo C; Mendes, Rosemairy L; Guimarães, Adriana G; Quintans-Júnior, Lucindo J; Almeida, Jackson Roberto G da S

    2015-06-24

    Annona vepretorum Mart. (Annonaceae) is a native tree from Caatinga (Brazilian Northeastern savanna biome), popularly known as "araticum" and "pinha da Caatinga". In this study, we investigated the effects of the crude ethanolic extract (Av-EtOH) in models of pain and inflammation in rodents. The evaluation of antinociceptive activity was carried out by the acetic acid-induced writhing, formalin, hot plate and tail flick tests, while paw edema induced by carrageenan or histamine, and leukocyte migration to the peritoneal cavity were used for anti-inflammatory profile. Histological analyses also were carried out. Av-EtOH (25, 50 and 100 mg/kg, p.o) significantly reduced the number of writhing (P < 0.01) and decreased (P < 0.01) the paw licking time in both phases of the formalin test. In the hot plate and tail flick tests, this extract increased the reaction time, consequently reduced painful behavior. The effects in the formalin and hot plate tests were antagonized by naloxone. Av-EtOH inhibited significantly (P < 0.01) the increase in the edema volume after administration of carrageenan and histamine. In the peritonitis test, acute pre-treatment with Av-EtOH inhibited leukocyte migration. Histological analysis showed less inflammation in the groups treated with the extract when the inflammation was induced by carrageenan or histamine. Thus, Av-EtOH has significant antinociceptive and anti-inflammatory properties, which are related probably with the activation of opioid receptors and inhibition of release of mediators of the inflammatory process. This specie is a potential target for drug discovery.

  19. Gastroprotective activity of Annona muricata leaves against ethanol-induced gastric injury in rats via Hsp70/Bax involvement.

    Science.gov (United States)

    Moghadamtousi, Soheil Zorofchian; Rouhollahi, Elham; Karimian, Hamed; Fadaeinasab, Mehran; Abdulla, Mahmood Ameen; Kadir, Habsah Abdul

    2014-01-01

    The popular fruit tree of Annona muricata L. (Annonaceae), known as soursop and graviola, is a widely distributed plant in Central and South America and tropical countries. Leaves of A. muricata have been reported to possess antioxidant and anti-inflammatory activities. In this study, the gastroprotective effects of ethyl acetate extract of A. muricata leaves (EEAM) were investigated against ethanol-induced gastric injury models in rats. The acute toxicity test of EEAM in rats, carried out in two doses of 1 g/kg and 2 g/kg, showed the safety of this plant, even at the highest dose of 2 g/kg. The antiulcer study in rats (five groups, n=6) was performed with two doses of EEAM (200 mg/kg and 400 mg/kg) and with omeprazole (20 mg/kg), as a standard antiulcer drug. Gross and histological features showed the antiulcerogenic characterizations of EEAM. There was significant suppression on the ulcer lesion index of rats pretreated with EEAM, which was comparable to the omeprazole effect in the omeprazole control group. Oral administration of EEAM to rats caused a significant increase in the level of nitric oxide and antioxidant activities, including catalase, glutathione, and superoxide dismutase associated with attenuation in gastric acidity, and compensatory effect on the loss of gastric wall mucus. In addition, pretreatment of rats with EEAM caused significant reduction in the level of malondialdehyde, as a marker for oxidative stress, associated with an increase in prostaglandin E2 activity. Immunohistochemical staining also demonstrated that EEAM induced the downregulation of Bax and upregulation of Hsp70 proteins after pretreatment. Collectively, the present results suggest that EEAM has a promising antiulcer potential, which could be attributed to its suppressive effect against oxidative damage and preservative effect toward gastric wall mucus.

  20. Susceptibilidad a insectos en selecciones y variedades de annona muricata l. y persea americana m. en Puerto Rico

    Directory of Open Access Journals (Sweden)

    Irma Cabrera

    2001-01-01

    Full Text Available En Puerto Rico se han reportado varios insectos en las guanábanas (Annona muricata L. y los aguacates (Persea americana M, sin embargo los de mayor importancia son el barrenador de la semilla Bephratelloides cubensis (A. y Apate monacha (F. en A. muricata y Pseudacysta persea (F. en P. americana. El objetivo principal de esta investigación fue determinar la incidencia de B. cubensis y A. monacha en seis selecciones de guanábana y en siete variedades de aguacate. De las evaluaciones realizadas en A. muricata, se observó que las selecciones IV-10, VII-14 y VI-1 mostraron la mayor incidencia y la IV-16 mostró la menor incidencia de B. cubensis en relación al número de barrenos por fruta. En cuanto a la incidencia de A. monacha en A. muricata las selecciones IV-16, IV-2, IV-3, VII-14 presentaron la mayor incidencia de barrenos por árbol. En las evaluaciones realizadas en Persea americana se seleccionaron las variedades Ávila, Semil 34, Wilson Popenoe, Pollock, Candelaria, Semil 43 y Butler como las variedades comerciales más sembradas en Puerto Rico. Se observó que la variedad Avila obtuvo el mayor número de huevos, ninfas, hembras y machos de P. persea por hojas comparadas con las demás variedades. Respecto al número de hojas infestadas por árbol se encontró valores significativos (P≤0,01 en la variedad Avila. Resultando tener un 90% de las hojas dañadas. No se observó que las variedades evaluadas tuviese baja o ninguna preferencia a P. Persea

  1. Antiallergic effect of the atomized extract of rhizome of Curcuma longa, flowers of Cordia lutea and leaves of Annona muricata

    Science.gov (United States)

    Arroyo-Acevedo, Jorge; Franco-Quino, Cesar; Ruiz-Ramirez, Eliberto; Chávez-Asmat, Roberto; Anampa-Guzmán, Andrea; Raéz-González, Ernesto; Cabanillas-Coral, José

    2016-01-01

    Introduction Allergies are a problem that greatly affects the population, and hence the use of antiallergic medications is fairly widespread. However, these drugs have many adverse effects. The use of medicinal plants could be an option, but they need to be evaluated. Objective This study was designed to evaluate the antiallergic effect of the atomized extract of rhizome of Curcuma longa, flowers of Cordia lutea, and leaves of Annona muricata. Materials and methods Twenty-four New Zealand white albino rabbits were randomized into 2 groups. Group A received the atomized extract diluted in physiological saline (APS) and group B received it diluted in Freund’s adjuvant (FA). Then, the back of each rabbit was divided into 4 quadrants. The A-I quadrant received only physiological saline. The A-I quadrants of each rabbit conformed the PS group. The following 3 quadrants received the APS in 10 μg/mL, 100 μg/mL, and 1,000 μg/mL, respectively. The B-I quadrant received only FA. The B-I quadrants of each rabbit conformed the FA group. The following 3 quadrants received the AFA in 10 μg/mL, 100 μg/mL, and 1,000 μg/mL, respectively. The occurrence of erythema and edema was recorded according to the Draize scoring system and the primary irritation index. After 72 hours, biopsies were performed. Results The AFA group presented significantly less erythema and edema compared to the FA group (Pmuricata lacks antigenic effect but could have an antiallergenic effect in a model of dermal irritation in rabbits. PMID:27877047

  2. icacy test of hexane extract of Annona squamosa L seeds for Chrysomya bezziana larvae growth in vitro

    Directory of Open Access Journals (Sweden)

    April H Wardhana

    2004-12-01

    Full Text Available Chrysomya bezziana is primer agent causing myiasis in livestock and human throughout Africa to Asia. At present, treatment of myiasis using chemical synthetic insecticide causing environment and livestock production contaminations. The aim of this study was to evaluate the effect of hexane extract of Annona squamosa L seed to kill C. bezziana as botanical insecticide. Three level and method preparation of larvae (L1, L2 and L3 were carried out. Meat blood mixture (MBM and larval rearing media (LRM were mixed with hexane extract of A. squamosa L seed and tested to 625 and 750 larvae (L1and L2 respectively, while for L3 625 larvae were soaked in the solution containing the hexane extract. This last preparation was carried out to observe the effect of toxic contact. Each larvae treatment was divided into 5 levels such as negative control using distillation water (PO, given 0.25% hexane extract (P I; 0.50% (P II; 0.75% (P III and positive control was given with 0.10% Asuntol®. This assay was to know digest toxic effect of hexane extract of A. squamosa L seed for those larvae. Number of 625 instar III larvae (L3 was soaked in the solution containing the hexane extract of A. squamosa L seed for 10 second, placed into vermicullite and incubated on 36oC. This assay was to know contact toxic effect of them. All of larvae were allowed to become pupae. Parameters oberserve were number of larvae death, pupae weight and number of pupae become into fly. The data was analyzed using Anova (5% and Z test (5% then smallest significant difference test (BNT 5%. The results showed that 0.50% of hexane extract of A. squamosa L seed was able to decrease pupae weight for L1 and L2 and to cause fail pupae become fly (P0.05.

  3. Assessment of the antioxidant, cytotoxic, and genotoxic potential of the Annona muricata leaves and their influence on genomic stability.

    Science.gov (United States)

    Acésio, Nathália Oliveira; Carrijo, Guilherme Scarano; Batista, Thales Henrique; Damasceno, Jaqueline Lopes; Côrrea, Mariana Beltrame; Tozatti, Marcos Gomide; Cunha, Wilson Roberto; Tavares, Denise Crispim

    2017-01-01

    The popular use of Annona muricata L. is based upon a range of medicinal purposes, and the plant exhibits biological activities including antihyperglycemic, antiparasitic, and antitumor activities. The objectives of this study were to examine the antioxidant, cytotoxic, and genotoxic potential of the hydroalcoholic extract of A. muricata leaves (AMEs), as well as its effects on genotoxicity induced by methyl methanesulfonate (MMS) and hydrogen peroxide (H 2 O 2 ). The results using 2,2-diphenyl-1-picrylhydrazyl assay showed that AME was able to scavenge 44.71% of free radicals. The extract significantly reduced the viability of V79 cells in the clonogenic assay at concentrations ≥8 µg/ml. No significant differences in micronucleus (MN) frequency were observed between V79 cell cultures treated with different concentrations of the extract (0.125, 0.25, 0.5, and 1 µg/ml) and negative control. When AME concentrations were combined with MMS, data revealed no marked differences from mutagen alone. In contrast, significant reductions in the frequencies of MN were noted in cultures treated with AME combined with H 2 O 2 compared to H 2 O 2 alone. In vivo studies found no significant differences in the frequencies of micronucleated polychromatic erythrocytes (MNPCEs) between animals treated with different AME doses compared to control. Animals treated with AME doses of 125 and 250 mg/kg and MMS exhibited significantly higher frequencies of MNPCE compared to mutagen alone. In conclusion, under current experimental conditions, AME was not genotoxic and exerted a modulatory effect on DNA damage depending upon the experimental conditions. The extract did not influence markedly MMS-induced genotoxicity in in vitro test system. However, the extract increased DNA damage induced by mutagen in mice. In V79 cells, AME reduced the genotoxicity produced by H 2 O 2 , and this protective effect was attributed in part to the antioxidant activity of AME.

  4. PHYSICOCHEMICAL CHARACTERISTICS AND FINITE ELEMENT SIMULATION OF FIRMNESS IN SOURSOP FRUITS (Annona muricata L. cv. Elita DURING POSTHARVEST

    Directory of Open Access Journals (Sweden)

    CARLOS J. MARQUEZ-CARDOZO

    2012-01-01

    Full Text Available Frutos de guanábana (Annona muricata L. cv Elita en diferentes etapas de maduración fueron evaluados, determinando sus características físico-químicas: sólidos solubles totales (SST, acidez y pH. La firmeza se encontró mediante la aplicación de pruebas de penetración uniaxial. El modelado y la simulación de la firmeza se llevó a cabo por el software Autodesk Inventor Professional 11.0 (ANSYS® Technology. Los frutos mostraron una tendencia creciente con respecto a los SST y la acidez, alcanzando valores máximos de 12,8°Brix y acidez de 0,74%, y un pH inferior a 3,43, valores que coinciden con la madurez de consumo, tal como se observa para el día 6. La Firmeza mostró una tendencia decreciente durante todo el período de poscosecha, con valores de 79,43 N para el día 0 y 3,62 N para el día 9. La simulación por elementos finitos de la fuerza de firmeza presentó alta correlación (>90 % con respecto a los datos experimentales. La simulación por elementos finitos se convierte en una alternativa no destructiva para la evaluación de la firmeza, útil para el almacenamiento, transporte, consumo en fresco, envasado y procesamiento de éstas frutas.

  5. Histomorphological and morphometric studies of the pancreatic islet cells of diabetic rats treated with extracts of Annona muricata.

    Science.gov (United States)

    Adeyemi, D O; Komolafe, O A; Adewole, O S; Obuotor, E M; Abiodun, A A; Adenowo, T K

    2010-05-01

    Microanatomical changes in the pancreatic islet cells of streptozotocin induced diabetic Wistar rats were studied after treatment with methanolic extracts of Annona muricata leaves. Thirty adult Wistar rats were randomly assigned into three groups (control, untreated diabetic group, and A. muricata-treated diabetic group) of ten rats each. Diabetes mellitus was experimentally induced in groups B and C by a single intra-peritoneal injection of 80 mg/kg streptozotocin dissolved in 0.1 M citrate buffer. The control rats were intraperitoneally injected with an equivalent volume of citrate buffer. Daily intra peritoneal injections of 100 mg/kg A. muricata were administered to group C rats for two weeks. Post sacrifice the pancreases of the rats were excised and fixed in Bouin's fluid. The tissues were processed for paraffin embedding and sections of 5 mum thickness were produced and stained with H & E, Gomori aldehyde fuchsin, and chrome alum haematoxylin-phloxine for demonstration of the beta-cells of islets of pancreatic islets. Histomorphological and morphometric examination of the stained pancreatic sections showed a significant increase in the number, diameter, and volume of the beta-cells of pancreatic islets of the A. muricata-treated group (5.67 +/- 0.184 N/1000 mum(2), 5.38 +/- 0.093 mum and 85.12 +/- 4.24 mum(3), respectively) when compared to that of the untreated diabetic group of rats (2.85 +/- 0.361 N/1000 mum(2), 2.85 +/- 0.362 mum and 69.56 +/- 5.216 mum(3), respectively). The results revealed regeneration of the beta-cells of islets of pancreatic islet of rats treated with extract of A. muricata.

  6. Antiallergic effect of the atomized extract of rhizome of Curcuma longa, flowers of Cordia lutea and leaves of Annona muricata.

    Science.gov (United States)

    Arroyo-Acevedo, Jorge; Franco-Quino, Cesar; Ruiz-Ramirez, Eliberto; Chávez-Asmat, Roberto; Anampa-Guzmán, Andrea; Raéz-González, Ernesto; Cabanillas-Coral, José

    2016-01-01

    Allergies are a problem that greatly affects the population, and hence the use of antiallergic medications is fairly widespread. However, these drugs have many adverse effects. The use of medicinal plants could be an option, but they need to be evaluated. This study was designed to evaluate the antiallergic effect of the atomized extract of rhizome of Curcuma longa , flowers of Cordia lutea , and leaves of Annona muricata . Twenty-four New Zealand white albino rabbits were randomized into 2 groups. Group A received the atomized extract diluted in physiological saline (APS) and group B received it diluted in Freund's adjuvant (FA). Then, the back of each rabbit was divided into 4 quadrants. The A-I quadrant received only physiological saline. The A-I quadrants of each rabbit conformed the PS group. The following 3 quadrants received the APS in 10 μg/mL, 100 μg/mL, and 1,000 μg/mL, respectively. The B-I quadrant received only FA. The B-I quadrants of each rabbit conformed the FA group. The following 3 quadrants received the AFA in 10 μg/mL, 100 μg/mL, and 1,000 μg/mL, respectively. The occurrence of erythema and edema was recorded according to the Draize scoring system and the primary irritation index. After 72 hours, biopsies were performed. The AFA group presented significantly less erythema and edema compared to the FA group ( P muricata lacks antigenic effect but could have an antiallergenic effect in a model of dermal irritation in rabbits.

  7. Gas exchange, phisiological indexes and ionic accumulation in Annona emarginata (Schltdl. H. Rainer seedlings in nutrients solution

    Directory of Open Access Journals (Sweden)

    Daniel Baron

    2013-06-01

    Full Text Available "Araticum-de-terra-fria" (Annona emarginata (Schltdl. H. Rainer has been consider a good alternative in rootstock production for the main commercial Annonaceae species. Although this species develops in different soil and climate conditions, there is no understanding by the physiological responses of this species at different nutritional levels. Thus, the objective of this study was to evaluate the influence of different ionic strengths on development of vegetative species known as "Araticum-de-terra-fria". It was evaluated in seedlings grown in different ionic strengths (25% I, 50% I, 75% I and 100% I of the complete nutrient solution Hoagland and Arnon (1950 nº 2, for 140 days, the following characteristics: Gas Exchange (CO2 assimilation rate, stomatal conductance, internal CO2 concentration, transpiration rate, water use efficiency, Rubisco carboxylation efficiency; Vegetative growth characteristics (diameter, leaf number, dry matter; Physiological Indexes (leaf area ratio, specific leaf area, relative growth rate, net assimilation rate, leaf weight ratio and Ionic Accumulation (nutrients leaf analysis. Seedlings grown under 50% I showed the highest values of Leaf CO2 assimilation rate, water use efficiency, carboxylation efficiency, growth, relative growth rate, net assimilation rate and ionic accumulation in the total dry matter. So it is concluded that "Araticum-de-terra-fria" seedlings grown under intermediate nutrient concentrations of complete nutrient solution Hoagland and Arnon (1950 nº 2, explored more adequately their physiological potential that justify their adaptation in different nutritional conditions and allow reducing the amount of mineral nutrition of seedlings production.

  8. The flavonoid content and antiproliferative, hypoglycaemic, anti-inflammatory and free radical scavenging activities of Annona dioica St. Hill

    Directory of Open Access Journals (Sweden)

    Formagio Anelise S N

    2013-01-01

    Full Text Available Abstract Background Annona dioica St. Hill (Annonacaeae is a Brazilian plant used in folk medicine for the treatment of several types of rheumatisms and diarrhoea. The focus of this work was to evaluate the in vitro antiproliferative and antioxidant activity and the in vivo hypoglycaemic and anti-inflammatory activity of A. dioica and identify the principal constituents of this plant. Methods The crude methanol extract (EAD and hexane (HF, chloroform (CF, ethyl acetate (EAF and hydromethanol fractions (HMF were evaluated for free radical scavenging activity using the DPPH assay. The EAD and EAF were assayed for hypoglycaemic activity in rats. The EAD was tested in an antiproliferation assay and for anti-inflammatory effects in paw oedema, in addition to myeloperoxidase activity induced by carrageenan (Cg in mice. The EAF was assayed using chromatographic methods. Results The fractionation of the EAF through chromatographic methods identified derivatives of the flavonoids quercetin and kaempferol. Among all the tested fractions, the ethyl acetate and hydromethanol fractions were the most potent, exhibiting an IC50 of 8.53 and 10.57 μg/mL, respectively, which is comparable to that of the commercial antioxidant butylated hydroxytoluene (BHT. The oral administration of the EAD (100 mg/kg and EAF (15 mg/kg inhibited the increase of glucose levels, resulting in a hypoglycaemic effect. The EAD (30 to 300 mg/kg exhibited an anti-oedematogenic effect in Cg-induced paw oedema in a time- and dose-dependent manner. The results showed a reduction of MPO activity by A. dioica 6 h after the induction of paw oedema at all doses tested with maximal inhibition at 300 mg/kg. Conclusions Our results reveal for the first time that compounds contained in the A. dioica leaves exert anti-inflammatory, hypoglycaemic, antiproliferative, and antioxidant effects. The antioxidant activity may be associated with the presence of flavonoids.

  9. The Annona muricata leaf ethanol extract affects mobility and reproduction in mutant strain NB327 Caenorhabditis elegans.

    Science.gov (United States)

    Bustos, A V Gualteros; Jiménez, M Gómez; Mora, R M Sánchez

    2017-07-01

    The C. elegans NB327 mutant strain is characterized for the knockdown of the dic-1 gene. The dic-1 gene is homologous to the dice-1 gene in humans, encoding the protein DICE-1 as a tumor suppressor. Absence or under-regulation of the dice-1 gene can be reflected in lung and prostate cancer [17], [18]. This study evaluated the effect of EEAML on the C. elegans NB327 mutant strain. Phenotypic aspects such as morphology, body length, locomotion, and reproductive behaviour were analyzed. It is important to emphasize that the strain presents a phenotype characteristic with respect to egg laying and hatching. Reported studies showed that Annona muricata extract and its active components evidence anti-cancer and anti-tumor effects, through experimentation in vivo and in vitro models. However, neurotoxicity has been reported as a side effect. The results showed that the mutant strain NB327 was exposed to EEAML (5 mg/ml) concentration, it showed a significant decrease in average locomotion, resulting in 13 undulations in 30 s. This contrasts with the control strain's 17.5 undulations in 30 s. Similarly, the number of progenies was reduced from 188 progenies (control strain) to 114 and 92 progenies at the dose of (1 mg/ml and 5 mg/m) EEAML. The results of this study suggest that EEAML has a possible neurotoxic effect in concentrations equal to or greater than 5 mg/ml. Also, it does not have positive effects on the mutant strain of Caenorhabditis elegans NB327 phenotype.

  10. The Annona muricata leaf ethanol extract affects mobility and reproduction in mutant strain NB327 Caenorhabditis elegans

    Directory of Open Access Journals (Sweden)

    A.V. Gualteros Bustos

    2017-07-01

    Full Text Available The C. elegans NB327 mutant strain is characterized for the knockdown of the dic-1 gene. The dic-1 gene is homologous to the dice-1 gene in humans, encoding the protein DICE-1 as a tumor suppressor. Absence or under-regulation of the dice-1 gene can be reflected in lung and prostate cancer [17,18]. This study evaluated the effect of EEAML on the C. elegans NB327 mutant strain. Phenotypic aspects such as morphology, body length, locomotion, and reproductive behaviour were analyzed. It is important to emphasize that the strain presents a phenotype characteristic with respect to egg laying and hatching. Reported studies showed that Annona muricata extract and its active components evidence anti-cancer and anti-tumor effects, through experimentation in vivo and in vitro models. However, neurotoxicity has been reported as a side effect. The results showed that the mutant strain NB327 was exposed to EEAML (5 mg/ml concentration, it showed a significant decrease in average locomotion, resulting in 13 undulations in 30 s. This contrasts with the control strain's 17.5 undulations in 30 s. Similarly, the number of progenies was reduced from 188 progenies (control strain to 114 and 92 progenies at the dose of (1 mg/ml and 5 mg/m EEAML. The results of this study suggest that EEAML has a possible neurotoxic effect in concentrations equal to or greater than 5 mg/ml. Also, it does not have positive effects on the mutant strain of Caenorhabditis elegans NB327 phenotype.

  11. Anticancer activity test of ethyl acetate extract of endophytic fungi isolated from soursop leaf (Annona muricata L.).

    Science.gov (United States)

    Minarni; Artika, I Made; Julistiono, Heddy; Bermawie, Nurliani; Riyanti, Eny Ida; Hasim; Hasan, Akhmad Endang Zainal

    2017-06-01

    To analyze anticancer activity of an ethyl acetate extract of endophytic fungi isolated from soursop leaf (Annona muricata L.). Anticancer activity of fungal extracts was determined by observing its toxicity against MCF-7 (Michigan Cancer Foundation-7) cells in vitro by using the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay method. At an extract concentration of 100 μg/mL, 4 isolates out of 12 showed high activity against the cancer cell growth. The four isolates were then selected for further IC 50 determination, by measuring the inhibition of cancer cell proliferation at extract concentration of 25 μg/mL, 50 μg/mL, 100 μg/mL, 200 μg/mL and 400 μg/mL. Results showed that isolate Sir-G5 had the highest anticancer activity with an IC 50 of 19.20 μg/mL. The best isolates were screened again using a normal cell (Chang cells) to determine its toxicity against normal cells. Results indicated that the extracts do not affect the proliferation of normal cells. Molecular identification showed that the fungal isolate Sir-G5 has a close relationship with Phomopsis sp. The endophytic fungi isolated from soursop leaf has the potential to be used as a source of anticancer agents. Copyright © 2017 Hainan Medical University. Production and hosting by Elsevier B.V. All rights reserved.

  12. Beneficial uses of paper mill residuals for New York State`s recycled-paper mills. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-09-01

    This report evaluates the New York paper mill industry in terms of the productive management and treatment of solid wastes. It identifies current efforts by recycling mills to beneficially use paper mill residuals (often called sludge) and suggests additional options that should be considered by the industry in general and individual mills in particular. It also examines the regulations and economics affecting the mills and suggests actions that could improve the industry`s ability to convert wastes to value-added products. The report recommends that the mills should continue measures to reduce fiber and filler clay losses, promote the transfer of usable fiber and clay to mills able to use them, upgrade sludge dewatering capabilities, and take a more regional approach to solid waste disposal problems. State agencies are urged to support these efforts, encourage the development and commercialization of new beneficial use technologies, and reduce regulatory barriers whenever possible.

  13. Understanding dental CAD/CAM for restorations - dental milling machines from a mechanical engineering viewpoint. Part A: chairside milling machines.

    Science.gov (United States)

    Lebon, Nicolas; Tapie, Laurent; Duret, Francois; Attal, Jean-Pierre

    2016-01-01

    The dental milling machine is an important device in the dental CAD/CAM chain. Nowadays, dental numerical controlled (NC) milling machines are available for dental surgeries (chairside solution). This article provides a mechanical engineering approach to NC milling machines to help dentists understand the involvement of technology in digital dentistry practice. First, some technical concepts and definitions associated with NC milling machines are described from a mechanical engineering viewpoint. The technical and economic criteria of four chairside dental NC milling machines that are available on the market are then described. The technical criteria are focused on the capacities of the embedded technologies of these milling machines to mill both prosthetic materials and types of shape restorations. The economic criteria are focused on investment costs and interoperability with third-party software. The clinical relevance of the technology is assessed in terms of the accuracy and integrity of the restoration.

  14. Decommissioning of the Zirovski Vrh Uranium Mill

    International Nuclear Information System (INIS)

    Zabukovec, I.; Logar, Z.; Arh, S.

    1996-01-01

    First of the inventions, which will ensure the beginning of the permanent closure of uranium ore exploitation and prevent the consequences of mining in the Zirovski Vrh Uranium Mine, abandoned according to the law from July 1992, will be soon realized. After obtaining the location permit for dismantling the equipment, foundations and installations in four main buildings of the uranium mill, current procedures are carried out in order to obtain the permission for performing the mentioned activities and to make contracts with acting organizations. Those buildings contain sources of radiation, which were considered within the legal procedures and design of technical documentation. Instructions for decontamination and protection against radiation, both issued with those projects, highly contribute to the Slovenian experience in the field of practical management of radiation sources. Additional requirement, which enters difference between decommissioning of similar mills worldwide and the one mentioned, is preservation of buildings in order to change their purpose. (author)

  15. An ambitwistor Yang-Mills Lagrangian

    International Nuclear Information System (INIS)

    Mason, L.J.; Skinner, D.

    2006-01-01

    We introduce a Chern-Simons Lagrangian for Yang-Mills theory as formulated on ambitwistor space via the Ward, Isenberg, Yasskin, Green, Witten construction. The Lagrangian requires the selection of a codimension-2 Cauchy-Riemann submanifold which is naturally picked out by the choice of space-time reality structure and we focus on the choice of Euclidean signature. The action is shown to give rise to a space-time action that is equivalent to the standard one, but has just cubic vertices. We identify the ambitwistor propagators and vertices and work out their corresponding expressions on space-time and momentum space. It is proposed that this formulation of Yang-Mills theory underlies the recursion relations of Britto, Cachazo, Feng and Witten and provides the generating principle for twistor diagrams for gauge theory

  16. Nonperturbative Results for Yang-Mills Theories

    DEFF Research Database (Denmark)

    Sannino, Francesco; Schechter, Joseph

    2010-01-01

    Some non perturbative aspects of the pure SU(3) Yang-Mills theory are investigated assuming a specific form of the beta function, based on a recent modification by Ryttov and Sannino of the known one for supersymmetric gauge theories. The characteristic feature is a pole at a particular value....... Assuming the usual QCD value one finds it to be 1.67 GeV, which is in surprisingly good agreement with a quenched lattice calculation. A similar calculation is made for the supersymmetric Yang-Mills theory where the corresponding beta function is considered to be exact....... of the coupling constant, g. First it is noted, using dimensional analysis, that physical quantities behave smoothly as one travels from one side of the pole to the other. Then it is argued that the form of the integrated beta function g(μ), where μ is the mass scale, determines the mass gap of the theory...

  17. Health concerns in uranium mining and milling

    International Nuclear Information System (INIS)

    Archer, V.E.

    1981-01-01

    Mortality of uranium miners from both lung cancer and other respiratory diseases is strongly dependent on exposure to radon daughters, cigarette smoking and height. Lung cancer among 15 different mining groups (uranium, iron, lead, zinc) was analyzed to determine what factors influence incidence and the induction-latent period. At low exposure or exposure rates, alpha radiation is more efficient in inducing lung cancer, producing an upward convex exposure-response curve. The induction-latent period is shortened by increased age at start of mining, by cigarette smoking and by high exposure rates. Instead of extrapolating downward from high exposures to estimate risk at low levels, it is suggested that it might be more appropriate to use cancer rates associated with background radiation as the lowest point on the exposure-response curve. Although health risks are much greater in uranium mines than mills, there is some health risk in the mills from long-lived radioactive materials

  18. Environmental impact of uranium mining and milling

    International Nuclear Information System (INIS)

    Dory, A.B.

    1981-08-01

    The author introduces the subject with an overview of the regulatory requirments and philosophy applied to uranium mines and mills. The special attention given to tailings management is highlighted, and a discussion of the basic environmental concerns is concluded with an itemizing of the main tasks facing the AECB. The extent of the environmental impact of uranium mining, milling and waste management is illustrated with specific details pertaining to mines in the Elliot Lake area. The author concludes that the impact on the ground and surface water system is not alarming, and the impact on air quality is not significant beyond a few hundred metres from the mining facilities. The publicly perceived impact is discussed, followed by a rationale for the continued licensing of new uranium mining operations complete with tailings management facilities

  19. Geothermal Mill Redevelopment Project in Massachusetts

    Energy Technology Data Exchange (ETDEWEB)

    Vale, A.Q.

    2009-03-17

    Anwelt Heritage Apartments, LLC redeveloped a 120-year old mill complex into a mixed-use development in a lower-income neighborhood in Fitchburg, Massachusetts. Construction included 84 residential apartments rented as affordable housing to persons aged 62 and older. The Department of Energy (“DOE”) award was used as an essential component of financing the project to include the design and installation of a 200 ton geothermal system for space heating and cooling.

  20. Kinetic reduction of mill scale via hydrogen

    Directory of Open Access Journals (Sweden)

    Gaballah N.M.

    2014-01-01

    Full Text Available Mill scale is very attractive industrial waste since it is rich in iron (about = 72 % Fe and it is suiTab. for direct recycling to the blast furnace via sintering plant. In this paper the characterizations of raw materials were studied by different methods of analyses. The produced briquettes were reduced with different amounts of hydrogen at varying temperatures, and the reduction kinetics was determined. Two models were applied and the energy of activation was calculated.

  1. Higher derivative super Yang-Mills theories

    NARCIS (Netherlands)

    Bergshoeff, E.; Rakowski, M.; Sezgin, E.

    1987-01-01

    The most general higher derivative Yang-Mills actions of the type (F^2 + α^2F^4) which are globally supersymmetric up to order α^2 in six- and ten-dimensional spacetimes are given. The F^4-terms turn out to occur in the combination α^2[tr F^4 - ¼(tr F^2)^2], where the trace is over the Lorentz

  2. Environmental impact of uranium mining and milling

    International Nuclear Information System (INIS)

    Dory, A.B.

    1981-08-01

    The Atomic Energy Control Board is now involved from the early planning stages in the development of uranium mine/mill facilities. As a result, new facilities (including tailings management areas) are designed and developed to meet a high standard. The impact of the mines and tailings areas in the Elliot Lake area on ground and surface waters and air quality is discussed in detail

  3. Chemical-milling solution for invar alloy

    Science.gov (United States)

    Batiuk, W.

    1980-01-01

    Excellent surface finishes and tolerances are achieved using two formulations. Solution A gives finish of 3.17 micrometers after milling at 57 to 63 deg C. Constituents of A are: Hydrofluoric acid (70%), 5,8 oz/gal; nitric acid (40-42) degrees Baume), 40 oz/gal. Alternative solution gives 2.16 micrometer finish, and differs from A by addition of 7% phosphoric acid. Formulations eliminate channeling at root fillets, dishing, island formation, and overhangs.

  4. Geometry of Yang-Mills fields

    International Nuclear Information System (INIS)

    Atiyah, M.F.

    1978-01-01

    In this talk I shall explain how information about classical solutions of Yang-Mills equations can be obtained, rather surprisingly, from algebraic geometry. Although direct physical interest is restricted to the case of four dimensions I shall begin by discussing the two-dimensional case. Besides preparing the ground for the four-dimensional problem this has independent mathematical (and possible physical) interest, and very complete results can be obtained. (orig.) [de

  5. Biologi Perbungaan Tanaman Avokad (Persea Americana Mill.)

    OpenAIRE

    SUKAMTO, L. AGUS

    1985-01-01

    L. AGUS SUKAMTO 1985.The flowering biology of avocado (Persea americana Mill.). Berita Biologi 3 (1) 8 - H.- A study on the flowering biology of avocado available at Bogor Botanic Garden was made.The observation was conducted in respects to the opening and closing of the flowers, the versality of the pollen grains which are then related to the fruit production.The climatic condition as well as pollination agents which may affect on the vertilization in avocado are also discussed.

  6. Multifractal properties of ball milling dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Budroni, M. A., E-mail: mabudroni@uniss.it; Pilosu, V.; Rustici, M. [Dipartimento di Chimica e Farmacia, Università degli Studi di Sassari, Via Vienna 2, Sassari 07100 (Italy); Delogu, F. [Dipartimento di Ingegneria Meccanica, Chimica, e dei Materiali, Università degli Studi di Cagliari, via Marengo 2, Cagliari 09123 (Italy)

    2014-06-15

    This work focuses on the dynamics of a ball inside the reactor of a ball mill. We show that the distribution of collisions at the reactor walls exhibits multifractal properties in a wide region of the parameter space defining the geometrical characteristics of the reactor and the collision elasticity. This feature points to the presence of restricted self-organized zones of the reactor walls where the ball preferentially collides and the mechanical energy is mainly dissipated.

  7. PENGARUH TEKNIK PENYAYATAN PAHAT MILLING PADA CNC MILLING 3 AXIS TERHADAP TINGKAT KEKASARAN PERMUKAAN BENDA BERKONTUR

    Directory of Open Access Journals (Sweden)

    Irawan Irawan

    2016-06-01

    Full Text Available Dalam perindustrian penggunaan mesin CNC Milling sangat di andalkan untuk mendapatkan hasil yang optimum baik secara kualitas maupun kuantitas. Akan tetapi muncul permasalahan,bagaimana pengaruh perbedaan teknik penyayatan terhadap nilai kekasaran permukaan benda kerja berkontur dalam proses milling CNC. Penelitian ini bertujuan untuk mengetahui pengaruh metode penyayatan pahat milling terhadap kekasaran permukaan benda kerja berkontur yang di hasilkan pada proses freis dengan menggunakan mesin milling CNC - 3Axis Makino S33. Peneliitan ini merancang dan membuat molding Cover stop kontak dikarenakan permukaan produk cover stop kontak memiliki permukaan yang berkontur. Molding ini terdiri dari Core dan Cavity. Benda kerja yang akan di ujicoba adalah bagian Core sebanyak 3 buah. Dalam pengerjaanya benda ujicoba diberikan perlakuan yang sama antara lain, kedalaman pemotongan, kecepatan spindle, dan jenis pahat yang di gunakan, kemudian dari ke 3 benda kerja tersebut masing- masing di tentukan 3 titik pengukuran. Dari hasil pengujian yang di peroleh kemudian dilakukan analisis tabel. Nilai kekasaran permukaan terendah (rata-rata kekasaran 0.899µ m dengan waktu permesinan tercepat (waktu proses 1 jam 08 menit pada penggunaan metode penyayatan 3D offset finishing. Penulis menyarankan agar dalam proses freis menggunakan mesin milling CNC 3Axis Makino S33 pada permukaan benda yang berkontur, untuk mendapatkan nilai kekasaran yang terendah disarankan menggunakan metode penyayatan 3D offset finishing.

  8. John Stuart Mill on socialism and accountability

    Directory of Open Access Journals (Sweden)

    Francisco José Sales Rocha

    2010-01-01

    Full Text Available http://dx.doi.org/10.5007/1677-2954.2010v9n1p17Este artigo mostra que o tipo de socialismo proposto por John Stuart Mill é marcado por uma forte preocupação com a controlabilidade do poder econômico e político. Ele rejeitou enfaticamente os modelos centralistas de socialismo por entender que eles levam a uma grande concentração de poder que compromete a liberdade. Para J. S. Mill, o socialismo deve ser implantado lentamente a partir de reformas amplamente discutidas que favoreçam a cidadania econômica dos trabalhadores, promovam a participação deles nas decisões referentes ao processo produtivo e em associações voluntárias. J. S. Mill acreditava que a competição econômica é essencial para o adequado funcionamento de uma economia socialista. Ele não esperava que tal economia se tornasse uma realidade em um futuro próximo.

  9. Loop groups in Yang–Mills theory

    Directory of Open Access Journals (Sweden)

    Alexander D. Popov

    2015-09-01

    Full Text Available We consider the Yang–Mills equations with a matrix gauge group G on the de Sitter dS4, anti-de Sitter AdS4 and Minkowski R3,1 spaces. On all these spaces one can introduce a doubly warped metric in the form ds2=−du2+f2dv2+h2dsH22, where f and h are the functions of u and dsH22 is the metric on the two-dimensional hyperbolic space H2. We show that in the adiabatic limit, when the metric on H2 is scaled down, the Yang–Mills equations become the sigma-model equations describing harmonic maps from a two-dimensional manifold (dS2, AdS2 or R1,1, respectively into the based loop group ΩG=C∞(S1,G/G of smooth maps from the boundary circle S1=∂H2 of H2 into the gauge group G. For compact groups G these harmonic map equations are reduced to equations of geodesics on ΩG, solutions of which yield magnetic-type configurations of Yang–Mills fields. The group ΩG naturally acts on their moduli space.

  10. Loop groups in Yang-Mills theory

    Science.gov (United States)

    Popov, Alexander D.

    2015-09-01

    We consider the Yang-Mills equations with a matrix gauge group G on the de Sitter dS4, anti-de Sitter AdS4 and Minkowski R 3 , 1 spaces. On all these spaces one can introduce a doubly warped metric in the form ds2 = - du2 +f2 dv2 +h2 d s H2 2 , where f and h are the functions of u and d s H2 2 is the metric on the two-dimensional hyperbolic space H2. We show that in the adiabatic limit, when the metric on H2 is scaled down, the Yang-Mills equations become the sigma-model equations describing harmonic maps from a two-dimensional manifold (dS2, AdS2 or R 1 , 1, respectively) into the based loop group ΩG =C∞ (S1 , G) / G of smooth maps from the boundary circle S1 = ∂H2 of H2 into the gauge group G. For compact groups G these harmonic map equations are reduced to equations of geodesics on ΩG, solutions of which yield magnetic-type configurations of Yang-Mills fields. The group ΩG naturally acts on their moduli space.

  11. Radiation hazards of uranium mining and milling

    International Nuclear Information System (INIS)

    Fry, R.M.

    1975-09-01

    This paper examines each of the radiological problems that arise in these processes and explains their scientific background. The major operational requirement is to ensure that exposure of miners over their working lives to radon and its daughter products does not lead to an unacceptable increase in their chance of contracting lung cancer. Studies on the incidence of lung cancer amongst underground uranium miners indicate that this risk will be small if lifetime exposures are kept below about 120 'working level months', even amongst underground miners who smoke cigarettes. The risk is much smaller again for miners who do not smoke cigarettes. Other hazards that must be controlled are exposure of miners and mill workers to external radiation and to dusts containing long-lived radioactive alpha emitting isotopes. Finally, the solid waste products from the mill (the tailings) which contain most of the naturally occurring radioactivity, must be properly impounded and after closure of the mill, stabilized to ensure long-term containment. Access by the public to the stabilized tailings must be controlled and habitation within the controlled area prohibited. (author)

  12. Continuum regularized Yang-Mills theory

    International Nuclear Information System (INIS)

    Sadun, L.A.

    1987-01-01

    Using the machinery of stochastic quantization, Z. Bern, M. B. Halpern, C. Taubes and I recently proposed a continuum regularization technique for quantum field theory. This regularization may be implemented by applying a regulator to either the (d + 1)-dimensional Parisi-Wu Langevin equation or, equivalently, to the d-dimensional second order Schwinger-Dyson (SD) equations. This technique is non-perturbative, respects all gauge and Lorentz symmetries, and is consistent with a ghost-free gauge fixing (Zwanziger's). This thesis is a detailed study of this regulator, and of regularized Yang-Mills theory, using both perturbative and non-perturbative techniques. The perturbative analysis comes first. The mechanism of stochastic quantization is reviewed, and a perturbative expansion based on second-order SD equations is developed. A diagrammatic method (SD diagrams) for evaluating terms of this expansion is developed. We apply the continuum regulator to a scalar field theory. Using SD diagrams, we show that all Green functions can be rendered finite to all orders in perturbation theory. Even non-renormalizable theories can be regularized. The continuum regulator is then applied to Yang-Mills theory, in conjunction with Zwanziger's gauge fixing. A perturbative expansion of the regulator is incorporated into the diagrammatic method. It is hoped that the techniques discussed in this thesis will contribute to the construction of a renormalized Yang-Mills theory is 3 and 4 dimensions

  13. Analysis of crystallite size and microdeformation crystal lattice the tungsten carbide milling in mill high energy

    International Nuclear Information System (INIS)

    Silva, F.T. da; Nunes, M.A.M.; Souza, C.P. de; Gomes, U.U.

    2010-01-01

    The tungsten carbide (WC) has wide application due to its properties like high melting point, high hardness, wear resistance, oxidation resistance and good electrical conductivity. The microstructural characteristics of the starting powders influences the final properties of the carbide. In this context, the use of nanoparticle powders is an efficient way to improve the final properties of the WC. The high energy milling stands out from other processes to obtain nanometric powders due to constant microstructural changes caused by this process. Therefore, the objective is to undertake an analysis of microstructural characteristics on the crystallite size and microdeformations of the crystal lattice using the technique of X-ray diffraction (XRD) using the Rietveld refinement. The results show an efficiency of the milling process to reduce the crystallite size, leading to a significant deformation in the crystal lattice of WC from 5h milling. (author)

  14. John Stuart Mill: utilitarismo e liberalismo = John Stuart Mill: utilitarianism and liberalism

    Directory of Open Access Journals (Sweden)

    Simões, Mauro Cardoso

    2013-01-01

    Full Text Available Meu objetivo, neste trabalho, é investigar a compatibilidade das teses utilitaristas e liberais de John Stuart Mill. Apresentarei, inicialmente, os principais críticos da filosofia moral e política de Mill, para os quais o discípulo de Bentham teria abandonado o utilitarismo ou, ainda, não esclarecido suficientemente seu princípio da liberdade, o que o tornaria um pensador assistemático e inconsistente. Minha tese é contrária a tais interpretações, uma vez que sustenta ser Mill consistente. Em seguida, defenderei uma interpretação do princípio da liberdade e da individualidade, procurando demonstrar que seu utilitarismo é compatível com seu liberalismo

  15. Milling damage on Carbon Fibre Reinforced Polymer using TiAlN coated End mills

    Science.gov (United States)

    Konneh, Mohamed; Izman, Sudin; Rahman Kassim, Abdullah Abdul

    2015-07-01

    This paper reports on the damage caused by milling Carbon Fibre Reinforced Composite (CFRP) with 2-flute 4 mm-diameter solid carbide end mills, coated with titanium aluminium nitride. The machining parameters considered in work are, rotation speed, feed rate and depth of cut. Experiments were designed based on Box-Behnken design and the experiments conducted on a Mikrotool DT-110 CNC micro machine. A laser tachometer was used to ascertain a rotational speed for conducting any machining trial. Optical microscopy examination reveals minimum delamination value of 4.05 mm at the spindle speed of 25,000 rpm, depth of cut of 50μm and feed rate of 3 mm/min and the maximum delamination value of 5.04 mm at the spindle speed of 35000 rpm, depth of cut of 150μm and feed rate of 9 mm/min A mathematical model relating the milling parameters and delamination has been established.

  16. Fenologia de Annona coriacea Mart. (Annonaceae em um fragmento de Cerrado sensu stricto em Rio Verde, Goiás (Nota Científica. Phenology of Annona coriacea Mart. (Annonaceae in a fragment of Cerrado sensu stricto in Rio Verde, Goiás (Scientific Note.

    Directory of Open Access Journals (Sweden)

    Michellia Pereira SOARES

    2013-06-01

    Full Text Available Estudos fenológicos são importantes para a compreensão da dinâmica das comunidades vegetais, para o entendimento da reprodução das espécies, da organização temporal dos recursos e da coevolução entre plantas e animais. Neste estudo, acompanhou-se a fenologia vegetativa e reprodutiva de 22 indivíduos de Annona coriacea Mart., durante 11 meses, em um fragmento de Cerrado sensu stricto no município de Rio Verde, Goiás, registrando-se os índices de atividade, intensidade e avaliando-se a sincronia das fenofases. A ocorrência da floração e brotamento no início das chuvas, a manutenção da produção de folhas adultas durante todo o período estudado e a maior intensidade de frutificação e senescência foliar durante a estiagem são estratégias características de uma planta adaptada à ocorrência de duas estações bem marcadas. Dessa forma, há indícios de que Annona coriacea responde à sazonalidade climática característica do Domínio Cerrado, já que a delimitação dos padrões fenológicos e da sazonalidade só é possível a partir de pelo menos dois anos de dados. Phenological studies are important for understanding the dynamics of plant communities, the reproduction of the species, the temporal organization of resources and coevolution between plants and animals. This study followed up the vegetative and reproductive phenology of 22 individuals of Annona coriacea Mart., for 11 months, in a fragment of Cerrado in Rio Verde, Goiás, recording activity and intensity index and evaluating the timing of phenophases. The occurrence of flowering and budding at the beginning of the rains, the continued production of mature leaves throughout the study period, and more intense fruiting and leaf senescence during drought are strategies proper of a plant adapted to the occurrence of two well-defined seasons. So, probably Annona coriacea responds to climatic seasonality characteristic of the Cerrado Domain because it is only

  17. Health physics program for the Edgemont Uranium Mill decommissioning project

    International Nuclear Information System (INIS)

    Polehn, J.L.; Wallace, R.G.; Reed, R.P.; Wilson, G.T.

    1986-01-01

    The Tennessee Valley Authority (TVA) is actively involved in decommissioning a uranium mill located near the town of Edgemont, South Dakota. The Edgemont Mill Decommissioning Project, which is unique in many respects, will involve dismantlement of the old inactive mill building and excavation and transportation of several million tons of uranium mill tailings to a permanent disposal site. To ensure that workers are adequately protected from radiation exposure during decommissioning operations, a health physics program appropriate for the decommissioning situation was developed. The Edgemont Mill Decommissioning Project Health Physics Manual (HPM) gives the programmatic requirements for worker radiation protection. The requirements of the HPM are implemented by means of detailed onsite operating procedures. The Edgemont project health physics program was developed using currently available regulations and guidance for an operating uranium mill with appropriate modifications for decommissioning. This paper discusses the development, implementation, and documentation of that program

  18. Fault Detection in Coal Mills used in Power Plants

    DEFF Research Database (Denmark)

    Odgaard, Peter Fogh; Mataji, Babak

    2006-01-01

    In order to achieve high performance and efficiency of coal-fired power plants, it is highly important to control the coal flow into the furnace in the power plant. This means suppression of disturbances and force the coal mill to deliver the required coal flow, as well as monitor the coal mill...... in order to detect faults in the coal mill when they emerge. This paper deals with the second objective. Based on a simple dynamic model of the energy balance a residual is formed for the coal mill. An optimal unknown input observer is designed to estimate this residual. The estimated residual is following...... tested on measured data of a fault in a coal mill, it can hereby be concluded that this residual is very useful for detecting faults in the coal mill....

  19. Nanograin formation in milled MoO3 powders

    International Nuclear Information System (INIS)

    Guerrero-Paz, J; Dorantes-Rosales, H; Aguilar-Martínez, J A; Garibay-Febles, V

    2013-01-01

    Powder of Molybdenum trioxide was milled for different times in horizontal ball mills. Such powder was characterized by TEM and XRD. Powder was rapidly de-agglomerated and fragmented up to attain nanoplates of two types, amorphous and crystalline. Finally, cold-welding of nanoplates occurred permitting some relaxation process to obtain a more stable energized structure consisting of equiaxial crystalline nanograins after 16 hours of milling.

  20. Inclusion of Yang–Mills fields in string corrected supergravity

    OpenAIRE

    Bellucci, S.; O'Reilly, D.

    2008-01-01

    We consistently incorporate Yang Mills matter fields into string corrected (deformed), D=10, N=1 Supergravity. We solve the Bianchi identities within the framework of the modified beta function favored constraints to second order in the string slope parameter $\\g$ also including the Yang Mills fields. In the torsion, curvature and H sectors we find that a consistent solution is readily obtained with a Yang Mills modified supercurrent $A_{abc}$. We find a solution in the F sector following our...

  1. Enraizamento de estacas de atemoieira ‘Gefner’ tratadas com auxinas Rooting of atemoya ‘Gefner’ cuttings treated with auxins

    Directory of Open Access Journals (Sweden)

    Gisela Ferreira

    2008-12-01

    Full Text Available A propagação da atemóia deve ser feita assexuadamente e, nesse contexto, a estaquia surge como alternativa. Dessa forma, objetivou-se determinar a parte do ramo de atemoieira (Annona cherimola Mill. x Annona squamosa L. cv. 'Gefner' mais apropriada para estaquia. O delineamento experimental foi o inteiramente casualizado, em esquema fatorial 3x3 (reguladores x tipos de estaca, com 5 repetições de 12 estacas. Os reguladores utilizados foram AIB 0,5% e ANA 0,5%, aplicados na forma de talco na base das estacas, além da testemunha. Os diferentes tipos de estacas foram retirados de 3 regiões do caule (apical, mediana e basal. As estacas tratadas foram colocadas para enraizar em bandejas de poliestireno contendo substrato comercial Plantmax® e levadas para câmara de nebulização intermitente, onde permaneceram durante 136 dias. As variáveis avaliadas foram: porcentagem de estacas vivas, porcentagem de estacas vivas com enraizamento, porcentagem de estacas enraizadas com folhas remanescentes, com brotações e com folhas remanescentes + brotações, porcentagem de estacas enraizadas sem folhas, número, comprimento médio e massa da matéria seca de raízes por estaca enraizada, área foliar e massa da matéria seca de folhas remanescentes e brotações. A atemoieira apresenta maior potencial para formação de mudas por estaquia empregando-se estacas apicais sem tratamento e medianas tratadas com ANA (0,5%.Atemoya propagation must be done asexually; in this context, cutting represents an alternative. This work aimed to verify the most appropriate branch part of atemoya (Annona cherimola Mill. x Annona squamosa L. cv. 'Gefner' for cutting. The experimental design was completely randomized, in a 3x3 factorial arrangement (plant growth regulators x cutting types, with 5 replicates of 12 cuttings. The plant growth regulators IBA 0.5% and NAA 0.5% were applied as talc in the base of cuttings, besides the control. The different cutting types were

  2. Annona muricata leaf extract-mediated silver nanoparticles synthesis and its larvicidal potential against dengue, malaria and filariasis vector.

    Science.gov (United States)

    Santhosh, S B; Yuvarajan, R; Natarajan, D

    2015-08-01

    Mosquitoes transmit several diseases which cause millions of deaths every year. The use of synthetic insecticides to control mosquitoes caused diverse effects to the environment, mammals, and high manufacturing cost. The present study was aimed to test the larvicidal activity of green synthesized silver nanoparticles using Annona muricata plant leaf extract against third instar larvae of three medically important mosquitoes, i.e., Aedes aegypti, Anopheles stephensi, and Culex quinquefasciatus. The different concentrations of green synthesized Ag Nanoparticles (AgNPs; 6, 12, 18, 24, 30 μg mL(-1)) and aqueous crude leaf extract (30, 60, 90, 120, 150 μg mL(-1)) were tested against the larvae for 24 h. Significant larval mortality was observed after the treatment of A. muricata for all mosquitoes with lowest LC50 and LC90 values, viz., A. aegypti (LC50 and LC90 values of 12.58 and 26.46 μg mL(-1)), A. stephensi (LC50 and LC90 values of 15.28 and 31.91 μg mL(-1)) and C. quinquefasciatus (LC50 and LC90 values of 18.77 and 35.72 μg mL(-1)), respectively. The synthesized AgNPs from A. muricata were highly toxic than aqueous crude extract. The nanoparticle characterization was done using spectral and microscopic analysis, namely UV-visible spectroscopy which showed a sharp peak at 420 nm of aqueous medium containing AgNPs, X-ray diffraction (XRD) analysis revealed the average crystalline size of synthesized AgNPs (approximately 45 nm), and Fourier transform infrared spectroscopy (FTIR) study exhibited prominent peaks 3381.28, 2921.03, 1640.17, 1384.58, 1075.83, and 610.77 cm(-1). Particle size analysis (PSA) showed the size and distribution of AgNPs (103 nm); field emission scanning electron microscopy (FE-SEM) and high-resolution transmission electron microscopy (HR-TEM) analysis showed a spherical shape, size range from 20 to 53 nm; and energy-dispersive X-ray spectroscopy (EDX) reflects the chemical composition of synthesized AgNPs. Heat stability of the AgNPs was

  3. Fases da germinação de sementes de Annona emarginata (Schltdl. H. Rainer em diferentes temperaturas Germination phases of Annona emarginata (Schltdl. H. Rainer seeds under different temperatures

    Directory of Open Access Journals (Sweden)

    Paula Nepomuceno Costa

    2011-03-01

    Full Text Available O presente trabalho foi realizado com o objetivo de identificar as fases da germinação de sementes de araticum-de-terra-fria (Annona emarginata (Schltdl. H. Rainer sob diferentes temperaturas. Para tanto, o trabalho foi dividido em dois experimentos: um para a determinação das fases I e II da germinação, e outro para a fase III. O delineamento experimental foi o inteiramente casualizado, com 3 tratamentos e 4 repetições de 25 sementes por parcela, em ambos os experimentos. Os tratamentos foram constituídos pelas temperaturas constantes de 25ºC e 30ºC e temperatura alternada de 20-30ºC (8-16 h, respectivamente, com luz constante. As variáveis analisadas foram a variação do grau de umidade ao longo do tempo (experimento 1, a porcentagem e a velocidade média de germinação (experimento 2. Os dados foram submetidos à análise de variância, as médias comparadas pelo teste Tukey, a 5% de probabilidade e regressão polinomial. A variação do grau de umidade ao longo do tempo foi estudada através da regressão não linear monomolecular, com os parâmetros das funções comparados conforme os tratamentos, ajustados, submetidos à análise de variância e teste Tukey, a 5% de probabilidade. Observou-se que as sementes mantidas a 30ºC apresentaram maiores valores para velocidade de aquisição de água, atingindo 27,85% de grau de umidade na mudança da fase I para a fase II. Quando as sementes foram submetidas a 25ºC, a fase I teve duração de 60 horas, atingindo 28,35% de grau de umidade e, sob 20/30ºC, a fase durou 72 horas, alcançando 28,33% de grau de umidade. Embora 30ºC tenha promovido a maior velocidade de embebição, não refletiu em maior porcentagem de germinação (fase III, que foi observada nas sementes mantidas a 20/30ºC.This study was carried out with the aimed to identify the germination phases of "araticum-de-terra-fria" (Annona emarginata (Schltdl. H. Rainer seeds under different temperatures. Thus, the work

  4. Field-ball milling induced anisotropy in magnetic particles

    Energy Technology Data Exchange (ETDEWEB)

    Poudyal, Narayan [Department of Physics, University of Texas at Arlington, Arlington, TX 76019 (United States); Altuncevahir, Baki [Department of Physics, University of Texas at Arlington, Arlington, TX 76019 (United States); Chakka, Vamsi [Department of Physics, University of Texas at Arlington, Arlington, TX 76019 (United States); Chen Kanghua [Department of Physics, University of Texas at Arlington, Arlington, TX 76019 (United States); Black, Truman D [Department of Physics, University of Texas at Arlington, Arlington, TX 76019 (United States); Liu, J Ping [Department of Physics, University of Texas at Arlington, Arlington, TX 76019 (United States); Ding, Yong [School of Materials Science and Engineering, Georgia Institute of Technology, Atlanta, GA 30332 (United States); Wang Zhonglin [School of Materials Science and Engineering, Georgia Institute of Technology, Atlanta, GA 30332 (United States)

    2004-12-21

    Nd{sub 2}Fe{sub 14}B and Sm{sub 2}Co{sub 17} particles of submicrometre sizes have been prepared by ball milling in a magnetic field. Structural and magnetic characterization reveal that these submicrometre particles milled in a magnetic field, consisting of nanosize grains, exhibit strong magnetic anisotropy compared with the particles milled without a magnetic field. Based on in situ observations of the field-ball milling in a transparent container, the mechanism of field-induced anisotropy in the nanostructured hard magnetic particles is discussed. (rapid communication)

  5. Mechanical intervention for reducing dust concentration in traditional rice mills

    OpenAIRE

    PRANAV, Prabhanjan K.; BISWAS, Mrinmoy

    2016-01-01

    A huge number of workers are employed in traditional rice mills where they are potentially exposed to dust. In this study a dust collection system was developed to capture the airborne dust in the rice mill. The feeding and sieving section of the mill was identified as major dust creating zone. The dust was captured by creating suitable air stream at feeding and sieving sections of the mill and collected in cyclone dust collector. The air stream was created by blower which was selected on the...

  6. Engineering assessment of inactive uranium mill tailings

    Energy Technology Data Exchange (ETDEWEB)

    1981-07-01

    The Grand Junction site has been reevaluated in order to revise the October 1977 engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Grand Junction, Colorado. This engineering assessment has included the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and radiation exposures of individuals and nearby populations, the investigations of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. Radon gas released from the 1.9 million tons of tailings at the Grand Junction site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The eight alternative actions presented herein range from millsite and off-site decontamination with the addition of 3 m of stabilization cover material (Option I), to removal of the tailings to remote disposal sites and decontamination of the tailings site (Options II through VIII). Cost estimates for the eight options range from about $10,200,000 for stabilization in-place to about $39,500,000 for disposal in the DeBeque area, at a distance of about 35 mi, using transportation by rail. If transportation to DeBeque were by truck, the cost estimated to be about $41,900,000. Three principal alternatives for the reprocessing of the Grand Junction tailings were examined: (a) heap leaching; (b) treatment at an existing mill; and (c) reprocessing at a new conventional mill constructed for tailings reprocessing. The cost of the uranium recovered would be about $200/lb by heap leach and $150/lb by conventional plant processes. The spot market price for uranium was $25/lb early in 1981. Therefore, reprocessing the tailings for uranium recovery appears not to be economically attractive.

  7. Engineering assessment of inactive uranium mill tailings

    International Nuclear Information System (INIS)

    1981-07-01

    The Grand Junction site has been reevaluated in order to revise the October 1977 engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Grand Junction, Colorado. This engineering assessment has included the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and radiation exposures of individuals and nearby populations, the investigations of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. Radon gas released from the 1.9 million tons of tailings at the Grand Junction site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The eight alternative actions presented herein range from millsite and off-site decontamination with the addition of 3 m of stabilization cover material (Option I), to removal of the tailings to remote disposal sites and decontamination of the tailings site (Options II through VIII). Cost estimates for the eight options range from about $10,200,000 for stabilization in-place to about $39,500,000 for disposal in the DeBeque area, at a distance of about 35 mi, using transportation by rail. If transportation to DeBeque were by truck, the cost estimated to be about $41,900,000. Three principal alternatives for the reprocessing of the Grand Junction tailings were examined: (a) heap leaching; (b) treatment at an existing mill; and (c) reprocessing at a new conventional mill constructed for tailings reprocessing. The cost of the uranium recovered would be about $200/lb by heap leach and $150/lb by conventional plant processes. The spot market price for uranium was $25/lb early in 1981. Therefore, reprocessing the tailings for uranium recovery appears not to be economically attractive

  8. El efecto antisenescente del resveratrol reduce la tasa de ablandamiento poscosecha de chirimoya

    Directory of Open Access Journals (Sweden)

    Aaran Aquilino Morales Pérez

    2014-01-01

    Full Text Available El fruto de chirimoya (Annona cherimolaMill. es muy susceptible al deterioroposcosechadebido a sunaturaleza climatérica. Con el fin de observar el efecto antisenescente del resveratrol (RVS, éste bioreguladorvegetal se aplicó en frutos de ‘Fino de Jete’ y ‘Bronceada’ a 1,6; 0,16; 0,016 y 0 mM a los 0, 8 y 15 días antesde la cosecha (DAC. A los 1, 7 y 15 días después de la cosecha (DDC se analizaron variables bioquímicas ybiofísicas. Al termino de 15 días de almacenamiento a temperatura ambiente, en relación al control, 1,6 mMRVS, aplicado 15 DAC, disminuyó el ablandamiento del fruto 78% para chirimoya ‘Fino de Jete’ y 54% para‘Bronceada’. A los 15 DDC se realizó la evaluación sensorial a frutos tratados 8 y15 DAC, los resultadosmostraron que los frutos de mayor aceptación fueron los tratados con 1,6 mM RVS ya sea a los 8 y 15 DAC,al ser calificados como de mejor aspecto, aroma y sabor.

  9. The anti-senescence effect of resveratrol reduces postharvest softening rate in cherimoya fruit

    Directory of Open Access Journals (Sweden)

    Aaran Aquilino Morales Pérez

    2014-03-01

    Full Text Available Due to its climateric behavior, the cherimoya fruit (Annona cherimola Mill. is a very perishable commodity. Present research aimed to observe the anti-senescence effect of resveratrol (RVS; this plant bioregulator was applied at 1.6, 0.16, 0.016 and 0 mM at 0, 8 and 15 days before harvest (DBH. At 1, 7 and 15 days of postharvest life, several physical and biochemical determinations were performed on the cherimoya fruit. After 15 days under room temperature conditions, in relation to control fruit, those fruit with 1.6 mM RVS applied 15 DBH reduced skin softening rate 78% and 54% for ‘Fino de Jete’ and ‘Bronceada’, respectively. Similarly, after 15 days of storage, a non-trained group of tasters preferred those fruit treated with 1.6 mM RVS 15 DBH; they qualified the fruit as better than the control fruit in presentation, aroma and taste.

  10. The fruit of Annona squamosa L. as a source of environmental neurotoxins: From quantification of squamocin to annotation of Annonaceous acetogenins by LC-MS/MS analysis.

    Science.gov (United States)

    Bonneau, Natacha; Baloul, Lamia; Bajin Ba Ndob, Idensi; Sénéjoux, François; Champy, Pierre

    2017-07-01

    Annonaceous acetogenins (AAGs) are neurotoxins possibly responsible for atypical Parkinsonism/dementia clusters, via the consumption of edible Annonaceae fruits. Their presence was investigated in fruit pulps of Annona squamosa from different locations. Qualitative analysis of other AAGs was performed. We here report the identification of squamocin in batches from Asia, the Caribbean Basin and the Indian Ocean. This molecule was quantified by HPLC-UV, evidencing a content of 13.5-36.4mg/fruit. HPLC-ESI-Q-TOF allowed the detection of 25 different raw formulas matching with AAGs. LC-MS/MS methodological development was performed using 4 representative standards. The main AAGs could be annotated, including bullatacin (rolliniastatin-2) and annonacin. This study evidences a remarkable homogeneity for the main AAGs within the species, and discrepancies for minor compounds. These findings indicate that A. squamosa should be considered a risk factor for neurodegenerative disorders. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Estudo fitoquímico e atividades leishmanicida, anticolinestarásica e antioxidante de extratos de Annona glabra L. (araticum panã

    Directory of Open Access Journals (Sweden)

    Antonio Adailson de Sousa Silva

    2015-10-01

    Full Text Available O objetivo deste estudo foi investigar as principais classes de compostos químicos presentes em Annona grabra L. (Araticum panã, e avaliar o seu potencial biológico analisando suas atividades antioxidante, antiacetilcolinesterase e leishmanicida. Para tanto, a entrecasca e sementes foram submetidas à extração em aparelho de soxhlet com os solventes orgânicos hexano, clorofórmio, acetato de etila e metanol, obtendo-se os respectivos extratos. Com os extratos foram realizados testes de prospecção fitoquímica, determinação da atividade antioxidante pelo método de inibição do radical livre DPPH e inibição da acetilcolinesterase em ensaio de cromatografia em camada delgada. Os testes de atividade leishmanicida in vitro em formas promastigotas de Leishmania infantum chagasi foram realizados em placa de 96 poços em aparelho ELISA. Os extratos foram testados a 100 μg/ mL. Os testes fitoquímicos revelaram a presença de esteroides, triterpenos, alcaloides, compostos fenólicos e saponinas. Todos os extratos apresentaram inibição da acetilcolinesterase e os extratos hexânicos de ambas partes mostraram maior percentual de inibição de L. infantum chagasi. Nestes extratos, compostos apolares como esteroides e triterpenos podem contribuir para a atividade leishmanicida. Os extratos de melhor atividade antioxidante foram o acetato de etila e metanólico da entrecasca e metanólico das sementes que correspondem aos que contem compostos fenólicos. Conclui-se que A. glabra constitui uma fonte potencial de agentes leishmanicida com possível mecanismo de ação pela inibição da enzima acetilcolinesterase das membranas da L. infantum chagasi, causador da leishmaniose visceral.Phytochemical study and leishmanicidal, anticholinesterase and antioxidant activities of Annona glabra L. (araticum panã extracts ABSTRACT The aim of this study was to investigate the main types of chemical constituents present in Annona grabra L. (araticum pan

  12. Nutritional Impacts of Different Whole Grain Milling Techniques: A Review of Milling Practices and Existing Data

    NARCIS (Netherlands)

    Miller Jones, J.; Adams, J.; Harriman, C.; Miller, C.; Kamp, J.W. van der

    2015-01-01

    The majority of whole grain flour is produced using modern milling techniques, usually with steel rollers, in which a batch of grain is separated into multiple millstreams, sifted, and recombined. In some cases constituent millstreams are purchased and combined by a supplier or end user to achieve a

  13. Nutritional impacts of different whole grain milling techniques : A review of milling practices and existing data

    NARCIS (Netherlands)

    Miller Jones, J.; Adams, J.; Harriman, C.; Miller, C.; Kamp, J.W. van der

    2015-01-01

    The majority of whole grain flour is produced using modern milling techniques, usually with steel rollers, in which a batch of grain is separated into multiple millstreams, sifted, and recombined. In some cases constituent millstreams are purchased and combined by a supplier or end user to achieve a

  14. Domestic uranium mining and milling industry 1991

    International Nuclear Information System (INIS)

    1992-12-01

    This report was prepared by the Energy Information Administration to provide the Secretary of Energy with basic data and analyses for ninth annual determination of the viability of the domestic uranium mining and milling industry. A viability determination is required annually, for the years 1983 through 1992, by Section 170B of the Nuclear Regulatory Commission (NRC) Authorization Act of 1983, Public Law 97-415, which amend the Atomic Energy Act of 1954. Topics include: evolution of the U.S. uranium industry; nuclear power requirements and uranium industry projections; and attributes of industry viability

  15. Air pollution control in kraft pulp mills.

    Science.gov (United States)

    Bhatia, S P; de Souza, T L; Azarniouch, M K; Prahacs, S

    1978-02-01

    A patented gas scrubbing process, whereby the emissions of malodorous reduced sulphur compounds are effectively and economically reduced, is described. Stack gases are scrubbed with an alkaline suspension of activated carbon. Reduced sulphur compounds as well as sulphur oxides are converted to sodium salts which are subsequently recovered and utilized for pulping. The process also reduces particulate emissions. It does not produce subsequent waste disposal problems and has little or, in some cases, zero net cost, on account of the simultaneous recovery of heat and chemicals. Furthermore, the paper also reviews some innovations made in gas chromatography techniques, for the measurement of trace quantities of sulphur compounds present in kraft mill emissions.

  16. Perturbative spacetimes from Yang-Mills theory

    Energy Technology Data Exchange (ETDEWEB)

    Luna, Andrés [School of Physics and Astronomy, University of Glasgow,Glasgow G12 8QQ, Scotland (United Kingdom); Monteiro, Ricardo [Theoretical Physics Department, CERN,Geneva (Switzerland); Nicholson, Isobel; Ochirov, Alexander; O’Connell, Donal [Higgs Centre for Theoretical Physics,School of Physics and Astronomy, The University of Edinburgh,Edinburgh EH9 3JZ, Scotland (United Kingdom); Westerberg, Niclas [Institute of Photonics and Quantum Sciences,School of Engineering and Physical Sciences, Heriot-Watt University,Edinburgh (United Kingdom); Higgs Centre for Theoretical Physics,School of Physics and Astronomy, The University of Edinburgh,Edinburgh EH9 3JZ, Scotland (United Kingdom); White, Chris D. [Centre for Research in String Theory,School of Physics and Astronomy, Queen Mary University of London,327 Mile End Road, London E1 4NS (United Kingdom)

    2017-04-12

    The double copy relates scattering amplitudes in gauge and gravity theories. In this paper, we expand the scope of the double copy to construct spacetime metrics through a systematic perturbative expansion. The perturbative procedure is based on direct calculation in Yang-Mills theory, followed by squaring the numerator of certain perturbative diagrams as specified by the double-copy algorithm. The simplest spherically symmetric, stationary spacetime from the point of view of this procedure is a particular member of the Janis-Newman-Winicour family of naked singularities. Our work paves the way for applications of the double copy to physically interesting problems such as perturbative black-hole scattering.

  17. Understanding Biomass Ignition in Power Plant Mills

    DEFF Research Database (Denmark)

    Schwarzer, Lars; Jensen, Peter Arendt; Glarborg, Peter

    2017-01-01

    Converting existing coal fired power plants to biomass is a readily implemented strategy to increase the share of renewable energy. However, changing from one fuel to another is not straightforward: Experience shows that wood pellets ignite more readily than coal in power plant mills or storages....... This is not very well explained by apply-ing conventional thermal ignition theory. An experimental study at lab scale, using pinewood as an example fuel, was conducted to examine self-heating and self-ignition. Supplemental experiments were performed with bituminous coal. Instead of characterizing ignition...

  18. YANG-MILLS FIELDS AND THE LATTICE.

    Energy Technology Data Exchange (ETDEWEB)

    CREUTZ,M.

    2004-05-18

    The Yang-Mills theory lies at the heart of our understanding of elementary particle interactions. For the strong nuclear forces, we must understand this theory in the strong coupling regime. The primary technique for this is the lattice. While basically an ultraviolet regulator, the lattice avoids the use of a perturbative expansion. I discuss some of the historical circumstances that drove us to this approach, which has had immense success, convincingly demonstrating quark confinement and obtaining crucial properties of the strong interactions from first principles.

  19. Self-Improving CNC Milling Machine

    OpenAIRE

    Spilling, Torjus

    2014-01-01

    This thesis is a study of the ability of a CNC milling machine to create parts for itself, and an evaluation of whether or not the machine is able to improve itself by creating new machine parts. This will be explored by using off-the-shelf parts to build an initial machine, using 3D printing/rapid prototyping to create any special parts needed for the initial build. After an initial working machine is completed, the design of the machine parts will be adjusted so that the machine can start p...

  20. Technological system self-tuning when milling

    Directory of Open Access Journals (Sweden)

    Kozlov Aleksandr

    2017-01-01

    Full Text Available This paper reports the dynamics of the technological system during the milling of complex parts and the investigations of possibility in efficiency increase of a cutting process at the expense of conditions creation for a system self-tuning at which a general level of oscillations will not decrease in it. This can be achieved with a special damping device located on the machine screw gears supports. In this case, if the period of the wave on the cutting surface does not coincide with the period of natural oscillations, then there will be no resonance, and the level of oscillations will be much smaller.