WorldWideScience

Sample records for anlagenbau ag o-1140

  1. AGS experiments -- 1991, 1992, 1993

    International Nuclear Information System (INIS)

    Depken, J.C.

    1994-04-01

    This report contains: (1) FY 1993 AGS schedule as run; (2) FY 1994--95 AGS schedule; (3) AGS experiments ≥ FY 1993 (as of 30 March 1994); (4) AGS beams 1993; (5) AGS experimental area FY 1991 physics program; (6) AGS experimental area FY 1992 physics program; (7) AGS experimental area FY 1993 physics program; (8) AGS experimental area FY 1994 physics program (planned); (9) a listing of experiments by number; (10) two-page summaries of each experiment; (11) listing of publications of AGS experiments; and (12) listing of AGS experiments

  2. AGS experiments - 1994, 1995, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1997-01-01

    This report contains the following information on the Brookhaven AGS Accelerator complex: FY 1996 AGS schedule as run; FY 1997 AGS schedule (working copy); AGS beams 1997; AGS experimental area FY 1994 physics program; AGS experimental area FY 1995 physics program; AGS experimental area FY 1996 physics program; AGS experimental area FY 1997 physics program (in progress); a listing of experiments by number; two-phage summaries of each experiment begin here, also ordered by number; listing of publications of AGS experiments begins here; and listing of AGS experimenters begins here.

  3. AGS experiments - 1994, 1995, 1996

    International Nuclear Information System (INIS)

    Depken, J.C.

    1997-01-01

    This report contains the following information on the Brookhaven AGS Accelerator complex: FY 1996 AGS schedule as run; FY 1997 AGS schedule (working copy); AGS beams 1997; AGS experimental area FY 1994 physics program; AGS experimental area FY 1995 physics program; AGS experimental area FY 1996 physics program; AGS experimental area FY 1997 physics program (in progress); a listing of experiments by number; two-phage summaries of each experiment begin here, also ordered by number; listing of publications of AGS experiments begins here; and listing of AGS experimenters begins here

  4. @AuAg nanostructures

    Science.gov (United States)

    Singh, Rina; Soni, R. K.

    2014-09-01

    Bimetallic and trimetallic nanoparticles have attracted significant attention in recent times due to their enhanced electrochemical and catalytic properties compared to monometallic nanoparticles. The numerical calculations using Mie theory has been carried out for three-layered metal nanoshell dielectric-metal-metal (DMM) system consisting of a particle with a dielectric core (Al@Al2O3), a middle metal Ag (Au) layer and an outer metal Au (Ag) shell. The results have been interpreted using plasmon hybridization theory. We have also prepared Al@Al2O3@Ag@Au and Al@Al2O3@AgAu triple-layered core-shell or alloy nanostructure by two-step laser ablation method and compared with calculated results. The synthesis involves temporal separations of Al, Ag, and Au deposition for step-by-step formation of triple-layered core-shell structure. To form Al@Ag nanoparticles, we ablated silver for 40 min in aluminium nanoparticle colloidal solution. As aluminium oxidizes easily in water to form alumina, the resulting structure is core-shell Al@Al2O3. The Al@Al2O3 particle acts as a seed for the incoming energetic silver particles for multilayered Al@Al2O3@Ag nanoparticles is formed. The silver target was then replaced by gold target and ablation was carried out for different ablation time using different laser energy for generation of Al@Al2O3@Ag@Au core-shell or Al@Al2O3@AgAu alloy. The formation of core-shell and alloy nanostructure was confirmed by UV-visible spectroscopy. The absorption spectra show shift in plasmon resonance peak of silver to gold in the range 400-520 nm with increasing ablation time suggesting formation of Ag-Au alloy in the presence of alumina particles in the solution.

  5. AGS experiments: 1993 - 1994 - 1995

    International Nuclear Information System (INIS)

    Depken, J.C.

    1996-04-01

    This report contains: FY 1995 AGS Schedule as Run; FY 1996-97 AGE Schedule (working copy); AGS Beams 1995; AGS Experimental Area FY 1993 Physics Program; AGS Experimental Area FY 1994 Physics Program; AGS Experimental Area FY 1995 Physics Program; AGS Experimental Area FY 1996 Physics Program (In progress); A listing of experiments by number; Two-page summaries of each experiment begin here, also ordered by number; Listing of publications of AGS experiments begins here; and Listing of AGS experimenters begins here. This is the twelfth edition

  6. AGS experiments: 1993 - 1994 - 1995

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1996-04-01

    This report contains: FY 1995 AGS Schedule as Run; FY 1996-97 AGE Schedule (working copy); AGS Beams 1995; AGS Experimental Area FY 1993 Physics Program; AGS Experimental Area FY 1994 Physics Program; AGS Experimental Area FY 1995 Physics Program; AGS Experimental Area FY 1996 Physics Program (In progress); A listing of experiments by number; Two-page summaries of each experiment begin here, also ordered by number; Listing of publications of AGS experiments begins here; and Listing of AGS experimenters begins here. This is the twelfth edition.

  7. AGS intensity record

    International Nuclear Information System (INIS)

    Bleser, Ed

    1994-01-01

    As flashed in the September issue, this summer the Brookhaven Alternating Gradient Synchrotron (AGS) reached a proton beam intensity of 4.05 x 10 13 protons per puise, claimed as the highest intensity ever achieved in a proton synchrotron. It is, however, only two-thirds of the way to its final goal of 6 x 10 13 . The achievement is the resuit of many years of effort. The Report of the AGS II Task Force, issued in February 1984, laid out a comprehensive programme largely based on a careful analysis of the PS experience at CERN. The AGS plan had two essential components: the construction of a new booster, and major upgrades to the AGS itself.

  8. Tunneling-recombination luminescence between Ag0 and Ag2+ in KCl:AgCl

    International Nuclear Information System (INIS)

    Delbecq, C.J.; Dexter, D.L.; Yuster, P.H.

    1978-01-01

    Appropriate treatment of a KCl:AgCl crystal results in the trapping of electrons as silver atoms, Ag 0 , and positive holes as AgCl 4 2- , Ag 2+ , centers. Optical excitation of Ag 0 in such a crystal at T 0 and Ag 2+ pairs, similar to the Ag 0 -Cl 2 - tunneling-recombination studies we previously reported. We have shown that Ag 2+ centers are involved in the emission process by preferentially orienting the anisotropic Ag 2+ at 6 K by excitation with polarized light and observing that the afterglow is polarized. Upon warming to 50 K, where the preferentially oriented Ag 2+ can change orientation, a strong reversal in the degree of polarization occurs which finally decays to zero. The characteristics of this luminescence can be understood if we assume: (i) a tunneling-recombination mechanism in which the orientation of the electric vector of the emitted radiation depends on the position of the Ag 0 relative to the Ag 2+ and (ii) the tunneling is anisotropic and depends on the location of the Ag 0 relative to the anisotropic Ag 2+ . The latter assumption is based on the tetragonal (d-like) symmetry of the Ag 2+ complex. Good quantitative agreement between theory and experiment has been obtained on the decay kinetics, the degree of polarization, and the polarization reversal

  9. Sn-In-Ag phase equilibria and Sn-In-(Ag)/Ag interfacial reactions

    International Nuclear Information System (INIS)

    Chen Sinnwen; Lee Wanyu; Hsu Chiaming; Yang Chingfeng; Hsu Hsinyun; Wu Hsinjay

    2011-01-01

    Research highlights: → Thermodynamic models of Sn-In and Sn-In-Ag are developed using the CALPHAD approach. → Reaction layer in the Sn-In-(Ag)/Ag couples at 100 deg. C is thinner than those at 25 deg. C, 50 deg. C, and 75 deg. C. → Reactions in the Sn-20 wt%In-2.8 wt%Ag/Ag couples are faster than those in the Sn-20 wt%In/Ag couples. - Abstract: Experimental verifications of the Sn-In and Sn-In-Ag phase equilibria have been conducted. The experimental measurements of phase equilibria and thermodynamic properties are used for thermodynamic modeling by the CALPHAD approach. The calculated results are in good agreement with experimental results. Interfacial reactions in the Sn-In-(Ag)/Ag couples have been examined. Both Ag 2 In and AgIn 2 phases are formed in the Sn-51.0 wt%In/Ag couples reacted at 100 and 150 deg. C, and only the Ag 2 In phase is formed when reacted at 25, 50 and 75 deg. C. Due to the different growth rates of different reaction phases, the reaction layer at 100 deg. C is thinner than those at 25 deg. C, 50 deg. C, and 75 deg. C. In the Sn-20.0 wt%In/Ag couples, the ζ phase is formed at 250 deg. C and ζ/AgIn 2 phases are formed at 125 deg. C. Compared with the Sn-20 wt%In/Ag couples, faster interfacial reactions are observed in the Sn-20.0 wt%In-2.8 wt%Ag/Ag couples, and minor Ag addition to Sn-20 wt%In solder increases the growth rates of the reaction phases.

  10. AGS experiments: 1990, 1991, 1992

    International Nuclear Information System (INIS)

    Depken, J.C.

    1993-04-01

    This report contains a description of the following: AGS Experimental Area - High Energy Physics FY 1993 and Heavy Ion Physics FY 1993; Table of Beam Parameters and Fluxes; Experiment Schedule ''as run''; Proposed 1993 Schedule; A listing of experiments by number; Two-page summaries of each experiment begin here, also ordered by number; Publications of AGS Experiments; and List of AGS Experimenters

  11. Ag K- and L3-edge XAFS study on Ag species in Ag/Ga2O3 photocatalysts

    International Nuclear Information System (INIS)

    Yamamoto, M; Yamamoto, N; Yoshida, T; Nomoto, T; Yamamoto, A; Yoshida, H; Yagi, S

    2016-01-01

    Ag loaded Ga 2 O 3 (Ag/Ga 2 O 3 ) shows photocatalytic activity for reduction of CO 2 with water. Ag L 3 -edge XANES and K-edge EXAFS spectra were measured for various Ag/Ga 2 O 3 samples, which suggested that structural and chemical states of Ag species varied with the loading amount of Ag and the preparation method. The Ag species were metallic Ag particles with an AgGaO 2 -like interface structure in the sample with high loading amount of Ag while predominantly Ag metal clusters in the sample with low loading amount of Ag. The XANES feature just above the edge represented the interaction between the Ag species and the Ga 2 O 3 surface, showing that the Ag metal clusters had more electrons in the d -orbitals by interacting with the Ga 2 O 3 surface, which would contribute the high photocatalytic activity. (paper)

  12. Ag transport in CrN-Ag nanocomposite coatings

    Energy Technology Data Exchange (ETDEWEB)

    Mulligan, C.P. [Department of Materials Science and Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); U.S. Army Armament Research Development and Engineering Center, Benet Laboratories, Watervliet, NY 12189 (United States); Papi, P.A. [Department of Materials Science and Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Gall, D., E-mail: galld@rpi.edu [Department of Materials Science and Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States)

    2012-09-01

    2-{mu}m-thick CrN-Ag composite coatings containing 22 at.% Ag were deposited on Si(001) by reactive co-sputtering at T{sub s} = 300, 400, and 500 Degree-Sign C. Subsequent vacuum annealing at T{sub a} = 425, 525, and 625 Degree-Sign C causes Ag transport to the surface. Auger electron spectroscopy and plan-view microscopy are used to quantify the Ag transport to the surface, which increases strongly with increasing {Delta}T = T{sub a} - T{sub s}. Compositional depth profiles and cross-sectional microscopy show that annealing causes a negligible Ag gradient through the composite layer, suggesting that the Ag transport is detachment-limited as opposed to diffusion-limited. Statistical analyses of Ag aggregate size-distributions within the matrix show that large aggregates ({>=} 50 nm) are unaffected by annealing, while the Ag in a large fraction of small aggregates (< 50 nm) moves to the surface, leaving behind 10-50 nm wide voids in the annealed composite. This indicates that the Ag from the smaller grains, with a higher chemical potential and thus a higher detachment rate, is transferred to the large grains on the surface which are 200-1000 nm wide. - Highlights: Black-Right-Pointing-Pointer CrN-Ag coatings were deposited at T{sub s} = 300-500 Degree-Sign C and annealed at T{sub a} = 425-625 Degree-Sign C. Black-Right-Pointing-Pointer Ag diffuses from aggregates in the coating to the surface, if T{sub a} > T{sub s}. Black-Right-Pointing-Pointer During annealing, aggregates < 50 nm become voids, those > 50 nm are unaffected. Black-Right-Pointing-Pointer The Ag transport is detachment rather than diffusion limited.

  13. AGS experiments -- 1995, 1996 and 1997

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.; Presti, P.L.

    1997-12-01

    This report contains (1) FY 1995 AGS schedule as run; (2) FY 1996 AGS schedule as run; (3) FY 1997 AGS schedule as run; (4) FY 1998--1999 AGS schedule (proposed); (5) AGS beams 1997; (6) AGS experimental area FY 1995 physics program; (7) AGS experimental area FY 1996 physics program; (8) AGS experimental area FY 1997 physics program; (9) AGS experimental area FY 1998--1999 physics program (proposed); (10) a listing of experiments by number; (11) two-page summaries of each experiment, in order by number; and (12) listing of publications of AGS experiments.

  14. AGS experiments - 1995, 1996 and 1997

    International Nuclear Information System (INIS)

    Depken, J.C.; Presti, P.L.

    1997-12-01

    This report contains (1) FY 1995 AGS schedule as run; (2) FY 1996 AGS schedule as run; (3) FY 1997 AGS schedule as run; (4) FY 1998--1999 AGS schedule (proposed); (5) AGS beams 1997; (6) AGS experimental area FY 1995 physics program; (7) AGS experimental area FY 1996 physics program; (8) AGS experimental area FY 1997 physics program; (9) AGS experimental area FY 1998--1999 physics program (proposed); (10) a listing of experiments by number; (11) two-page summaries of each experiment, in order by number; and (12) listing of publications of AGS experiments

  15. AGS experiments -- 1991, 1992, 1993. Tenth edition

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1994-04-01

    This report contains: (1) FY 1993 AGS schedule as run; (2) FY 1994--95 AGS schedule; (3) AGS experiments {ge} FY 1993 (as of 30 March 1994); (4) AGS beams 1993; (5) AGS experimental area FY 1991 physics program; (6) AGS experimental area FY 1992 physics program; (7) AGS experimental area FY 1993 physics program; (8) AGS experimental area FY 1994 physics program (planned); (9) a listing of experiments by number; (10) two-page summaries of each experiment; (11) listing of publications of AGS experiments; and (12) listing of AGS experiments.

  16. AGS polarized H- source

    International Nuclear Information System (INIS)

    Kponou, A.; Alessi, J.G.; Sluyters, T.

    1985-01-01

    The AGS polarized H - source is now operational. During a month-long experimental physics run in July 1984, pulses equivalent to 15 μA x 300 μs (approx. 3 x 10 10 protons) were injected into the RFQ preaccelerator. Beam polarization, measured at 200 MeV, was approx. 75%. After the run, a program to increase the H - yield of the source was begun and significant progress has been made. The H - current is now frequently 20 to 30 μA. A description of the source and some details of our operating experience are given. We also briefly describe the improvement program

  17. Preparation and antibacterial activities of Ag/Ag+/Ag3+ nanoparticle composites made by pomegranate (Punica granatum) rind extract

    Science.gov (United States)

    Yang, Hui; Ren, Yan-yu; Wang, Tao; Wang, Chuang

    Nano-silver and its composite materials are widely used in medicine, food and other industries due to their strong conductivity, size effect and other special performances. So far, more microbial researches have been applied, but a plant method is rarely reported. In order to open up a new way to prepare AgNP composites, pomegranate peel extract was used in this work to reduce Ag+ to prepare Ag/Ag+/Ag3+ nanoparticle composites. UV-Vis was employed to detect and track the reduction of Ag+ and the forming process of AgNPs. The composition, structure and size of the crystal were analyzed by XRD and TEM. Results showed that, under mild conditions, pomegranate peel extract reacted with dilute AgNO3 solution to produce Ag/Ag+/Ag3+ nanoparticle composites. At pH = 8 and 10 mmol/L of AgNO3 concentration, the size of the achieved composites ranged between 15 and 35 nm with spherical shapes and good crystallinity. The bactericidal experiment indicated that the prepared Ag/Ag+/Ag3+ nanoparticles had strong antibacterial activity against gram positive bacteria and gram negative bacteria. FTIR analysis revealed that biological macromolecules with groups of sbnd NH2, sbnd OH, and others were distributed on the surface of the newly synthesized Ag/Ag+/Ag3+ nanoparticles. This provided a useful clue to further study the AgNP biosynthesis mechanism.

  18. EPIDAUROS Biotechnologie AG.

    Science.gov (United States)

    Arnold, Hans-Peter; Kluge, Peter; Mauch, Simon

    2005-07-01

    EPIDAUROS Biotechnologie AG is a leading provider of pharmacogenetic consulting, genotyping and research services to the international pharmaceutical and biotechnology industries, contract research organizations and healthcare providers. The company's mission is to improve safety, efficacy and predictability in drug development and drug therapy. EPIDAUROS determines its customers' needs in the field of pharmacogenetics using an in-depth consultancy process. The development and conduct of genotyping assays for drug-metabolizing enzymes, drug transporters and drug targets (for example, receptors)--all performed under stringent quality standards--are a major activity at EPIDAUROS. The company offers its research services to academic and industrial partners for the development of innovative diagnostic solutions by using its intellectual property.

  19. BROOKHAVEN: AGS improvements

    International Nuclear Information System (INIS)

    Bleser, Ed

    1994-01-01

    The new Booster - AGS Alternating Gradient Synchrotron complex is providing beam while machine development to enhance performance also progresses, so far on schedule. In 1991 the Booster turned on and performed as requested - attesting to a successful construction and quality control programme. In 1992 beam was provided to users while the Booster met most of its operational goals - falling slightly short of its proton intensity goal of 0.5 x 10 13 protons per pulse (ppp). This would have been inconsequential except that the Booster intensity seemed to be hitting a fairly solid brick wall of undetermined origin. Since the goal for 1993 called for a doubling of the intensity, the situation seemed serious enough to schedule three months (February - April 1993) for Booster development

  20. AGS Experiments: 1989, 1990, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1992-02-01

    This report contains: Experimental areas layout; table of beam parameters and fluxes; experiment schedule as run''; proposed 1992 schedule; a listing of experiments by number; two-page summaries of each experiment begin here, also ordered by number; publications of AGS Experiments begin here; and list of AGS Experimenters begins here.

  1. AGS Experiments: 1989, 1990, 1991

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1992-02-01

    This report contains: Experimental areas layout; table of beam parameters and fluxes; experiment schedule ``as run``; proposed 1992 schedule; a listing of experiments by number; two-page summaries of each experiment begin here, also ordered by number; publications of AGS Experiments begin here; and list of AGS Experimenters begins here.

  2. AGS Experiments: 1989, 1990, 1991

    International Nuclear Information System (INIS)

    Depken, J.C.

    1992-02-01

    This report contains: Experimental areas layout; table of beam parameters and fluxes; experiment schedule ''as run''; proposed 1992 schedule; a listing of experiments by number; two-page summaries of each experiment begin here, also ordered by number; publications of AGS Experiments begin here; and list of AGS Experimenters begins here

  3. Construction of Ag/AgCl nanostructures from Ag nanoparticles as high-performance visible-light photocatalysts

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Fan; Liu, Dongzhi; Wang, Tianyang; Li, Wei [Tianjin University, School of Chemical Engineering and Technology (China); Hu, Wenping [Tianjin University, Collaborative Innovation Center of Chemical Science and Engineering (China); Zhou, Xueqin, E-mail: zhouxueqin@tju.edu.cn [Tianjin University, School of Chemical Engineering and Technology (China)

    2016-11-15

    A combined strategy of in situ oxidation and assembly is developed to prepare Ag/AgCl nanospheres and nanocubes from Ag nanoparticles under room temperature. It is a new facile way to fabricate Ag/AgCl with small sizes and defined morphologies. Ag/AgCl nanospheres with an average size of 80 nm were achieved without any surfactants, while Ag/AgCl nanocubes with a mean edge length of 150 nm were obtained by introduction of N-dodecyl-N,N-dimethyl-2-ammonio-acetate. The possible formation mechanism involves the self-assembly of AgCl nanoparticles, Ostwald ripening and photoreduction of Ag{sup +} into Ag{sup 0} by the room light. The as-prepared Ag/AgCl nanospheres and nanocubes exhibit excellent photocatalytic activity and stability toward degradation of organic pollutants under visible-light irradiation. It is demonstrated that Ag/AgCl nanocubes display enhanced photocatalytic activity in comparison with Ag/AgCl nanospheres due to the more efficient charge transfer. This work may pave an avenue to construct various functional materials via the assembly strategy using nanoparticles as versatile building blocks.

  4. Bioceres: AG Biotechnology from Argentina

    Directory of Open Access Journals (Sweden)

    Roberto Feeney

    2016-04-01

    Full Text Available In this case we present a business decision-making situation in which the CEO of an Argentine Ag Biotech company, Bioceres, has to decide the best way to commercialize a new drought-tolerant transgenic technology. The company was founded by twenty three farmers, who shared a common dream that Argentina could become a benchmark in the development of Ag biotechnology. The case has strategic and financial implications, as well as decision-making situation involving a joint venture with an American biotechnology company. It also introduces to discussion the business models of Ag biotechnology companies in developing countries.

  5. Neutrino physics at the AGS

    International Nuclear Information System (INIS)

    Sokolsky, P.

    1978-01-01

    The AGS neutrino beam is the last low energy (1 to 2 GeV) neutrino beam left. As more work is done at higher energies and as the whole realm of new physics (whose threshold seems barely attainable at AGS ν energies) is explored in increasing detail, it is appropriate to ask what physics remains to be done here. To answer this question, current theory and experiment are confronted, not in an attempt to confirm or refute theoretical (or experimental) prejudices, but to ask if present experiments at low energies are good enough. In the process, the recent AGS neutrino experimental program are reviewed

  6. Rattle-type hierarchical particles containing multilevel cores (Ag@AgCl@SiO2 and Au/Ag@AgCl@SiO2) as versatile catalysts.

    Science.gov (United States)

    Huy, Do Xuan; Lee, Ha-Jin; Lee, Young Boo; Choi, Won San

    2014-07-01

    A protocol for the synthesis of rattle-type core@shell particles containing Ag@AgCl or Au/Ag@AgCl core structures was developed, and the use of these particles as catalysts for the decomposition of toxic materials was demonstrated. A monometallic Ag or bimetallic Au/Ag core was incorporated into the interior of SiO2 capsules via controlled heat treatment of metal nanoparticle/SiO2-coated polymer particles, resulting in the formation of rattle-type core@shell structures. By appropriate treatments, it was possible to transform the Ag or Au/Ag core into multilevel cores (Ag@AgCl or Au/Ag@AgCl) within the SiO2 capsules (Ag@AgCl@SiO2 or Au/Ag@AgCl@SiO2). This method for the synthesis of rattle-type core@shell particles is useful for further introducing AgCl fused with plasmonic materials into the capsule structures. The rattle-type core@shell structures were used as photocatalysts for the decomposition of organic pollutants such as methyl orange. Furthermore, these nanocatalysts containing semiconductors such as AgCl were also applied toward the reduction of nitrophenol (NPh) to aminophenol (APh). The Ag@AgCl@SiO2 or Au/Ag@AgCl@SiO2 catalysts showed excellent catalytic properties in the decomposition of toxic substances in terms of their activity and reusability. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. The mechanism of ionic conductivity in superionic conductors AgI, Ag2S and Ag3SI

    International Nuclear Information System (INIS)

    Polyakov, V.I.

    1997-01-01

    The conductivity channels are studied and the conductivity model by silver ions in superionic conductors AgI, Ag 2 S, Ag 3 SI is proposed. It is shown the Ag + ions migration is of retardation-rotational character by annular crossing orbits, forming the flow channels near the crystallographic positions of tetrahedral, octohedral and triangular types. It is established that the most stable positions of Ag + ions are determined of vertexes of the Dirichlet polyhedron of stationary sublattice

  8. Neutron resonance spectroscopy of 107Ag and 109Ag

    International Nuclear Information System (INIS)

    Lowie, L.Y.; Mitchell, G.E.; Stephenson, S.L.; Bowman, J.D.; Knudson, J.N.; Penttila, S.I.; Seestrom, S.J.; Yen, Y.; Yuan, V.W.; Crawford, B.E.; Roberson, N.R.; Delheij, P.P.; Haseyama, T.; Masaike, A.; Matsuda, Y.; Postma, H.; Sharapov, E.I.

    1997-01-01

    Parity violation has been observed in a number of previously unreported neutron resonances in silver. Analysis of these parity violation data requires improved neutron resonance spectroscopy. The neutron total cross section for natural silver was measured for E n =10 - 800 eV with the time-of-flight method at the Los Alamos Neutron Scattering Center. The neutron capture reaction was studied with both a natural silver target and a highly enriched sample (98.29%) of 107 Ag. A total of 38 previously unreported resonances were observed. The combination of the two measurements allowed assignment of the newly observed resonances to 107 Ag or to 109 Ag. Resonance parameters were determined for almost all of the neutron resonances observed. copyright 1997 The American Physical Society

  9. Ruhrgas AG. Business report 2000; Ruhrgas AG. Geschaeftsbericht 2000

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    A detailed account of the situation of the international gas market provides the basis of the status report of Ruhrgas AG and the group of affiliated companies. Emphasis is placed on gas procurement aspects, sales volumes, the construction and operation of natural gas distribution systems, and on development, utilization and application aspects. The activities and situation of major Ruhrgas AG holding companies are described, and the annual financial statements are documented. (orig.) [German] Ausgehend von einer eingehenden Beschreibung des internationalen Gasmarktes wird ein Lagebericht des Konzerns sowie der Ruhrgas AG gegeben. Dabei wird insbesondere auf Fragen der Gasbeschaffung, des Gasabsatzes, des Baus und Betriebs von Erdgasverteilungsnetzen, sowie der Entwicklung und der Anwendungstechnik eingegangen. Ferner wird ueber den Geschaeftsverlauf wesentlicher Ruhrgas-Beteiligungsgesellschaften berichtet. Abschliessend wird der Jahresabschluss dokumentiert. (orig.)

  10. How Ag Nanospheres Are Transformed into AgAu Nanocages

    Energy Technology Data Exchange (ETDEWEB)

    Moreau, Liane M.; Schurman, Charles A.; Kewalramani, Sumit; Shahjamali, Mohammad M.; Mirkin, Chad A.; Bedzyk, Michael J. (NWU)

    2017-08-23

    Bimetallic hollow, porous noble metal nanoparticles are of broad interest for biomedical, optical and catalytic applications. The most straightforward method for preparing such structures involves the reaction between HAuCl4 and well-formed Ag particles, typically spheres, cubes, or triangular prisms, yet the mechanism underlying their formation is poorly understood at the atomic scale. By combining in situ nanoscopic and atomic-scale characterization techniques (XAFS, SAXS, XRF, and electron microscopy) to follow the process, we elucidate a plausible reaction pathway for the conversion of citrate-capped Ag nanospheres to AgAu nanocages; importantly, the hollowing event cannot be explained by the nanoscale Kirkendall effect, nor by Galvanic exchange alone, two processes that have been previously proposed. We propose a modification of the bulk Galvanic exchange process that takes into account considerations that can only occur with nanoscale particles. This nanoscale Galvanic exchange process explains the novel morphological and chemical changes associated with the typically observed hollowing process.

  11. Level structure of 105Ag

    International Nuclear Information System (INIS)

    Dewanjee, M.K.; Okon, O.B.; Bakhru, H.; Preiss, I.L.

    1979-01-01

    The excited lvels of 105 Ag have been investigated from the decay of 105 Cd with high-resolution Ge(Li) and Si(Li) detectors as well as with standard scintillation counters. 105 Cd was produced via 106 Cd (n,2n) 105 Cd and 102 Pd (α,n) 105 Cd reactions. Levels of the following energies (in keV) have been established in 105 Ag: 25.5, 53.2, 111.5, 198.0, 973.6, 1014.7, 1032.2, 1096.8, 1364.3, 1413.4, 1635.2, 1670.1, 1718.9, 1923.7, 1933.5, 1986.2, 2144.6, 2257.1, 2326.8, 2333.4, 2419.5, 2449.5, 2472.6, and 2582.0. The use of two Ge(Li) detectors in connection with the PDP-8/I computer and a program for two-dimensional analysis with a 4096-dual analog-to-digital converter revealed the presence of several previously unreported transitions in 105 Ag. Based on the γ-γ and β-γ coincidence results, a consistent lvel scheme for 105 Ag is given. The spin and parity assignments of levels of 105 Ag are discussed. (author)

  12. Enhanced photocatalytic activity of Ag-TiO2/Ag heterogeneous films

    Science.gov (United States)

    Liang, Ying; Wang, ShaoHua; Guo, PengFeng

    2015-11-01

    Ag-deposited TiO2 and Ag (Ag-TiO2/Ag) films coated on glass substrates were prepared using a simple sol-gel and dip-coating method. The Ag chemical state was investigated through X-ray diffractometry and X-ray photoelectron spectroscopy. Results showed that the Ag mainly exists in metallic state in the Ag-TiO2 film. Ag-TiO2/Ag exhibits higher photocatalytic activity than individual Ag-TiO2 and TiO2/Ag films. This enhanced photocatalytic activity was attributed to high surface plasmon resonance effects and separation rates of photoinduced electron-hole pairs of Ag nanoparticles. Results were verified by photoluminescence and UV-Vis spectroscopy.

  13. Compare the photocatalytic properties of nanocomposites with tandem n (AgBr)-n (Ag2CO3) and p (AgCl)-n (Ag2CO3) heterojunctions

    Science.gov (United States)

    Asadollahi, A.; Sohrabnezhad, Sh.; Ansari, R.

    2017-07-01

    In this work, Ag2CO3 nanoparticles (NPs) (as a n-type semiconductor) incorporated in mordenite zeolite (MOR) by a facile precipitation method. Silver halides, AgCl (as a p-type semiconductor) and AgBr (as a n-type semiconductor), with different weight percentage (20%, 40% and 50%) were coupled into Ag2CO3-MOR nanocomposite (NC) and producing a series of novel AgCl/Ag2CO3 (p-n heterojunction)-MOR and AgBr/Ag2CO3 (n-n heterojunction)-MOR NCs. The effects of silver halides on the Ag2CO3-MOR catalyst for the photocatalytic degradation of methyl blue (MB) under visible light irradiation have been investigated. The structure, composition and optical properties of NCs were investigated by UV-Visible diffuse reflectance spectroscopy (UV-Vis DRS), X-ray diffraction (XRD), transmission electron microscopy (TEM), scanning electron microscopy (SEM). The prepared AgX/Ag2CO3-MOR NCs with the optimal content of AgX (50 wt%) indicated higher photocatalytic activity than that of the Ag2CO3-MOR and Ag2CO3. The cycle experiments on the heterojuctions NCs indicated that photocatalytic stability of AgBr/Ag2CO3-MOR NC was more than AgCl/Ag2CO3-MOR NC in all cycles. On the basis of the experimental results, a possible mechanism for the enhanced photocatalytic activity and photoinduced stability of silver compounds was proposed.

  14. One-pot synthesis of Ag-SiO2-Ag sandwich nanostructures

    International Nuclear Information System (INIS)

    Li Chaorong; Mei Jie; Li Shuwen; Lu Nianpeng; Wang Lina; Chen Benyong; Dong Wenjun

    2010-01-01

    Ag-SiO 2 -Ag sandwich nanostructures were prepared by a facile one-pot synthesis method. The Ag core, SiO 2 shell and Ag nanoparticle shell were all synthesized with polyvinylpyrrolidone, catalysed by ammonia, in the one-pot reaction. The polyvinylpyrrolidone, acting as a smart reducing agent, reduced the Ag + to Ag cores and Ag shells separately. Furthermore, the polyvinylpyrrolidone served as a protective agent to prevent the silver cores from aggregating. The SiO 2 shell and outer layer Ag nanoparticles were obtained when tetraethyl orthosilicate and ammonia were added to the silver core solution. Ammonia, acting as the catalyst, accelerated the hydrolysis of the tetraethyl orthosilicate to SiO 2 , which coated the silver cores. Furthermore, Ag(NH 3 ) 2 + ions were formed when aqueous ammonia was added to the solution, which increased the reduction capability. Then the polyvinylpyrrolidone reduced the Ag(NH 3 ) 2 + ions to small Ag nanoparticles on the surface of the Ag-SiO 2 and formed Ag-SiO 2 -Ag sandwich structures with a standard deviation of less than 4%. This structure effectively prevented the Ag nanoparticles on the silica surface from aggregating. Furthermore, the Ag-SiO 2 -Ag sandwich structures showed good catalysis properties due to the large surface area/volume value and activity of surface atoms of Ag particles.

  15. AGS experiments---1987, 1988, 1989

    International Nuclear Information System (INIS)

    Depken, J.C.

    1989-04-01

    This report contains: Experimental Areas Layout; Table of Beam Parameters and Fluxes; Experiment Schedule ''as run''; Experiment Long Range Schedule; A listing of experiments by number; Two-page summaries of each experiment begin here, also ordered by number; Publications of AGS experiments; and List of experimenters

  16. AGS 20th anniversary celebration

    Energy Technology Data Exchange (ETDEWEB)

    Baggett, N.V. (ed.)

    1980-05-22

    On May 22, 1980, a symposium was held at Brookhaven to celebrate the 20th birthday of the AGS, to recall its beginnings, and to review major discoveries that have been made with its beams. The talks at the symposium are recorded in this volume.

  17. AGS experiments, 1988, 1989, 1990

    International Nuclear Information System (INIS)

    Depken, J.C.

    1991-04-01

    This report contains: experimental areas layout; table of beam parameters and fluxes; experiment schedule ''as run''; experiment long range schedule; a listing of experiments by number; two-page summaries of each experiment begin here, also ordered by number; publications of AGS experiments; and list of experimenters

  18. AGS experiments: 1985, 1986, 1987

    International Nuclear Information System (INIS)

    Depken, J.C.

    1987-01-01

    This report contains: Experimental areas layout, table of beam parameters and fluxes, experiment schedule ''as run,'' experiment long range schedule, a listing of experiments by number, two-page summaries of each experiment, also ordered by number, and publications of AGS experiments, 1982-1987

  19. AGS 20th anniversary celebration

    International Nuclear Information System (INIS)

    Baggett, N.V.

    1980-01-01

    On May 22, 1980, a symposium was held at Brookhaven to celebrate the 20th birthday of the AGS, to recall its beginnings, and to review major discoveries that have been made with its beams. The talks at the symposium are recorded in this volume

  20. Synthesis, morphological control, and antibacterial properties of hollow/solid Ag2S/Ag heterodimers

    KAUST Repository

    Pang, Maolin

    2010-08-11

    Ag2S and Ag are important functional materials that have received considerable research interest in recent years. In this work, we develop a solution-based synthetic method to combine these two materials into hollow/solid Ag2S/Ag heterodimers at room temperature. Starting from monodisperse Cu2O solid spheres, CuS hollow spheres can be converted from Cu2O through a modified Kirkendall process, and the obtained CuS can then be used as a solid precursor for preparation of the Ag2S/Ag heterodimers through ion exchange and photo-assisted reduction. We have found that formation of the Ag2S/Ag heterodimers is instantaneous, and the size of Ag nanocrystals on the hollow spheres of Ag2S can be controlled by changing the concentration and power of reducing agents in the synthesis. The growth of Ag nanoparticles on hollow spheres of Ag2S in the dimers is along the [111] direction of the silver crystal; the light absorption properties have also been investigated. Furthermore, coupling or tripling of Ag2S/Ag heterodimers into dumbbell-like trimers ((Ag 2S)2/Ag, linear) and triangular tetramers ((Ag 2S)3/Ag, coplanar) can also be attained at 60°C by adding the bidentate ligand ethylenediamine as a cross-linking agent. To test the applicability of this highly asymmetric dipolar composite, photocatalytic inactivation of Escherichia coli K-12 in the presence of the as-prepared Ag 2S/Ag heterodimers has been carried out under UV irradiation. The added Ag2S/Ag heterodimers show good chemical stability under prolonged UV irradiation, and no appreciable solid dissolution is found. Possible mechanisms regarding the enhanced antibacterial activity have also been addressed. © 2010 American Chemical Society.

  1. AGS experiments: 1990, 1991, 1992. Ninth edition

    Energy Technology Data Exchange (ETDEWEB)

    Depken, J.C.

    1993-04-01

    This report contains a description of the following: AGS Experimental Area - High Energy Physics FY 1993 and Heavy Ion Physics FY 1993; Table of Beam Parameters and Fluxes; Experiment Schedule ``as run``; Proposed 1993 Schedule; A listing of experiments by number; Two-page summaries of each experiment begin here, also ordered by number; Publications of AGS Experiments; and List of AGS Experimenters.

  2. Laser-based synthesis of core Ag-shell AgI nanoparticles

    Science.gov (United States)

    Tan, Hua; Fan, Wai Yip

    2005-05-01

    A laser-controlled synthesis of silver iodide (AgI) nanoparticles with isolable AgI shell-Ag core stable intermediates is achieved via molecular iodine photodissociation in the presence of pure Ag nanoparticles dispersed in water. Ag nanoparticles were introduced into the solution containing sodium dodecylsulphate surfactants and iodine by ablating a piece of silver foil with a 532 nm pulsed Nd-YAG laser. Transmission electron microscopy images showed that different AgI shell-Ag core sizes could be achieved by controlling the photolysis of I 2 in solution. These nanoparticles were also found to catalyse an atom-economy Grignard-Barbier organic reaction.

  3. Photoinduced formation of Ag nanoparticles on the surface of As2S3/Ag thin bilayer

    International Nuclear Information System (INIS)

    Binu, S; Khan, Pritam; Barik, A R; Sharma, Rituraj; Adarsh, K V; Golovchak, R; Jain, H

    2014-01-01

    In this article, we demonstrate the combined effect of photodoping and photoinduced-surface deposition in a bilayer of chalcogenide glass (ChG) and Ag as an alternative method to optically synthesize Ag nanoparticles (AgNP) on the surface of ChG. In our experiment, AgNP formation occurs through two distinct stages: In the first stage, Ag is transported through the As 2 S 3 layer as Ag + ions, and in the second stage Ag + ions are photo-deposited as AgNP. The ex situ x-ray photoelectron spectroscopy measurements and AFM observations show photoinduced Ag mass transport and the formation of AgNP. (paper)

  4. Green synthesis of graphene/Ag nanocomposites

    International Nuclear Information System (INIS)

    Yuan Wenhui; Gu Yejian; Li Li

    2012-01-01

    Graphical abstract: A facile and green approach to synthesis of GNS/AgNPs is reported by employing sodium citrate as reductant, and this study represents the use of biocompounds for nontoxic and scalable production of GNS/AgNPs under a suitable concentration of silver ions and the prepared GNS/AgNPs can be used in the field of disinfection. Highlights: ► Graphene/Ag nanocomposites were prepared by a green and facile strategy based on sodium citrate. ► The influence of AgNO 3 amount on particle size and size range of AgNPs was studied. ► The surface plasmon resonance properties of AgNPs on graphene was investigated. ► The antibacterial activity of silver nanoparticles was retained in the nanocomposites. - Abstract: Graphene/Ag nanocomposites (GNS/AgNPs) were fabricated via a green and facile method, employing graphite oxide (GO) as a precursor of graphene, AgNO 3 as a precursor of Ag nanoparticles, and sodium citrate as an environmentally friendly reducing and stabilizing agent. The synthesized GNS/AgNPs were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), Fourier transform infrared spectroscopy (FT-IR), X-ray photoelectron spectroscopy (XPS) and Raman spectra (RS), respectively. The results indicated that graphite oxide was completely reduced to graphene, and the silver ion was reduced by sodium citrate simultaneously. Under a suitable dosage of silver ions, well-dispersed AgNPs on the graphene sheets mostly centralized at 20–25 nm. The surface plasmon resonance property of AgNPs on graphene showed that there was a interaction between AgNPs and graphene supports. In addition, antibacterial activity of silver nanoparticles was retained in the nanocomposites, suggesting that they can be potentially used as a graphene-based biomaterial.

  5. Direct electrospinning of Ag/polyvinylpyrrolidone nanocables

    DEFF Research Database (Denmark)

    Song, Jie; Chen, Menglin; Havelund, Rasmus

    2011-01-01

    Core-sheath silver nanowire/polyvinylpyrrolidone (AgNW/PVP) nanocables have been fabricated via an efficient single-spinneret electrospinning method. The core-sheath structure is revealed by combining several characterization methods. A possible formation mechanism of the AgNW/PVP nanocable...... involving a strong stretching during the electrospinning process is proposed. Further, electrical measurements were performed on AgNW/PVP nanocables as well as bare AgNWs, which indicated the nanocables became insulating due to the isolation of highly conductive AgNWs by insulating PVP sheath. Therefore...

  6. Comparative study of antimicrobial activity of AgBr and Ag nanoparticles (NPs.

    Directory of Open Access Journals (Sweden)

    Petr Suchomel

    Full Text Available The diverse mechanism of antimicrobial activity of Ag and AgBr nanoparticles against gram-positive and gram-negative bacteria and also against several strains of candida was explored in this study. The AgBr nanoparticles (NPs were prepared by simple precipitation of silver nitrate by potassium bromide in the presence of stabilizing polymers. The used polymers (PEG, PVP, PVA, and HEC influence significantly the size of the prepared AgBr NPs dependently on the mode of interaction of polymer with Ag+ ions. Small NPs (diameter of about 60-70 nm were formed in the presence of the polymer with low interaction as are PEG and HEC, the polymers which interact with Ag+ strongly produce nearly two times bigger NPs (120-130 nm. The prepared AgBr NPs were transformed to Ag NPs by the reduction using NaBH4. The sizes of the produced Ag NPs followed the same trends--the smallest NPs were produced in the presence of PEG and HEC polymers. Prepared AgBr and Ag NPs dispersions were tested for their biological activity. The obtained results of antimicrobial activity of AgBr and Ag NPs are discussed in terms of possible mechanism of the action of these NPs against tested microbial strains. The AgBr NPs are more effective against gram-negative bacteria and tested yeast strains while Ag NPs show the best antibacterial action against gram-positive bacteria strains.

  7. Novel AgCl/Ag/AgFeO2 Z-scheme heterostructure photocatalyst with enhanced photocatalytic and stability under visible light

    Science.gov (United States)

    Song, Zhe; He, Yiqiang

    2017-10-01

    A new AgCl/Ag/AgFeO2 composite was synthesized for the first time via a simple precipitation method. The very detailed characterizations were enforced in photocatalytic activity and stability. The photocatalytic performance was studied by the degradation of the rhodamine B (RhB, a cationic dye) under visible irradiation. The as-prepared AgCl/Ag/AgFeO2 photocatalyst exhibited excellent photocatalytic activity and stability under the visible light region compared to pure AgCl and AgFeO2. About 97.47% of RhB can be removed in 60 min by the optimized AgCl/Ag/AgFeO2 composite, which was ∼2.26 and ∼10.83 times as fast as that pure AgCl and pure AgFeO2. After three cycles visible light irradiation experiments found that degradation rate of RhB reached 76.35%, which was still higher than pure AgCl and AgFeO2. The obviously enhanced photocatalytic activity of AgCl/Ag/AgFeO2 composites can be attributed to the efficient separation of electron-hole pairs of the Z-scheme heterostructure between AgCl, Ag and AgFeO2. In this study, we also found the superoxide radicals (rad O2-) was considered to be the dominant active radical in the degradation of dye.

  8. Surface-enhanced Raman scattering of a Ag/oligo(phenyleneethynylene)/Ag sandwich.

    Science.gov (United States)

    Fletcher, Melissa; Alexson, D M; Prokes, Sharka; Glembocki, Orest; Vivoni, Alberto; Hosten, Charles

    2011-02-01

    α,ω-Dithiols are a useful class of compounds in molecular electronics because of their ability to easily adsorb to two metal surfaces, producing a molecular junction. We have prepared Ag nanosphere/oligo(phenyleneethynylene)/Ag sol (AgNS/OPE/Ag sol) and Ag nanowire/oligo(phenyleneethynylene)/Ag sol (AgNW/OPE/Ag sol) sandwiches to simulate the architecture of a molecular electronic device. This was achieved by self-assembly of OPE on the silver nanosurface, deprotection of the terminal sulfur, and deposition of Ag sol atop the monolayer. These sandwiches were then characterized by surface-enhanced Raman scattering (SERS) spectroscopy. The resulting spectra were compared to the bulk spectrum of the dimer and to the Ag nanosurface/OPE SERS spectra. The intensities of the SERS spectra in both systems exhibit a strong dependence on Ag deposition time and the results are also suggestive of intense interparticle coupling of the electromagnetic fields in both the AgNW/OPE/Ag and the AgNS/OPE/Ag systems. Three previously unobserved bands (1219, 1234, 2037 cm(-1)) arose in the SER spectra of the sandwiches and their presence is attributed to the strong enhancement of the electromagnetic field which is predicted from the COSMOL computational package. The 544 cm(-1) disulfide bond which is observed in the spectrum of solid OPE but is absent in the AgNS/OPE/Ag and AgNW/OPE/Ag spectra is indicative of chemisorption of OPE to the nanoparticles through oxidative dissociation of the disulfide bond. Copyright © 2010 Elsevier B.V. All rights reserved.

  9. Resistance switching of an individual Ag2S/Ag nanowire heterostructure

    International Nuclear Information System (INIS)

    Liang Changhao; Terabe, Kazuya; Hasegawa, Tsuyoshi; Aono, Masakazu

    2007-01-01

    Ag/Cu-based chalcogenide ionic conductors are candidates for use in applications in resistance-switching and nonvolatile memory devices. We report the investigation of the electrical properties of individual Ag 2 S/Ag heteronanowires (HNWs) by atomic force microscopy (AFM) using a nanoscale-tip electrode. Hysteretic current-voltage (IV) curves and the polarity-dependent resistance-switching phenomenon in an individual Ag 2 S/Ag HNW were observed. A local impedance spectroscopy measurement of Ag 2 S/Ag HNWs was performed to reveal the interface-related electrical characteristics. The DC-bias-dependent impedance spectra suggested the occurrence of charge and mass transfer at the interface of the electrode/mixed conductor. It is proposed that reversible resistance switching originates from the creation and rupture of filament-like conducting pathways inside the Ag 2 S/Ag HNW

  10. Plasmonic Ag{sub 2}MoO{sub 4}/AgBr/Ag composite: Excellent photocatalytic performance and possible photocatalytic mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Zhongliao [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Zhang, Jinfeng, E-mail: zjf_y2004@126.com [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Lv, Jiali [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Dai, Kai, E-mail: daikai940@chnu.edu.cn [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Liang, Changhao [College of Physics and Electronic Information, Anhui Key Laboratory of Energetic Materials, Huaibei Normal University, Huaibei, 235000 (China); Key Laboratory of Materials Physics and Anhui Key Laboratory of Nanomaterials and Nanotechnology, Institute of Solid State Physics, Chinese Academy of Sciences, Hefei, 230031 (China)

    2017-02-28

    Highlights: • Novel Ag{sub 2}MoO{sub 4}/AgBr/Ag photocatalyst was prepared. • Ag{sub 2}MoO{sub 4}/AgBr/Ag showed high photocatalytic activity. • Ag{sub 2}MoO{sub 4}/AgBr/Ag showed long reusable life. - Abstract: Plasmonic Ag{sub 2}MoO{sub 4}/AgBr/Ag composite is fabricated by in-situ ion exchange and reduction methods at room temperature. The samples are characterized by X-ray diffraction (XRD), UV–vis diffuse reflectance (DRS), energy-dispersive X-ray spectroscopy (EDS), scanning electron microscope (SEM) and photoluminescence (PL) measurements. The results show that butterfly-like Ag{sub 2}MoO{sub 4} nanosheets served as the precursor, and Ag{sub 2}MoO{sub 4}/AgBr/Ag is formed in phase transformation with MoO{sub 4}{sup 2−} displaced by Br{sup −}. The ternary Ag{sub 2}MoO{sub 4}/AgBr/Ag composite photocatalysts show greatly enhanced photocatalytic activity in photodegrading methylene blue (MB) under visible light irradiation compared with AgBr and Ag{sub 2}MoO{sub 4}. The pseudo-first-order rate constant k{sub app} of Ag{sub 2}MoO{sub 4}/AgBr/Ag is 0.602 min{sup −1}, which is 11.6 and 18.3 times as high as that of AgBr and Ag{sub 2}MoO{sub 4}, respectively. Meanwhile, the efficiency of degradation still kept 90% after ten times cyclic experiments. Eventually, possible photocatalytic mechanism was proposed.

  11. Ag diffusion in cubic silicon carbide

    International Nuclear Information System (INIS)

    Shrader, David; Khalil, Sarah M.; Gerczak, Tyler; Allen, Todd R.; Heim, Andrew J.; Szlufarska, Izabela; Morgan, Dane

    2011-01-01

    The diffusion of Ag impurities in bulk 3C-SiC is studied using ab initio methods based on density functional theory. This work is motivated by the desire to reduce transport of radioactive Ag isotopes through the SiC boundary layer in the Tristructural-Isotropic (TRISO) fuel pellet, which is a significant concern for the Very High Temperature Reactor (VHTR) nuclear reactor concept. The structure and stability of charged Ag and Ag-vacancy clusters in SiC are calculated. Relevant intrinsic SiC defect energies are also determined. The most stable state for the Ag impurity in SiC is found to be a Ag atom substituting on the Si sub-lattice and bound to a C vacancy. Bulk diffusion coefficients are estimated for different impurity states and values are all found to have very high activation energy. The impurity state with the lowest activation energy for diffusion is found to be the Ag interstitial, with an activation energy of approximately 7.9 eV. The high activation energies for Ag diffusion in bulk 3C-SiC cause Ag transport to be very slow in the bulk and suggests that observed Ag transport in this material is due to an alternative mechanism (e.g., grain boundary diffusion).

  12. Study of Ag+/PAA (polyacrylic acid) and Ag0/PAA aqueous system at equilibrium

    International Nuclear Information System (INIS)

    Keghouche, N.; Mostafavi, M.; Delcourt, M.O.

    1991-01-01

    When submitted to gamma radiation the system Ag + -PAA-water leads to clusters Ag 0 n /PAA (3 420 nm) interacting with the clusters. Potentiometric measurements carried out on Ag + solutions in the presence of PAA at various pH show that the deprotonated form (polyacrylate anion) is strongly bonded to Ag + , on the opposite of the protonated form of PAA. One of the oligomer clusters can be stabilized for more than one year. Studying it by infra-red spectrometry reveals important modifications in the vibration bands of the COO - group circa 1400 and 1600 cm -1 according to the bonding of PAA with Ag + or Ag 0 [fr

  13. New AGS fast extraction system

    International Nuclear Information System (INIS)

    Weng, W.T.

    1980-09-01

    Both the high energy physics program and ISA injection require an improved fast extraction system from the AGS. The proposed new system consists of a fast kicker at H5 and an ejector magnet at H10. The H5 kicker is capable of producing 1.2 mrad deflection and rising up to 99% strength in 150 nsec with flat top ripple within +- 1%. It is found that the focusing strengths and positions of UQ3-UQ7 have to be modified to achieve an achromatic condition at the end of 8 0 -bend. Also, the conceptual design of the H5 magnet and the pulser system are discussed

  14. Ag nanoprisms with Ag₂S attachment.

    KAUST Repository

    Xiong, Shenglin

    2013-01-01

    Triangular Ag nanoprisms are a type of most-studied noble-metal nanostructures over the past decade owing to their special structural architecture and outstanding optical and catalytic properties for a wide range of applications. Nevertheless, in contrast to active research for the synthesis of phase-pure Ag nanoprisms, no asymmetric heterodimers containing Ag prisms have been developed so far, probably due to lack of suitable synthetic methods. Herein, we devise a simple ion-exchange method to synthesize Ag2S/Ag heterodimers at room temperature, through which Ag nanoprisms with controllable size and thickness can be fabricated. Formation chemistry and optical properties of the heterodimers have been investigated. These semiconductor/metal heterodimers have exhibited remarkable bactericidal activity to E. coli cells under visible light illumination.

  15. Flower-like Ag/AgCl microcrystals: Synthesis and photocatalytic activity

    International Nuclear Information System (INIS)

    Daupor, Hasan; Wongnawa, Sumpun

    2015-01-01

    Silver/silver chloride (Ag/AgCl) composites with a novel flower-like morphology were prepared via a hot precipitation assisted by the vinyl acetate monomer (VAM) route. An aqueous solution of AlCl 3 was mixed with the vinyl acetate monomer and acetic acid before adding a AgNO 3 solution at a temperature of 100 °C. The octapod shaped flower-like Ag/AgCl particles (or “flower-like Ag/AgCl” hereinafter) has eight petals each of which was about 7–11 μm in length. The flower-like octapods were formed by preferential overgrowth along the <111> directions of the cubic seeds. Detailed studies of the growth process at different AlCl 3 concentrations revealed that the concave cube developed into a Rubik's cube where eight corners grew further into the flower-like structures. The VAM and acetic acid concentration strongly affected the growth of the Ag/AgCl to the flower-like structure and their optimum concentrations were determined. The morphologies of these particles were carefully examined by scanning electron microscopy (SEM). The crystal structures and orientation relationship were characterized by X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), and UV–visible diffused reflectance spectroscopy (DRS). The flower-like Ag/AgCl microcrystals were tested for their photocatalytic degradation of orange G dye (OG) catalyzed by visible light. From comparative test runs, the flower-like Ag/AgCl exhibited better photocatalytic activity than simple and commercial Ag/AgCl particles. - Highlights: • Interesting transformation of microcrystals Ag/AgCl from concave cube via Rubik's cube to flower-like shape. • The first to use VAM as morphology control reagent. • High photocatalytic activity under visible light irradiation

  16. The cardiovascular response to the AGS

    Science.gov (United States)

    Cardus, David; Mctaggart, Wesley G.

    1993-01-01

    This paper reports the preliminary results of experiments on human subjects conducted to study the cardiovascular response to various g-levels and exposure times using an artificial gravity simulator (AGS). The AGS is a short arm centrifuge consisting of a turntable, a traction system, a platform and four beds. Data collection hardware is part of the communication system. The AGS provides a steep acceleration gradient in subjects in the supine position.

  17. Transformation from Ag@Ag3PO4 to Ag@Ag2SO4 hybrid at room temperature: preparation and its visible light photocatalytic activity

    Science.gov (United States)

    Wei, Ting; Gao, Shanmin; Wang, Qingyao; Xu, Hui; Wang, Zeyan; Huang, Baibiao; Dai, Ying

    2017-02-01

    In the present study, Ag/Ag2SO4 hybrid photocatalysts were obtained via a facile redox-precipitation reaction approach by using Ag@Ag3PO4 nanocomposite as the precursor and KMnO4 as the oxidant. Multiple techniques, such as X-ray diffraction pattern (XRD), transmission electron microscope (TEM), high-resolution transmission electron microscopy (HRTEM), X-ray photoelectron spectroscopy (XPS), UV-vis diffuse reflectance spectroscopy (DRS) and Brunauer-Emmett-Teller (BET), photocurrent and electrochemical impedance spectroscopy (EIS), were applied to investigate the structures, morphologies, optical, and electronic properties of as-prepared samples. The photocatalytic activities were evaluated by photodegradation of organic rhodamine B (RhB) and methyl orange (MO) under visible light irradiation. It was found that pure Ag2SO4 can partially transform into metallic Ag during the photocatalytic degradation of organic pollutants, but the Ag/Ag2SO4 hybrids can maintain its structure stability and show enhanced visible light photocatalytic activity because of the surface plasma resonance effect of the metallic Ag.

  18. A study of the properties of core/shell/shell Ag/FeCo/Ag nanoparticles

    Science.gov (United States)

    Kamzin, A. S.; Takahashi, M.; Maenosono, S.; Valiullin, A. A.

    2017-10-01

    The properties of heterophase core/shell/shell Ag/FeCo/Ag nanoparticles synthesized via a plasma method that are promising for biological applications are studied. As is established, the core/shell/shell Ag/FeCo/Ag nanoparticles exhibit a superparamagnetic state at room temperature that allows one to manage the hyperthermia process. The magnetic characteristics of core/shell/shell Ag/FeCo/Ag nanoparticles are interpreted by assuming partial oxidation of the surface layer of a ferromagnetic FeCo shell and formation of the antiferromagnetic CoxFe1-xO layer on the FeCo surface. The interaction between the surface antiferromagnetic CoxFe1-xO layer and the ferromagnetic FeCo shell causes the emergence of the exchange bias in Ag/FeCo/Ag nanoparticles.

  19. Synthesis of Cu-Ag@Ag particles using hyperbranched polyester as template

    Science.gov (United States)

    Han, Wen-Song

    2015-07-01

    In this manuscript, the third-generation hyperbranched polyester was synthesized with 2, 2-dimethylol propionic acid as AB2 monomer and pentaerythrite as core molecule by using step by step polymerization process at first. Then, the Cu-Ag particles were prepared by co-reduction of silver nitrate and copper nitrate with ascorbic acid in the aqueous solution using hyperbranched polyester as template. Finally, the Cu-Ag@Ag particles were prepared by coating silver on the surface of Cu-Ag particles by reduction of silver nitrate. The synthesized hyperbranched polyester and Cu-Ag@Ag particles were characterized by Fourier transform infrared (FT-IR) spectroscopy, UV-vis spectra, x-ray diffraction, Laser light scattering, thermogravimetric analysis (TGA) and SEM. UV-vis spectra results showed that the Cu-Ag@Ag particles had a strong absorption band at around 420 nm. Laser light scattering and SEM studies confirmed that the most frequent particle sizes of Cu-Ag@Ag particles were 1.2 um. TGA results indicated that the Cu-Ag@Ag particles had good thermal stability. [Figure not available: see fulltext.

  20. AgI/Ag3PO4 hybrids with highly efficient visible-light driven photocatalytic activity

    International Nuclear Information System (INIS)

    Katsumata, Hideyuki; Hayashi, Takahiro; Taniguchi, Masanao; Suzuki, Tohru; Kaneco, Satoshi

    2015-01-01

    Highlights: • AgI/Ag 3 PO 4 hybrid was prepared via an in situ anion-exchange method. • AgI/Ag 3 PO 4 displays the excellent photocatalytic activity under visible light. • AgI/Ag 3 PO 4 readily transforms to be Ag@AgI/Ag 3 PO 4 system. • h + and O 2 ·− play the major role in the AO 7 decolorization over AgI/Ag 3 PO 4 . • The activity enhancement is ascribed to a Z-scheme system composed of Ag 3 PO 4 , Ag and AgI. - Abstract: Highly efficient visible-light-driven AgI/Ag 3 PO 4 hybrid photocatalysts with different mole ratios of AgI were prepared via an in situ anion-exchange method and characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), UV–vis diffuse reflectance spectroscopy (DRS) and photoluminescence (PL) technique. Under visible light irradiation (>420 nm), the AgI/Ag 3 PO 4 photocatalysts displayed the higher photocatalytic activity than pure Ag 3 PO 4 and AgI for the decolorization of acid orange 7 (AO 7). Among the hybrid photocatalysts, AgI/Ag 3 PO 4 with 80% of AgI exhibited the highest photocatalytic activity for the decolorization of AO 7. X-ray photoelectron spectroscopy (XPS) results revealed that AgI/Ag 3 PO 4 readily transformed to be Ag@AgI/Ag 3 PO 4 system while the photocatalytic activity of AgI/Ag 3 PO 4 remained after 5 recycling runs. In addition, the quenching effects of different scavengers displayed that the reactive h + and O 2 ·− play the major role in the AO 7 decolorization. The photocatalytic activity enhancement of AgI/Ag 3 PO 4 hybrids can be ascribed to the efficient separation of electron–hole pairs through a Z-scheme system composed of Ag 3 PO 4 , Ag and AgI, in which Ag nanoparticles act as the charge separation center

  1. AGS fast kicker magnet system

    International Nuclear Information System (INIS)

    Weng, W.T.; Cottingham, J.G.; Foelsche, H.; Frey, W.; Ghoshroy, S.; Schmidt, C.; Tuozzolo, J.

    1981-01-01

    A new fast extraction system from the AGS will be implemented to improve the neutrino beam and to serve for ISABELLE injection. The fast kicker for the system is of an open C-type design with a field strength of 1.25 kG at 2650 amperes. The pulser system is a mismatched, discharge type PFN which is capable of delivering a pulse of 3000 amperes peak current at 30 kV dc, with a 2.7 μsec pulse width, 170 nsec rise time, and flat top ripple within +-1%. It also serves as a prototype for an ISA injection magnet, and is to be operated in UHV in the 10 -11 Torr range. Special measures to achieve this goal are also discussed

  2. Machinability of experimental Ti-Ag alloys.

    Science.gov (United States)

    Kikuchi, Masafumi; Takahashi, Masatoshi; Okuno, Osamu

    2008-03-01

    This study investigated the machinability of experimental Ti-Ag alloys (5, 10, 20, and 30 mass% Ag) as a new dental titanium alloy candidate for CAD/CAM use. The alloys were slotted with a vertical milling machine and carbide square end mills under two cutting conditions. Machinability was evaluated through cutting force using a three-component force transducer fixed on the table of the milling machine. The horizontal cutting force of the Ti-Ag alloys tended to decrease as the concentration of silver increased. Values of the component of the horizontal cutting force perpendicular to the feed direction for Ti-20% Ag and Ti-30% Ag were more than 20% lower than those for titanium under both cutting conditions. Alloying with silver significantly improved the machinability of titanium in terms of cutting force under the present cutting conditions.

  3. Antibacterial biodegradable Mg-Ag alloys

    Directory of Open Access Journals (Sweden)

    D Tie

    2013-06-01

    Full Text Available The use of magnesium alloys as degradable metals for biomedical applications is a topic of ongoing research and the demand for multifunctional materials is increasing. Hence, binary Mg-Ag alloys were designed as implant materials to combine the favourable properties of magnesium with the well-known antibacterial property of silver. In this study, three Mg-Ag alloys, Mg2Ag, Mg4Ag and Mg6Ag that contain 1.87 %, 3.82 % and 6.00 % silver by weight, respectively, were cast and processed with solution (T4 and aging (T6 heat treatment.The metallurgical analysis and phase identification showed that all alloys contained Mg4Ag as the dominant β phase. After heat treatment, the mechanical properties of all Mg-Ag alloys were significantly improved and the corrosion rate was also significantly reduced, due to presence of silver. Mg(OH2 and MgO present the main magnesium corrosion products, while AgCl was found as the corresponding primary silver corrosion product. Immersion tests, under cell culture conditions, demonstrated that the silver content did not significantly shift the pH and magnesium ion release. In vitro tests, with both primary osteoblasts and cell lines (MG63, RAW 264.7, revealed that Mg-Ag alloys show negligible cytotoxicity and sound cytocompatibility. Antibacterial assays, performed in a dynamic bioreactor system, proved that the alloys reduce the viability of two common pathogenic bacteria, Staphylococcus aureus (DSMZ 20231 and Staphylococcus epidermidis (DSMZ 3269, and the results showed that the killing rate of the alloys against tested bacteria exceeded 90%. In summary, biodegradable Mg-Ag alloys are cytocompatible materials with adjustable mechanical and corrosion properties and show promising antibacterial activity, which indicates their potential as antibacterial biodegradable implant materials.

  4. Synthesis and characterizations of AgSCN nanospheres using AgCl as the precursor

    International Nuclear Information System (INIS)

    Yang Ming; Ma Jing

    2009-01-01

    Nanospheres of AgSCN with an average radius of 30-80 nm have been prepared by a simple reaction between AgCl suspension and KSCN in the presence of gelatin. Gelatin played a decisive role as an inhibitor of the direct attack of SCN - ions to AgCl surfaces and coagulation of the growing AgSCN in producing the spherical AgSCN nanoparticles. The products were characterized by X-ray powder diffraction, transmission electron microscopy and X-ray photoelectron spectra techniques. The electrical conductivity of thin films of as-prepared AgSCN nanoparticles and polyethylene oxide (PEO) at room temperature was measured. The maximum value of electrical conductivity of as-prepared AgSCN-PEO was 1.53 x 10 -5 S cm -1 .

  5. Evolution of AgX nanowires into Ag derivative nano/microtubes for highly efficient visible-light photocatalysts.

    Science.gov (United States)

    Choi, Won San; Byun, Gyo Yeon; Bae, Tae Sung; Lee, Ha-Jin

    2013-11-13

    Our study proposes a novel strategy for the synthesis of Ag derivatives (AgX@Ag (X = Cl and Br) or Ag nano/microtubes) using the controlled chemical reduction or electron-beam irradiation of AgX nanowires (NWs), which are formed from the controlled dewetting of a AgX thin film on colloidal particles. The size of the AgX@Ag and Ag nano/microtubes can be controlled using the AgCl NWs as templates and varying the concentration of NaX. By controlling the concentration of NaBr, heterojunction-structured AgCl/AgBr NWs (H-AgCl/AgBr NWs) can be produced from the AgCl NWs due to a partial ion-exchange reaction (low concentration), and the AgBr NWs produced after a complete ion-exchange reaction between Cl- and Br- are further grown into micrometer-sized AgBr wires (high concentration). The resulting AgX NWs can be transformed into corresponding AgX@Ag or Ag nano/microtubes via a controlled chemical or physical method. The AgX derivatives (AgX@Ag nanotubes (NTs) and AgX NWs) are tested as visible-light-induced photocatalysts for decomposition of methyl orange. The AgX@Ag NTs exhibit the best photocatalytic activities due to the advantages of the core@shell structure, allowing multiple reflections of visible light within the interior cavity, providing a well-defined and clean Ag/AgX interface, and preventing direct adsorption of pollutants on AgX because of the shell structure. These advantages allow AgX@Ag NTs to maintain high catalytic performance even after multiple uses. The approach can also be used as a direct method for preparing Ag nano/microtubes with a tailored size and as a new method for incorporating a AgX NW core into a Ag nano/microtube shell. Our approach is useful for synthesizing various types of one-dimensional heterostructured NWs or metal NTs with controlled structures and properties.

  6. Preparation and Characterization of γ-AgI in Superionic Composite Glasses (AgIx(AgPO31-x

    Directory of Open Access Journals (Sweden)

    S. Suminta

    2007-07-01

    Full Text Available The γ-AgI phase was stabilized at room temperature in the composites glasses (AgIx(AgPO31-x with x = 0.6 and 0.7 via rapid quenching of their molten mixture. The measurement of the crystal structure has been carried out using an X-ray Difractometer at the Physics Departement of Ibaraki University, Japan. The micro strain and crystal size are derived from Hall’s equation. The X-ray diffraction pattern shows some Bragg peaks that correspond to the crystalline γ-AgI. By increasing the concentration of AgI, the peak width becomes more narrow and the position shifts to the higher angle. This indicates that the crystalline size and microstrain are increasing. The increase of micro strain (η, and particle size (D will increase the ionic mobility, thus increasing the ionic conductivity. It is concluded that solidification process on melt AgI into glass matrix AgPO3 not only decreases the micro strain and the particle size, but it also increases the ionic conductivity.

  7. AgCl/Ag3PO4: A stable Ag-Based nanocomposite photocatalyst with enhanced photocatalytic activity for the degradation of parabens.

    Science.gov (United States)

    Guo, Jianhao; Shi, Huixian; Huang, Xiaobo; Shi, Huifang; An, Zhongfu

    2018-04-01

    An AgCl/Ag 3 PO 4 composite has been successfully fabricated by a simple desorption-precipitation method. Scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), ultraviolet-visible spectroscopy (UV/Vis), and photoluminescence (PL) have been used to study the structural and physicochemical characteristics of the AgCl/Ag 3 PO 4 composite. The photocatalytic activity of the AgCl/Ag 3 PO 4 composite has been tested by the degradation of parabens under visible-light irradiation. 100% of MPB was degraded within 40 min in the AgCl/Ag 3 PO 4 -visible light system. Moreover, the photocatalytic activity of AgCl/Ag 3 PO 4 remained at 94% of the original level after five runs, which was much higher than that of pure Ag 3 PO 4 (25%). The obtained results confirmed that the AgCl/Ag 3 PO 4 composite exhibited significantly higher photocatalytic performance and improved stability compared with bare Ag 3 PO 4 . The enhanced photocatalytic performance of the AgCl/Ag 3 PO 4 composite could be mainly attributed to highly efficient charge separation through a synergistic effect of AgCl, Ag 3 PO 4 , and in situ photo-reduced Ag nanoparticles. Trapping experiments confirmed h + and ·O 2 - to be the two main active species in the photocatalytic process. Finally, a possible photocatalytic mechanism for the charge-transfer process is proposed to account for the enhanced photocatalytic performance of the AgCl/Ag 3 PO 4 composite. Copyright © 2018 Elsevier Inc. All rights reserved.

  8. Visible light driven photocatalysis and antibacterial activity of AgVO{sub 3} and Ag/AgVO{sub 3} nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Anamika [Department of Life Sciences, University of Mumbai, Santacruz (E), Mumbai 400 098 (India); Dutta, Dimple P., E-mail: dimpled@barc.gov.in [Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India); Ballal, A. [Molecular Biology Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India); Tyagi, A.K. [Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400 085 (India); Fulekar, M.H. [School of Environment and Sustainable Development, Central University of Gujarat, Gandhinagar 382 030, Gujarat (India)

    2014-03-01

    Graphical abstract: - Highlights: • Ag/AgVO{sub 3} and pure AgVO{sub 3} nanowires synthesized by sonochemical process. • Characterization done using XRD, SEM, TEM, EDX and BET analysis. • Visible light degradation of RhB by Ag/AgVO{sub 3} within 45 min. • Antibacterial activity of Ag/AgVO{sub 3} demonstrated. - Abstract: Ag/AgVO{sub 3} nanowires and AgVO{sub 3} nanorods were synthesized in aqueous media via a facile sonochemical route. The as-synthesized products were characterized by X-ray diffraction, Brunauer–Emmett–Teller surface area analysis, scanning electron microscopy together with an energy dispersion X-ray spectrum analysis, transmission electron microscopy and UV–vis diffuse reflectance spectroscopy. The results revealed that inert atmosphere promotes the formation of Ag/AgVO{sub 3} nanowires. The photocatalytic studies revealed that the Ag/AgVO{sub 3} nanowires exhibited complete photocatalytic degradation of Rhodamine B within 45 min under visible light irradiation. The antibacterial activity of Ag/AgVO{sub 3} nanowires was tested against Escherechia coli and Bacillus subtilis. The minimum growth inhibitory concentration value was found to be 50 and 10 folds lower than for the antibiotic ciprofloxacin for E. coli and B. subtilis, respectively. The antibacterial properties of the β-AgVO{sub 3} nanorods prove that in case of the Ag dispersed Ag/AgVO{sub 3} nanowires, the enhanced antibacterial action is also due to contribution from the AgVO{sub 3} support.

  9. Sulfurization Study on the Ag and Ag-Pd Reflectors for GaN-Based LEDs

    Science.gov (United States)

    Chen, Y. H.; Liu, W. C.; Lin, Y. C.; Chung, C. C.; Zeng, W. J.; Chu, W. J.; Chung, T. Y.; Liu, C. Y.

    2016-01-01

    In this study, we have established a sulfurization resistance test, which is an immersion process in 0.01 M Na2S solution for 10 min. By using this process, we found that the sulfurized Ag reflector drops significantly over 52%. However, the Ag-Pd alloy reflector does not drop as much as the Ag reflector. The minimum reduction rate (around 20%) occurs at the Ag-Pd reflector with a Pd content of 3.72 at.%. It means that there is an optimal surface Pd content (around 3.72 at.%) for the reduction in reflectivity. Above, two effects of Pd alloying atoms on the sulfurization of the surface Ag atoms have been drawn, which are (1) chemical-state change effect and (2) surface microstructure effect. We found that the chemical-state change effect retards the sulfurization of the surface Ag atoms, but the surface microstructure effect (increase in Ag (111) plane) promotes the sulfurization of the surface Ag atoms. Here, we believe that these two opposite effects explain that there is an optimal Pd content on the Ag-Pd surface for the resistance of the sulfurization on the Ag surface.

  10. Operation of the AGS polarized beam

    International Nuclear Information System (INIS)

    Ahrens, L.A.

    1988-01-01

    A polarized proton physics run took place during January, 1988, at the Brookhaven AGS. It is the purpose of this paper to review the tune-up period preceding that run. This was the third such run at the AGS; the others occurred in June of 1984 and February of 1986. Some comparisons will be drawn among these. A thorough review of the history and hardware associated with the acceleration of polarized protons at the AGS can be found in the proceedings of the last meeting of this group at Protvino and will not be repeated here. 2 refs., 6 figs., 1 tab

  11. Experimental and theoretical investigation on photocatalytic activities of 1D Ag/Ag2WO4 nanostructures

    Science.gov (United States)

    Liu, Danqing; Huang, Weicheng; Li, Long; Liu, Lu; Sun, Xiaojun; Liu, Bo; Yang, Bin; Guo, Chongshen

    2017-09-01

    Ag2WO4 is a significant photocatalyst that responds to UV light irradiation only, which greatly hinders it for further practical application for solar light. To address this problem, herein, 1D plasmonic Ag/Ag2WO4 photocatalysts have been fabricated by a successive process including hydrothermal synthesis to obtain Ag2WO4 followed by an additional in situ chemical-reduction process for Ag decoration. Then, the structural features, optical properties, and electronic structures of Ag2WO4 and Ag/Ag2WO4 nanowires were systematically investigated via a combination of theoretical calculations and experimental evidence. The plasmon-enhanced Ag/Ag2WO4 nanowires exhibited higher visible-light-driven photocatalytic activity, which performed a desired photodestruction ratio of 91.2% on methylene blue within 60 min and good stability in five cycles. The Ag decoration greatly facilitates visible-light harvesting and thus promotes photogenerated radical oxidation to dye, which is evidenced by the higher hydroxyl radical level of Ag/Ag2WO4 detected in the ESR test during the photocatalytic process. The theoretical calculation based on density functional theory indicates that Ag nanoparticles formed on the surface of Ag2WO4 could narrow the band gap of Ag2WO4. In addition, the surface plasmon resonance absorption effect and fast charge transfer effect in the metal-semiconductor system contribute to the photocatalytic performance of Ag/Ag2WO4.

  12. AgSat Areas of Interest

    Data.gov (United States)

    Farm Service Agency, Department of Agriculture — The AgSat Areas of Interest map contains area polygons where satellite imagery will be collected for the Farm Service Agency (FSA) to provide imagery coverage for...

  13. Comparative toxicity study of Ag, Au, and Ag-Au bimetallic nanoparticles on Daphnia magna.

    Science.gov (United States)

    Li, Ting; Albee, Brian; Alemayehu, Matti; Diaz, Rocio; Ingham, Leigha; Kamal, Shawn; Rodriguez, Maritza; Bishnoi, Sandra Whaley

    2010-09-01

    A comparative assessment of the 48-h acute toxicity of aqueous nanoparticles synthesized using the same methodology, including Au, Ag, and Ag-Au bimetallic nanoparticles, was conducted to determine their ecological effect in freshwater environments through the use of Daphnia magna, using their mortality as a toxicological endpoint. D. magna are one of the standard organisms used for ecotoxicity studies due to their sensitivity to chemical toxicants. Particle suspensions used in toxicity testing were well-characterized through a combination of absorbance measurements, atomic force or electron microscopy, flame atomic absorption spectrometry, and dynamic light scattering to determine composition, aggregation state, and particle size. The toxicity of all nanoparticles tested was found to be dose and composition dependent. The concentration of Au nanoparticles that killed 50% of the test organisms (LC(50)) ranged from 65-75 mg/L. In addition, three different sized Ag nanoparticles (diameters = 36, 52, and 66 nm) were studied to analyze the toxicological effects of particle size on D. magna; however, it was found that toxicity was not a function of size and ranged from 3-4 μg/L for all three sets of Ag nanoparticles tested. This was possibly due to the large degree of aggregation when these nanoparticles were suspended in standard synthetic freshwater. Moreover, the LC(50) values for Ag-Au bimetallic nanoparticles were found to be between that of Ag and Au but much closer to that of Ag. The bimetallic particles containing 80% Ag and 20% Au were found to have a significantly lower toxicity to Daphnia (LC(50) of 15 μg/L) compared to Ag nanoparticles, while the toxicity of the nanoparticles containing 20% Ag and 80% Au was greater than expected at 12 μg/L. The comparison results confirm that Ag nanoparticles were much more toxic than Au nanoparticles, and that the introduction of gold into silver nanoparticles may lower their environmental impact by lowering the amount

  14. BNL AGS - a context for kaon factories

    International Nuclear Information System (INIS)

    Littenberg, L.S.

    1983-05-01

    Figure 1 shows the Brookhaven site with the AGS-CBA complex highlighted. In this photograph the AGS is dwarfed by CBA and indeed during the past few years future plans for particle physics at BNL have been dominated by this enormous project. However, very recently interest in future physics use of the AGS has undergone a strong revival. Indeed, since the beginning of this year, two projects for augmenting the AGS have been proposed. Such projects could keep the AGS viable as a research machine for many years to come. In general such schemes will also improve the performance and increase the versatility of the CBA, and so are doubly valuable. It should be kept in mind that in spite of the fact the AGS has been perhaps the most fruitful machine in the history of high energy physics, its full capacities have never been exploited. Even without improvements at least one generation of rare K decay experiments beyond those currently launched seems feasible. Beyond that a major effort at any of the experiments discussed above could take it to the point where it would be limited by intrinsic physics background. To pursue a full program of physics at this level one would want to increase the intensity of the AGS as described. A ten-fold increase in K flux would remove such experiments from the category of all-out technological assaults and render them manageable by reasonably small groups of physicists. In addition, certain other, cleaner experiments, e.g., K/sub L/ 0 → e + e - or e + e - π 0 , could be pushed to limits unobtainable at the present AGS. The increased flux would also be welcomed by the neutrino and hypernuclear physics programs. Even experiments which do not at present require higher fluxes would benefit through the availability of purer beams and cleaner conditions

  15. Sonochemical synthesis of Ag/AgCl nanocubes and their efficient visible-light-driven photocatalytic performance.

    Science.gov (United States)

    Chen, Deliang; Yoo, Seung Hwa; Huang, Qingsong; Ali, Ghafar; Cho, Sung Oh

    2012-04-23

    A novel one-step sonochemical approach to synthesize a plasmonic photocatalyst of AgCl nanocubes (ca. 115 nm in edge length) with a small amount of Ag metal species is presented. The nanoscale Ag/AgCl hybrid photocatalysts with cubic morphology are readily formed under ambient ultrasonic conditions and neither external heat treatment nor reducing agents are required. The size of the Ag/AgCl photocatalysts could be controlled by changing the concentrations of Ag(+) ions and polyvinylpyrrolidone molecules in precursor solutions. The compositions, microstructures, influencing factors, and possible growth mechanism of the Ag/AgCl hybrid nanocubes were systematically investigated. The Ag/AgCl photocatalysts show excellent photocatalytic performance for degradation of various dye molecules under visible light. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Transformation of Ag nanocubes into Ag-Au hollow nanostructures with enriched Ag contents to improve SERS activity and chemical stability.

    Science.gov (United States)

    Yang, Yin; Zhang, Qiang; Fu, Zheng-Wen; Qin, Dong

    2014-03-12

    We report a strategy to complement the galvanic replacement reaction between Ag nanocubes and HAuCl4 with co-reduction by ascorbic acid (AA) for the formation of Ag-Au hollow nanostructures with greatly enhanced SERS activity. Specifically, in the early stage of synthesis, the Ag nanocubes are sharpened at corners and edges because of the selective deposition of Au and Ag atoms at these sites. In the following steps, the pure Ag in the nanocubes is constantly converted into Ag(+) ions to generate voids owing to the galvanic reaction with HAuCl4, but these released Ag(+) ions are immediately reduced back to Ag atoms and are co-deposited with Au atoms onto the nanocube templates. We observe distinctive SERS properties for the Ag-Au hollow nanostructures at visible and near-infrared excitation wavelengths. When plasmon damping is eliminated by using an excitation wavelength of 785 nm, the SERS activity of the Ag-Au hollow nanostructures is 15- and 33-fold stronger than those of the original Ag nanocubes and the Ag-Au nanocages prepared by galvanic replacement without co-reduction, respectively. Additionally, Ag-Au hollow nanostructures embrace considerably improved stability in an oxidizing environment such as aqueous H2O2 solution. Collectively, our work suggests that the Ag-Au hollow nanostructures will find applications in SERS detection and imaging.

  17. Synthesis and characterization of Ag/AgBrO{sub 3} photocatalyst with high photocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Song, Limin, E-mail: songlmnk@sohu.com [College of Environment and Chemical Engineering & State Key Laboratory of Hollow-Fiber Membrane Materials and Membrane Processes, Tianjin Polytechnic University, Tianjin, 300387 (China); Li, Tongtong [College of Environment and Chemical Engineering & State Key Laboratory of Hollow-Fiber Membrane Materials and Membrane Processes, Tianjin Polytechnic University, Tianjin, 300387 (China); Zhang, Shujuan [College of Science, Tianjin University of Science & Technology, Tianjin, 300457 (China)

    2016-10-01

    A new Ag/AgBrO{sub 3} photocatalyst was prepared by mixing aqueous solutions of AgNO{sub 3} and NaBrO{sub 3}. The catalyst’s structure and performance were investigated with X-ray powder diffraction, transmission electron microscopy, and X-ray photoelectron spectroscopy. The UV–vis absorption spectrum of Ag/AgBrO{sub 3} exhibits a band gap of 3.97 eV. The results show that the Ag/AgBrO{sub 3} semiconductor can be excited by ultraviolet–visible light. The photodegradation of Rhodamine B displayed much higher photocatalytic activity than that of N-doped TiO{sub 2} under the same experimental conditions. Moreover, ·OH and ·O{sub 2}{sup −} generated in the photocatalysis played a key role of the photodegradation of Rhodamine B. - Highlights: • Ag/AgBrO{sub 3} with higher photodegradation ability was synthesized. • ·OH and ·O{sub 2}{sup −} radicals were the main active species in the oxidation of RhB. • The possible reaction mechanism was discussed in details.

  18. Resonance Transitions in the Spectra of the Ag6+–Ag8+ Ions

    Directory of Open Access Journals (Sweden)

    Alexander Ryabtsev

    2017-03-01

    Full Text Available The spectrum of silver, excited in a vacuum spark, was recorded in the region 150–350 Å on a 3-m grazing incidence spectrograph. The resonance 4dk–(4dk−15p + 4dk−14f + 4p54dk+1 was studied in the Ag6+–Ag8+ spectra (Ag VII–Ag IX with k = 5–3, respectively. Several hundred lines were identified with the aid of the Cowan code and orthogonal operator technique calculations. The energy levels were found and the transition probabilities were calculated.

  19. RHIC/AGS Online Model Environments: Experiences and Design for AGS Modeling

    International Nuclear Information System (INIS)

    Brown, K.; Niederer, J.; Satogata, T.; Alai Tafti, A.; Tsoupas, N.; Zeijts, J. van

    1999-01-01

    The RHIC/AGS online modeling environment, a general client-server modeling package that supports cdev and straightforward integration of diverse computational modeling engines (CMEs), is being adapted to model the AGS and Booster at BNL. This implementation uses a version of MAD modified at BNL that allows traditional lattice structure analysis, single pass beam line analysis, multi-particle tracking, interactive graphics, and the use of field maps. The on-line model system is still under development, a real working prototype exists and is being tested. This paper describes the system and experience with its design and use for AGS and AGS Booster online modeling

  20. Synthesis of Ag-liposome nano composites.

    Science.gov (United States)

    Barani, Hossein; Montazer, Majid; Toliyat, Tayebeh; Samadi, Nasrin

    2010-12-01

    Silver nanoparticles were synthesized and stabilized by a simple, environment-friendly method in a liposomes structure. Liposomes were prepared by facing lecithin to the aqueous-phase solutions while stirring vigorously. The ratio of lecithin concentration to silver nitrate (K(Lec/Ag) = [Lecithin]/[AgNO(3)]) is the influencing factor in the synthesis of silver nanoparticles. The stability, size distribution, and antibacterial properties of synthesized silver nanoparticles were studied by ultraviolet (UV)-visible, dynamic light scattering, and antibacterial assay. The UV spectra indicated a single symmetric extinction peak at 400 nm, confirming the spherical shape of the synthesized silver nanoparticles. A high K(Lec/Ag) value leads to a reduction in the intensity of extinction spectra and increases the size of Ag-liposomes nanocomposites. The large Ag-liposomes nanocomposites are transformed to the smaller Ag-liposomes nanocomposites (from 342 to 190 nm) due to sonication treatment. The stabilized silver nanoparticles with various lecithin concentrations showed a good antibacterial activity against Staphylococcus aureus, a Gram-positive bacterium, and Escherichia coli, a Gram-negative bacterium.

  1. Fabrication and size control of Ag nanoparticles

    Directory of Open Access Journals (Sweden)

    M Farbod

    2012-06-01

    Full Text Available  The objective of this research was to fabricate Ag nanoparticles and control their sizes. Colloidal Ag nanoparticles with particle size of 30 nm were prepared by dissolving AgNO3 in ethanol and through the chemical reduction of Ag+ in alcohol solution. To control the nanoparticle size, different samples were fabricated by changing the AgNO3 and stabilizer concentrations and the effects of different factors on the shape and size of nanoparticles were investigated. The samples were characterized using SEM and EDX analysis. The results showed that by increasing the AgNO3 concentration, the average size of nanoparticles increases and nanoparticles lose their spherical shape. Also, we found that by using the stabilizer, it is possible to produce stable nanoparticles but increasing the stabilizer concentration caused an increase in size of nanoparticles. Fabrication of nanoparticles without using stabilizer was achieved but the results showed the nanoparticles size had a growth of 125 nm/h in the alcoholic media.

  2. Antibacterial Ag/a-C nanocomposite coatings: The influence of nano-galvanic a-C and Ag couples on Ag ionization rates

    Energy Technology Data Exchange (ETDEWEB)

    Manninen, N.K., E-mail: nora.sousa@dem.uc.pt [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, 3030-788 Coimbra (Portugal); GRF-CFUM, Physics Department, University of Minho, Campus of Azurém, 4800-058 Guimarães (Portugal); Calderon, S. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, 3030-788 Coimbra (Portugal); GRF-CFUM, Physics Department, University of Minho, Campus of Azurém, 4800-058 Guimarães (Portugal); Carvalho, I. [GRF-CFUM, Physics Department, University of Minho, Campus of Azurém, 4800-058 Guimarães (Portugal); CEB—Centre of Biological Engineering, LIBRO-Laboratório de Investigação em Biofilmes Rosário Oliveira, University of Minho, 4710-057 Braga (Portugal); Henriques, M. [CEB—Centre of Biological Engineering, LIBRO-Laboratório de Investigação em Biofilmes Rosário Oliveira, University of Minho, 4710-057 Braga (Portugal); Cavaleiro, A. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, 3030-788 Coimbra (Portugal); Carvalho, S. [SEG-CEMUC, Mechanical Engineering Department, University of Coimbra, 3030-788 Coimbra (Portugal); GRF-CFUM, Physics Department, University of Minho, Campus of Azurém, 4800-058 Guimarães (Portugal)

    2016-07-30

    Highlights: • Amorphous carbon (a-C), Ag/a-C and Ag coatings were deposited by magnetron sputtering. • a-C/Ag coating shows antibacterial activity against S. epidermidis. • The formation of nano-galvanic couples in a-C/Ag enhances the Ag{sup +} ionization rate. • The Ag{sup +} ionization occurs along with Ag nanoparticles agglomeration in 0.9% NaCl. - Abstract: Biofilm formation has been pointed as a major concern in different industrial applications, namely on biomedical implants and surgical instruments, which has prompted the development of new strategies for production of efficient antimicrobial surfaces. In this work, nano-galvanic couples were created to enhance the antibacterial properties of silver, by embedding it into amorphous carbon (a-C) matrix. The developed Ag/a-C nanocomposite coatings, deposited by magnetron sputtering, revealed an outstanding antibacterial activity against Staphylococcus epidermidis, promoting a total reduction in biofilm formation with no bacteria counts in all dilution. The open circuit potential (OCP) tests in 0.9% NaCl confirmed that a-C shows a positive OCP value, in contrast to Ag coating, thus enhancing the ionization of biocidal Ag{sup +} due to the nano-galvanic couple activation. This result was confirmed by the inductively coupled plasma-optical emission spectroscopy (ICP-OES), which revealed a higher Ag ionization rate in the nanocomposite coating in comparison with the Ag coating. The surface of Ag/a-C and Ag coatings immersed in 0.9% NaCl were monitored by scanning electron microscopy (SEM) over a period of 24 h, being found that the Ag ionization determined by ICP-OES was accompanied by an Ag nanoparticles coalescence and agglomeration in Ag/a-C coating.

  3. Antibacterial Ag/a-C nanocomposite coatings: The influence of nano-galvanic a-C and Ag couples on Ag ionization rates

    International Nuclear Information System (INIS)

    Manninen, N.K.; Calderon, S.; Carvalho, I.; Henriques, M.; Cavaleiro, A.; Carvalho, S.

    2016-01-01

    Highlights: • Amorphous carbon (a-C), Ag/a-C and Ag coatings were deposited by magnetron sputtering. • a-C/Ag coating shows antibacterial activity against S. epidermidis. • The formation of nano-galvanic couples in a-C/Ag enhances the Ag + ionization rate. • The Ag + ionization occurs along with Ag nanoparticles agglomeration in 0.9% NaCl. - Abstract: Biofilm formation has been pointed as a major concern in different industrial applications, namely on biomedical implants and surgical instruments, which has prompted the development of new strategies for production of efficient antimicrobial surfaces. In this work, nano-galvanic couples were created to enhance the antibacterial properties of silver, by embedding it into amorphous carbon (a-C) matrix. The developed Ag/a-C nanocomposite coatings, deposited by magnetron sputtering, revealed an outstanding antibacterial activity against Staphylococcus epidermidis, promoting a total reduction in biofilm formation with no bacteria counts in all dilution. The open circuit potential (OCP) tests in 0.9% NaCl confirmed that a-C shows a positive OCP value, in contrast to Ag coating, thus enhancing the ionization of biocidal Ag + due to the nano-galvanic couple activation. This result was confirmed by the inductively coupled plasma-optical emission spectroscopy (ICP-OES), which revealed a higher Ag ionization rate in the nanocomposite coating in comparison with the Ag coating. The surface of Ag/a-C and Ag coatings immersed in 0.9% NaCl were monitored by scanning electron microscopy (SEM) over a period of 24 h, being found that the Ag ionization determined by ICP-OES was accompanied by an Ag nanoparticles coalescence and agglomeration in Ag/a-C coating.

  4. Both released silver ions and particulate Ag contribute to the toxicity of AgNPs to earthworm Eisenia fetida

    NARCIS (Netherlands)

    Li, L.; , van, Gestel C.A.M.

    2015-01-01

    To disentangle the contribution of ionic and nanoparticulate Ag to the overall toxicity to the earthworm Eisenia fetida, a semi-permeable membrane strategy was used to separate Ag+ released from silver nanoparticles (AgNPs) in an aqueous exposure. Internal Ag fractionation, activities of antioxidant

  5. Search for chirality in 109Ag

    International Nuclear Information System (INIS)

    Timar, J.; Nyako, B.M.; Berek, G.; Gal, J.; Kalinka, G.; Krasznahorkay, A.; Molnar, J.; Zolnai, L.

    2007-01-01

    Complete text of publication follows. The existence of nuclear chirality is one of the most intriguing questions of contemporary high-spin nuclear structure studies. Rotational doublet-band candidates for chiral structures have been observed mostly in two regions of the nuclear chart: around 134 Pr, and around 104 Rh. In this second region chirality in the Rh isotopes are rather well studied, chiral doubling have also been observed in 100 Tc, however, results obtained for chirality in the studied Ag nuclei ( 105 Ag and 106 Ag) look rather contradictory. Thus, it is interesting to study these doublet bands in the nearby higher-mass Ag nuclei. In order to search for a chiral-candidate partner band to the yrast πg 9/2 v(h 11/2 ) 2 band in 109 Ag, high-spin states of this nucleus have been studied using the 96 Zr( 18 O,p4n) reaction. The experiment was performed at iThemba LABS using 8 Clover detectors of the AFRODITE array and the DIAMANT charged-particle array to detect the γ-rays and the charged particles, respectively. Altogether ∼140 million γγ-coincidence events were collected. Approximately 10 million events of them correspond to the reaction channel producing 109 Ag. No chiral candidate partner band has been found to the πg 9/2 v(h 11/2 ) 2 band with this statistics, however, the level scheme could be extended by several new levels and γ-transitions. A preliminary level scheme of 109 Ag obtained from the ongoing data analysis is shown in Fig. 1

  6. Molecular dynamics study on glass and molten state of AgI-AgPO3

    Science.gov (United States)

    Matsunaga, Shigeki

    2017-08-01

    Molecular dynamics (MD) simulation on molten and glass state of AgI-AgPO3 have been performed to investigate the structural features and transport properties. In MD, the screened Born-Mayer type potentials including the effect of polarizability of ions have been used. The structure, conductivity, shear viscosity, and Voronoi polyhedron are discussed in relation with the temperature change.

  7. Precipitation of Ag2Te in the thermoelectric material AgSbTe2

    International Nuclear Information System (INIS)

    Sugar, Joshua D.; Medlin, Douglas L.

    2009-01-01

    The microstructure of AgSbTe 2 , prepared by solidification, is investigated using electron microscopy. During solidification and thermal treatment, the material separates into a two-phase mixture of a rocksalt phase, which is Ag 22 Sb 28 Te 50 , and silver telluride, Ag 2 Te. Ag 2 Te formation results either from eutectic solidification (large lamellar structures), or by solid-state precipitation (fine-scale particles). The crystal structure of the AgSbTe 2 phase determined by electron diffraction is consistent with a rocksalt structure that has a disordered cation sublattice. A preferred crystallographic orientation relationship at the interface between the matrix and the low-temperature monoclinic Ag 2 Te phase is defined and discussed. This orientation relationship is observed for both second-phase morphologies. In both cases, the orientation relationship originates from a topotactic (cube-on-cube) alignment of the Te sublattices in the initially cubic Ag 2 Te and the matrix at elevated temperature. This Te sublattice alignment is retained as the Ag 2 Te undergoes a cubic-to-monoclinic transformation during cooling. This orientation relationship is observed for both second-phase morphologies.

  8. Oxygen electrosorption on Ag(111) and Ag(110) electrodes in in NaOH solution

    NARCIS (Netherlands)

    Droog, J.M.M.

    1980-01-01

    The first stages of the anodic oxidation of Ag(111) and Ag(110) electrodes in NaOH solution were studied by potential sweep voltammetry and ellipsometry. It was found that in the potential region studied, dissolution of silver species and electrosorption of oxygen occur. The (110) face is much more

  9. Radiation hardness of LuAG:Ce and LuAG:Pr scintillator crystals

    CERN Document Server

    Derdzyan, M V; Belsky, A; Dujardin, C; Lecoq, P; Lucchini, M; Ovanesyan, K L; Pauwels, K; Pedrini, C; Petrosyan, A G

    2012-01-01

    Single crystals of LuAG:Ce, LuAG:Pr and un-doped LuAG were grown by the vertical Bridgman method and studied for radiation hardness under gamma-rays with doses in the range 10-10(5) Gy (Co-60). A wide absorption band peaking at around 600 nm springs up in all three types of crystals after the irradiations. The second band peaking at around 375 nm appears in both LuAG:Pr and un-doped LuAG. Compositional variations have been done to reveal the spectral behavior of induced color centers in more detail and to understand their origin. Similarities in behavior of Yb2+ centers in as-grown garnets are found, indicating that radiation induced color centers can be associated with residual trace amounts of Yb present in the raw materials. Un-doped LuAG and LuAG:Ce demonstrate moderate radiation hardness (the induced absorption coefficients being equal to 0.05-0.08 cm(-1) for accumulated doses of 10(3)-10(4) Gy), while LuAG:Pr is less radiation hard. The ways to improve the radiation hardness are discussed.

  10. Characterization of Ag/Ag2SO4 system as reference electrode for in ...

    Indian Academy of Sciences (India)

    except the graphene nanoplatelets, carbon nanotubes, paper film and titanium foil were obtained from Sigma. Aldrich. The Ag/Ag2SO4 RE was situated between two lay- ers of the separator from the edge of the working and counter electrodes, besides these electrodes were rigor- ously positioned relative to each other to ...

  11. Observation of a Ag protrusion on a Ag2S island using a scanning tunneling microscope

    Directory of Open Access Journals (Sweden)

    Takeo Ohno

    2015-01-01

    Full Text Available A silver sulfide (Ag2S island as an ionic conductor in resistive switching memories was formed and a protrusion of silver from the Ag2S formed by an electrochemical reaction was observed using a scanning tunneling microscope.

  12. Ternary Ag/epoxy adhesive with excellent overall performance.

    Science.gov (United States)

    Ji, Yan-Hong; Liu, Yu; Huang, Gui-Wen; Shen, Xiao-Jun; Xiao, Hong-Mei; Fu, Shao-Yun

    2015-04-22

    Excellent electrical conductivity (EC) generally conflicts with high lap shear strength (LSS) for electrically conductive adhesives (ECAs) since EC increases while LSS decreases with increasing conductive filler content. In this work, the ECAs with the excellent overall performance are developed based on the ternary hybrid of Ag microflakes (Ag-MFs), Ag nanospheres (Ag-NSs), and Ag nanowires (Ag-NWs). First, a low silver content adhesive system is determined. Then, the effects of the relative contents of Ag fillers on the EC and the LSS are studied. It is shown that a small amount of Ag-NSs or Ag-NWs can dramatically improve the EC for the Ag-MF/epoxy adhesives. The Ag-NSs and Ag-NWs with appropriate contents have a synergistic effect in improving the EC. Meanwhile, the LSS of the as-prepared adhesive with the appropriate Ag contents reaches an optimal value. Both the EC and the LSS of the as-prepared ternary hybrid ECA with a low content of 40 wt % Ag are higher than those of the commercial ECAs filled with the Ag-MF content over 60 wt %. Finally, the ternary hybrid ECA with the optimal formulation is shown to be promising for printing the radio frequency identification tag antennas as an immediate application example.

  13. Ag-Ag2S/reduced graphene oxide hybrids used as long-wave UV radiation emitting nanocomposites

    Science.gov (United States)

    Li, Wenyao; Xu, Ruoyu; Ling, Min; He, Guanjie

    2017-10-01

    We report a facile thermal decomposition approach to synthesize Ag-Ag2S/reduced graphene oxide (Ag-Ag2S/rGO), the Ag-Ag2S nanoparticles uniformly dispersed on reduced graphene oxide with diameters of 10-20 nm. The photoluminescence spectra of Ag-Ag2S/rGO showed two obvious emission peaks at 327 and 339 nm with the excitation wavelength at 287 nm. Compared with Ag-Ag2S heterostructured clusters with two peaks at 407 and 430 nm, it showed a big blue shift and higher intensity, which makes it a novel candidate for long-wave UV radiation emitting nanocomposite.

  14. First-principles study of surface plasmons on Ag(111) and H/Ag(111)

    DEFF Research Database (Denmark)

    Yan, Jun; Jacobsen, Karsten Wedel; Thygesen, Kristian Sommer

    2011-01-01

    Linear-response time-dependent density functional theory is used to investigate the relation between molecular bonding and surface plasmons for the model system H/Ag(111). We employ an orbital-dependent exchange-correlation functional to obtain a correct description of the Ag 3d band, which...... is crucial to avoid overscreening the plasmon by the s-d interband transitions. For the clean surface, this approach reproduces the experimental plasmon energies and dispersion to within 0.15 eV. Adsorption of hydrogen shifts and damps the Ag(111) surface plasmon and induces a new peak in the loss function...... at 0.6 eV below the Ag(111) plasmon peak. This feature originates from interband transitions between states located on the hydrogen atoms and states on the Ag surface atoms....

  15. HBcrAg Identifies Patients Failing to Achieve HBeAg Seroconversion Treated with Pegylated Interferon Alfa-2b

    Directory of Open Access Journals (Sweden)

    Hui Ma

    2016-01-01

    Conclusions: Effective antiviral treatment can decrease HBcrAg levels in the serum. The NPVs of HBcrAg for predicting HBeAg seroconversion at 24-week follow-up was 100%, but the PPVs were not satisfactory (all <31%. The serum HBcrAg levels of the patients with HBeAg seroconversion at the end of the 24-week follow-up steadily declined or even became undetectable during the LTFU.

  16. Predictive role of serum HBsAg and HBcrAg kinetics in patients with HBeAg-negative chronic hepatitis B receiving pegylated interferon-based therapy.

    Science.gov (United States)

    Chuaypen, N; Posuwan, N; Chittmittraprap, S; Hirankarn, N; Treeprasertsuk, S; Tanaka, Y; Shinkai, N; Poovorawan, Y; Tangkijvanich, P

    2018-03-01

    To investigate the role of serum hepatitis B core-related antigen (HBcrAg) kinetics in predicting long-term outcome of pegylated interferon (PEG-IFN)-based therapy in patients with hepatitis B e antigen (HBeAg)-negative chronic hepatitis B (CHB). A total of 121 Thai patients with HBeAg-negative CHB recruited from a previous randomized trial of 48-week PEG-IFN alone or combined with entecavir were enrolled. Hepatitis B surface antigen (HBsAg) and HBcrAg levels were serially examined. Paired biopsy samples taken at baseline and after treatment were assessed for intrahepatic covalently closed circular DNA (cccDNA). Persistent virologic remission (PVR, defined by persistent hepatitis B virus (HBV) DNA <2000 IU/mL) and HBsAg clearance at 3 years after treatment were 29% (35/121) and 9% (11/121) respectively. Baseline HBcrAg correlated with HBV DNA and cccDNA but not with HBsAg. Baseline HBsAg, as well as HBsAg and HBcrAg, declines were associated with PVR, while HBsAg decline was predictive of HBsAg clearance. High baseline antigen levels (HBsAg ≥3.4 log 10 IU/mL plus HBcrAg ≥3.7 log 10 U/mL) yielded high negative predictive values of PVR (45/50, 90%) and HBsAg clearance (50/50, 100%). At week 12, declines of HBsAg, HBcrAg and both antigens combined of <0.5 log 10 yielded negative predictive values for PVR of 90% (71/79), 82% (61/74) and 96% (48/50) respectively. Quantitative HBcrAg was significantly associated with cccDNA in HBeAg-negative CHB. This novel antigen, together with HBsAg, could identify patients with low probability of PVR and HBsAg clearance in long-term follow-up. Copyright © 2017 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

  17. A biodynamic understanding of dietborne and waterborne Ag uptake from Ag NPs in the sediment-dwelling oligochaete, Tubifex tubifex

    DEFF Research Database (Denmark)

    Tangaa, Stine Rosendal; Selck, Henriette; Winther-Nielsen, Margrethe

    2018-01-01

    environmental risk assessment. Here we characterized unidirectional parameters for uptake and elimination of silver (Ag) in the sediment-dwelling oligochaete Tubifex tubifex after waterborne (0.01–47 nmol Ag/L) and dietborne (0.4–482 nmol Ag/g dw sed.) exposures to Ag NPs and AgNO3, respectively. Worms...... accumulated Ag from AgNO3 more efficiently than from Ag NPs during waterborne exposure. The Ag uptake rate constants from water were 8.2 L/g/d for AgNO3 and 0.34 L/g/d for Ag NPs. Silver accumulated from both forms was efficiently retained in tissues, as no significant loss of Ag was detected after up to 20...... days of depuration in clean media. High mortality (~50%) during depuration (i.e. after 17 days) was only observed for worms exposed to waterborne AgNO3 (3 nmol/L). Sediment exposures to both Ag forms resulted in low accumulation, i.e., the uptake rate constants were 0.002 and 0.005 g/g/d for AgNO3...

  18. High Intensity Performance of the Brookhaven AGS

    International Nuclear Information System (INIS)

    Ahrens, L. A.; Alessi, J.; Blaskiewicz, M.; Brennan, J. M.; Brown, K.; Gardner, C.; Glenn, J. W.; Roser, T.; Smith, K. S.; VanAsselt, W.; Zhang, S. Y.

    1999-01-01

    The Brookhaven AGS provides 24 GeV protons for a multi-user program of fixed-target high energy physics experiments, such as the study of extremely rare Kaon decays. Up to 7 x 10 13 protons are slowly extracted over 2.2 seeds each 5.1 seconds. The muon storage ring of the g-2 experiment is supplied with bunches of 7 x 10 12 protons. Since the completion of the 1.9 GeV Booster synchrotron and installation of a new high-power rf system and transition jump system in the AGS various modes of operation have been explored to overcome space charge limits and beam instabilities at these extreme beam intensities. Experiments have been done using barrier cavities to enable accumulation of debunched beam in the AGS as a potential path to significantly higher intensities. We report on the present understanding of intensity limitations and prospects for overcoming them

  19. Spectrophotometry of the shell around AG Carinae

    Science.gov (United States)

    Mitra, P. Mila; Dufour, Reginald J.

    1990-01-01

    Spatially-resolved long-slit spectrophotometry are presented for two regions of the shell nebula around the P-Cygni variable star AG Carinae. The spectra cover the 3700-6800 A wavelength range. Emission-line diagnostics are used to derive extinction, electron temperatures, and densities for various positions in the nebula. The chemical abundances and ionization structure are calculated and compared with other types of planetary nebulae and shells around other luminous stars. It is found that the N/O and N/S ratios of Ag Car are high compared to solar neighborhood ISM values. The O/H depletion found for the AG Car shell approaches that found in the condensations of the Eta Car system.

  20. Upgrading the AGS polarized beam facility

    International Nuclear Information System (INIS)

    Ratner, L.G.

    1991-01-01

    Although present techniques for crossing depolarizing resonances in circular accelerators work, they are very time-consuming to implement and were only able to provide about a 40% polarized beam at 22 GeV in the Alternating Gradient Synchrotron (AGS). We propose to install a partial ''Siberian Snake'' solenoid in the AGS to eliminate the need to correct imperfection resonances and to make other modifications in our intrinsic resonance correctors. This will allow us to reach an energy of 25 GeV with 70% polarization and will enable the AGS to be an efficient injector of polarized protons into the Relativistic Heavy Ion Collider (RHIC), as well as being able to carry on a fixed-target program with minimum set-up time. 3 refs., 5 figs., 1 tab

  1. A High Intensity Hadron Facility, AGS II

    International Nuclear Information System (INIS)

    Lee, Y.Y.; Lowenstein, D.I.

    1988-01-01

    We have present one of several possibilities for the evolution of the AGS complex into a high intensity hadron facility. One could consider other alternatives, such as using the AGS as the Collector and constructing a new 9-30 GeV machine. We believe the most responsible scenario must minimize the cost and downtime to the ongoing physics program. With a stepwise approach, starting with the Booster, the physics program can evolve without a single major commitment in funds. At each step an evaluation of the funds versus physics merit can be made. As a final aside, each upgrade at the AGS and Booster is presently being implemented to support an interleaved operation of both protons and ions. 1 fig., 6 tabs

  2. Ag on Si(111) from basic science to application

    Energy Technology Data Exchange (ETDEWEB)

    Belianinov, Aleksey [Iowa State Univ., Ames, IA (United States)

    2012-01-01

    In our work we revisit Ag and Au adsorbates on Si(111)-7x7, as well as experiment with a ternary system of Pentacene, Ag and Si(111). Of particular interest to us is the Si(111)-(√3x√3)R30°}–Ag (Ag-Si-√3 hereafter). In this thesis I systematically explore effects of Ag deposition on the Ag-Si-√3 at different temperatures, film thicknesses and deposition fluxes. The generated insight of the Ag system on the Si(111) is then applied to generate novel methods of nanostructuring and nanowire growth. I then extend our expertise to the Au system on the Ag-Si(111) to gain insight into Au-Si eutectic silicide formation. Finally we explore behavior and growth modes of an organic molecule on the Ag-Si interface.

  3. Spin tracking study of the AGS

    International Nuclear Information System (INIS)

    Huang, H.; Roser, T.; Luccio, A.

    1997-01-01

    In the recent polarized proton runs in the AGS, a 5% partial snake was used successfully to overcome the imperfection depolarizing resonances. Although some depolarization at intrinsic resonances are expected, the level of the depolarization does not agree with a simple model calculation. A spin tracking program is then used to simulate the real polarized proton beam in the AGS. The results show that, due to the linear coupling introduced by a solenoidal 5% partial snake, the polarized beam will be partially depolarized also at the so-called coupling resonance, which is related to the horizontal betatron tune. The synchrotron oscillation also affects the beam polarization to a smaller extent

  4. Siberian Snake solenoid for the AGS

    International Nuclear Information System (INIS)

    Ratner, L. G.

    1991-01-01

    Recent experiments at the Indiana University Cyclotron Facility (IUCF) have demonstrated that ''Siberian Snakes'' can be used to preserve the polarization of an accelerated polarized beam in a circular accelerator. Retrofitting full snakes into accelerators such as the Alternating Gradient Synchrotron (AGS) at Brookhaven is almost impossible due to space limitations, but a partial snake that can correct depolarization due to imperfection resonances with 1/20 to 1/30 of a full strength snake seems to present a viable option. We describe such a device for the AGS and give the design criteria in terms of simplicity of accelerator operation and level of achievable polarization. 2 refs., 5 figs., 1 tab

  5. Optical absorption spectra of Ag-11 isomers

    DEFF Research Database (Denmark)

    Martinez, Jose Ignacio; Fernandez, E. M.

    2009-01-01

    The optical absorption spectra of the three most; stable structural isomers of the Ag-11 cluster were calculated using the time-dependent, density functional theory within the Casida formalism. The slightly different, spectra, of the isomers may permit the identification of the ground-stale confi......The optical absorption spectra of the three most; stable structural isomers of the Ag-11 cluster were calculated using the time-dependent, density functional theory within the Casida formalism. The slightly different, spectra, of the isomers may permit the identification of the ground...

  6. Structure and stability of defective silicene on Ag(001) and Ag(111) substrates: A computer experiment

    Science.gov (United States)

    Galashev, A. E.; Ivanichkina, K. A.; Vorob'ev, A. S.; Rakhmanova, O. R.

    2017-06-01

    The structure and stability of a two-layer defective silicene on Ag(001) and Ag(111) substrates have been investigated using the molecular dynamics method. The transformation of the radial distribution function of silicene due to the formation of monovacancies, divacancies, trivacancies, and hexavacancies is reduced primarily to a decrease in the intensity of the peaks and the disappearance of the "shoulder" in the second peak. With the passage of time, multivacancies can undergo coalescence with each other and the fragmentation into smaller vacancies, as well as form vacancy clusters. According to the geometric criterion, the Ag(001) substrate provides a higher stability of a perfect two-layer silicene. It has been found, however, that the defective silicene on this substrate has a lower energy only when it contains monovacancies and divacancies. A change in the size of defects leads to a change in the energy priority when choosing between the Ag(001) and Ag(111) substrates. The motion of a lithium ion inside an extended channel between two silicene sheets results in a further disordering of the defective structure of the silicene, during which the strongest stresses in the silicene are generated by forces directed perpendicular to the external electric field. These forces dominate in the silicene channel, the wall of which is supported by the Ag(001) or Ag(111) substrate.

  7. Ag@Ag8W4O16 nanoroasted rice beads with photocatalytic, antibacterial and anticancer activity

    International Nuclear Information System (INIS)

    Selvamani, Muthamizh; Krishnamoorthy, Giribabu; Ramadoss, Manigandan; Sivakumar, Praveen Kumar; Settu, Munusamy; Ranganathan, Suresh; Vengidusamy, Narayanan

    2016-01-01

    Increasing resistance of pathogens and cancer cell line towards antibiotics and anticancer agents has caused serious health problems in the past decades. Due to these problems in recent years, researchers have tried to combine nanotechnology with material science to have intrinsic antimicrobial and anticancer activity. The metals and metal oxides were investigated with respect to their antimicrobial and anticancer effects towards bacteria and cancer cell line. In the present work metal@metal tungstate (Ag@Ag 8 W 4 O 16 nanoroasted rice beads) is investigated for antibacterial activity against Escherichia coli and Staphylococcus aureus using Mueller-Hinton broth and the anticancer activity against B16F10 cell line was studied. Silver decorated silver tungstate (Ag@Ag 8 W 4 O 16 ) was synthesized by the microwave irradiation method using Cetyl Trimethyl Ammonium Bromide (CTAB). Ag@Ag 8 W 4 O 16 was characterized by using various spectroscopic techniques. The phase and crystalline nature were analyzed by using XRD. The morphological analysis was carried out using Field Emission Scanning Electron Microscopy (FE-SEM), and High Resolution Transmission Electron Microscopy (HR-TEM). Further, Fourier Transform Infrared Spectroscopy (FT-IR) and Raman spectral analysis were carried out in order to ascertain the presence of functional groups in Ag@Ag 8 W 4 O 16 . The optical property was investigated using Diffuse Reflectance Ultraviolet–Visible Spectroscopy (DRS-UV–Vis) and the band gap was found to be 3.08 eV. Surface area of the synthesized Ag@Ag 8 W 4 O 16 wasanalyzed by BET analysis and Ag@Ag 8 W 4 O 16 was utilized for the degradation of organic dyes methylene blue and rhodamine B. The morphology of the Ag@Ag 8 W 4 O 16 resembles roasted rice beads with breath and length in nm range. The oxidation state of tungsten (W) and silver (Ag) was investigated using X-ray photoelectron spectroscopy (XPS). - Highlights: • Synthesis of Ag@Ag 8 W 4 O 16 nanoroasted rice beads

  8. Bifunctional Ag@Pd-Ag Nanocubes for Highly Sensitive Monitoring of Catalytic Reactions by Surface-Enhanced Raman Spectroscopy.

    Science.gov (United States)

    Li, Jumei; Liu, Jingyue; Yang, Yin; Qin, Dong

    2015-06-10

    We report a route to the facile synthesis of Ag@Pd-Ag nanocubes by cotitrating Na2PdCl4 and AgNO3 into an aqueous suspension of Ag nanocubes at room temperature in the presence of ascorbic acid and poly(vinylpyrrolidone). With an increase in the total titration volume, we observed the codeposition of Pd and Ag atoms onto the edges, corners, and side faces of the Ag nanocubes in a site-by-site fashion. By maneuvering the Pd/Ag ratio, we could optimize the SERS and catalytic activities of the Ag@Pd-Ag nanocubes for in situ SERS monitoring of the Pd-catalyzed reduction of 4-nitrothiophenol by NaBH4.

  9. A research on shape-controllable synthesis of Ag3PO4/AgBr and its degradation of ciprofloxacin.

    Science.gov (United States)

    Chen, Jingran; Yang, Xingyu; Zhu, Chenyu; Xie, Xin; Lin, Cuiping; Zhao, Yalei; Yan, Qishe

    2018-03-01

    Antibiotic ciprofloxacin is one of the commonly used broad spectrum fluoroquinolone human and veterinary drugs. Because of the overuse of human beings, the presence of ciprofloxacin has been detected in a variety of environmental matrices. To solve this problem, a facile, environmentally-friendly Ag 3 PO 4 /AgBr composite photocatalyst was synthesized by a simple precipitation method at room temperature in the presence of cetyltrimethyl ammonium bromide (CTAB). CTAB was served as surfactant and the source of bromide ions. The as-prepared Ag 3 PO 4 /AgBr microspheres were characterized by means of powder X-ray diffraction (XRD), scanning electron microscope (SEM) and UV-visible diffuse reflectance spectroscopy (UV-vis DRS). The results revealed that the Ag 3 PO 4 /AgBr sample (synthesized with CTAB, 0.8 g) exhibited the highest photocatalytic activity to the photodegradation rate of 96.36%. Moreover, mechanism detection experiment indicated that h + was the major active species in the degradation process. So the enhanced photocatalytic activity of Ag 3 PO 4 /AgBr composites is attributed to its excellent separation of photogenerated electron-hole pairs through Ag 3 PO 4 /AgBr heterojunction. Also, Ag 3 PO 4 /AgBr heterojunction has a lower band gap compared to pure Ag 3 PO 4 and pure AgBr, so higher efficiency of light harvesting is equipped.

  10. Effect of Ag in structural, electrical and magnetic properties of Ag-sheated Bi-2223 wires

    Directory of Open Access Journals (Sweden)

    D Sohrabi

    2009-08-01

    Full Text Available  In this study, the superconducting properties of Bi-2223/Ag wires, made by the PIT method have been studied. Powder samples were prepared using conventional solid state reaction method. After calcination, samples with different Ag percent (0, 5, 10, 15, 20, and 25 prepared and sintered at 830 °C. It was shown that Ag addition has not only affected the formation of the desired Bi-2223 phase and the microstructure of these wires, but also influenced on the critical current density (JC and critical temperature.

  11. Effect of cysteine and humic acids on bioavailability of Ag from Ag nanoparticles to a freshwater snail

    Science.gov (United States)

    Luoma, Samuel N.; Tasha Stoiber,; Croteau, Marie-Noele; Isabelle Romer,; Ruth Merrifeild,; Lead, Jamie

    2016-01-01

    Metal-based engineered nanoparticles (NPs) will undergo transformations that will affect their bioavailability, toxicity and ecological risk when released to the environment, including interactions with dissolved organic material. The purpose of this paper is to determine how interactions with two different types of organic material affect the bioavailability of silver nanoparticles (AgNPs). Silver uptake rates by the pond snail Lymnaea stagnalis were determined after exposure to 25 nmol l-1 of Ag as PVP AgNPs, PEG AgNPs or AgNO3, in the presence of either Suwannee River humic acid or cysteine, a high-affinity thiol-rich organic ligand. Total uptake rate of Ag from the two NPs was either increased or not strongly affected in the presence of 1 – 10 mg 1-1 humic acid. Humic substances contain relatively few strong ligands for Ag explaining their limited effects on Ag uptake rate. In contrast, Ag uptake rate was substantially reduced by cysteine. Three components of uptake from the AgNPs were quantified in the presence of cysteine using a biodynamic modeling approach: uptake of dissolved Ag released by the AgNPs, uptake of a polymer or large (>3kD) Ag-cysteine complex and uptake of the nanoparticle itself. Addition of 1:1 Ag:cysteine reduced concentrations of dissolved Ag, which contributed to, but did not fully explain the reductions in uptake. A bioavailable Ag-cysteine complex (> 3kD) appeared to be the dominant avenue of uptake from both PVP AgNPs and PEG AgNPs in the presence of cysteine. Quantifying the different avenues of uptake sets the stage for studies to assess toxicity unique to NPs.

  12. Enteroantigen (eAg)-binding B lymphocytes in the mouse - phenotype, distribution, function and eAg-specific antibody secretion

    DEFF Research Database (Denmark)

    Venning, Freja Albjerg; Trempenau, Mette Louise; Schmidt, Esben

    2013-01-01

    cells in causing proliferation of eAg-specific T cells. In comparison with eAg- B cells, eAg+ B cells secrete a significant amount of IL-10 in vitro, suggesting an anti-inflammatory potential. Compared with wild-type B cells, B cell receptor (BCR) transgenic, hen egg lysozyme-specific B cells show...... inferior eAg binding and T cell stimulatory activity suggesting involvement of the BCR in eAg binding and processing. After activation of CD19(+) B cells by eAg and hybridization with hypoxanthine-aminopterin-thymidine (HAT) sensitive ×63 lymphoma cells followed by cloning at limiting dilution conditions...

  13. Development of a Rhizoctonia solani AG1-IB Specific Gene Model Enables Comparative Genome Analyses between Phytopathogenic R. solani AG1-IA, AG1-IB, AG3 and AG8 Isolates.

    Directory of Open Access Journals (Sweden)

    Daniel Wibberg

    Full Text Available Rhizoctonia solani, a soil-born plant pathogenic basidiomycetous fungus, affects various economically important agricultural and horticultural crops. The draft genome sequence for the R. solani AG1-IB isolate 7/3/14 as well as a corresponding transcriptome dataset (Expressed Sequence Tags--ESTs were established previously. Development of a specific R. solani AG1-IB gene model based on GMAP transcript mapping within the eukaryotic gene prediction platform AUGUSTUS allowed detection of new genes and provided insights into the gene structure of this fungus. In total, 12,616 genes were recognized in the genome of the AG1-IB isolate. Analysis of predicted genes by means of different bioinformatics tools revealed new genes whose products potentially are involved in degradation of plant cell wall components, melanin formation and synthesis of secondary metabolites. Comparative genome analyses between members of different R. solani anastomosis groups, namely AG1-IA, AG3 and AG8 and the newly annotated R. solani AG1-IB genome were performed within the comparative genomics platform EDGAR. It appeared that only 21 to 28% of all genes encoded in the draft genomes of the different strains were identified as core genes. Based on Average Nucleotide Identity (ANI and Average Amino-acid Identity (AAI analyses, considerable sequence differences between isolates representing different anastomosis groups were identified. However, R. solani isolates form a distinct cluster in relation to other fungi of the phylum Basidiomycota. The isolate representing AG1-IB encodes significant more genes featuring predictable functions in secondary metabolite production compared to other completely sequenced R. solani strains. The newly established R. solani AG1-IB 7/3/14 gene layout now provides a reliable basis for post-genomics studies.

  14. Determination of Ag in technique process research

    International Nuclear Information System (INIS)

    Su Tao; Zhang Lihua; Fan Dejun; Liu Huanliang; Wu Jizong

    2008-01-01

    Based on the chromogenic reaction of Ag with p-dimethylamino benzyl rhodanine, a new spectrophotometric method for determination of Ag in the presence of PVA-124 and Triton X-100 as surfactant is established. The factors such as acidity, reaction time and the concentration of surfactant were studied. The results show that the appropriate conditions are as the following. The concentrations of p-dimethylamino benzyl rhodanine, PVA and Triton X-100 are 0.1 g·L -1 , 10 g·L -1 and 0.16% respectively. Acidity is 1.0 mol·L -1 . Reaction time is 20 minutes. Absorption wavelength is 470 nm. The influence of several coexisting ions, especially Pu (Ⅳ) on analyzing Ag is also studied. The results indicate that when the concentration of Ag is less than five times of the concentration of Pu. PMBP is used to extract Pu (Ⅳ). The optimum extraction conditions are as follows. The concentration of PMBP is 0.1 mol·L-1. Acidity is 2.0 mol·L-1. The ratio of organic and water phase is 1:1. Extraction time is 3 minutes. Conformity to Berr's law was obtained with the scope of 0.1-1.0 μg·mL -1 . The determination limit of Ag is 0.1 μg·mL -1 . The relative standard deviation for this method is 2.6% (n=3). The recovery is 104-114%. (authors)

  15. Synthesis and Ag-loading-density-dependent photocatalytic activity of Ag@TiO{sub 2} hybrid nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Deliang, E-mail: dlchen@zzu.edu.cn [School of Materials Science and Engineering, Zhengzhou University, 100 Science Road, Zhengzhou 450001 (China); Chen, Qianqian; Ge, Lianfang; Yin, Li; Fan, Bingbing; Wang, Hailong; Lu, Hongxia; Xu, Hongliang [School of Materials Science and Engineering, Zhengzhou University, 100 Science Road, Zhengzhou 450001 (China); Zhang, Rui [School of Materials Science and Engineering, Zhengzhou University, 100 Science Road, Zhengzhou 450001 (China); Laboratory of Aeronautical Composites, Zhengzhou Institute of Aeronautical Industry Management, 2 University Road, Zhengzhou 450046 (China); Shao, Guosheng [UK-China Centre for Multi-functional Nanomaterials, Zhengzhou University, Zhengzhou 450001 (China); Institute for Renewable Energy and Environmental Technology, University of Bolton, Bolton BL3 5AB (United Kingdom)

    2013-11-01

    Silver-decorated TiO{sub 2} nanoparticles (Ag@TiO{sub 2}) were synthesized by photoreducing Ag{sup +} species in an EG–ethanol solution in the presence of TiO{sub 2} (P25) nanoparticles. The TEM observations indicate that the Ag nanoclusters (NCs) with a size range of 1–3 nm were uniformly anchored on the surfaces of TiO{sub 2} nanoparticles. The Ag@TiO{sub 2} nanocomposites with various amounts of Ag NCs (0.5–10% in mass) were synthesized by changing the concentrations of Ag{sup +} in their precursors. The photocatalytic activity of the as-synthesized Ag@TiO{sub 2} nanocomposites was investigated by photodegradating RhB dye under visible-light irradiation (λ ≥ 400 nm). The results show that the as-obtained Ag@TiO{sub 2} nanocomposites show a novel Ag-loading-density-dependent photocatalytic activity, and that the Ag@TiO{sub 2} photocatalyst with ∼1% Ag NCs has the best photocatalytic performance with a high rate constant, 22 times higher than that of P25 TiO{sub 2} under the same condition. The enhanced photocatalytic performance should be attributed to the LSPR property of Ag NCs. The possible mechanism for the Ag-loading-density-dependent photocatalytic performance was discussed in detail.

  16. A comparative study about electronic structures at rubrene/Ag and Ag/rubrene interfaces

    Directory of Open Access Journals (Sweden)

    Sumona Sinha

    2015-10-01

    Full Text Available The contact between the electrode and the organic semiconductor is one of the most crucial factors in determining the organic device performance. The development and production technology of different organic devices require the understanding of different types of metal/organic semiconducting thin film interfaces. Comparisons about the electronic structures at Rubrene/Ag and Ag/Rubrene interfaces have been studied using photoemission spectroscopy. The Ag on rubrene interfaces is found to show more interesting and complex natures than its counterpart. The vacuum level (VL was shifted about 0.51 eV from push back effect for deposition of 5 Å rubrene onto Ag film whereas the electronic features of silver was only suppressed and no energy shift was resulted. While the deposition of 5 Å Ag onto rubrene film leads to the diffusion of the Ag atoms, as a cluster with quantum size effect, inside the film. Angle dependent XPS measurement indicates that diffused metal clusters were present at entire probed depth of the film. Moreover these clusters dope the uppermost surface of the rubrene film which consequences a shift of the electronic states of thick organic film towards higher binding energy. The VL was found to shift about 0.31 eV toward higher binding energy whereas the shift was around 0.21 eV for the electronic states of rubrene layer.

  17. Safe and Effective Ag Nanoparticles Immobilized Antimicrobial NanoNonwovens

    DEFF Research Database (Denmark)

    Song, Jie; Chen, Menglin; Regina, Viduthalai R.

    2012-01-01

    Silver nanoparticles (AgNPs) with large surface-to-volume ratio have been widely studied as a valuable material for their strong antimicrobial effect. However, the practical applications of AgNPs in health care and water purification are often hampered by the concern of their toxicity...... retains the enhanced antimicrobial activities from nanofeatured AgNPs without detectable AgNPs leaching, which holds great potential for safe and recyclable use....

  18. Study of structural modification of PVA by incorporating Ag nanoparticles

    DEFF Research Database (Denmark)

    Saini, I.; Sharma, A.; Rozra, J.

    2016-01-01

    Nanocomposites of PVA with Ag nanoparticles dispersed in it were synthesized using solution casting method. The morphology and size distribution of Ag nanoparticles embedded in PVA matrix were obtained by transmission electron microscopy (TEM) and Field emission scanning electron microscopy (FE......-SEM). Raman spectroscopy was used to examine structural changes taking place inside polyvinyl alcohol (PVA) matrix due to incorporation of Ag nanoparticle. Raman analysis indicates that Ag nanoparticles interact with PVA through H-bonding. © 2016 Author(s)....

  19. Study of structural modification of PVA by incorporating Ag nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Saini, Isha; Sharma, Annu, E-mail: asharma@kuk.ac.in; Rozra, Jyoti; Aggarwal, Sanjeev [Department of Physics, Kurukshetra University, Kurukshetra 136119 (India); Dhiman, Rajnish [Department of Physics and Chemistry, University of Southern Denmark, Campusvej 55, DK-5230 Odense M (Denmark); Sharma, Pawan K. [Department of Chemistry, Kurukshetra University, Kurukshetra 136119 (India)

    2016-05-23

    Nanocomposites of PVA with Ag nanoparticles dispersed in it were synthesized using solution casting method. The morphology and size distribution of Ag nanoparticles embedded in PVA matrix were obtained by transmission electron microscopy (TEM) and Field emission scanning electron microscopy (FE-SEM). Raman spectroscopy was used to examine structural changes taking place inside polyvinyl alcohol (PVA) matrix due to incorporation of Ag nanoparticle. Raman analysis indicates that Ag nanoparticles interact with PVA through H-bonding.

  20. Antibacterial Ag/a-C nanocomposite coatings: The influence of nano-galvanic a-C and Ag couples on Ag ionization rates

    Science.gov (United States)

    Manninen, N. K.; Calderon, S.; Carvalho, I.; Henriques, M.; Cavaleiro, A.; Carvalho, S.

    2016-07-01

    Biofilm formation has been pointed as a major concern in different industrial applications, namely on biomedical implants and surgical instruments, which has prompted the development of new strategies for production of efficient antimicrobial surfaces. In this work, nano-galvanic couples were created to enhance the antibacterial properties of silver, by embedding it into amorphous carbon (a-C) matrix. The developed Ag/a-C nanocomposite coatings, deposited by magnetron sputtering, revealed an outstanding antibacterial activity against Staphylococcus epidermidis, promoting a total reduction in biofilm formation with no bacteria counts in all dilution. The open circuit potential (OCP) tests in 0.9% NaCl confirmed that a-C shows a positive OCP value, in contrast to Ag coating, thus enhancing the ionization of biocidal Ag+ due to the nano-galvanic couple activation. This result was confirmed by the inductively coupled plasma-optical emission spectroscopy (ICP-OES), which revealed a higher Ag ionization rate in the nanocomposite coating in comparison with the Ag coating. The surface of Ag/a-C and Ag coatings immersed in 0.9% NaCl were monitored by scanning electron microscopy (SEM) over a period of 24 h, being found that the Ag ionization determined by ICP-OES was accompanied by an Ag nanoparticles coalescence and agglomeration in Ag/a-C coating.

  1. Electrochemical sensing and photocatalysis using Ag-TiO 2 ...

    Indian Academy of Sciences (India)

    The superior performance of the Ag-TiO2 composite microwires is attributed to improved surface reactivity, mass transport and catalytic property as a result of wiring the TiO2 surface with Ag nanoparticles. Compared to the TiO2 microwires, Ag-TiO2 microwires exhibited three times higher sensitivity in the detection of ...

  2. AGS experiments -- 1996, 1997, 1998, 1999. Fifteenth edition

    Energy Technology Data Exchange (ETDEWEB)

    Lo Presti, P.

    1999-03-01

    This report is a compilation of two-page summaries for AGS experiments for FY 1996, FY 1997, FY 1998, FY 1999. The bulk of the experiments are for high energy physics and nuclear physics programs. Also included are the run schedules for the AGS for each of those years and a listing of publications of AGS experiments for 1982--1999.

  3. AGS experiments - 1996, 1997, 1998, 1999. Fifteenth edition

    International Nuclear Information System (INIS)

    Lo Presti, P.

    1999-03-01

    This report is a compilation of two-page summaries for AGS experiments for FY 1996, FY 1997, FY 1998, FY 1999. The bulk of the experiments are for high energy physics and nuclear physics programs. Also included are the run schedules for the AGS for each of those years and a listing of publications of AGS experiments for 1982--1999

  4. Mechanical alloying of the FeNi-Ag system

    International Nuclear Information System (INIS)

    Gonzalez, G.; Ibarra, D.; Ochoa, J.; Villalba, R.; Sagarzazu, A.

    2007-01-01

    The Fe-Ni-Ag system is of particular interest for its potential applications as soft magnetic granular material with small magnetic grains embedded in a non-magnetic metal matrix. Under equilibrium conditions: Fe-Ag and Ni-Ag are immiscible and Fe-Ni shows complete solubility. These materials are particularly important for magnetoresistivity properties. The properties of these alloys are closely related to their microstructure; therefore, a detailed study of the transformations occurring during milling was undertaken using pre-alloyed Fe x Ni 100-x (x = 30, 50 and 70) further milled with different Ag content to give the following alloys compositions (Fe x -Ni 100-x ) 100-y Ag y (y = 5, 20, 60). Consolidation of the mechanically alloyed powders by sintering at 950 o C was performed. Morphological and structural characterization of the sintered powders was carried out by scanning and transmission electron microscopy and X-ray diffraction. Fe 30 Ni 70 and Fe 50 Ni 50 formed ordered FeNi 3 compound. Fe 70 Ni 30 showed the formation of a mixture of γ-(Fe,Ni) and α-Fe(Ni) solid solutions. The mixture of these systems with Ag showed the metal solid solutions surrounded by Ag islands of Fe x Ni y -Ag, There was also evidence of Ag diffusing into the γ-(Fe,Ni). High Ag content (60%) shows formation of islands of FeNi surrounded by Ag. Sintering is always improved with the Ag content

  5. Formation of bimetallic Ag-Pd nanoclusters via the reaction between Ag nanoclusters and Pd2+ ions.

    Science.gov (United States)

    Chen, Ching-Hsiang; Sarma, Loka Subramanyam; Wang, Guo-Rung; Chen, Jiun-Ming; Shih, Shou-Chu; Tang, Mau-Tsu; Liu, Ding-Goa; Lee, Jyh-Fu; Chen, Jing-Ming; Hwang, Bing-Joe

    2006-06-01

    We have investigated systematically the mechanistic aspects of the Ag-Pd bimetallic cluster formation within sodium bis(2-ethylhexyl)sulfosuccinate (AOT) reverse micelles by using in-situ X-ray absorption spectroscopy (XAS). A two-step sequential reduction method is employed for the synthesis of Ag-Pd bimetallic clusters. The first step involves preparation of Ag nanoclusters, by mixing the Ag+ ions containing the AOT microemulsion system with a reducing agent hydrazine (N2H4) containing the AOT microemulsion system. In the second step, the addition of Pd2+ ions to Ag nanoclusters led to the formation of Ag-Pd bimetallic clusters via the reaction between Ag nanoclusters and Pd2+ ions in AOT reverse micelles. The reduction of silver ions and the formation of corresponding Ag nanoclusters are monitored as a function of the dosage of the reducing agent, hydrazine. In-situ XAS allowed probing of the reaction between Ag nanoclusters and Pd2+ ions during the formation of Ag-Pd bimetallic clusters. Analysis of Ag and Pd K-edge XAS spectra reveals that in the final stage Ag-Pd clusters, in which "Ag" atoms prefer to be surrounded by "Pd" and "Pd" atoms prefer to be surrounded by "Pd", were formed. On the basis of XAS results presented here, we are able to propose a structural model for each step so that this work provides a detailed insight into the mechanism of nucleation and growth of Ag-Pd bimetallic clusters. We also discussed the atomic distribution of Ag and Pd atoms in Ag-Pd bimetallic clusters based on the calculated XAS structural parameters.

  6. The effect of soil properties on the toxicity and bioaccumulation of Ag nanoparticles and Ag ions in Enchytraeus crypticus.

    Science.gov (United States)

    Topuz, Emel; van Gestel, Cornelis A M

    2017-10-01

    Standard natural Lufa soils (2.2, 2.3 and 5M) with different organic carbon contents (0.67-1.61%) and pH CaCl2 (5.5-7.3) were spiked with ionic Ag (AgNO 3 ) and polyvinyl pyrrolidone (AgNP-PVP) and citrate (AgNP-Cit) coated Ag nanoparticles (NPs). Enchytraeus crypticus were exposed for 21 days to assess effects on survival and reproduction. Soil, pore water and animals were analyzed for Ag. AgNP-Cit had a strong increasing effect on soil pH, leading to high enchytraeid mortality at concentrations higher than 60-100mg Ag/kg dry soil which made it impossible to determine the influence of soil properties on its toxicity. LC50s were lower for AgNO 3 than for AgNP-PVP (92-112 and 335-425mg Ag/kg dry soil, respectively) and were not affected by soil properties. AgNO 3 and AgNP-PVP had comparable reproductive toxicity with EC50s of 26.9-75.2 and 28.2-92.3mg Ag/kg dry soil, respectively; toxicity linearly increased with decreasing organic carbon content of the soils but did not show a clear effect of soil pH. Ag uptake in the enchytraeids was higher at higher organic carbon content, but could not explain differences in toxicity between soils. This study indicates that the bioavailability of both ionic and nanoparticulate Ag is mainly affected by soil organic carbon, with little effect of soil pH. Copyright © 2017. Published by Elsevier Inc.

  7. In situ oxidation synthesis of Ag/AgCl core-shell nanowires and their photocatalytic properties.

    Science.gov (United States)

    Bi, Yingpu; Ye, Jinhua

    2009-11-21

    Ag/AgCl core-shell nanowires with uniform structure have been synthesized in large quantities via an in situ oxidation reaction between pentagonal Ag nanowires and FeCl(3) solution at room temperature, which exhibit excellent photocatalytic performance for decomposition of methylene orange under visible-light irradiation.

  8. New insight into daylight photocatalysis of AgBr@Ag: synergistic effect between semiconductor photocatalysis and plasmonic photocatalysis.

    Science.gov (United States)

    Jiang, Jing; Li, Hao; Zhang, Lizhi

    2012-05-14

    Noble metal nanoparticles (NPs) are often used as electron scavengers in conventional semiconductor photocatalysis to suppress electron-hole (e(-)-h(+) ) recombination and promote interfacial charge transfer, and thus enhance photocatalytic activity of semiconductors. In this contribution, it is demonstrated that noble metal NPs such as Ag NPs function as visible-light harvesting and electron-generating centers during the daylight photocatalysis of AgBr@Ag. Novel Ag plasmonic photocatalysis could cooperate with the conventional AgBr semiconductor photocatalysis to enhance the overall daylight activity of AgBr@Ag greatly because of an interesting synergistic effect. After a systematic investigation of the daylight photocatalysis mechanism of AgBr@Ag, the synergistic effect was attributed to surface plasmon resonance induced local electric field enhancement on Ag, which can accelerate the generation of e(-)-h(+) pairs in AgBr, so that more electrons are produced in the conduction band of AgBr under daylight irradiation. This study provides new insight into the photocatalytic mechanism of noble metal/semiconductor systems as well as the design and fabrication of novel plasmonic photocatalysts. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. Ag/AgCl Loaded Bi2WO6 Composite: A Plasmonic Z-Scheme Visible Light-Responsive Photocatalyst

    Directory of Open Access Journals (Sweden)

    Xiangchao Meng

    2016-01-01

    Full Text Available Hierarchical flower-like Bi2WO6 was successfully synthesized by facile hydrothermal method at low pH. And Ag/AgCl was loaded by photoreduction on its surface. As-prepared photocatalysts were characterized by various techniques. Bi2WO6 was successfully synthesized at a size of 2-3 μm. Depositing Ag/AgCl did not destroy the crystal structure, and both Ag+ and metallic Ag0 were found. The band gap of the composite was 2.57 eV, which indicates that visible light could be the activating irradiation. In the photocatalytic activity test, the composite with 10 wt% Ag/AgCl boasted the highest removal efficiency (almost 100% in 45 min. The significant enhancement can be attributed to the surface plasmon resonance (SPR effect and the establishment of heterostructures between Ag/AgCl and Bi2WO6. A possible mechanism of photocatalytic oxidation in the presence of Ag/AgCl-Bi2WO6 was proposed. This work sheds light on the potential applications of plasmonic metals in photocatalysis to enhance their activities.

  10. Biochemical Synthesis of Ag/AgCl Nanoparticles for Visible-Light-Driven Photocatalytic Removal of Colored Dyes

    Directory of Open Access Journals (Sweden)

    Xiyun Zhao

    2015-04-01

    Full Text Available Photocatalytic removal of organic pollution such as waste colored dyes was a promising technique for environment technique. However, effective photocatalysts were needed to enhance the photocatalytic efficiency. Ag/AgCl was regarded as high performance catalyst for photocatalytic degradation. Ag/AgCl nanoparticles were biochemically prepared with metabolin of living fungi which was used as reductant and characterized by X-Ray diffraction (XRD, UV-visible spectroscopy and transmission electron microscopy (TEM. The Ag/AgCl nanoparticle composites showed spherical aggregation shape with an average size of about 3–5 nm which is well inside the quantum regime. The UV-visible study showed that Ag/AgCl nanoparticles had strong visible light absorption and exhibited excellent visible-light-driven photocatalytic performance. Photocatalytic results indicated that the obtained Ag/AgCl nanoparticles were suitable for photocatalytic removal of RhB dye under visible light irradiation. The excellent photocatalytic activities could be attributed to the quantum size nanoparticles and the Plasmon resonance of Ag/AgCl composites.

  11. Effect of nano/micro-Ag compound particles on the bio-corrosion, antibacterial properties and cell biocompatibility of Ti-Ag alloys.

    Science.gov (United States)

    Chen, Mian; Yang, Lei; Zhang, Lan; Han, Yong; Lu, Zheng; Qin, Gaowu; Zhang, Erlin

    2017-06-01

    In this research, Ti-Ag alloys were prepared by powder metallurgy, casting and heat treatment method in order to investigate the effect of Ag compound particles on the bio-corrosion, the antibacterial property and the cell biocompatibility. Ti-Ag alloys with different sizes of Ag or Ag-compounds particles were successfully prepared: small amount of submicro-scale (100nm) Ti 2 Ag precipitates with solid solution state of Ag, large amount of nano-scale (20-30nm) Ti 2 Ag precipitates with small amount of solid solution state of Ag and micro-scale lamellar Ti 2 Ag phases, and complete solid solution state of Ag. The mechanical tests indicated that both nano/micro-scale Ti 2 Ag phases had a strong dispersion strengthening ability and Ag had a high solid solution strengthening ability. Electrochemical results shown the Ag content and the size of Ag particles had a limited influence on the bio-corrosion resistance although nano-scale Ti 2 Ag precipitates slightly improved corrosion resistance. It was demonstrated that the nano Ag compounds precipitates have a significant influence on the antibacterial properties of Ti-Ag alloys but no effect on the cell biocompatibility. It was thought that both Ag ions release and Ti 2 Ag precipitates contributed to the antibacterial ability, in which nano-scale and homogeneously distributed Ti 2 Ag phases would play a key role in antibacterial process. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Barrier bucket experiment at the AGS

    Directory of Open Access Journals (Sweden)

    M. Fujieda

    1999-12-01

    Full Text Available A barrier bucket experiment with two dedicated barrier cavities was performed at the Brookhaven AGS. One of the barrier cavities was a magnetic alloy (MA–loaded cavity and the other was a ferrite-loaded cavity. They generated a single sine wave with a peak voltage of 40 kV at a repetition rate of 351 kHz. A barrier rf system was established with these cavities and five bunches from the AGS booster were accumulated. A total of 3×10^{13} protons were stored without beam loss, and were successfully rebunched and accelerated. The longitudinal emittance growth was observed during accumulation by the barrier bucket, the blowup factor of which was about 3. The longitudinal mismatch between the rf bucket and the beam bunch was the main reason for the emittance growth. The potential distortions by beam loading of the ferrite cavity and the overshooting voltage of the MA cavity disturbed the smooth debunching.

  13. Radiometric Calibration for AgCam

    Directory of Open Access Journals (Sweden)

    Edward Hildum

    2010-02-01

    Full Text Available The student-built Agricultural Camera (AgCam now onboard the International Space Station observes the Earth surface through two linescan cameras with Charge-Coupled Device (CCD arrays sensitive to visible and near-infrared wavelengths, respectively. The electro-optical components of the AgCam were characterized using precision calibration equipment; a method for modeling and applying these measurements was derived. Correction coefficients to minimize effects of optical vignetting, CCD non-uniform quantum efficiency, and CCD dark current are separately determined using a least squares fit approach. Application of correction coefficients yields significant variability reduction in flat-field images; comparable results are obtained when applied to ground test images.

  14. Beam instrumentation in the AGS Booster

    International Nuclear Information System (INIS)

    Witkover, R.L.

    1991-01-01

    The AGS Booster was designed to accelerate low intensity (2 x 10 10 ) polarized protons, high intensity (1.5x10 13 ) protons and heavy ions through Au +33 . Coping with this wide range of beams, the 3 x 10 -11 Torr vacuum and the radiation environment presented challenges for the beam monitors. Some of the more interesting instrumentation design and performance during the recent Booster proton commissioning will be described

  15. New beam instrumentation in the AGS Booster

    International Nuclear Information System (INIS)

    Witkover, R.L.

    1991-01-01

    The AGS Booster was designed to accelerate beams from 2x10 10 polarized protons to 1.5x10 13 protons and heavy ions through Au +33 . The range of beam parameters and the high vacuum, and radiation environment presented challenges for the beam instrumentation. Some interesting beam monitors in the Booster and transport lines, will be described. Where available, results will be presented. 21 refs., 7 figs

  16. Polarimetry at RHIC and the AGS

    International Nuclear Information System (INIS)

    Spinka, H.; Bravar, A.; Alekseev, I.

    2004-01-01

    An overview of the AGS and RHIC polarimeters and results from recent polarized proton running is given. These polarimeters are based on p + C elastic scattering in the Coulomb-nuclear interference region. A surprising energy variation is observed in the t-dependence of the analyzing power between 3.8 and 24 GeV/c, while there is evidence that changes are much smaller up to 200 GeV/c. Plans for future polarimetry are also described. (author)

  17. SNS RING STUDY AT THE AGS BOOSTER

    International Nuclear Information System (INIS)

    ZHANG, S.Y.; AHRENS, L.; BEEBE-WANG, J.; BLASKIEWICZ, M.; FEDOTOV, A.; GARDNER, C.; LEE, Y.Y.; LUCCIO, A.; MALITSKY, N.; ROSER, T.; WENG, W.T.; WEI, J.; ZENO, K.; REECE, K.; WANG, J.G.

    2000-01-01

    During the g-2 run at the BNL AGS in early 2000, a 200 MeV storage-ring-like magnetic cycle has been set-up and tuned at the Booster in preparing for the Spallation Neutron Source (SNS) accumulator ring study. In this article, we report the progress of the machine set-up, tuning, some preliminary studies, and the future plan

  18. Pressureless Bonding Using Sputtered Ag Thin Films

    Science.gov (United States)

    Oh, Chulmin; Nagao, Shijo; Suganuma, Katsuaki

    2014-12-01

    To improve the performance and reliability of power electronic devices, particularly those built around next-generation wide-bandgap semiconductors such as SiC and GaN, the bonding method used for packaging must change from soldering to solderless technology. Because traditional solders are problematic in the harsh operating conditions expected for emerging high-temperature power devices, we propose a new bonding method in this paper, namely a pressureless, low-temperature bonding process in air, using abnormal grain growth on sputtered Ag thin films to realize extremely high temperature resistance. To investigate the mechanisms of this bonding process, we characterized the microstructural changes in the Ag films over various bonding temperatures and times. We measured the bonding properties of the specimens by a die-shear strength test, as well as by x-ray diffraction measurements of the residual stress in the Ag films to show how the microstructural developments were essential to the bonding technology. Sound bonds with high die strength can be achieved only with abnormal grain growth at optimum bonding temperature and time. Pressureless bonding allows for production of reliable high-temperature power devices for a wide variety of industrial, energy, and environmental applications.

  19. Nanojoining of crossed Ag nanowires: a molecular dynamics study

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Jianlei, E-mail: cjlxjtu@mail.xjtu.edu.cn; Wang, Xuewen; Barayavuga, Theogene; Mei, Xuesong; Wang, Wenjun [Xi’an Jiaotong University, State Key Laboratory for Manufacturing Systems Engineering (China); He, Xiaoqiao, E-mail: bcxqhe@cityu.edu.hk [City University of Hong Kong, Department of Architecture and Civil Engineering (Hong Kong)

    2016-07-15

    Ag nanowires are considered to be the promising candidates for future electronic circuit owing to the excellent electrical and thermal properties, with the miniaturization of electronics devices into nanometer scale. Though interconnect technology between Ag nanowires (Ag NWs) is essential for nanofunctional devices, it lacks sufficient experimental data. Besides, the determination of Ag NW interconnection configuration is experimentally difficult to do for lacking the sufficient investigation of atomic configuration evolution during nanojoining process. So the nanojoining between the crossed Ag NWs with the same diameter of 2 nm and different lengths was performed by molecular dynamics simulation to explain the unclear nanojoining mechanism based on thermal effect. As the simulation results present, when the nanojoining temperature is relatively high, though the Ag NWs are connected with the interpenetration effect of Ag atoms at the crossed nanojunction area, the nanostructures of Ag NWs have been seriously deformed with shorter length and larger diameter, showing relatively more obvious melting characteristics based on the chaotic atomic structures. If the temperature is reduced to 300 K as cold welding, the crossed Ag NWs can be partially contacted with the partial mixture of Ag atoms, and the interstices always exist between the Si surface and the upper Ag nanowire. In addition, the obvious dislocation phenomenon will appear and evolve as time goes on. Consequently, the dominant mechanism was revealed for providing a fundamental understanding of how ‘hot’ and ‘cold’ welding technology affects the atomic contact configuration, respectively.

  20. Ionic transport properties in AgCl under high pressures

    Science.gov (United States)

    Wang, Jia; Zhang, Guozhao; Liu, Hao; Wang, Qinglin; Shen, Wenshu; Yan, Yalan; Liu, Cailong; Han, Yonghao; Gao, Chunxiao

    2017-07-01

    Ionic transport behaviors of silver chloride (AgCl) have been revealed with impedance spectra measurement under high pressures up to 20.4 GPa. AgCl always presented ionic conducting under experimental pressures, but electronic conduction can coexist with ionic conduction within the pressure range from 6.7 to 9.3 GPa. The ionic conductivity of AgCl decreases by three orders of magnitude under compression, indicating that Ag+ ion migrations are suppressed by high pressure. A parameter, fW, was defined as the starting frequency at which Ag+ ions begin to show obvious long-distance diffusion in AgCl. fW showed a similar trend with the ionic conductivity under high pressures, indicating that the speed of Ag+ ion diffusion slows down as the pressure increases. Unlike AgI, Ag+ ion diffusion in AgCl is controlled by the indirect-interstitial mechanism. Due to stronger ionic bonds and larger lattice deformation, Ag+ ion diffusion in the rigid Cl- lattice is more difficult than in the I- lattice under high pressures.

  1. Microstructure evolution during 300 °C storage of sintered Ag nanoparticles on Ag and Au substrates

    Energy Technology Data Exchange (ETDEWEB)

    Paknejad, S.A. [King’s College London, Physics Department, Strand, London WC2R 2LS (United Kingdom); Dumas, G. [Eltek Semiconductors Ltd, Nelson Road Industrial Estate, Dartmouth, Devon TQ6 9LA (United Kingdom); West, G. [Loughborough University, Materials Department, Loughborough LE11 3TU (United Kingdom); Lewis, G. [Eltek Semiconductors Ltd, Nelson Road Industrial Estate, Dartmouth, Devon TQ6 9LA (United Kingdom); Mannan, S.H., E-mail: samjid.mannan@kcl.ac.uk [King’s College London, Physics Department, Strand, London WC2R 2LS (United Kingdom)

    2014-12-25

    Highlights: • Shear strength of pressure-free sintered Ag found to increase during ageing at 300 °C on Ag substrate. • Rapid collapse of void number density after 24 h ageing in the sintered Ag layer. • Higher porosity at edge of joint compared to the middle. • Shear strength of pressure-free sintered Ag decreases during ageing at 300 °C due to high porosity layer growth. • Void free layer and high porosity layer growth explained in terms of atomic diffusion and grain boundary migration. - Abstract: A silver nanoparticle based die attach material was used in a pressure free process to bond 2.5 mm square Ag plated Si die to Ag and Au plated substrates. The assemblies were stored at 300 °C for up to 500 h and the morphology of the sintered Ag and the shear strength were monitored as a function of time. On Ag substrate it was found that die shear strength increased and that the Ag grains grew in size and porosity decreased over time. There was also a clear difference in morphology between sintered Ag at the die edge and centre. On Au substrate, it was observed that the initially high die shear strength decreased with storage time and that voids migrated away from the Ag/Au interface and into the Ag joint. This has led to the formation of a void free layer at the interface followed by a high porosity region, which weakened the joint. The microstructure reveals a high density of grain and twin boundaries which facilitate the Ag and Au atomic diffusion responsible. The grain structure of the plated Au led to diffusion of Au into the Ag via high-angle tilt grain boundaries, and grain boundary migration further dispersed the Au into the Ag layer.

  2. Anomalous photoelectric emission from Ag on zinc-phthalocyanine film

    International Nuclear Information System (INIS)

    Tanaka, Senku; Otani, Tomohiro; Fukuzawa, Ken; Hiromitsu, Ichiro; Ogawa, Koji; Azuma, Junpei; Yamamoto, Isamu; Takahashi, Kazutoshi; Kamada, Masao

    2014-01-01

    Photoelectric emission from organic and metal thin films is generally observed with irradiation of photon energy larger than 4 eV. In this paper, however, we report photoelectric emission from Ag on a zinc-phthalocyanine (ZnPc) layer at a photon energy of 3.4 eV. The threshold energy for this photoelectric emission is much smaller than the work function of Ag estimated by conventional photoelectron spectroscopy. The photoelectric emission by low-energy photons is significant for Ag thicknesses of less than 1 nm. Photoelectron spectroscopy and morphological study of the Ag/ZnPc suggest that the anomalous photoelectric emission from the Ag surface is caused by a vacuum level shift at the Ag/ZnPc interface and by surface plasmons of the Ag nanoparticles

  3. Control of texture in Ag and Ag-alloy substrates for superconducting tapes

    International Nuclear Information System (INIS)

    Gladstone, T.A.

    2000-01-01

    The use of a biaxially textured silver tape as a substrate for high temperature superconductor (HTS) phases is one possible route towards the fabrication of high-J c superconducting tape. Using a cold-rolling and annealing process we have reproducibly fabricated {110} textured silver which is stable up to 900 deg. C. We have found that there are two critical process requirements for the formation of this texture; a low oxygen content in the material prior to deformation, and a cold-rolling thickness reduction of less than 97%. To overcome the problems associated with the poor mechanical strength of pure silver, texture development in Ag-Mg and Ag-Hf alloys with improved mechanical properties has been studied. Heat treatments in a reducing atmosphere allow the {110} annealing texture to be obtained in Ag-0.1 wt%Mg. The recrystallization behaviour of a Ag-Pd alloy with an increased stacking fault energy was also investigated and a partial cube texture was obtained in this material. Using orientation distribution function (ODF) analysis we have shown that minor variations in the deformation texture of both pure silver and Ag-based alloys can lead to significant differences in the recrystallization textures obtained. (author)

  4. Control of texture in Ag and Ag-alloy substrates for superconducting tapes

    Science.gov (United States)

    Gladstone, T. A.; Moore, J. C.; Henry, B. M.; Speller, S.; Salter, C. J.; Wilkinson, A. J.; Grovenor, C. R. M.

    2000-09-01

    The use of a biaxially textured silver tape as a substrate for high temperature superconductor (HTS) phases is one possible route towards the fabrication of high-Jc superconducting tape. Using a cold-rolling and annealing process we have reproducibly fabricated {110} textured silver which is stable up to 900 °C. We have found that there are two critical process requirements for the formation of this texture; a low oxygen content in the material prior to deformation, and a cold-rolling thickness reduction of less than 97%. To overcome the problems associated with the poor mechanical strength of pure silver, texture development in Ag-Mg and Ag-Hf alloys with improved mechanical properties has been studied. Heat treatments in a reducing atmosphere allow the {110} annealing texture to be obtained in Ag-0.1 wt%Mg. The recrystallization behaviour of a Ag-Pd alloy with an increased stacking fault energy was also investigated and a partial cube texture was obtained in this material. Using orientation distribution function (ODF) analysis we have shown that minor variations in the deformation texture of both pure silver and Ag-based alloys can lead to significant differences in the recrystallization textures obtained.

  5. Ab initio Study of Ag-Based Fluoroperovskite AgMF3 (M = Co and Ni) Compounds

    Science.gov (United States)

    Mubarak, A. A.

    2018-01-01

    Ab initio calculations of Ag-based fluoroperovskite AgMF3 (M = Co and Ni) compounds are investigated using the full-potential linearized augmented plane wave method. Wien2k and BoltzTrap codes are used to calculate the different physical properties. The structural parameters of the present compounds are within reasonable agreement with previous calculations. This study shows that AgCoF3 and AgNiF3 are anisotropic, ductile, mechanically and thermodynamically stable compounds, where AgCoF3 is found to be stiffer and less compressible than AgNiF3. The spin-polarized electronic band structure illustrates that AgCoF3 is metallic, while AgNiF3 is a semiconductor with indirect (M-D) band gap energy of 0.43 eV. The bonding force between atoms is found to be mainly ionic with some covalent nature. The total magnetic moment of AgCoF3 (3.04 μ B) is found to be higher than that calculated for AgNiF3 (2.00 μ B). Using the magnetic susceptibility calculations, AgCoF3 is classified as antiferromagnetic, whereas AgNiF3 is a ferromagnetic compound. The calculated static refractive index of AgCoF3 (3.85) and AgNiF3 (3.60) is inversely proportional with the energy band gap. Suitable applications are predicted for AgCoF3 and AgNiF3 based on their absorption and reflection properties. Furthermore, beneficial thermoelectric applications are expected for the present compounds due to their large Seebeck coefficient ( S_{{{{AgCoF}}_{ 3} }} = 2.92 × 103 μ {V/K} {and} S_{{{{AgNiF}}3 }} = 2.84 × 103 μ {V/K} ) and their thermoelectric power factor with respect to relaxation time ( S2 σ /t_{{AgNiF3 }} = 1.11 × 109 {W/K}^{ 2} {and} S2 σ /t_{{AgNiF3 }} = 1.28 × 10^{11} {W/K}^{ 2} ).

  6. Room temperature synthesis and photocatalytic property of AgO/Ag2Mo2O7 heterojunction nanowires

    International Nuclear Information System (INIS)

    Hashim, Muhammad; Hu, Chenguo; Wang, Xue; Wan, Buyong; Xu, Jing

    2012-01-01

    Graphical abstract: The AgO nanoparticles are attached on the surface of the Ag 2 Mo 2 O 7 nanowires to form a heterojunction structure. The AgO nanoparticles start embedding into the nanowires with increasing reaction temperature or time. Highlights: ► AgO/Ag 2 Mo 2 O 7 heterojunction NWs were synthesized at room temperature for the first time. ► AgO particles embed into the Ag 2 Mo 2 O 7 NWs with increase in reaction time and temperature. ► The heterojunction NWs display much better photocatalytic activity than the none-heterojunction NWs. ► The catalytic mechanism was proposed. -- Abstract: AgO/Ag 2 Mo 2 O 7 heterojunction nanowires were synthesized at temperatures of 25 °C, 50 °C, 80 °C, and 110 °C, under magnetic stirring in solution reaction. The catalytic activity of AgO/Ag 2 Mo 2 O 7 nanowires was evaluated by the degradation of Rhodmine B dye under the irradiation of the simulated sunlight. The synthesized samples were characterized by X-ray diffractometer, energy dispersive spectrometry, X-ray photoelectron spectrometer, scanning electron microscopy, and transmission electron microscopy. The results show that the AgO nanoparticles are attached on the surface of the Ag 2 Mo 2 O 7 nanowires to form a heterojunction structure. The length of the nanowires is up to 10 μm and the size of the AgO nanoparticles is 10–20 nm. The length of nanowires increases with increasing reaction time and temperature while the AgO particles are gradually embedded into the nanowires. The photocatalytic activity is greatly improved for the AgO/Ag 2 Mo 2 O 7 heterojunction nanowires compared with that of the pure Ag 2 Mo 2 O 7 nanowires, indicating a remarkable role of AgO particles on the Ag 2 Mo 2 O 7 nanowires in the photodegradation.

  7. Sequestration of Ag(I) from aqueous solution as Ag(0) nanostructures by nanoscale zero valent iron (nZVI)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yalei, E-mail: zhangyalei2003@163.com [Tongji University, State Key Laboratory of Pollution Control and Resources Reuse (China); Yan, Jing [Tongji University, Modern Agricultural Science and Engineering Institute (China); Dai, Chaomeng, E-mail: daichaomeng@163.com, E-mail: daichaomeng@tongji.edu.cn [Tongji University, College of Civil Engineering (China); Li, Yuting; Zhu, Yan [Tongji University, Modern Agricultural Science and Engineering Institute (China); Zhou, Xuefei [Tongji University, State Key Laboratory of Pollution Control and Resources Reuse (China)

    2015-11-15

    This study investigates the application of nanoparticle zero valent iron (nZVI) to sequester Ag(I) as Ag(0) nanostructures from aqueous solution. Batch experiments were performed with nZVI exposed to aqueous Ag(I) to investigate the effects of environmental parameters, including nZVI dose, temperature and pH. High temperature facilitates Ag(I) sequestration, and the rate constants are determined to be 0.02, 0.12, and 0.31 mg L/m{sup 2} at 30, 50, and 60 °C, respectively. Ag(I) sequestration was adversely affected by adding nitric acid to the solution due to significant acid washing, decreasing the available nZVI active sites. Characterization techniques including TEM, XRD, and HR-XPS revealed that nZVI is oxidized to lepidocrocite and magnetite/maghemite and confirmed the formation of nanocrystalline silver. HR-XPS analysis indicated that Ag{sub 2}O forms rapidly as an intermediate due to Ag(I) adsorption onto the FeOOH layer. The Ag(0) nanostructures that are formed are fractal, spherical, and dendritic or rod-like, respectively, in morphology by FE-TEM images at different Ag/Fe mass ratios. A general reaction model for the interaction Ag(I) with nZVI is proposed. Our results suggest that nZVI is effective for Ag(I) removal.

  8. Fluoride-induced reduction of Ag(I) cation leading to formation of silver mirrors and luminescent Ag-nanoparticles.

    Science.gov (United States)

    Maity, Krishnendu; Panda, Dillip K; Lochner, Eric; Saha, Sourav

    2015-03-04

    In aprotic solvents, Lewis basic F(-) anion reduces Lewis acidic Ag(I) cation to Ag(0), forming metallic silver mirrors on the inner surfaces of reaction vessels and luminescent Ag-nanoparticles (AgNPs) in supernatant solutions, which emit blue light upon UV irradiation. The F(-)-induced formation of silver mirrors and AgNPs was confirmed through X-ray photoelectron spectroscopy (XPS), transmission electron microscopy (TEM), energy dispersive X-ray spectroscopy (EDS), fluorescence spectroscopy, and mass spectrometry, whereas the Ag(I)-induced oxidation of F(-) to Ḟ radical, followed by its conversion to HF2(-) via H-abstraction and H-bonding, was evident from (19)F NMR spectroscopy. This redox reaction is deactivated in water, as the reducing power of hydrated F(-) diminishes drastically. Less Lewis basic Cl(-), Br(-), and I(-) ions do not reduce Ag(I) to Ag(0), instead they can only form Ag(I) halide precipitates irrespective of protic or aprotic solvents. The Ag-coated surfaces, luminescent AgNPs, and Ḟ radicals produced by this unprecedented redox reaction could be exploited as electrodes, light-emitting materials, and radical initiators, respectively.

  9. Directional solidification of YBaCuO thick films deposited by screen printing on Ag and Ag-Pd tapes

    Science.gov (United States)

    Piñol, S.; Najib, M.; Puig, T.; Obradors, X.; Xuriguera, H.; Segarra, M.

    2002-08-01

    Textured tapes of Ag{1 1 0} and polycrystalline tapes of Ag-Pd(0.5-12.5%) alloys have been prepared by cold rolling as possible substrates for deposition of high critical current density YBCO films. The Ag{1 1 0} texture with some twins was promoted by recrystallization after cold rolling from ingots prepared by melting and solidification of Ag powders. Nevertheless, no textured tapes were obtained by cold rolling from Ag-Pd alloys with Pd>0.5%. YBCO thick films (10-30 μm) were deposited on the metallic tapes by screen printing using organic inks. Biaxially textured superconducting thick films were observed on the Ag{1 1 0} substrates at low solidification rates. Nevertheless, uniaxial texture with some biaxial colonies of YBCO grains were found on Ag-Pd alloys when the superconducting phase was solidified at high rate.

  10. Modification of field emission resonances by Cu and Cu/Ag islands on Ag(100)

    Energy Technology Data Exchange (ETDEWEB)

    Zaum, Christopher; Morgenstern, Karina [Institut fuer Festkoerperphysik, Abteilung ATMOS, Gottfried Wilhelm Leibniz Universitaet, Appelstr. 2, D-30167 Hannover (Germany)

    2011-07-01

    We deposited Cu islands containing 10 to 500 atoms on a clean Ag(100) surface at room temperature and investigated their electronic structure by STS spectroscopy with a low temperature scanning tunneling microscope. Islands containing less than 50 atoms per islands are pure Cu islands, while islands at sizes above 80 atoms per island are Cu/Ag alloy islands. STS measurements reveal that these two island types have a different impact on the field emission resonances (FERs) of the Ag(100) surface. While the observed modifications for large islands are marginal, noticeable shifts of the FERs occur for small islands. These different results in STS spectroscopy are discussed with respect to the different work functions of pure and alloyed islands. Such STS measurements could therefore be used to determine the composition of surface alloys with high spatial resolution.

  11. Heterojunction double dumb-bell Ag2Te-Te-Ag2Te nanowires

    Science.gov (United States)

    Som, Anirban; Pradeep, T.

    2012-07-01

    Growth of isolated axial heterojunction nanowires by a solution phase growth process is reported. The dumb-bell shaped nanowires contain two silver telluride sections at the extremes joined by a tellurium section. Reaction of silver nitrate with tellurium NWs in aqueous solution at a molar ratio of 1 : 1 leads to the formation of amorphous partially silver reacted Te NWs. Low temperature (75 °C) solution phase annealing of these silver deficient NWs results in phase segregation producing crystalline Ag2Te and Te phases with clear phase boundaries along the wire axis. Structural characterization of these dumb-bell shaped NWs was performed with different microscopic and spectroscopic tools. Solution phase silver concentration over the course of annealing indicated leaching of silver into the solution during the formation of biphasic NWs. Similar Ag : Te ratios were observed in both partially silver reacted Te NWs and phase segregated Ag2Te-Te-Ag2Te NWs and this was attributed to redeposition of leached silver on the amorphous NW tips which eventually resulted in complete phase segregation. Successful integration of different chemical components in single NWs is expected to open up new application possibilities as physical and chemical properties of the heterostructure can be exploited.Growth of isolated axial heterojunction nanowires by a solution phase growth process is reported. The dumb-bell shaped nanowires contain two silver telluride sections at the extremes joined by a tellurium section. Reaction of silver nitrate with tellurium NWs in aqueous solution at a molar ratio of 1 : 1 leads to the formation of amorphous partially silver reacted Te NWs. Low temperature (75 °C) solution phase annealing of these silver deficient NWs results in phase segregation producing crystalline Ag2Te and Te phases with clear phase boundaries along the wire axis. Structural characterization of these dumb-bell shaped NWs was performed with different microscopic and spectroscopic

  12. Ag induced suppression of irradiation response in YBCO/Ag composite thin films

    International Nuclear Information System (INIS)

    Behera, D.; Mohanty, T.; Mohanta, D.; Patnaik, K.; Mishra, N.C.; Senapati, L.; Kanjilal, D.; Mehta, G.K.; Pinto, R.

    1999-01-01

    Practical application of cuprate superconductors in radiation environment demands that these systems remain insensitive to the irradiation induced defects. The cuprate superconductors however are many orders of magnitude more sensitive than the conventional low T c superconductors. To suppress the irradiation sensitivity of cuprates we consider a crystal engineering approach where metal ions as Ag is made to occupy inter and intra-granular sites of YBa 2 Cu 3 O 7 thin films. We show that superconducting and normal state properties of YBCO/Ag composite thin films prepared by laser ablation remain unchanged under 140 MeV Si ion irradiation up to fluence of 8 x 10 14 ions/cm 2 . The inter- and intra-granular occupancy of Ag is shown to induce microstructural modifications and rigidity to the CuO chains respectively which in turn lead to the radiation insensitivity of the composite films. (author)

  13. Mechanisms of Toxicity of Ag Nanoparticles in Comparison to Bulk and Ionic Ag on Mussel Hemocytes and Gill Cells.

    Directory of Open Access Journals (Sweden)

    Alberto Katsumiti

    Full Text Available Silver nanoparticles (Ag NPs are increasingly used in many products and are expected to end up in the aquatic environment. Mussels have been proposed as marine model species to evaluate NP toxicity in vitro. The objective of this work was to assess the mechanisms of toxicity of Ag NPs on mussel hemocytes and gill cells, in comparison to ionic and bulk Ag. Firstly, cytotoxicity of commercial and maltose stabilized Ag NPs was screened in parallel with the ionic and bulk forms at a wide range of concentrations in isolated mussel cells using cell viability assays. Toxicity of maltose alone was also tested. LC50 values were calculated and the most toxic Ag NPs tested were selected for a second step where sublethal concentrations of each Ag form were tested using a wide array of mechanistic tests in both cell types. Maltose-stabilized Ag NPs showed size-dependent cytotoxicity, smaller (20 nm NPs being more toxic than larger (40 and 100 nm NPs. Maltose alone provoked minor effects on cell viability. Ionic Ag was the most cytotoxic Ag form tested whereas bulk Ag showed similar cytotoxicity to the commercial Ag NPs. Main mechanisms of action of Ag NPs involved oxidative stress and genotoxicity in the two cell types, activation of lysosomal AcP activity, disruption of actin cytoskeleton and stimulation of phagocytosis in hemocytes and increase of MXR transport activity and inhibition of Na-K-ATPase in gill cells. Similar effects were observed after exposure to ionic and bulk Ag in the two cell types, although generally effects were more marked for the ionic form. In conclusion, results suggest that most observed responses were due at least in part to dissolved Ag.

  14. Mechanisms of Toxicity of Ag Nanoparticles in Comparison to Bulk and Ionic Ag on Mussel Hemocytes and Gill Cells

    Science.gov (United States)

    Katsumiti, Alberto; Gilliland, Douglas; Arostegui, Inmaculada; Cajaraville, Miren P.

    2015-01-01

    Silver nanoparticles (Ag NPs) are increasingly used in many products and are expected to end up in the aquatic environment. Mussels have been proposed as marine model species to evaluate NP toxicity in vitro. The objective of this work was to assess the mechanisms of toxicity of Ag NPs on mussel hemocytes and gill cells, in comparison to ionic and bulk Ag. Firstly, cytotoxicity of commercial and maltose stabilized Ag NPs was screened in parallel with the ionic and bulk forms at a wide range of concentrations in isolated mussel cells using cell viability assays. Toxicity of maltose alone was also tested. LC50 values were calculated and the most toxic Ag NPs tested were selected for a second step where sublethal concentrations of each Ag form were tested using a wide array of mechanistic tests in both cell types. Maltose-stabilized Ag NPs showed size-dependent cytotoxicity, smaller (20 nm) NPs being more toxic than larger (40 and 100 nm) NPs. Maltose alone provoked minor effects on cell viability. Ionic Ag was the most cytotoxic Ag form tested whereas bulk Ag showed similar cytotoxicity to the commercial Ag NPs. Main mechanisms of action of Ag NPs involved oxidative stress and genotoxicity in the two cell types, activation of lysosomal AcP activity, disruption of actin cytoskeleton and stimulation of phagocytosis in hemocytes and increase of MXR transport activity and inhibition of Na-K-ATPase in gill cells. Similar effects were observed after exposure to ionic and bulk Ag in the two cell types, although generally effects were more marked for the ionic form. In conclusion, results suggest that most observed responses were due at least in part to dissolved Ag. PMID:26061169

  15. Temperature dependence of the electric field gradient in AgPd and AgPt alloys

    International Nuclear Information System (INIS)

    Krolas, K.

    1977-07-01

    The measurements of temperature dependence of the electric field gradient (EFG) on 111 Cd nuclei in AgPd and AgPt alloys were performed using the time dependent perturbed angular correlation method. The EFG caused by impurities distributed in further coordination shells decrease stronaer with increasing temperature than the EFG due to single impurity being the nearest neighbour of the probe atom. These results were explained assuming different modes of thermal vibrations of single impurity atoms and impurity complexes in silver host lattice. (author)

  16. Experimental study of the Ag-Sn-In phase diagram

    International Nuclear Information System (INIS)

    Vassilev, Gueorgui P.; Dobrev, Evgueni S.; Tedenac, Jean-Claude

    2005-01-01

    Combined metallographic, differential scanning calorimetry, X-ray and scanning electron microscopy studies have been performed using 27 ternary alloys. The microhardness of the α(Ag), ε(Ag 3 Sn) and ζ(Ag 4 Sn,Ag 3 In) phases has been measured. The ternary extension of the phase φ(Ag x In y Sn z , where x ∼ 0.36, y ∼ 0.61, z ∼ 0.03) has been revealed in some specimens, although the binary compound (AgIn 2 ) melts at 166 deg. C. This finding is attributed to the limited cooling rate. The solubility ranges of the solid solution and the intermetallic phases have been determined. The tin and the indium show approximately equal mutual solubility (around 2 at.%) in the ternary extensions of their Ag-Sn or Ag-In phases. The experimental data have been compared with a calculated isothermal section at 280 deg. C and with a vertical section at 2.5 at.% Ag. The thermal analyses have confirmed, in general, the temperatures of the invariant reactions in the Ag-Sn-In system as calculated by literature data

  17. Structure of Ag, Fe and Ge microclusters

    International Nuclear Information System (INIS)

    Montano, P.A.; Shenoy, G.K.; Schulze, W.

    1989-01-01

    The structures of Ag, Fe and Ge microclusters were determined using EXAFS. The measurements were performed over a wide range of clusters sizes. The clusters were prepared using the gas aggregation technique and isolated in solid argon at 4.2 K. The measurements were performed at the National Synchrotron Light Source (NSLS) at beam line X-18B. A strong contraction of the interatomic distances was observed for Ag dimers and multimers. Silver clusters larger than 12 A mean diameter show a small contraction of the nn distance and a structure consistent with an fcc lattice. By contrast clusters smaller than 12 A show the presence of a small expansion and a strong reduction or absence of nnn in the EXAFS signal. This points towards a different crystallographic structure for Ag microclusters with diameter less than 12 A. In iron clusters we observe a gradual reduction of the nn distance as the cluster size decreases. The interatomic distance for iron dimers was determined to be 1.94 A, in good agreement with earlier measurements. The iron microclusters show a bcc structure down to a mean diameter of 9 A. Iron clusters with 9 A mean diameter show a structure inconsistent with a bcc lattice. The new structure is consistent with an fcc or hcp lattice. The measurements on Ge clusters show the presence of only nearest neighbors. There was clear evidence of temporal annealing as determined by variations in the near edge structure of the K-absorption edge. Absorption edge measurements were also performed for free Ge clusters travelling perpendicular to the direction of the synchrotron radiation beam. The measurements performed on the free clusters were consistent with those obtained for matrix isolated clusters. (orig.)

  18. AgPi: Agents on Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Tushar Semwal

    2016-10-01

    Full Text Available The Raspberry Pi and its variants have brought with them an aura of change in the world of embedded systems. With their impressive computation and communication capabilities and low footprint, these devices have thrown open the possibility of realizing a network of things in a very cost-effective manner. While such networks offer good solutions to prominent issues, they are indeed a long way from being smart or intelligent. Most of the currently available implementations of such a network of devices involve a centralized cloud-based server that contributes to making the necessary intelligent decisions, leaving these devices fairly underutilized. Though this paradigm provides for an easy and rapid solution, they have limited scalability, are less robust and at times prove to be expensive. In this paper, we introduce the concept of Agents on Raspberry Pi (AgPi as a cyber solution to enhance the smartness and flexibility of such embedded networks of physical devices in a decentralized manner. The use of a Multi-Agent System (MAS running on Raspberry Pis aids agents, both static and mobile, to govern the various activities within the network. Agents can act autonomously or on behalf of a human user and can collaborate, learn, adapt and act, thus contributing to embedded intelligence. This paper describes how Tartarus, a multi-agent platform, embedded on Raspberry Pis that constitute a network, can bring the best out of the system. To reveal the versatility of the concept of AgPi, an application for a Location-Aware and Tracking Service (LATS is presented. The results obtained from a comparison of data transfer cost between the conventional cloud-based approach with AgPi have also been included.

  19. Modelling of the AGS using Zgoubi - Status

    Energy Technology Data Exchange (ETDEWEB)

    Meot F.; Ahrens, L.; Dutheil, Y.; Glenn, J.; Huang, H.; Roser, T.; Schoefer, V.; Tsoupas, N.

    2012-05-20

    This paper summarizes the progress achieved so far, and discusses various outcomes, regarding the development of a model of the Alternating Gradient Synchrotron at the RHIC collider. The model, based on stepwise ray-tracing methods, includes beam and polarization dynamics. This is an on-going work, and a follow-on of code developments and particle and spin dynamics simulations that have been subject to earlier publications at IPAC and PAC [1, 2, 3]. A companion paper [4] gives additional informations, regarding the use of the measured magnetic field maps of the AGS main magnets.

  20. Thermodynamic modelling of Ag-Zn alloys

    International Nuclear Information System (INIS)

    Gomez-Acebo, T.; Sundman, B.

    1998-01-01

    A thermodynamic assessment of the Ag-Zn system has been done using a computerized CALPHAD (calculation of phase diagrams) technique. The liquid, α,β,ε and η phases are described by a regular solution model, the ζ phase by a two-sublattices model, and the γ phase by a four-sublattices model both based on considerations of their crystal structure and compatibility with the same phase in other systems. Some calculated phase and property diagrams are presented. (Author) 27 refs

  1. The Ag-Al-Cu system

    Energy Technology Data Exchange (ETDEWEB)

    Witusiewicz, V.T. [ACCESS e. V., Intzestr. 5, D-52072 Aachen (Germany)]. E-mail: victor@access.rwth-aachen.de; Hecht, U. [ACCESS e. V., Intzestr. 5, D-52072 Aachen (Germany); Fries, S.G. [ACCESS e. V., Intzestr. 5, D-52072 Aachen (Germany); Rex, S. [ACCESS e. V., Intzestr. 5, D-52072 Aachen (Germany)

    2005-01-25

    The thermodynamic description of the Ag-Al-Cu system is obtained by modelling the Gibbs energy of all individual phases in the system using the CALPHAD approach. The model parameters have been evaluated, by means of a computer optimisation technique, based on the descriptions of the constituent binaries proposed in the first part of the work and relevant experimental information for ternary alloys both from literature and own experimental measurements. Several vertical and isothermal sections, the liquidus surface and some thermodynamic properties are calculated using the evaluated parameters. A good agreement between the calculations and the experimental data is achieved.

  2. The AGS Booster Beam Position Monitor system

    International Nuclear Information System (INIS)

    Ciardullo, D.J.; Abola, A.; Beadle, E.R.; Smith, G.A.; Thomas, R.; Van Zwienen, W.; Warkentien, R.; Witkover, R.L.

    1991-01-01

    To accelerate both protons and heavy ions, the AGS Booster requires a broadband (multi-octave) beam position monitoring system with a dynamic range spanning several orders of magnitude (2 x 10 10 to 1.5 x 10 13 particles per pulse). System requirements include the ability to acquire single turn trajectory and average orbit information with ± 0.1 mm resolution. The design goal of ± 0.5 mm corrected accuracy requires that the detectors have repeatable linear performance after periodic bakeout at 300 degree C. The system design and capabilities of the Booster Beam Position Monitor will be described, and initial results presented. 7 refs., 5 figs

  3. Upgrade of the AGS H- linac

    International Nuclear Information System (INIS)

    Alessi, J.G.; Buxton, W.; Kponou, A.; LoDestro, V.; Mapes, M.; McNerney, A.J.; Raparia, D.

    1994-01-01

    The AGS linac presently accelerates 25 mA of H - to 200 MeV at a 5 Hz rep-rate and 500 μs pulse width. The Booster takes 4 pulses every 3.8 seconds, and the remaining pulses are used for isotope production. The authors are in the process of upgrading the linac to increase the average current delivered for isotope production by more than a factor of two, while at the same time expecting to decrease linac downtime. Various aspects of this upgrade are discussed, including the upgrade of the control system, new high power transmission line, transport line vacuum, and rf power supply system upgrades

  4. Hierarchical Ag/AgCl-TiO{sub 2} hollow spheres with enhanced visible-light photocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xu Long; Yin, Hao Yong [College of Materials Environment Engineering, Hangzhou Dianzi University, Hangzhou 310018 (China); Nie, Qiu Lin, E-mail: nieqiulin@hdu.edu.cn [College of Materials Environment Engineering, Hangzhou Dianzi University, Hangzhou 310018 (China); Wu, Wei Wei [College of Materials Environment Engineering, Hangzhou Dianzi University, Hangzhou 310018 (China); Zhang, Yang; LiYuan, Qiu [College of Science, Hangzhou Dianzi University, Hangzhou 310018 (China)

    2017-01-01

    The hierarchical Ag/AgCl-TiO{sub 2} hollow spheres were synthesized by depositing Ag/AgCl nanoparticles on TiO{sub 2} hollow spheres via a precipitation photoreduction method, and they were further characterized using TGA, SEM, TEM, XRD, XPS, UV–vis DRS and photoelectric chemical analysis. The analysis showed that the hierarchical Ag/AgCl-TiO{sub 2} hollow spheres exhibited the highest photocatalytic activity, which was approximately 13 times higher than that of TiO{sub 2} hollow spheres. The high photocatalytic activity of the composites is due to efficient electron-hole pairs separation at the photocatalyst interfaces, and localized surface plasmon resonance of Ag nanoparticles formed on AgCl particles in the degradation reaction. - Highlights: • TiO{sub 2} hollow spheres were prepared by a sacrificial template method. • The hollow spheres were modified with Ag/AgCl to form the heterojunctions. • The modification may produce synergistic effect of LSPR and hollow structure. • Visible light photocatalytic activity was enhanced on this hollow catalyst. • The mechanism of the improved photocatalytic performance was discussed.

  5. Preparation of mesoporous Ag/AgBr/TiO2 nanocomposites with comb-type polymer as template

    Directory of Open Access Journals (Sweden)

    Li XU

    Full Text Available The mesoporous TiO2 nanocomposites were fabricated in a water bath at lower temperatures using the sol-gel method with a comb-type polymer as template and tetrabutyl titanate as Ti source. The Ag/AgBr/TiO2 nanocomposites with higher specific surface areas were obtained by the introduction of Ag/AgBr on the surface of the mesoporous TiO2 using a deposition-precipitation method. The as-prepared nanocomposites were characterized by X-ray diffraction (XRD, N2 sorption analysis, transmission electron microscope (TEM and UV-vis diffuse reflectance spectroscopy (UV-vis DRS. The results showed that both the as-prepared TiO2 and Ag/AgBr/TiO2 exhibited mesoporous structure. The introduction of Ag/AgBr not only decreased the specific surface area of the mesoporous TiO2 from 346 m2/g to 253 m2/g, but also significantly increased its visible light photocatalytic activity. The degradation rate of methyl orange under visible light irradiation over Ag/AgBr/TiO2 was 145 and 60 times of those over the commercial TiO2 P25 and the mesoporous TiO2, respectively.

  6. Synthesis of biocompatible AuAgS/Ag2S nanoclusters and their applications in photocatalysis and mercury detection

    International Nuclear Information System (INIS)

    Zhao, Qian; Chen, Shenna; Zhang, Lingyang; Huang, Haowen; Liu, Fengping; Liu, Xuanyong

    2014-01-01

    In this paper, a facile approach for preparation of AuAgS/Ag 2 S nanoclusters was developed. The unique AuAgS/Ag 2 S nanoclusters capped with biomolecules exhibit interesting excellent optical and catalytic properties. The fluorescent AuAgS/Ag 2 S nanoclusters show tunable luminescence depending on the nanocluster size. The apoptosis assay demonstrated that the AuAgS/Ag 2 S nanoclusters showed low cytotoxicity and good biocompatibility. Therefore, the nanoclusters can be used not only as a probe for labeling cells but also for their photocatalytic activity for photodegradation of organic dye. Moreover, a highly selective and sensitive assay for detection of mercury including Hg 2+ and undissociated mercury complexes was developed based on the quenching fluorescent AuAgS/Ag 2 S nanoclusters, which provides a promising approach for determining various forms of Hg in the mercury-based compounds in environment. These unique nanoclusters may have potential applications in biological labeling, sensing mercury, and photodegradation of various organic pollutants in waste water.Graphical Abstract

  7. Spreadability of Ag Layer on Oxides and High Performance of AZO/Ag/AZO Sandwiched Transparent Conductive Film

    Directory of Open Access Journals (Sweden)

    Yuchao Niu

    2017-01-01

    Full Text Available Single layers of indium tin oxide (ITO, aluminum-doped zinc oxide (AZO, and Ag, bilayers of ITO/Ag and AZO/Ag, and sandwiched layers of ITO/Ag/ITO (IAI and AZO/Ag/AZO (ZAZ were fabricated on ordinary glass substrates using magnetron sputtering. The surface morphologies of single layers and bilayers were measured. The sheet resistance and transmittance of the sandwiched layers were investigated. The results showed that the spreadability of the Ag on the AZO was significantly better than that on the ITO or bare glass substrate. The spreadability of Ag on underlayers influences obviously the performance of transparent conductive oxide/Ag/transparent conductive oxides (TCO/Ag/TCO or TAT. The sheet resistance and transmittance of the ZAZ sandwiched layer with the matching of 35 nm AZO (35 nm/Ag (9 nm/AZO (35 nm fabricated in this paper were low to 3.84 Ω/sq and up to 85.55% at 550 nm, respectively. Its maximum Haacke figure of merit was 0.05469 Ω−1, higher than that of IAI multilayer.

  8. Controllable irregular phenomenon induced by Ag atomic segregation on the melting of (AgPd)561 bimetallic clusters

    Science.gov (United States)

    Li, Guojian; Wang, Qiang; Liu, Tie; Wang, Kai; Wu, Chun; He, Jicheng

    2012-08-01

    This paper studies the melting of Ag-Pd bimetallic clusters with different Ag concentrations and atomic distributions by using molecular dynamics simulation with a general embedded-atom method. The melting of a cluster with 45 % Ag atoms distributing in the core was compared with that of 45 %, 15 % Ag on the surface and 15 % Ag in the core. It is found that the energy variation with the increasing temperature is strongly related to the Ag atomic segregation, due to the reason that there is a competition between the decreased energy induced by the atomic segregation and the increased energy as the temperature increases. The melting of the Ag-core clusters with different Ag concentrations from 5 to 55 % Ag was further explored. It is found that the irregular variation of energy occurred that the atomic energy increases, keeps unchanged or decreases with the increase of the temperature. Furthermore, the irregular phenomena of the melting were induced by the Ag concentrations. This gives a new method to tune the melting in bimetallic clusters.

  9. Highly efficient degradation of thidiazuron with Ag/AgCl- activated carbon composites under LED light irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Yisi [College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha 410128 (China); Hubei Key Laboratory for Processing and Application of Catalytic Materials, Huanggang Normal University, Huanggang 438000 (China); College of Chemical Engineering, Huanggang Normal University, Huanggang 438000 (China); Zhang, Yan [Hubei Key Laboratory for Processing and Application of Catalytic Materials, Huanggang Normal University, Huanggang 438000 (China); College of Chemical Engineering, Huanggang Normal University, Huanggang 438000 (China); Dong, Mingguang; Yan, Ting; Zhang, Maosheng [College of Chemical Engineering, Huanggang Normal University, Huanggang 438000 (China); Zeng, Qingru, E-mail: 40083763@qq.com [College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha 410128 (China)

    2017-08-05

    Highlights: • Photocatalytic degradation of thidiazuron was performed in a neutral water matrix. • This was carried out in the presence of Ag/AgCl-activated carbon composites and LED light. • The pH effect and the dominant active species were explored. • Degradation products and pathways in water were studied for the first time. - Abstract: Thidiazuron (TDZ; 1-phenyl-3-(1,2,3-thiadiazol-5-yl)urea) is one of the most widely used defoliant and easy to dissolve in surface water. Risk associated with the pesticide is not clearly defined, so it is important to remove/degrade TDZ with an efficient and environment friendly technology. Here, we investigated the use of Ag/AgCl-activated carbon (Ag/AgCl–AC) composites in photocatalytic degradation of TDZ under LED light. By the synergic effect of Ag/AgCl and AC, the optimum Ag/carbon weight ratio of 2:1 exhibited superior visible-light photocatalytic activity, the highest removal efficiency was close to 91% in pH 7 matrix. Different types of Ag/AgCl–AC composites were tested, all showed much faster photodegradation kinetics than bare Ag/AgCl in 210 min. The degradation products as identified by HPLC–MS revealed that the hydroxylation by hydroxyl radicals and that of oxidation by superoxide radicals as well as holes were the two main pathways for TDZ degradation. Results revealed that the adsorption concentrated TDZ molecules and the photocatalytically generated radicals rapidly degradated TDZ, the two contributions functioned together for removal of the pollutant from water.

  10. Nano-galvanic coupling for enhanced Ag+ release in ZrCN-Ag films : Antibacterial application

    NARCIS (Netherlands)

    Calderon, S.; Ferreri, I.; Henriques, M.; De Hosson, J. T. M.; Cavaleiro, A.; Carvalho, S.

    2016-01-01

    The antibacterial properties of materials developed for medical devices with embedded silver nanoparticles are enhanced by controlling the release of silver ions. In this study, a simple experimental procedure for the augmentation of the silver ion release from ZrCN-Ag coatings is described. The

  11. Fabrication of antimicrobial bacterial cellulose-Ag/AgCl nanocomposite using bacteria as versatile biofactory

    Science.gov (United States)

    Liu, Chuang; Yang, Dong; Wang, Yuangui; Shi, Jiafu; Jiang, Zhongyi

    2012-08-01

    In nature, a number of nanocomposites are formed through biomineralization-relevant processes under mild conditions. In the present study, a total "biologic" route to fabricate nanocomposite is reported. Non-pathogenic bacteria, Gluconacetobacter xylinum, was utilized as a versatile biofactory, which produced biopolymer bacterial cellulose (BC) and induced the formation of Ag/AgCl nanoparticles, yielding BC-Ag/AgCl nanocomposite. Scanning electron microscopy revealed that nanoparticles with average size of 17.4 nm were randomly embedded into the BC network; transmission electron microscopy and X-ray diffraction confirmed that the nanoparticles were mixtures of face-centered cubic silver and silver chloride nanoparticles. Moreover, the content of silver in the BC nanocomposite is around 0.05 wt%, determined by atomic absorption spectrometry and X-ray photoelectron spectroscopy analysis. The entire process of nanocomposite fabrication was conducted at ambient environment without utilizing toxic agents or producing hazardous products, which is not only environmentally friendly but also with less chances to generate harmful products to human bodies as biomedical materials. The resultant nanocomposite displayed the desirable activity in inhibiting bacterial growth of both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli microorganisms on agar plate and in liquid culture, indicating the potential of the material as antimicrobial wound dressing materials. This work demonstrated the feasibility of using microorganism to fabricate nanocomposite, especially for biomedical materials.

  12. Fabrication of antimicrobial bacterial cellulose-Ag/AgCl nanocomposite using bacteria as versatile biofactory

    Energy Technology Data Exchange (ETDEWEB)

    Liu Chuang [Tianjin University, Key Laboratory for Green Technology, School of Chemical Engineering and Technology (China); Yang Dong; Wang Yuangui [Tianjin University, Department of Biochemical Engineering and Key Laboratory of Systems Bioengineering of Ministry of Education, School of Chemical Engineering and Technology (China); Shi Jiafu; Jiang Zhongyi, E-mail: zhyjiang@tju.edu.cn [Tianjin University, Key Laboratory for Green Technology, School of Chemical Engineering and Technology (China)

    2012-08-15

    In nature, a number of nanocomposites are formed through biomineralization-relevant processes under mild conditions. In the present study, a total 'biologic' route to fabricate nanocomposite is reported. Non-pathogenic bacteria, Gluconacetobacter xylinum, was utilized as a versatile biofactory, which produced biopolymer bacterial cellulose (BC) and induced the formation of Ag/AgCl nanoparticles, yielding BC-Ag/AgCl nanocomposite. Scanning electron microscopy revealed that nanoparticles with average size of 17.4 nm were randomly embedded into the BC network; transmission electron microscopy and X-ray diffraction confirmed that the nanoparticles were mixtures of face-centered cubic silver and silver chloride nanoparticles. Moreover, the content of silver in the BC nanocomposite is around 0.05 wt%, determined by atomic absorption spectrometry and X-ray photoelectron spectroscopy analysis. The entire process of nanocomposite fabrication was conducted at ambient environment without utilizing toxic agents or producing hazardous products, which is not only environmentally friendly but also with less chances to generate harmful products to human bodies as biomedical materials. The resultant nanocomposite displayed the desirable activity in inhibiting bacterial growth of both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli microorganisms on agar plate and in liquid culture, indicating the potential of the material as antimicrobial wound dressing materials. This work demonstrated the feasibility of using microorganism to fabricate nanocomposite, especially for biomedical materials.

  13. Rare and forbidden kaon decays at the AGS

    Energy Technology Data Exchange (ETDEWEB)

    Kettell, S.

    1997-12-09

    An overview of the Rare Kaon Decay program at the AGS is presented, with particular emphasis on the three major experiments currently running and analyzing data. A brief overview of earlier kaon decay experiments and of the AGs performance improvements is also provided. This review concludes with a discussion of proposed and developing experiments planned to run in the year 2000 and beyond (AGS-2000).

  14. Borohydride electro-oxidation by Ag-doped lanthanum chromites

    Indian Academy of Sciences (India)

    The electrocatalytic activity of Ag-doped lanthanum chromites electrode materials viz., LaCr0.4Ag0.6O3 and LaCr0.7Ag0.3O3 prepared by decomposing the precursor complex is studied. Pure LaCrO3 is synthesized by combustion route using oxalic acid as a fuel. The decomposition behaviour of the assynthesized powder ...

  15. Molecular dynamics study of nanojoining between axially positioned Ag nanowires

    International Nuclear Information System (INIS)

    Cui, Jianlei; Theogene, Barayavuga; Wang, Xuewen; Mei, Xuesong; Wang, Wenjun; Wang, Kedian

    2016-01-01

    Highlights: • The temperature and distance have a great impact on joining effect without solders. • At high temperature, Ag atoms are disordered and the atomic queues become to distort. • When the distance is large, the Ag nanowires are not connected at any temperature. • When the distance is small and the temperature is low, Ag NWs on the Si substrate can be obtained relatively good nanoconnection. - Abstract: The miniaturization of electronics devices into nanometer scale is indispensable for next-generation semiconductor technology. Ag nanowires (Ag NWs) are considered to be the promising candidates for future electronic circuit owing to the excellent electrical and thermal properties. The nanojoining of axially positioned Ag NWs was performed by molecular dynamics simulation. Through the detailed atomic evolution during the nanojoining, the results indicate that the temperature and the distance between Ag NWs in axial direction have a great impact on nanojoining effect. When the nanojoining temperature is relatively high, the atoms are disordered and the atomic queues become to distort with strong thermodynamic properties and weak effect of metal bonds. At the relatively low temperature, the Ag NWs can be well connected with good junction quality and their own morphology, which is similar to the cold welding without fusion, while the distance between Ag NWs should be controlled for interaction and diffusion of interfacial atoms at nanowires head. When the Ag NWs are placed on Si and SiO 2 substrate, because the atomic species and lattice structure of substrate material can differently affect the motions of Ag atoms through the interactive force between the atoms, the nanojoining quality of Ag NWs on Si substrate is better than that on the SiO 2 substrate. So, for getting effective and reliable nanojoining without nanosolders and other materials, the temperature, distance and substrate surface should be reasonably controlled and selected, providing

  16. Molecular dynamics study of nanojoining between axially positioned Ag nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Jianlei, E-mail: cjlxjtu@xjtu.edu.cn [State Key Laboratory for Manufacturing Systems Engineering, Xi’an Jiaotong University, Xi’an 710049 (China); State Key Laboratory of Surface Physics and Department of Physics, Fudan University, Shanghai 200433 (China); State Key Laboratory of Advanced Welding and Joining, Harbin Institute of Technology, Harbin 150001 (China); Theogene, Barayavuga, E-mail: 1400584887@qq.com [State Key Laboratory for Manufacturing Systems Engineering, Xi’an Jiaotong University, Xi’an 710049 (China); State Key Laboratory of Surface Physics and Department of Physics, Fudan University, Shanghai 200433 (China); Wang, Xuewen, E-mail: 358994796@qq.com [State Key Laboratory for Manufacturing Systems Engineering, Xi’an Jiaotong University, Xi’an 710049 (China); State Key Laboratory of Surface Physics and Department of Physics, Fudan University, Shanghai 200433 (China); Mei, Xuesong, E-mail: xsmeixjtu@163.com [State Key Laboratory for Manufacturing Systems Engineering, Xi’an Jiaotong University, Xi’an 710049 (China); Wang, Wenjun, E-mail: wangwenjun1981@yeah.net [State Key Laboratory for Manufacturing Systems Engineering, Xi’an Jiaotong University, Xi’an 710049 (China); Wang, Kedian, E-mail: kedianwang@yeah.net [State Key Laboratory for Manufacturing Systems Engineering, Xi’an Jiaotong University, Xi’an 710049 (China)

    2016-08-15

    Highlights: • The temperature and distance have a great impact on joining effect without solders. • At high temperature, Ag atoms are disordered and the atomic queues become to distort. • When the distance is large, the Ag nanowires are not connected at any temperature. • When the distance is small and the temperature is low, Ag NWs on the Si substrate can be obtained relatively good nanoconnection. - Abstract: The miniaturization of electronics devices into nanometer scale is indispensable for next-generation semiconductor technology. Ag nanowires (Ag NWs) are considered to be the promising candidates for future electronic circuit owing to the excellent electrical and thermal properties. The nanojoining of axially positioned Ag NWs was performed by molecular dynamics simulation. Through the detailed atomic evolution during the nanojoining, the results indicate that the temperature and the distance between Ag NWs in axial direction have a great impact on nanojoining effect. When the nanojoining temperature is relatively high, the atoms are disordered and the atomic queues become to distort with strong thermodynamic properties and weak effect of metal bonds. At the relatively low temperature, the Ag NWs can be well connected with good junction quality and their own morphology, which is similar to the cold welding without fusion, while the distance between Ag NWs should be controlled for interaction and diffusion of interfacial atoms at nanowires head. When the Ag NWs are placed on Si and SiO{sub 2} substrate, because the atomic species and lattice structure of substrate material can differently affect the motions of Ag atoms through the interactive force between the atoms, the nanojoining quality of Ag NWs on Si substrate is better than that on the SiO{sub 2} substrate. So, for getting effective and reliable nanojoining without nanosolders and other materials, the temperature, distance and substrate surface should be reasonably controlled and selected

  17. Magnetic properties of Fe20Ag80 granular films

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Mørup, Steen; Jonsson, T.

    1997-01-01

    Fe20Ag80 granular films prepared by ion-beam cosputtering have been investigated by Mossbauer spectrocopy and dc susceptibility measurements. The as-sputtered Fe20Ag80 films consist of small magnetic particles embedded in the Ag matrix. The system is in a superparamagnetic state at temperatures a...... above 30 K. Below 30 K, the films begins to show slow magnetic relaxation and by further lowering the temperature, a super-spin-glass phase is formed around 20 K....

  18. Transport of silver nanoparticles (AgNPs) in soil.

    Science.gov (United States)

    Sagee, Omer; Dror, Ishai; Berkowitz, Brian

    2012-07-01

    The effect of soil properties on the transport of silver nanoparticles (AgNPs) was studied in a set of laboratory column experiments, using different combinations of size fractions of a Mediterranean sandy clay soil. The AgNPs with average size of ~30nm yielded a stable suspension in water with zeta potential of -39mV. Early breakthrough of AgNPs in soil was observed in column transport experiments. AgNPs were found to have high mobility in soil with outlet relative concentrations ranging from 30% to 70%, depending on experimental conditions. AgNP mobility through the column decreased when the fraction of smaller soil aggregates was larger. The early breakthrough pattern was not observed for AgNPs in pure quartz columns nor for bromide tracer in soil columns, suggesting that early breakthrough is related to the nature of AgNP transport in natural soils. Micro-CT and image analysis used to investigate structural features of the soil, suggest that soil aggregate size strongly affects AgNP transport in natural soil. The retention of AgNPs in the soil column was reduced when humic acid was added to the leaching solution, while a lower flow rate (Darcy velocity of 0.17cm/min versus 0.66cm/min) resulted in higher retention of AgNPs in the soil. When soil residual chloride was exchanged by nitrate prior to column experiments, significantly improved mobility of AgNPs was observed in the soil column. These findings point to the importance of AgNP-soil chemical interactions as a retention mechanism, and demonstrate the need to employ natural soils rather than glass beads or quartz in representative experimental investigations. Copyright © 2012 Elsevier Ltd. All rights reserved.

  19. Progress report on the analytical determination of Ag2+

    International Nuclear Information System (INIS)

    Van Alsenoy, V.

    1997-01-01

    The strong oxidising properties of Ag 2+ have been used in the chemical and nuclear industry to destroy organic waste. We aim to apply the process on radioactive graphite, organic resins and effluents. The reaction mechanisms have been studied, taking into account the thermodynamic and kinetic properties of the different reactions involved. For the experimental analysis of these reactions, the accurate analytical determination of all species involved, including Ag 2+ , is needed. The results of a systematic study of the volumetric quantification of Ag 2+ using Tl + and BrO 3 - , and of the spectrophotometric and polarographic quantification of Ag + and Ag 2+ are described. The influence of the nitric acid during the quantification of Tl + by titration with KBrO 3 is investigated and the optimal analytical conditions for our purposes were determined. The best analytical results were obtained when the titration was carried out with maximum 3 M HNO 3 and 0.5 M NaCl. When those conditions are used, the determination is accurate and reproducible. The prepared Ag 2+ solutions were analysed for Ag + using polarography with a platinum electrode. The benefits and the limitation of the polarographic measurement of Ag + using a platinum electrode are described. An indirect measurement was performed by the determination of Ce 4+ after reaction with Ce 3+ . The produced Ce 4+ was measured by direct spectrophotometry. In the future, the quantification of Ag 2+ by measuring the Ce 4+ concentration produced by the reaction with Ce 3+ , will also be verified using potentiometric titration with Fe 2+ . Ag 2+ can also be determined by the direct spectrophotometry. There is a region in which the absorbance of Ag 2+ changes linearly with the concentration. Further evaluation of the titrimetric, spectrophotometric and polarographic methods will continue, until two methods give comparable Ag 2+ concentrations, beginning with the potentiometric titration of Ce 4+ with Fe 2+

  20. Ag-bridged Ag2O nanowire network/TiO2 nanotube array p-n heterojunction as a highly efficient and stable visible light photocatalyst.

    Science.gov (United States)

    Liu, Chengbin; Cao, Chenghao; Luo, Xubiao; Luo, Shenglian

    2015-03-21

    A unique Ag-bridged Ag2O nanowire network/TiO2 nanotube array p-n heterojunction (Ag-Ag2O/TiO2 NT) was fabricated by simple electrochemical method. Ag nanoparticles were firstly electrochemically deposited onto the surface of TiO2 NT and then were partly oxidized to Ag2O nanowires while the rest of Ag mother nanoparticles were located at the junctions of Ag2O nanowire network. The Ag-Ag2O/TiO2 NT heterostructure exhibited strong visible-light response, effective separation of photogenerated carriers, and high adsorption capacity. The integration of Ag-Ag2O self-stability structure and p-n heterojunction permitted high and stable photocatalytic activity of Ag-Ag2O/TiO2 NT heterostructure photocatalyst. Under 140-min visible light irradiation, the photocatalytic removal efficiency of both dye acid orange 7 (AO7) and industrial chemical p-nitrophenol (PNP) over Ag-Ag2O/TiO2 NT reached nearly 100% much higher than 17% for AO7 or 13% for PNP over bare TiO2 NT. After 5 successive cycles under 600-min simulated solar light irradiation, Ag-Ag2O/TiO2 NT remained highly stable photocatalytic activity. Copyright © 2014 Elsevier B.V. All rights reserved.

  1. Quantification of HBsAg to predict low levels and seroclearance in HBeAg-negative patients receiving nucleos(tide analogues.

    Directory of Open Access Journals (Sweden)

    Teresa Broquetas

    Full Text Available HBeAg-negative chronic hepatitis B patients require long-term nucleos(tide analogues(NAs because loss of surface antigen (HBsAg is unusual. Low quantitative HBsAg (qHBsAg levels can identify patients with higher probability of seroclearance. The aim of our study was to evaluate qHBsAg in HBeAg-negative patients receiving NAs to predict a reduction of HBsAg levels and seroclearance.Retrospective analysis of qHBsAg in HBeAg-negative patients before and at years 1, 3, 5, 8 and over of NAs treatment.From 1999 to 2015, HBsAg was quantified in 358 serum samples from 95 HBeAg-negative patients. Low qHBsAg (0.3 log IU/mL showing a positive and negative predictive value of 42% and 100% to identify patients achieving low levels of HBsAg.Reduction of qHBsAg is slow in HBeAg-negative patients receiving NAs, although low levels or faster qHBsAg decline may occur in 14%. A qHBsAg reduction >0.3 log IU/mL at year 3 can identify patients with a higher probability of achieving low levels and HBsAg seroclearance.

  2. Enhanced Visible Light Photocatalytic Degradation of Organic Pollutants over Flower-Like Bi2O2CO3 Dotted with Ag@AgBr

    Science.gov (United States)

    Lin, Shuanglong; Wang, Miao; Liu, Li; Liang, Yinghua; Cui, Wenquan; Zhang, Zisheng; Yun, Nan

    2016-01-01

    A facile and feasible oil-in-water self-assembly approach was developed to synthesize flower-like Ag@AgBr/Bi2O2CO3 micro-composites. The photocatalytic activities of the samples were evaluated through methylene blue degradation under visible light irradiation. Compared to Bi2O2CO3, flower-like Ag@AgBr/Bi2O2CO3 micro-composites show enhanced photocatalytic activities. In addition, results indicate that both the physicochemical properties and associated photocatalytic activities of Ag@AgBr/Bi2O2CO3 composites are shown to be dependent on the loading quantity of Ag@AgBr. The highest photocatalytic performance was achieved at 7 wt % Ag@AgBr, degrading 95.18% methylene blue (MB) after 20 min of irradiation, which is over 1.52 and 3.56 times more efficient than that of pure Ag@AgBr and pure Bi2O2CO3, respectively. Bisphenol A (BPA) was also degraded to further demonstrate the degradation ability of Ag@AgBr/Bi2O2CO3. A photocatalytic mechanism for the degradation of organic compounds over Ag@AgBr/Bi2O2CO3 was proposed. Results from this study illustrate an entirely new approach to fabricate semiconductor composites containing Ag@AgX/bismuth (X = a halogen). PMID:28774002

  3. Enhanced Visible Light Photocatalytic Degradation of Organic Pollutants over Flower-Like Bi2O2CO3 Dotted with Ag@AgBr

    Directory of Open Access Journals (Sweden)

    Shuanglong Lin

    2016-10-01

    Full Text Available A facile and feasible oil-in-water self-assembly approach was developed to synthesize flower-like Ag@AgBr/Bi2O2CO3 micro-composites. The photocatalytic activities of the samples were evaluated through methylene blue degradation under visible light irradiation. Compared to Bi2O2CO3, flower-like Ag@AgBr/Bi2O2CO3 micro-composites show enhanced photocatalytic activities. In addition, results indicate that both the physicochemical properties and associated photocatalytic activities of Ag@AgBr/Bi2O2CO3 composites are shown to be dependent on the loading quantity of Ag@AgBr. The highest photocatalytic performance was achieved at 7 wt % Ag@AgBr, degrading 95.18% methylene blue (MB after 20 min of irradiation, which is over 1.52 and 3.56 times more efficient than that of pure Ag@AgBr and pure Bi2O2CO3, respectively. Bisphenol A (BPA was also degraded to further demonstrate the degradation ability of Ag@AgBr/Bi2O2CO3. A photocatalytic mechanism for the degradation of organic compounds over Ag@AgBr/Bi2O2CO3 was proposed. Results from this study illustrate an entirely new approach to fabricate semiconductor composites containing Ag@AgX/bismuth (X = a halogen.

  4. Beam dump experiments at the AGS

    International Nuclear Information System (INIS)

    Soukas, A.; Bregman, M.; Galik, R.

    1978-01-01

    Searches for the prompt production of weak or semi-strongly interacting particles in a neutrino beam dump and their subsequent interaction or decay were performed at the AGS. The experiment is detailed using the totally active liquid scintillator detector, and mention the results of the spark chamber detector. An exposure of a copper beam dump to two orders of magnitude more protons than in previous searches at 28 GeV has yielded 104 neutrino-like events in the detector. The events from the beam dump are compared directly with those from π and K decay neutrinos produced concurrently in the normal long neutrino decay path following a 15 cm brass target. The characteristics of the events are similar. However, when compared to the rate of events predicted by scaling the 15 cm target yields, the beam dump data show an excess of 45 +- 16 events. The excess events from the beam dump appear to deposit energies greater than or equal to 1 GeV. Their source remains puzzling. Future experiments at the AGS could verify the existence of the effect, decrease the uncertainty in the predicted number of events from 30 to 10% by directly measuring the pion absorption length with a variable density target, search for threshold effects, and measure the sign of the charge of the existing muons. 22 references

  5. Transformation from Ag@Ag{sub 3}PO{sub 4} to Ag@Ag{sub 2}SO{sub 4} hybrid at room temperature: preparation and its visible light photocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Wei, Ting; Gao, Shanmin, E-mail: gaosm@ustc.edu; Wang, Qingyao; Xu, Hui [Ludong University, College of Chemistry and Materials Science (China); Wang, Zeyan; Huang, Baibiao, E-mail: bbhuang@sdu.edu.cn; Dai, Ying [Shandong University, State Key Laboratory of Crystal Materials (China)

    2017-02-15

    In the present study, Ag/Ag{sub 2}SO{sub 4} hybrid photocatalysts were obtained via a facile redox–precipitation reaction approach by using Ag@Ag{sub 3}PO{sub 4} nanocomposite as the precursor and KMnO{sub 4} as the oxidant. Multiple techniques, such as X-ray diffraction pattern (XRD), transmission electron microscope (TEM), high-resolution transmission electron microscopy (HRTEM), X-ray photoelectron spectroscopy (XPS), UV–vis diffuse reflectance spectroscopy (DRS) and Brunauer–Emmett–Teller (BET), photocurrent and electrochemical impedance spectroscopy (EIS), were applied to investigate the structures, morphologies, optical, and electronic properties of as-prepared samples. The photocatalytic activities were evaluated by photodegradation of organic rhodamine B (RhB) and methyl orange (MO) under visible light irradiation. It was found that pure Ag{sub 2}SO{sub 4} can partially transform into metallic Ag during the photocatalytic degradation of organic pollutants, but the Ag/Ag{sub 2}SO{sub 4} hybrids can maintain its structure stability and show enhanced visible light photocatalytic activity because of the surface plasma resonance effect of the metallic Ag.

  6. Facile synthesis of Ag nanocubes and Au nanocages.

    Science.gov (United States)

    Skrabalak, Sara E; Au, Leslie; Li, Xingde; Xia, Younan

    2007-01-01

    This protocol describes a method for the synthesis of Ag nanocubes and their subsequent conversion into Au nanocages via the galvanic replacement reaction. The Ag nanocubes are prepared by a rapid (reaction time nanocubes. With this method, Ag nanocubes can be prepared and isolated for use within approximately 3 h. The Ag nanocubes can then serve as sacrificial templates for the preparation of Au nanocages, with a method for their preparation also described herein. The procedure for Au nanocage preparation and isolation requires approximately 5 h.

  7. Stability of Ag nanoparticles dispersed in amphiphilic organic matrix

    Science.gov (United States)

    Suvorova, Elena I.; Klechkovskaya, Vera V.; Kopeikin, Victor V.; Buffat, Philippe A.

    2005-02-01

    Nano- and thin-film technologies based on novel systems associating metals particles to polymer matrix open a broad range of different applications. Such composites were found to be more efficient and safe, for instance, in biomedical needs. The Ag/poly(N-vinyl-2-pyrrolidone) (Ag/PVP) composite investigated in the present work is a new bactericide mean applied in complicated cases of infected burns and purulent wounds. High-resolution transmission electron microscopy (HRTEM) and X-ray energy-dispersive (EDS) microanalysis were used to bring chemical and structural information in a study of the properties and stability of thin-film nanocomposite whih consisted of Ag nanoparticles dispersed in water-soluble organic matrix poly(N-vinyl-2-pyrrolidone). The nanostructural investigation of Ag/PVP composite by HRTEM and EDS exposed to SO 2 and H 2S from the atmosphere and some traces of S-containing substances explains the limited stability of this system by a structural modification associated with a phase change and formation of Ag 2S and Ag 2SO 3. However, formation of the hardly water-soluble Ag 2S and Ag 2SO 3 salts may play an important role in the suppression of bacterial growth. On the one hand, silver could block S-H groups in vital proteins and conduced to their destruction, in that way revealing the antibacterial power. On the other hand, antiseptic properties of Ag consist in binding the products of the protein decay.

  8. RHIC FY15 pp Run RHIC and AGS polarization analysis

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H. [Brookhaven National Lab. (BNL), Upton, NY (United States); Adams, P. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-02-20

    The polarization information is important for the spin physics program in Relativistic Heavy Ion Collider (RHIC). There are discrepancies between AGS and RHIC polarization measurements. First, the face value of AGS polarization is higher than RHIC ones in general. Second, the measured polarization profile (described by the profile ratio R) is stronger in AGS than in RHIC. This note analyzes the polarization data from FY15 pp run period. The results show that the differences between AGS and RHIC polarization measurements are reasonable, but the R value difference is puzzling. The difference between blue and yellow ring is worth of spin simulation to explain.

  9. Synthesis and characterizations of spherical hollow composed of AgI nanoparticle using AgBr as the precursor

    International Nuclear Information System (INIS)

    Yang Ming; Zhou Kui

    2011-01-01

    Hollow spheres of AgI with an average radius of 100-200 nm have been prepared by a simple reaction between AgBr suspension and KI in the presence of gelatin. Gelatin played a decisive role as an inhibitor of the direct attack of I - ions to AgBr surfaces and coagulation of the growing AgI in producing the spherical AgI particles. The products were characterized by X-ray powder diffraction, transmission electron microscopy, UV-vis absorption spectroscopy and X-ray photoelectron spectra techniques. The band gaps are estimated to be 2.95 eV according to the results of optical measurements of the hollow spheres of AgI.

  10. Understanding the Composition Dependence of the Fragility of AgI-Ag2O-MxOy Glassy Systems

    International Nuclear Information System (INIS)

    Aniya, M

    2011-01-01

    It has been reported that the fragility in the AgI-Ag 2 O-M x O y (M = B, Ge, P, Mo) system is determined by Ag 2 O-M x O y and does not depend on the amount of AgI. This is an interesting result and provides a hint to understand the nature of the glassy state of these materials. However, the origin of such behavior has not been sufficiently discussed. In the present report a model for the above behavior is presented. According to the model, the behavior arises from the solid like nature of the network formed by Ag 2 O-M x O y and the liquid like AgI which flow between the networks. The model is consistent with the structural model of superionic glasses proposed previously.

  11. Improvement of photocatalytic activities of Ag/P25 hybrid systems by controlled morphology of Ag nanoprisms

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ti, E-mail: r01527017@ntu.edu.tw [Department of Materials Science and Engineering, National Taiwan University, Taipei 10617, Taiwan (China); Chao, Bo-Kai, E-mail: d98527007@ntu.edu.tw [Department of Materials Science and Engineering, National Taiwan University, Taipei 10617, Taiwan (China); Kuo, Yu-Lin, E-mail: ylkuo@mail.ntust.edu.tw [Department of Mechanical Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Hsueh, Chun-Hway, E-mail: hsuehc@ntu.edu.tw [Department of Materials Science and Engineering, National Taiwan University, Taipei 10617, Taiwan (China)

    2017-05-01

    Constructing hybrid systems with noble metal nanostructures is one known way to improve the poor photocatalysis efficiency of TiO{sub 2} under visible light. In our study, two different Ag nanostructures were prepared: (1) Ag nanospheres synthesized by chemical reduction method, and (2) Ag nanoprisms transformed from nanospheres with an additional photo-conversion process. Both Ag-TiO{sub 2} hybrid systems were prepared by mixing various concentrations of Ag solutions with commercial TiO{sub 2} powder (P25), and they were then utilized as photocatalysts for the photodecolorization test of methyl blue under various light sources (fluorescent, UV light and red LED lamps) irradiations. Results of the photodecolorization tests showed that Ag nanostructures could evidently enhance the photocatalytic activity of TiO{sub 2} under different light sources, while an optimal composition of 0.432 wt% Ag nanoprisms/TiO{sub 2} displayed superior photocatalytic properties under visible light irradiations (fluorescent and red LED lamps). The enhanced photocatalytic activities could be mainly attributed to the mechanisms of hot electrons injection and resonant energy transfer by the localized surface plasmon resonance of Ag nanostructures and the electronic states favorable of charge separation at the interface between metals and semiconductors. - Highlights: • We used Ag nanostructures to improve photocatalysis efficiency of TiO{sub 2}. • Ag nanoprisms were more efficient than Ag nanospheres under visible light. • Ag nanoprisms/P25 is about 7 times more efficient than P25 under fluorescent lamp. • Mechanisms rely on hot electrons injection and resonant energy transfer by LSPR.

  12. Atomic Ensemble and Electronic Effects in Ag-Rich AgPd Nanoalloy Catalysts for Oxygen Reduction in Alkaline Media

    OpenAIRE

    Slanac, Daniel A.; Hardin, William G.; Johnston, Keith P.; Stevenson, Keith J.

    2012-01-01

    The ability to design and characterize uniform, bimetallic alloy nanoparticles, where the less active metal enhances the activity of the more active metal, would be of broad interest in catalysis. Herein, we demonstrate that simultaneous reduction of Ag and Pd precursors provides uniform, Ag-rich AgPd alloy nanoparticles (~5 nm) with high activities for the oxygen reduction reaction (ORR) in alkaline media. The particles are crystalline and uniformly alloyed, as shown by X-ray diffraction and...

  13. Comparison of antibacterial activities of Ag@TiO2 and Ag@SiO2 core-shell nanoparticles

    Science.gov (United States)

    Dhanalekshmi, K. I.; Meena, K. S.

    2014-07-01

    Core-shell type Ag@TiO2 nanoparticles were prepared by one pot simultaneous reduction of AgNO3 and hydrolysis of Ti (IV) isopropoxide and Ag@SiO2 core-shell nanoparticles were prepared by Stober's method. They were characterized by absorption, XRD, and HR-TEM techniques. XRD patterns show the presence of anatase form of TiO2 and amorphous form of SiO2 and the noble metal (Ag). High resolution transmission electron microscopy measurements revealed that their size is below 50 nm. The antibacterial properties of Ag@TiO2 and Ag@SiO2 core-shell nanoparticles against Escherichia coli (E. coli) and Staphylococcus aureus (S. aureus) were examined by the agar diffusion method. As a result E. coli and S. aureus were shown to be substantially inhibited by Ag@TiO2 and Ag@SiO2 core-shell nanoparticles. These results demonstrated that TiO2 and SiO2 supported on the surface of Ag NPs without aggregation was proved to have enhanced antibacterial activity.

  14. Posintro™-HBsAg, a modified ISCOM including HBsAg, induces strong cellular and humoral responses

    DEFF Research Database (Denmark)

    Schiött, Asa; Larsson, Kristina; Manniche, Søren

    2011-01-01

    HBsAg vaccine formulation, Posintro™-HBsAg, was compared to two commercial hepatitis B vaccines including aluminium or monophosphoryl lipid A (MPL) and the two adjuvant systems MF59 and QS21 in their efficiency to prime both cellular and humoral immune responses. The Posintro™-HBsAg induced...... of delayed type hypersensitivity (DTH) reaction and CD4(+) T-cell proliferation. In addition, Posintro™-HBsAg was the only vaccine tested that also induced a strong cytotoxic T lymphocyte (CTL) response, with high levels of antigen specific CD8 T-cells secreting IFN-gamma mediating cytolytic activity...

  15. RRR and thermal conductivity of Ag and Ag0.2wt%Mg alloy in Ag/Bi-2212 wires

    Energy Technology Data Exchange (ETDEWEB)

    Li, Pei [Fermilab; Ye, L. [North Carolina State U.; Jiang. J., Jiang. J. [Natl. High Mag. Field Lab.; Shen, T. [Fermilab

    2015-08-19

    The residual resistivity ratio (RRR) and thermal conductivity of metal matrix in metal/superconductor composite wires are important parameters for designing superconducting magnets. However, the resistivity of silver in reacted Ag/Bi-2212 wires has yet to be determined over temperature range from 4.2 K to 80 K because Bi-2212 filaments have a critical transition temperature Tc of ~ 80 K, and because it is unknown whether the RRR of Ag/Bi-2212 degrades with Cu diffusing from Bi-2212 filaments into silver sheathes at elevated temperatures and to what degree it varies with heat treatment. We measured the resistivity of stand-alone Ag and AgMg (Ag-0.2wt%Mg) wires as well as the resistivity of Ag and Ag- 0.2wt%Mg in the state-of-the-art Ag/Bi-2212 round wires reacted in 1 bar oxygen at 890 °C for 1, 8, 24 and 48 hours and quickly cooled to room temperature. The heat treatment was designed to reduce the critical current Ic of Bi-2212 wires to nearly zero while allowing Cu loss to fully manifest itself. We determined that pure silver exhibits a RRR of ~ 220 while the oxide-dispersion strengthened AgMg exhibits a RRR of ~ 5 in stand-alone samples. A surprising result is that the RRR of silver in the composite round wires doesn’t degrade with extended time at 890 °C for up to 48 hours. This surprising result may be explained by our observation that the Cu that diffuses into the silver tends to form Cu2O precipitates in oxidizing atmosphere, instead of forming Ag-Cu solution alloy. We also measured the thermal conductivity and the magneto-resistivity of pure Ag and Ag-0.2 wt%Mg from 4.2 K to 300 K in magnetic fields up to 14.8 T and summarized them using a Kohler plot.

  16. Precipitation of (PdxAg1-x)3 In in Ag-25% Pd-In alloys and the partial phase diagram of ternary Ag-Pd-In alloys.

    Science.gov (United States)

    Suh, Y C; Lee, Z H; Ohta, M

    2000-05-01

    A study was carried out to determine the partial phase diagram for the system Ag-25 wt % Pd-y wt% In with y Ag1-x)3 In was determined by the parametric method and the temperature dependence of In-solubility in Ag-25 wt % Pd was very strong above 900 degrees C. Copyright 2000 Kluwer Academic Publishers

  17. Controllable Charge Transfer in Ag-TiO₂ Composite Structure for SERS Application.

    Science.gov (United States)

    Wang, Yaxin; Yan, Chao; Chen, Lei; Zhang, Yongjun; Yang, Jinghai

    2017-06-28

    The nanocaps array of TiO₂/Ag bilayer with different Ag thicknesses and co-sputtering TiO₂-Ag monolayer with different TiO₂ contents were fabricated on a two-dimensional colloidal array substrate for the investigation of Surface enhanced Raman scattering (SERS) properties. For the TiO₂/Ag bilayer, when the Ag thickness increased, SERS intensity decreased. Meanwhile, a significant enhancement was observed when the sublayer Ag was 10 nm compared to the pure Ag monolayer, which was ascribed to the metal-semiconductor synergistic effect that electromagnetic mechanism (EM) provided by roughness surface and charge-transfer (CT) enhancement mechanism from TiO₂-Ag composite components. In comparison to the TiO₂/Ag bilayer, the co-sputtered TiO₂-Ag monolayer decreased the aggregation of Ag particles and led to the formation of small Ag particles, which showed that TiO₂ could effectively inhibit the aggregation and growth of Ag nanoparticles.

  18. Antimicrobial Nanocomposites Prepared from Montmorillonite/Ag+/Quaternary Ammonium Nitrate

    Directory of Open Access Journals (Sweden)

    Lin Zhang

    2018-01-01

    Full Text Available Nanocomposites of Ag with organic montmorillonite (Ag-OMMT, Ag with montmorillonite (Ag-MMT, and organic montmorillonite (OMMT were successfully prepared via a one-step solution-intercalated method. Sodium MMT, silver nitrate, and dimethyl octadecyl hydroxy ethyl ammonium nitrate were used as precursors. X-ray diffraction, Fourier transform infrared spectroscopy, transmission electron microscopy, and energy dispersive spectroscopy analyses confirmed that the MMT layers were intercalated, and Ag+ was partly reduced to silver nanoparticles with diameters within 10–20 nm in Ag-OMMT. The decomposition temperature of the organic cations in OMMT and Ag-OMMT increased to 220°C, as revealed by differential scanning calorimetry-thermogravimetric analysis. The antimicrobial activity of the nanocomposites was tested by measuring the minimum inhibitory concentration (MIC and killing rate. The MICs of Ag-OMMT against Staphylococcus aureus, Escherichia coli, and Candida albicans were 0.313, 2.5, and 0.625 mg/mL, respectively. Because of the presence of quaternary ammonium nitrate, Ag-OMMT has a better MIC against Gram-positive bacteria compared to Gram-negative bacteria and fungi. OMMT did not show antimicrobial activity against Escherichia coli and Candida albicans. In 2 h, 0.0125 mg/mL Ag-OMMT could kill 100% of S. aureus, E. coli, and C. albicans in solution, and Ag-MMT could kill 99.995% of S. aureus, 90.15% of E. coli, and 93.68% of C. albicans. These antimicrobial functional nanocomposites have the potential for application in the area of surface decoration films.

  19. Ag nanoparticle-coated zirconia for antibacterial prosthesis.

    Science.gov (United States)

    Yamada, Risa; Nozaki, Kosuke; Horiuchi, Naohiro; Yamashita, Kimihiro; Nemoto, Reina; Miura, Hiroyuki; Nagai, Akiko

    2017-09-01

    Bacterial adhesion to dental materials is a major cause of caries and periodontitis, necessitating the development of compounds such as yttria-stabilized zirconia (YSZ) and silver nanoparticles (AgNPs), which are widely employed in medicine due to their high antimicrobial activity and low cytotoxicity. The main goal of this study is the synthesis of the broad antimicrobial activity of AgNP-coated YSZ with facile methods. The bactericidal AgNPs were immobilized on the surface of YSZ and tested for bactericidal activity against Staphylococcus aureus, Streptococcus mutans, Escherichia coli, and Aggregatibacter actinomycetemcomitans based on ISO 22196:2007. The loading of AgNPs was optimized by culturing mouse fibroblast cells on AgNP-coated YSZ with cell viability test based on ISO 10993-5. In addition, the silver release profile of AgNP-coated YSZ in artificial saliva was determined using an accelerated aging test. Antibacterial activity, and cell viability test revealed optimum performance with no cytotoxicity at a level of 32 μg/cm 2 . Accelerated aging test showed that the AgNP-coated surface was extremely stable, exhibiting a total silver leaching level of only 1% and confirming the effectiveness of this coating method for retaining AgNPs while exerting an antibacterial effect against oral pathogens. This finding also implies that the bactericidal action of AgNP-coated YSZ is not mediated by the released Ag ions, but rather corresponds to contact killing. Yttria-stabilized zirconia, YSZ; silver nanoparticles, AgNPs; field emission scanning electron microscopy, FE-SEM; X-ray photoelectron spectroscopy, XPS; grazing incidence X-ray diffraction, GIXRD; ultraviolet-visible, UV-vis; inductively coupled plasma atomic emission spectrometry, ICP-AES. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. 76 FR 56099 - Implementation of a Decision Adopted Under the Australia Group (AG) Intersessional Silent...

    Science.gov (United States)

    2011-09-12

    .... 110222155-1110-01] RIN 0694-AF14 Implementation of a Decision Adopted Under the Australia Group (AG... proposal that was discussed at the 2010 Australia Group (AG) Plenary and adopted under the AG... under the Australia Group (AG) intersessional silent approval procedures in November 2010. The AG is a...

  1. Oscillatory relaxation of the Ag(110) surface

    International Nuclear Information System (INIS)

    Kuk, Y.; Feldman, L.C.

    1984-01-01

    The relaxation of the Ag(110) surface was studied by high-energy ion scattering. We find the first-layer spacing contracted by (7.8 +- 2.5)% and the second-layer spacing increased by (4.3 +- 2.5)%. The sensitivity of these results to assumptions of surface vibrations is explored. It is shown that the nearest-neighbor spacing at the surface (i.e., the spacing between the first and third layers) is contracted by (3.5 +- 0.5)%, and this result is almost independent of the surface Debye temperature. The results are consistent with the body of data indicating large, multilayer relaxation in (110)fcc surfaces

  2. Electron capture probabilities in sup 105 Ag

    Energy Technology Data Exchange (ETDEWEB)

    Chandrasekhar Rao, M.V.S.; Sree Krishna Murty, G.; Radha Krishna, K.; Bhuloka Reddy, S.; Satyanarayana, G.; Raghavaiah, C.V.; Sastry, D.L. (Andhra Univ., Visakhapatnam (India). Labs. for Nuclear Research); Chintalapudi, S.N. (Bhabha Atomic Research Centre, Calcutta (India). Variable Energy Cyclotron Centre)

    1990-01-01

    The K-electron capture probabilities for the 1/2{sup -}yields3/2{sup -} and 1/2{sup -}yields1/2{sup +} transitions in the decay of {sup 105}Ag were measured for the first time using the sum coincidence method. The experimental P{sub K} values were estimated to be 0.824{plus minus}0.042 and 0.851{plus minus}0.046 for the allowed and first-forbidden beta transitions, respectively in agreement with the theory. The P{sub L} experimental values to these two levels were also computed using the experimental P{sub L}/P{sub K} values reported by earlier authors. These results are also found to be consistent with the theoretical P{sub L} values. (orig.).

  3. The AGS Booster beam loss monitor system

    International Nuclear Information System (INIS)

    Beadle, E.R.; Bennett, G.W.; Witkover, R.L.

    1991-01-01

    A beam loss monitor system has been developed for the Brookhaven National Laboratory Booster accelerator, and is designed for use with intensities of up to 1.5 x 10 13 protons and carbon to gold ions at 50-3 x 10 9 ions per pulse. This system is a significant advance over the present AGS system by improving the sensitivity, dynamic range, and data acquisition. In addition to the large dynamic range achievable, it is adaptively shifted when high losses are detected. The system uses up to 80 argon filled ion chambers as detectors, as well as newly designed electronics for processing and digitizing detector outputs. The hardware simultaneously integrates each detector output, interfaces to the beam interrupt systems, and digitizes all 80 channels to 21 bits at 170 KHz. This paper discuses the design, construction, and operation of the system. 4 refs., 2 figs

  4. Tha AGS Booster high frequency rf system

    International Nuclear Information System (INIS)

    Sanders, R.; Cameron, P.; Damn, R.

    1988-01-01

    A high level rf system, including a power amplifier and cavity has been designed for the AGS Booster. It covers a frequency range of 2.4 to 4.2 Mhz and will be used to accelerate high intensity proton, and low intensity polarized proton beams to 1.5 GeV and heavy ions to 0.35 GeV per nucleon. A total accelerating voltage of up to 90kV will be provided by two cavities, each having two gaps. The internally cross-coupled, pushpull cavities are driven by an adjacently located power amplifier. In order to accommodate the high beam intensity, up to 0.75 /times/ 10 13 protons per bunch, a low plate resistance power tetrode is used. The tube anode is magnetically coupled to one of the cavity's two paralleled cells. The amplifier is a grounded cathode configuration driven by a remotely located solid state amplifier

  5. The AGS booster high frequency rf system

    International Nuclear Information System (INIS)

    Sanders, R.; Cameron, P.; Kamn, R.; Goldman, M.; Jablonski, E.; Keane, J.; McNerney, A.; Meth, M.; Plotkin, M.; Puglisi, M.; Ratti, A.

    1988-01-01

    This paper reports on a high level RF system, which includes a power amplifier and cavity designed for the AGS Booster. It covers a frequency range of 2.4 to 4.2 MHz and will be used to accelerate high intensity proton, and low intensity polarized proton beams to 1.5 GeV and heavy ions to 0.35 GeV per nucleon. A total accelerating voltage of up to 90kV will be provided by two cavities, each having two gaps. The internally cross-coupled, pushpull cavities are driven by an adjacently located power amplifier. In order to accommodate the high beam intensity, up to 0.75 x 10 13 protons per bunch, a low plate resistance power tetrode is used. The tube anode is magnetically coupled to one of the cavity's two paralleled cells. The amplifier is a grounded cathode configuration driven by a remotely located solid state amplifier

  6. Rf beam control for the AGS Booster

    Energy Technology Data Exchange (ETDEWEB)

    Brennan, J.M.

    1994-09-26

    RF beam control systems for hadron synchrotrons have evolved over the past three decades into an essentially standard design. The key difference between hadron and lepton machines is the absence of radiation damping and existence of significant frequency variation in the case of hadrons. Although the motion of the hadron in the potential well of the rf wave is inherently stable it is not strongly damped. Damping must be provided by electronic feedback through the accelerating system. This feedback is typically called the phase loop. The technology of the rf beam control system for the AGS Booster synchrotron is described. First, the overall philosophy of the design is explained in terms of a conventional servo system that regulates the beam horizontal position in the vacuum chamber. The concept of beam transfer functions is fundamental to the mathematics of the design process and is reviewed. The beam transfer functions required for this design are derived from first principles. An overview of the beam signal pick-ups and high level rf equipment is given. The major subsystems, the frequency program, the heterodyne system, and beam feedback loops, are described in detail. Beyond accelerating the beam, the rf system must also synchronize the bunches in the Booster to the buckets in the AGS before transfer. The technical challenge in this process is heightened by the need to accomplish synchronization while the frequency is still changing. Details of the synchronization system are given. This report is intended to serve two purposes. One is to document the hardware and performance of the systems that have been built. The other is to serve as a tutorial vehicle from which the non-expert can not only learn the details of this system but also learn the principles of beam control that have led to the particular design choices made.

  7. Rf beam control for the AGS Booster

    International Nuclear Information System (INIS)

    Brennan, J.M.

    1994-01-01

    RF beam control systems for hadron synchrotrons have evolved over the past three decades into an essentially standard design. The key difference between hadron and lepton machines is the absence of radiation damping and existence of significant frequency variation in the case of hadrons. Although the motion of the hadron in the potential well of the rf wave is inherently stable it is not strongly damped. Damping must be provided by electronic feedback through the accelerating system. This feedback is typically called the phase loop. The technology of the rf beam control system for the AGS Booster synchrotron is described. First, the overall philosophy of the design is explained in terms of a conventional servo system that regulates the beam horizontal position in the vacuum chamber. The concept of beam transfer functions is fundamental to the mathematics of the design process and is reviewed. The beam transfer functions required for this design are derived from first principles. An overview of the beam signal pick-ups and high level rf equipment is given. The major subsystems, the frequency program, the heterodyne system, and beam feedback loops, are described in detail. Beyond accelerating the beam, the rf system must also synchronize the bunches in the Booster to the buckets in the AGS before transfer. The technical challenge in this process is heightened by the need to accomplish synchronization while the frequency is still changing. Details of the synchronization system are given. This report is intended to serve two purposes. One is to document the hardware and performance of the systems that have been built. The other is to serve as a tutorial vehicle from which the non-expert can not only learn the details of this system but also learn the principles of beam control that have led to the particular design choices made

  8. Bicomponent AgCl/PVP nanofibre fabricated by electrospinning with ...

    Indian Academy of Sciences (India)

    Administrator

    AgCl nanoparticles in the PVP solution, and then the solutions were electrospun to obtain AgCl/PVP composite nanofibres. The final products were thoroughly characterized by X-ray powder diffraction (XRD), transmission electron microscopy (TEM), and field-emission scanning electron microscopy (FESEM), which showed ...

  9. Correlation of beam loss to residual activation in the AGS

    International Nuclear Information System (INIS)

    Brown, K.A.

    1991-01-01

    Studies of beam loss and activation at the AGS have provided a better understanding of measurements of beam loss and how they may be used to predict activation. Studies have been done in which first order correlations have been made between measured beam losses on the distributed ionization chamber system in the AGS and the health physics recorded residual activation. These studies have provided important insight into the ionization chamber system, its limitations, and its usefulness in the prediction of activation based on monitored beam loss. In recent years the AGS has run high intensity protons primarily for rare kaon decay experiments. In this mode of running the AGS typically accelerates beam from an injection momentum of 0.644 GeV/c up to a slow extracted beam (SEB) momentum of 24.2 GeV/c. The beam intensities are on the order of 4.5 x 10 13 protons per AGS cycle at injection to as high as 1.9 x 10 13 protons per AGS cycle at extraction. Residual activation varies around the AGS ring from the order of 5 mR/hour to levels of the order at 5 R/hour. The highest levels occur around the AGS beam catcher and the extraction equipment

  10. Thermodynamic properties of liquid solutions Ag-Tl-Te

    Energy Technology Data Exchange (ETDEWEB)

    Zaleska, E.; Sztuba, Z.; Sroka, A.; Gawel, W. [Department of Analytical Chemistry, Wroclaw University of Medicine, Wroclaw (Poland)

    1998-12-31

    Excess partial molar thermodynamic functions for the Ag-Tl-Te liquid solutions have been determined along the sections: X{sub Ag}:X{sub Te} = 1:4, 2:3, 1:1 and 3:2. The thermodynamic properties have been discussed in dependence on the number of associates existing in the liquid. (author) 34 refs,5 figs, 1 tab

  11. Correlation of beam loss to residual activation in the AGS

    International Nuclear Information System (INIS)

    Brown, K.A.

    1991-01-01

    Studies of beam loss and activation at the AGS have provided a better understanding of measurements of beam loss and how they may be used to predict activation. Studies have been done in which first order correlations have been made between measured beam losses on the distributed ionization chamber system in the AGS and the health physics recorded residual activation. These studies have provided important insight into the ionization chamber system, its limitations, and its usefulness in the prediction of activation based on monitored beam loss. In recent years the AGS has run high intensity protons primarily for rare known decay experiments. In this mode of running the AGS typically accelerates beam from an injection momentum of 0.644 GeV/c up to a slow extracted beam (SEB) momentum of 24.2 GeV/c. The beam intensities are on the order of 4.5 x 10 13 protons per AGS cycle at injection to as high as 1.9 x 10 13 protons per AGS cycle at extraction. Residual activation varies around the AGS ring from the order of 5 mR/hour to levels of the order at 5 R/hour. The highest levels occur around the AGS beam catcher and the extraction equipment. 7 refs., 3 figs., 2 tabs

  12. Atomic structure of As2S3-Ag chalcogenide glasses

    Science.gov (United States)

    Kaban, I.; Jóvári, P.; Wagner, T.; Frumar, M.; Stehlik, S.; Bartos, M.; Hoyer, W.; Beuneu, B.; Webb, M. A.

    2009-09-01

    (As0.4S0.6)100-xAgx glasses (x = 0, 4, 8, 12 at.%) have been studied with high-energy x-ray diffraction, neutron diffraction and extended x-ray absorption spectroscopy at As and Ag K-edges. The experimental data were modelled simultaneously with the reverse Monte Carlo simulation method. Analysis of the partial pair correlation functions and coordination numbers extracted from the model atomic configurations revealed that silver preferentially bonds to sulfur in the As2S3-Ag ternary glasses, which results in the formation of homoatomic As-As bonds. Upon the addition of Ag, a small proportion of Ag-As bonds (NAgAs≈0.3) are formed in all three ternary compositions, while the direct Ag-Ag bonds (NAgAg≈ 0.4) appear only in the glass with the highest Ag content (12 at.%). Similar to the g- As2S3 binary, the mean coordination number of arsenic is close to three, and that of sulfur is close to two, in the As2S3-Ag ternary glasses. The first sharp diffraction peak on the total structure factors of As2S3 binary and (As0.4S0.6)100-xAgx ternary glasses is related to the As-As and As-S correlations.

  13. Synthesis, characterization and photocatalytic activities of Ag-N ...

    African Journals Online (AJOL)

    Ag-N-codoped zinc oxide nanoparticles were synthesized by a one-step impregnation of Ag in N-doped ZnO nanoparticles. The morphologies and structures of the as-synthesized nanomaterials were investigated by using X-ray diffraction (XRD), transmission electron microscopy (TEM), and UV-Vis spectrophotometric ...

  14. Dendrimer-templated Ag-Pd bimetallic nanoparticles.

    Science.gov (United States)

    Chung, Young-Min; Rhee, Hyun-Ku

    2004-03-01

    Ultrafine dendrimer-templated Ag-Pd bimetallic nanoparticles with various metal compositions have been prepared successfully using silver(I)-bis(oxalato)palladate(II) complex. The use of an oxalate complex, in which two metal ions exist in one complex, is found to be effective in preventing unfavorable silver halide formation and thus suitable for the formation of Ag-Pd bimetallic nanoparticles.

  15. AGS vertical beta function measurements for Run 15

    Energy Technology Data Exchange (ETDEWEB)

    Harper, C. [Brookhaven National Lab. (BNL), Upton, NY (United States); Ahrens, L. [Brookhaven National Lab. (BNL), Upton, NY (United States); Huang, H. [Brookhaven National Lab. (BNL), Upton, NY (United States); Schoefer, V. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2016-10-07

    One key parameter for running the AGS efficiently is by maintaining a low emittance. To measure emittance, one needs to measure the beta function throughout the cycle. This can be done by measuring the beta function at the ionization profile monitors (IPM) in the AGS. This tech note delves into the motivation, the measurement, and some strides that were made throughout Run15.

  16. Parity violation in neutron resonances in 107,109Ag

    International Nuclear Information System (INIS)

    Lowie, L.Y.; Mitchell, G.E.; Stephenson, S.L.; Bowman, J.D.; Frankle, C.M.; Knudson, J.N.; Penttilae, S.I.; Seestrom, S.J.; Yen, Y.; Yuan, V.W.; Corvi, F.; Zanini, L.; Crawford, B.E.; Roberson, N.R.; Delheij, P.P.; Iinuma, M.; Masaike, A.; Matsuda, Y.; Shimizu, H.M.; Masuda, Y.; Postma, H.; Sharapov, E.I.

    1999-01-01

    Parity nonconservation (PNC) was studied in p-wave resonances in Ag by measuring the helicity dependence of the neutron total cross section. Transmission measurements on natural Ag were performed in the energy range 32 to 422 eV with the time-of-flight method at the Manuel Lujan Neutron Scattering Center at Los Alamos National Laboratory. A total of 15 p-wave neutron resonances were studied in 107 Ag and nine p-wave resonances in 109 Ag. Statistically significant asymmetries were observed for eight resonances in 107 Ag and for four resonances in 109 Ag. An analysis treating the PNC matrix elements as random variables yields a weak spreading width of Γ w =(2.67 -1.21 +2.65 )x10 -7 eV for 107 Ag and Γ w =(1.30 -0.74 +2.49 )x10 -7 eV for 109 Ag. thinsp copyright 1999 The American Physical Society

  17. Quadratite, AgCdAsS3

    DEFF Research Database (Denmark)

    Bindi, Luca; Spry, Paul G.; Bonazzi, Paola

    2013-01-01

    , AgMnAsS3. Like manganoquadratite, quadratite adopts a galena-derivative framework, with metal atoms occupying all the available octahedral interstices, although only M1 and M2 cations, occupied mainly by Cd, adopt a fairly regular octahedral coordination; the M3 cation, occupied by Ag, is located...

  18. Transport of stabilized engineered silver (Ag) nanoparticles through porous sandstones

    Science.gov (United States)

    Neukum, Christoph; Braun, Anika; Azzam, Rafig

    2014-03-01

    Engineered nanoparticles are increasingly applied in consumer products and concerns are rising regarding their risk as potential contaminants or carriers for colloid-facilitated contaminant transport. Engineered silver nanoparticles (AgNP) are among the most widely used nanomaterials in consumer products. However, their mobility in groundwater has been scarcely investigated. In this study, transport of stabilized AgNP through porous sandstones with variations in mineralogy, pore size distribution and permeability is investigated in laboratory experiments with well-defined boundary conditions. The AgNP samples were mainly characterized by asymmetric flow field-flow fractionation coupled to a multi-angle static laser light detector and ultraviolet-visible spectroscopy for determination of particle size and concentration. The rock samples are characterized by mercury porosimetry, flow experiments and solute tracer tests. Solute and AgNP breakthrough was quantified by applying numerical models considering one kinetic site model for particle transport. The transport of AgNP strongly depends on pore size distribution, mineralogy and the solution ionic strength. Blocking of attachment sites results in less reactive transport with increasing application of AgNP mass. AgNPs were retained due to physicochemical filtration and probably due to straining. The results demonstrate the restricted applicability of AgNP transport parameters determined from simplified experimental model systems to realistic environmental matrices.

  19. Transport of engineered silver (Ag) nanoparticles through partially fractured sandstones

    Science.gov (United States)

    Neukum, Christoph; Braun, Anika; Azzam, Rafig

    2014-08-01

    Transport behavior and fate of engineered silver nanoparticles (AgNP) in the subsurface is of major interest concerning soil and groundwater protection in order to avoid groundwater contamination of vital resources. Sandstone aquifers are important groundwater resources which are frequently used for public water supply in many regions of the world. The objective of this study is to get a better understanding of AgNP transport behavior in partially fractured sandstones. We executed AgNP transport studies on partially fissured sandstone drilling cores in laboratory experiments. The AgNP concentration and AgNP size in the effluent were analyzed using flow field-flow fractionation mainly. We employed inverse mathematical models on the measured AgNP breakthrough curves to identify and quantify relevant transport processes. Physicochemical filtration, time-dependent blocking due to filling of favorable attachment sites and colloid-facilitated transport were identified as the major processes for AgNP mobility. Physicochemical filtration was found to depend on solute chemistry, mineralogy, pore size distribution and probably on physical and chemical heterogeneity. Compared to AgNP transport in undisturbed sandstone matrix reported in the literature, their mobility in partially fissured sandstone is enhanced probably due to larger void spaces and higher hydraulic conductivity.

  20. Thermal Diffusion Dynamic Behavior of Two-Dimensional Ag-SMALL Clusters on Ag(1 1 1) Surface

    Science.gov (United States)

    Zakirur-Rehman; Hayat, Sardar Sikandar

    2015-07-01

    In this paper, the thermal diffusion behavior of small two-dimensional Ag-islands on Ag(1 1 1) surface has been explored using molecular dynamics (MD) simulations. The approach is based on semi-empirical potentials. The key microscopic processes responsible for the diffusion of Ag1-5 adislands on Ag(1 1 1) surface are identified. The hopping and zigzag concerted motion along with rotation are observed for Ag one-atom to three-atom islands while single-atom and multi-atom processes are revealed for Ag four-atom and five-atom islands, during the diffusion on Ag(1 1 1) surface. The same increasing/decreasing trend in the diffusion coefficient and effective energy barrier is observed in both the self learning kinetic Monte Carlo (SLKMC) and MD calculations, for the temperature range of 300-700 K. An increase in the value of effective energy barrier is noticed with corresponding increase in the number of atoms in Ag-adislands. A reasonable linear fit is observed for the diffusion coefficient for studied temperatures (300, 500 and 700 K). For the observed diffusion mechanisms, our findings are in good agreement with ab initio density-functional theory (DFT) calculations for Al/Al(1 1 1) while the energy barrier values are in same range as the experimental values for Cu/Ag(1 1 1) and the theoretical values using ab initio DFT supplemented with embedded-atom method for Ag/Ag(1 1 1).

  1. Thermal characterization of Ag and Ag + N ion implanted ultra-high molecular weight polyethylene (UHMWPE)

    Science.gov (United States)

    Sokullu Urkac, E.; Oztarhan, A.; Tihminlioglu, F.; Kaya, N.; Ila, D.; Muntele, C.; Budak, S.; Oks, E.; Nikolaev, A.; Ezdesir, A.; Tek, Z.

    2007-08-01

    Most of total hip joints are composed of ultra-high molecular weight polyethylene (UHMWPE). However, as ultra-high molecular weight polyethylene is too stable in a body, wear debris may accumulate and cause biological response such as bone absorption and loosening of prosthesis. In this study, ultra-high molecular weight polyethylene samples were Ag and Ag + N hybrid ion implanted by using MEVVA ion implantation technique to improve its surface properties. Samples were implanted with a fluence of 1017 ion/cm2 and extraction voltage of 30 kV. Implanted and unimplanted samples were investigated by thermo-gravimetry analysis (TGA), differential scanning calorimetry (DSC), X-ray diffraction (XRD) analysis, scanning electron microscopy (SEM), optical microscopy (OM) and contact Angle measurement. Thermal characterization results showed that the ion bombardment induced an increase in the % crystallinity, onset and termination degradation temperatures of UHMWPE.

  2. Thermal characterization of Ag and Ag + N ion implanted ultra-high molecular weight polyethylene (UHMWPE)

    Energy Technology Data Exchange (ETDEWEB)

    Sokullu Urkac, E. [Department of Materials Science, Izmir High Technology Institute, Gulbahcekoyu Urla, Izmir (Turkey)]. E-mail: emelsu@gmail.com; Oztarhan, A. [Bioengineering Department, Ege University, Bornova, Izmir 35100 (Turkey); Tihminlioglu, F. [Department of Chemical Engineering, Izmir High Technology Institute, Gulbahcekoyu Urla, Izmir (Turkey); Kaya, N. [Bioengineering Department, Ege University, Bornova, Izmir 35100 (Turkey); Ila, D. [Center for Irradiation of Materials, Alabama A and M University, Normal AL 35762 (United States); Muntele, C. [Center for Irradiation of Materials, Alabama A and M University, Normal AL 35762 (United States); Budak, S. [Center for Irradiation of Materials, Alabama A and M University, Normal AL 35762 (United States); Oks, E. [H C Electronics Institute, Tomsk (Russian Federation); Nikolaev, A. [H C Electronics Institute, Tomsk (Russian Federation); Ezdesir, A. [R and D Department, PETKIM Holding A.S., Aliaga, Izmir 35801 (Turkey); Tek, Z. [Department of Physics, Celal Bayar University, Manisa (Turkey)

    2007-08-15

    Most of total hip joints are composed of ultra-high molecular weight polyethylene (UHMWPE ). However, as ultra-high molecular weight polyethylene is too stable in a body, wear debris may accumulate and cause biological response such as bone absorption and loosening of prosthesis. In this study, ultra-high molecular weight polyethylene samples were Ag and Ag + N hybrid ion implanted by using MEVVA ion implantation technique to improve its surface properties. Samples were implanted with a fluence of 10{sup 17} ion/cm{sup 2} and extraction voltage of 30 kV. Implanted and unimplanted samples were investigated by thermo-gravimetry analysis (TGA), differential scanning calorimetry (DSC), X-ray diffraction (XRD) analysis, scanning electron microscopy (SEM), optical microscopy (OM) and contact Angle measurement. Thermal characterization results showed that the ion bombardment induced an increase in the % crystallinity, onset and termination degradation temperatures of UHMWPE.

  3. Influence of fabrication procedure on the electrochemical performance of Ag/AgCl reference electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Stoica, Daniela [Department of Biomedical and Inorganic Chemistry, Laboratoire National de Metrologie et d' Essais, 1 Rue Gaston Boissier, 75015 Paris (France); Brewer, Paul J., E-mail: paul.brewer@npl.co.uk [Analytical Science Division, National Physical Laboratory, Teddington, Middlesex TW11 0LW (United Kingdom); Brown, Richard J.C. [Analytical Science Division, National Physical Laboratory, Teddington, Middlesex TW11 0LW (United Kingdom); Fisicaro, Paola [Department of Biomedical and Inorganic Chemistry, Laboratoire National de Metrologie et d' Essais, 1 Rue Gaston Boissier, 75015 Paris (France)

    2011-11-30

    The influence of several parameters in the preparation procedure of thermal-electrolytic Ag/AgCl electrodes on the resulting electrode performance has been studied. In particular, we report the effect on electrode performance of subtle variations in the preparation of silver oxide paste used for electrode manufacture, in thermal annealing conditions employed and in the procedure for electrochemically converting a fraction of the electrode from silver to silver chloride. Scanning electron microscopy and electrochemical impedance spectroscopy have been used to study the characteristics of the electrodes produced. This work reveals a correlation between the electrochemical behaviour and surface physical characteristics - in particular electrode porosity. The outputs of this study have positive implications for improving the accuracy and comparability of primary pH measurement.

  4. Nanoregions of rocksalt AgI in AgBr microcrystals

    Science.gov (United States)

    Marchetti, A. P.; Hansen, J. C.; Chen, S.; Irving, M.; Baetzold, R.; Sever, B. R.

    2004-03-01

    Rapid addition of iodide causes the optically excited low-temperature donor acceptor luminescence from AgBr1-xIx (xelectron microscopy (TEM) and computational methods have been applied to determine the structure responsible for this behavior. The data generated indicated that nanoregions of fcc rocksalt AgBr1-xIx (x>0.9) are integrated into these microcrystals. These nanoregions of high iodide are strained and can engender the characteristic dislocations observed in the TEMs. Some dislocation features are removed by annealing (200 °C). Heating also causes the luminescence and band-gap energy to return to the values characteristic of the crystals with a homogeneous distribution of iodide.

  5. Site-Selective Carving and Co-Deposition: Transformation of Ag Nanocubes into Concave Nanocrystals Encased by Au-Ag Alloy Frames.

    Science.gov (United States)

    Ahn, Jaewan; Wang, Daniel; Ding, Yong; Zhang, Jiawei; Qin, Dong

    2018-01-23

    We report a facile synthesis of Ag nanocubes with concave side faces and Au-Ag alloy frames, namely Ag@Au-Ag concave nanocrystals, by titrating HAuCl 4 solution into an aqueous mixture of Ag nanocubes, ascorbic acid (H 2 Asc), NaOH, and cetyltrimethylammonium chloride (CTAC) at an initial pH of 11.6 under ambient conditions. Different from all previous studies involving poly(vinylpyrrolidine), the use of CTAC at a sufficiently high concentration plays an essential role in carving away Ag atoms from the side faces through galvanic replacement. Concurrent co-deposition of Au and Ag atoms via chemical reduction at orthogonal sites on the surface of Ag nanocubes leads to the generation of Ag@Au-Ag concave nanocrystals with well-defined and controllable structures. Specifically, in the presence of CTAC-derived Cl - ions, the titrated HAuCl 4 is maintained in the AuCl 4 - species, enabling its galvanic replacement with the Ag atoms located on the side faces of nanocubes. The released Ag + ions can be retained in the soluble form of AgCl 2 - by complexing with the Cl - ions. Both the AuCl 4 - and AgCl 2 - in the solution are then reduced by ascorbate monoanion, a product of the neutralization reaction between H 2 Asc and NaOH, to Au and Ag atoms for their preferential co-deposition onto the edges and corners of the Ag nanocubes. Compared with Ag nanocubes, the Ag@Au-Ag concave nanocrystals exhibit much stronger SERS activity at an excitation of 785 nm, making it feasible to monitor the Au-catalyzed reduction of 4-nitrothiophenol by NaBH 4 in situ. When the Ag cores are removed, the concave nanocrystals evolve into Au-Ag nanoframes with controllable ridge thicknesses.

  6. No response to hepatitis B vaccine in infants born to HBsAg(+) mothers is associated to the transplacental transfer of HBsAg.

    Science.gov (United States)

    Wang, Jing; He, Yingli; Jin, Dongfang; Liu, Jinfeng; Zheng, Jie; Yuan, Ningxia; Bai, Yun; Yan, Taotao; Yang, Yuan; Liu, Yong; Zhang, Shulin; Zhao, Yingren; Chen, Tianyan

    2017-08-01

    No or low hepatitis B (HB) vaccine response is more frequent in infants from HBsAg(+) mothers than those from HBsAg(-). Our previous study found temporary positivity of HBsAg in infants from HBsAg(+) mothers. In this study, we hypothesized that HBsAg in infant blunt immune response to standard hepatitis B vaccination. A total of 328 consecutive HBsAg(+) mothers and their offspring were enrolled. Blood samples were taken from mothers and their infants and quantified for HBsAg, anti-HBs titer and HBV DNA load concentration; Placenta samples were collected to stain for HBsAg. First, 6.7% infants (22/328) showed anti-HBs titer lower than 10 mIU/mL after HB vaccination (non-response to HB vaccine). HBsAg(+) newborns showed higher risk of non-response than HBsAg(-) infants (13.0% versus 5.0%, p = 0.016). Infants from high HBsAg titer mothers displayed higher risk of HBsAg positivity at birth than those from low titer mothers (45.3% versus 2.8%, p < 0.001). HBsAg titer in mothers of HBsAg(+) newborns was much higher than mothers of HBsAg(-) newborns (p < 0.001). All those data supported HBsAg can be transferred through placenta. Our hypothesis was further reinforced by immunostaining with specific antibody against HBsAg, a substantial higher prevalence (87.5% versus 30.8%, p = 0.024) and stronger immunostaining (p = 0.008) was demonstrated in HBsAg(+) group comparing with placenta of the HBsAg(-) group. No response to HB vaccine in infants of HBsAg(+) mothers was associated to the transplacental transfer of HBsAg.

  7. Preparation and characterization of SrTiO3-Ag/AgCl hybrid composite with promoted plasmonic visible light excited photocatalysis

    Science.gov (United States)

    Shen, Hongfang; Wei, Hongyu; Pan, Zhidong; Lu, Youjun; Wang, Yanmin

    2017-11-01

    An efficient visible light responsive photocatalyst hybrid composite SrTiO3-Ag/AgCl was prepared via hydrothermal method and subsequent chemical precipitation/in-situ photoreduction at room temperature. The phase structure, morphology, element mapping distribution, surface chemical composition, specific surface area, and light absorption ability of the samples were characterized. The transient photocurrent response and electrochemical impedance under visible light illumination indicate that SrTiO3-Ag/AgCl composite possesses a more intense photocurrent response and a smaller surface resistance than SrTiO3 and Ag/AgCl due to the lower electrons-holes recombination. SrTiO3-Ag/AgCl composite exhibits an obvious promoted visible light excited photovcatalytic activity in photodecomposition of methyl orange, rhodamine B and phenol, compared to SrTiO3 and Ag/AgCl. A possible photocatalytic mechanism was proposed, indicating that the synergistic effect of surface plasmonic resonance of Ag0 photoreduced from AgCl and decreased the recombination rate of photogenerated carriers through transferring electrons from the surface of Ag0 to SrTiO3 promote the excellent photocatalytic activity of SrTiO3-Ag/AgCl. Moreover, the photodegradation reaction process of methyl orange, rhodamine B and phenol on SrTiO3-Ag/AgCl follows the pseudo-first-order kinetic model, and the reaction rate constants are approximately 10 times greater than those on Ag/AgCl. Four-recycling photocatalytic process of methyl orange on SrTiO3-Ag/AgCl also indicates a superior stability and durability.

  8. Ion beam mixing in Ag-Pd alloys

    International Nuclear Information System (INIS)

    Klatt, J.L.; Averback, R.S.; Peak, D.

    1989-01-01

    Ion beam mixing during 750 keV Kr + irradiation at 80 K was measured on a series of Ag-Pd alloys using Au marker atoms. The mixing in pure Ag was the greatest and it decreased monotonically with increasing Pd content, being a factor of 10 higher in pure Ag than in pure Pd. This large difference in mixing cannot be explained by the difference in cohesion energy between Ag and Pd in the thermodynamic model of ion beam mixing proposed by Johnson et al. [W. L. Johnson, Y. T. Cheng, M. Van Rossum, and M-A. Nicolet, Nucl. Instrum. Methods B 7/8, 657 (1985)]. An alternative model based on local melting in the cascade is shown to account for the ion beam mixing results in Ag and Pd

  9. Transfer of radiosilver (Ag-110m) in the food chain

    International Nuclear Information System (INIS)

    Handl, J.

    1993-01-01

    Following the Chernobyl accident, Ag-110m (Half-life: 250 days) has been reported in some important components of the terrestrial environment such as pasture vegetation and pasture animals. A review of the available literature showed that the behaviour of silver in the terrestrial environment is relatively poorly understood. A research programme to study the behaviour of Ag-110m along the soil - vegetation - animal - man pathway was therefore initiated. In an in-vivo study in cooperation with the Institute of Animal Husbandry and Animal Behaviour, Mariensee with pigs the transfer of Ag-110m from feed to animal tissues was followed for 30 days using Ag-110m labelled meat as feed. The observation has not yet been finished. After the evaluation of all measurements, transfer factors animal tissue/feed as well as the biological half-life for Ag-110m in animal organs will be determined. (orig./BBR)

  10. Antifungal Applications of Ag-Decorated Hydroxyapatite Nanoparticles

    Directory of Open Access Journals (Sweden)

    C. A. Zamperini

    2013-01-01

    Full Text Available Pure hydroxyapatite (HA and hydroxyapatite decorated with silver (HA@Ag nanoparticles were synthesized and characterized. The antifungal effect of HA@Ag nanoparticles in a distilled water solution was evaluated against Candida albicans. The origin of the antifungal activity of the HA@Ag is also discussed. The results obtained showed that the HA nanorod morphology remained the same with Ag ions decorations on the HA structure which were deposited in the form of nanospheres. Interaction where occurred between the structure and its defect density variation in the interfacial HA@Ag and intrafacial HA region with the fungal medium resulted in antifungal activity. The reaction mechanisms involved oxygen and water adsorption which formed an active complex cluster. The decomposition and desorption of the final products as well as the electron/hole recombination process have an important role in fungicidal effects.

  11. Plasmonic properties of Ag nanoclusters in various polymer matrices

    International Nuclear Information System (INIS)

    Takele, H; Greve, H; Pochstein, C; Zaporojtchenko, V; Faupel, F

    2006-01-01

    Nanocomposite films containing Ag nanoparticles embedded in a polymer matrix of Teflon AF, poly(methyl methacrylate) (PMMA) and Nylon 6 were prepared by vapour phase co-deposition in high vacuum. A large variation of the particle plasmon resonance frequency in the visible region was obtained by increasing the Ag volume fraction from 4-80%. The metal volume fraction was measured by energy dispersive x-ray spectrometry (EDX) and the film thickness was measured by surface profilometry. The position, width and strength of the plasmon resonance depend strongly on the metal filling factor, cluster size and interparticle distance. The microstructure of the nanocomposites (shape, size, size distribution and interparticle separation of metal clusters) was determined by transmission electron microscopy. The effect of the surrounding dielectric medium on the optical properties of nanocomposites was investigated by comparing the Teflon AF/Ag, PMMA/Ag and Nylon/Ag composites

  12. Synthesis, characterization and SERS activity of Au-Ag nanorods

    Science.gov (United States)

    Philip, Daizy; Gopchandran, K. G.; Unni, C.; Nissamudeen, K. M.

    2008-09-01

    The formation mechanism and morphology of Au-Ag bimetallic colloidal nanoparticles depend on the composition. Ag coated Au colloidal nanoparticles have been prepared by deposition of Ag through chemical reduction on performed Au colloid. The composition of the Au 100- x-Ag x particles was varied from x = 0 to 50. The obtained colloids were characterized by UV-vis spectroscopy and transmission electron microscopy (TEM). The Au 80-Ag 20 colloid consists of alloy nanorods with dimension of 25 nm × 100 nm. The activity of these nanorods in surface enhanced Raman spectroscopy (SERS) was checked by using sodium salicylate as an adsorbate probe. Intense SERS bands are observed indicating its usefulness as a SERS substrate in near infrared (NIR) laser excitation.

  13. Glass formation in AgI:Ag2O:V2O5 and AgI:Ag2O:(V2O5+B2O3) systems

    International Nuclear Information System (INIS)

    Kaushik, R.; Hariharan, K.

    1988-01-01

    Transport properties of glasses in the system AgI:Ag 2 O: V 2 O 5 and AgI:Ag 2 O: (V 2 O 5 +B 2 O 3 ) have ben investigated. It was found that, at high AgI concentrations, the addition of another glass former (B 2 O 3 ) did not improve the conduction characteristics of the pure vanadate glasses, the best conducting composition of which had ambient temperature, ionic conductivity comparable to that of conventional liquid electrolytes. The highest conducting composition was used as an electrolyte in the study of silver solid state cells. The discharge characteristics of different cells fabricated with the glassy electrolyte, have been compared with those having the best conducting polycrystalline ompositions as electrolytes. 11 refs.; 4 figs.; 1 table

  14. Positron annihilation studies of vacancies in Ag-Zn alloys

    International Nuclear Information System (INIS)

    Chabik, S.

    1982-01-01

    The temperature dependence of annihilation rate, F(T), at the peak of angular correlation curve has been measured for Ag-29.2%at Zn and Ag-50%at Zn alloys. By applying the trapping model the vacancy formation energy for Ag-29.2%at Zn alloy has been found to be equal to 0.94+-0.06 eV. It has been found that the course of the F(T) curve for Ag-50%at Zn depends on the phase composition and thermal history of the investigated sample. For alloys containing not more than 50%at Zn, the concentration dependence of the vacancy formation energy for Ag-Zn alloys is very similar to that for Cu-Zn alloys. (Auth.)

  15. Chemical ordering in magic-size Ag-Pd nanoparticles.

    Science.gov (United States)

    Bochicchio, Davide; Ferrando, Riccardo; Novakovic, Rada; Panizon, Emanuele; Rossi, Giulia

    2014-12-28

    Chemical ordering in magic-size Ag-Pd nanoalloys is studied by means of global optimization searches within an atomistic potential developed on the basis of density functional theory calculations. Ag-rich, intermediate and Pd-rich compositions are considered for fcc truncated octahedral, icosahedral and decahedral geometric structures. Besides a surface enrichment in Ag, we find a significant subsurface enrichment in Pd, which persists to quite high temperatures as verified by Monte Carlo simulations. This subsurface Pd enrichment is stronger in nanoparticles than in bulk systems and is rationalized in terms of the energetics of the inclusion of a single Pd impurity in an Ag host nanoparticle. Our results can be relevant to the understanding of the catalytic activity of Ag-Pd nanoparticles in those reactions in which subsurface sites play a role.

  16. Excitation functions and isomeric ratios for the isomeric pair sup(106m)Ag and sup(106g)Ag in the 107Ag (d,t) reaction

    International Nuclear Information System (INIS)

    Lalli, M.E.; Wasilevsky de Lammirato, C.; Herreros, O.R.; Nassiff, S.J.

    1976-09-01

    Excitation functions and isomeric cross section ratios have been measured for the 107 Ag (d,t), reaction in which the isomeric pair sup(106m/106g)Ag is produced. Thick-target yields have been determined for different irradiation times and as a function of deuteron energy. Stacked silver foils with aluminium foils as monitors were bombarded with deuterons up to 27 MeV and the activities of products measured with a calibrated Ge(Li) counter. (author) [es

  17. Thermodynamic Properties of AgIn2Te3I and AgIn2Te3Br, Determined by EMF Method

    Science.gov (United States)

    Moroz, M. V.; Prokhorenko, M. V.; Prokhorenko, S. V.; Yatskov, M. V.; Reshetnyak, O. V.

    2018-01-01

    Differential thermal analysis (DTA), X-ray diffraction (XRD), and electromotive force (EMF) are used to triangulate Ag-In-Te-I(Br) systems in the vicinity of compounds AgIn2Te3I and AgIn2Te3Br. The three-dimensional position of the AgIn2Te3I-InTe-Ag2Te-AgI and AgIn2Te3Br-InTe-Ag3TeBr phase areas with respect to the figurative points of silver is used to create equations of potential-determining chemical reactions. The potential-determining reactions are conducted in (-)C|Ag|Ag3GeS3I(Br) glass|D|C(+) electrochemical cells (ECCs), where C stands for inert (graphite) electrodes, Ag and D are ECC electrodes (D denotes alloys of one-, three-, and four-phase areas), and Ag3GeS3I and Ag3GeS3Br glasses are membranes with purely ionic Ag+ conductivity. Linear parts of the temperature dependences of the cell EMFs are used to calculate the standard integral thermodynamic functions of saturated solid solutions based on AgIn2Te3I and AgIn2Te3Br, and the relative partial thermodynamic functions of silver in the stoichiometric quaternary compounds.

  18. Dynamical and passive characteristics of the Ag/TlGaSeS/Ag RF resonators

    Energy Technology Data Exchange (ETDEWEB)

    Qasrawi, A.F. [Group of Physics, Faculty of Engineering, Atilim University, 06836 Ankara (Turkey); Department of Physics, Arab-American University, Jenin, West Bank, Palestine; Elayyat, Shadia M.S. (Department of Physics, Arab-American University, Jenin, West Bank, Palestine); Gasanly, N.M. [Department of Physics, Middle East Technical University, 06800 Ankara (Turkey)

    2012-06-15

    Ag contacts on the surface of the TlGaSeS single crystals are observed to exhibit Schottky characteristics. The ideality factor of the Ag/ TlGaSeS/Ag device decreased from 5.2 to 1.3 by the reduction of series resistance effect on the I-V characteristics. Cheung's model analysis revealed a series resistance and barrier height of 40.6 K{omega} and 0.32 V, respectively. The device was run on the passive mode by injection with an alternating ac signal of variable frequency in the frequency range of 0-120 MHz and recoding the device capacitance. Several resonance-antiresonance positions in the range of 27-350 KHz were observed. The tangent loss factor of the passive device was observed to decrease with increasing frequency. It exhibited a very low loss value of the order of 10{sup -5} at 120 MHz. Such property is a characteristic of high performance tunable device being suitable as processor clock controller. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  19. Anti-corrosive and anti-microbial properties of nanocrystalline Ni-Ag coatings

    Energy Technology Data Exchange (ETDEWEB)

    Raghupathy, Y.; Natarajan, K.A.; Srivastava, Chandan, E-mail: csrivastava@materials.iisc.ernet.in

    2016-04-15

    Graphical abstract: - Highlights: • Electrodeposition yielded phase-segregated, nanocrystalline Ni-Ag coatings. • Ni-Ag alloys exhibited smaller Ni crystals compared to pure Ni. • Ultra fine Ni grains of size 12–14 nm favoured Ni-Ag solid solution. • Nanocrystalline Ag resisted bio-fouling by Sulphate Reducing bacteria. • Ni-Ag outperformed pure Ni in corrosion and bio-corrosion tests. - Abstract: Anti-corrosive and anti-bacterial properties of electrodeposited nanocrystalline Ni-Ag coatings are illustrated. Pure Ni, Ni-7 at.% Ag, & Ni-14 at.% Ag coatings were electrodeposited on Cu substrate. Coating consisted of Ni-rich and Ag-rich solid solution phases. With increase in the Ag content, the corrosion resistance of the Ni-Ag coating initially increased and then decreased. The initial increase was due to the Ni-Ag solid solution. The subsequent decrease was due to the increased galvanic coupling between the Ag-rich and Ni-rich phases. For all Ag contents, the corrosion resistance of the Ni-Ag coating was higher than the pure Ni coating. Exposure to Sulphate Reducing Bacteria (SRB) revealed that the extent of bio-fouling decreased with increase in the Ag content. After 2 month exposure to SRB, the Ni-Ag coatings demonstrated less loss in corrosion resistance (58% for Ni-7 at.% Ag and 20% for Ni-14 at.% Ag) when compared pure Ni coating (115%).

  20. Anti-corrosive and anti-microbial properties of nanocrystalline Ni-Ag coatings

    International Nuclear Information System (INIS)

    Raghupathy, Y.; Natarajan, K.A.; Srivastava, Chandan

    2016-01-01

    Graphical abstract: - Highlights: • Electrodeposition yielded phase-segregated, nanocrystalline Ni-Ag coatings. • Ni-Ag alloys exhibited smaller Ni crystals compared to pure Ni. • Ultra fine Ni grains of size 12–14 nm favoured Ni-Ag solid solution. • Nanocrystalline Ag resisted bio-fouling by Sulphate Reducing bacteria. • Ni-Ag outperformed pure Ni in corrosion and bio-corrosion tests. - Abstract: Anti-corrosive and anti-bacterial properties of electrodeposited nanocrystalline Ni-Ag coatings are illustrated. Pure Ni, Ni-7 at.% Ag, & Ni-14 at.% Ag coatings were electrodeposited on Cu substrate. Coating consisted of Ni-rich and Ag-rich solid solution phases. With increase in the Ag content, the corrosion resistance of the Ni-Ag coating initially increased and then decreased. The initial increase was due to the Ni-Ag solid solution. The subsequent decrease was due to the increased galvanic coupling between the Ag-rich and Ni-rich phases. For all Ag contents, the corrosion resistance of the Ni-Ag coating was higher than the pure Ni coating. Exposure to Sulphate Reducing Bacteria (SRB) revealed that the extent of bio-fouling decreased with increase in the Ag content. After 2 month exposure to SRB, the Ni-Ag coatings demonstrated less loss in corrosion resistance (58% for Ni-7 at.% Ag and 20% for Ni-14 at.% Ag) when compared pure Ni coating (115%).

  1. Determination of Chloride Content in Cementitious Materials : From Fundamental Aspects to Application of Ag/AgCl Chloride Sensors

    NARCIS (Netherlands)

    Pargar, F.; Koleva, D.A.; van Breugel, K.

    2017-01-01

    This paper reports on the advantages and drawbacks of available test methods for the determination of chloride content in cementitious materials in general, and the application of Ag/AgCl chloride sensors in particular. The main factors that affect the reliability of a chloride sensor are presented.

  2. Evaluation of Ag/AgCI sensors for in-situ monitoring of freee chloride concentration in reinforced concrete structures

    NARCIS (Netherlands)

    Pargar, F.; Koleva, D.A.; Copuroglu, O.; Koenders, E.A.B.; van Breugel, K.

    2014-01-01

    The level of free chloride concentration in reinforced concrete structures essentially determines the onset of steel corrosion initiation and further propagation. One of the well-known methods for monitoring free chloride concentration is using silver/silver chloride electrodes (Ag/AgCl). These

  3. Durable antibacterial Ag/polyacrylonitrile (Ag/PAN) hybrid nanofibers prepared by atmospheric plasma treatment and electrospinning

    Science.gov (United States)

    Durable antibacterial Ag/polyacrylonitrile (Ag/PAN) hybrid nanofibers were prepared by atmospheric plasma treatment and electrospinning. Atmospheric helium plasma treatment was first used to reduce the silver nitrate precursor in pre-electrospinning solutions into metallic silver nanoparticles, foll...

  4. Enhanced adsorption and catalytic oxidation of ciprofloxacin by an Ag/AgCl@N-doped activated carbon composite

    Science.gov (United States)

    Nekouei, Farzin; Nekouei, Shahram; Noorizadeh, Hossein

    2018-03-01

    In this study, we synthesized a new nanocomposite catalyst comprising Ag/AgCl@N-doped activated carbon (Ag/AgCl@N-AC) and demonstrated its high efficiency during the enhanced adsorptive removal and catalytic oxidation of ciprofloxacin (CIP) with peroxymonosulfate (PMS) and persulfate (PS) as oxidants in aqueous solution. The efficiency of the new nanocomposite was compared with those of both pristine AC and N-AC under the same conditions. Furthermore, the effects of oxidants on the catalytic oxidation of CIP were assessed using PMS and PS. We found that the degradation efficiency of CIP with Ag/AgCl@N-AC was higher when using PS as an oxidant, whereas the use of PMS obtained relatively better results with both AC and N-AC. The adsorption processes for AC, N-AC, and Ag/AgCl@N-AC were dominated not only by electrostatic attraction but also by π-π interactions, which had higher impacts on the adsorption processes than the specific surface area.

  5. Screening different Brassica spp. germplasm for resistance to Rhizoctonia solani AG-2-1 and AG-8

    Science.gov (United States)

    Poor stands of canola seedlings in Pacific Northwest (PNW) have been associated with Rhizoctonia solani AG-2-1 and AG-8. A total of eighty five genotypes of Brassica napus, B. rapa, B. carinata, B. juncea and Sinapsis alba were evaluated in the growth chamber for their resistance to both R. solani A...

  6. Structure and properties of rapidly quenched ionic conductors belonging to AgI-Ag2MoO4 family

    International Nuclear Information System (INIS)

    Wisniewski, Z; Wisniewski, R; Wilczynska, T; Zasada, D; Dziduszko, R

    2009-01-01

    AgI-AgMoO 4 materials were obtained by rapid quenching method. Their structures were investigated by X-ray spectroscopy and Scanning Electron Microscopy (SEM). Additionally the compressibility of the amorphous samples was investigated. A relation between electrical and mechanical properties was suggested. It was also found that short range order of amorphous samples changes with composition.

  7. Synthesis, Crystal Structure, and Physical Properties of New Layered Oxychalcogenide La2O2Bi3AgS6

    Science.gov (United States)

    Hijikata, Yudai; Abe, Tomohiro; Moriyoshi, Chikako; Kuroiwa, Yoshihiro; Goto, Yosuke; Miura, Akira; Tadanaga, Kiyoharu; Wang, Yongming; Miura, Osuke; Mizuguchi, Yoshikazu

    2017-12-01

    We have synthesized a new layered oxychalcogenide La2O2Bi3AgS6. From synchrotron X-ray diffraction and Rietveld refinement, the crystal structure of La2O2Bi3AgS6 was refined using a model of the P4/nmm space group with a = 4.0644(1) Å and c = 19.412(1) Å, which is similar to the related compound LaOBiPbS3, while the interlayer bonds (M2-S1 bonds) are apparently shorter in La2O2Bi3AgS6. The tunneling electron microscopy (TEM) image confirmed the lattice constant derived from Rietveld refinement (c ˜ 20 Å). The electrical resistivity and Seebeck coefficient suggested that the electronic states of La2O2Bi3AgS6 are more metallic than those of LaOBiS2 and LaOBiPbS3. The insertion of a rock-salt-type chalcogenide into the van der Waals gap of BiS2-based layered compounds, such as LaOBiS2, will be a useful strategy for designing new layered functional materials in the layered chalcogenide family.

  8. Precipitation of Ag{sub 2}Te in the thermoelectric material AgSbTe{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Sugar, Joshua D. [Materials Physics Department, Sandia National Laboratories, Livermore, CA (United States)], E-mail: jdsugar@sandia.gov; Medlin, Douglas L. [Materials Physics Department, Sandia National Laboratories, Livermore, CA (United States)

    2009-06-10

    The microstructure of AgSbTe{sub 2}, prepared by solidification, is investigated using electron microscopy. During solidification and thermal treatment, the material separates into a two-phase mixture of a rocksalt phase, which is Ag{sub 22}Sb{sub 28}Te{sub 50}, and silver telluride, Ag{sub 2}Te. Ag{sub 2}Te formation results either from eutectic solidification (large lamellar structures), or by solid-state precipitation (fine-scale particles). The crystal structure of the AgSbTe{sub 2} phase determined by electron diffraction is consistent with a rocksalt structure that has a disordered cation sublattice. A preferred crystallographic orientation relationship at the interface between the matrix and the low-temperature monoclinic Ag{sub 2}Te phase is defined and discussed. This orientation relationship is observed for both second-phase morphologies. In both cases, the orientation relationship originates from a topotactic (cube-on-cube) alignment of the Te sublattices in the initially cubic Ag{sub 2}Te and the matrix at elevated temperature. This Te sublattice alignment is retained as the Ag{sub 2}Te undergoes a cubic-to-monoclinic transformation during cooling. This orientation relationship is observed for both second-phase morphologies.

  9. One-step synthesis of Ag2S/Ag@MoS2 nanocomposites for SERS and photocatalytic applications

    Science.gov (United States)

    Wu, Jie; Zhou, Yifeng; Nie, Wangyan; Chen, Pengpeng

    2018-01-01

    This paper reported a one-step synthesis of Ag2S/Ag@MoS2 nanocomposites and its applications in the surface-enhanced Raman scattering (SERS) detection and photocatalytic degradation of organic pollutants. The nanocomposites were well characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD), cyclic voltammograms (CV), the Brunauer-Emmett-Teller (BET), and Fourier transforms infrared spectra (FTIR). The AgNPs were uniformly dispersed on the MoS2 nanosheets and the particle size of the AgNPs was about 10-30 nm. These Ag2S/Ag@MoS2 nanocomposites offered sensitive SERS signals for the detection of R6G with the limit of detections as low as 10-10 M. The photocatalytic activity of the composite catalyst was studied by the degradation of methylene blue (MB) dye under light illumination. The apparent rate constant of MB degradation for the obtained catalyst could reach 6.6 × 10-2 min-1, indicating that the novel Ag2S/Ag@MoS2 nanocomposites can be explored for organic pollutant's detection and degradation.

  10. 78 FR 13931 - Designation of Iyad ag Ghali, Also Known as Iyad ag Ghaly, as a Specially Designated Global...

    Science.gov (United States)

    2013-03-01

    ... determined to be subject to the Order who might have a constitutional presence in the United States would... subject to this determination who might have a constitutional presence in the United States, because to do... DEPARTMENT OF STATE [Public Notice 8211] Designation of Iyad ag Ghali, Also Known as Iyad ag Ghaly...

  11. Mg-controlled formation of Mg–Ag co-clusters in initial aged Al–Cu–Mg–Ag alloys

    International Nuclear Information System (INIS)

    Bai, Song; Liu, Zhiyi; Zhou, Xuanwei; Xia, Peng; Zeng, Sumin

    2014-01-01

    Highlights: • The strongest age-hardening response was found in 0.81Mg alloy. • Quantitative APT study showed strong dependence of Mg–Ag co-clustering on Mg content. • A critical Mg content related to the greatest Mg–Ag co-clustering was revealed. • The evolution from Mg–Ag co-clusters to Ω phase was accelerated in 1.18Mg alloy. - Abstract: The effect of Mg variations on the number density, solute concentrations and sizes of Mg–Ag co-clusters at the early aging stage, as well as the age-hardening response of different Al–Cu–Mg–Ag alloys, was well investigated by a combination of Vickers hardness measurement, transmission electron microscopy (TEM) and atom probe tomography (APT). The strongest age-hardening response at 165 °C was found in 0.81Mg alloy, accompanied by the highest nucleation rate of Mg–Ag co-clusters after aging for 0.5 h. However, the least response was revealed in 0.39Mg alloy. By quantitative APT analysis, the observed trend in the total number density of Mg–Ag co-clusters suggested the following order: 0.81Mg alloy > 0.39Mg alloy > 1.18Mg alloy. This parabolic change in the total number density of Mg–Ag co-clusters with increasing Mg highlighted the existence of a critical Mg content, which contributed to the greatest nucleation kinetics of Mg–Ag co-clusters. As Mg increased from 0.39 to 0.81, the formation of small Mg–Ag co-clusters was significantly promoted, whereas the number density of large Mg–Ag co-clusters almost remained constant. Moreover, the remarkable enrichment of Cu within Mg–Ag co-clusters indicated that the accelerated evolution from Mg–Ag co-clusters to Ω phase was responsible for the lowest number density of Mg–Ag co-clusters in 1.18Mg alloy after aging at 165 °C for 0.5 h

  12. Microwave-assisted solvothermal synthesis of flower-like Ag/AgBr/BiOBr microspheres and their high efficient photocatalytic degradation for p-nitrophenol

    International Nuclear Information System (INIS)

    Li, Tingting; Luo, Shenglian; Yang, Lixia

    2013-01-01

    Flower-like Ag/AgBr/BiOBr microspheres were successfully fabricated by the approach of microwave-assisted solvothermal and in situ photo-assisted reduction. A reactive ionic liquid 1-hexadecyl-3-methylimidazolium bromide ([C 16 mim]Br) was employed as Br source in the presence of surfactant polyvinylpyrrolidone (PVP). The photocatalytic activity of Ag/AgBr/BiOBr towards the decomposition of p-nitrophenol under visible light irradiation was evaluated. The results indicated that Ag/AgBr/BiOBr showed enhanced photocatalytic activity towards p-nitrophenol, comparing with P25, BiOBr and Ag/AgBr. More than 96% of p-nitrophenol was decomposed in 3.5 h under visible-light irradation. The excellent photocatalytic activity of flower-like Ag/AgBr/BiOBr microspheres can be attributed to the large specific surface area, strong visible-light absorption, suitable energy band structure and surface plasmon resonance effect of Ag nanoparticles. The possible photocatalytic mechanism was proposed based on the active species test and band gap structure analysis. - Graphical abstract: The photocatalytic reaction mechanisms of the as-prepared Ag/AgBr/BiOBr. Display Omitted - Highlights: • Successful synthesis of flower-like Ag/AgBr/BiOBr microspheres. • The Ag/AgBr/BiOBr showed much higher photocatalytic activity towards p-nitrophenol as compared to BiOBr and Ag/AgBr. • The reasons for the excellent photocatalytic activity are the large specific surface area, strong visible-light absorption and surface plasmon resonance effect of Ag nanoparticles. • The O 2 · − , Br 0 and photogenerated h + play key roles in the photocatalytic degradation process

  13. Differential Phytotoxic Impact of Plant Mediated Silver Nanoparticles (AgNPs and Silver Nitrate (AgNO3 on Brassica sp.

    Directory of Open Access Journals (Sweden)

    Kanchan Vishwakarma

    2017-10-01

    Full Text Available Continuous formation and utilization of nanoparticles (NPs have resulted into significant discharge of nanosized particles into the environment. NPs find applications in numerous products and agriculture sector, and gaining importance in recent years. In the present study, silver nanoparticles (AgNPs were biosynthesized from silver nitrate (AgNO3 by green synthesis approach using Aloe vera extract. Mustard (Brassica sp. seedlings were grown hydroponically and toxicity of both AgNP and AgNO3 (as ionic Ag+ was assessed at various concentrations (1 and 3 mM by analyzing shoot and root length, fresh mass, protein content, photosynthetic pigments and performance, cell viability, oxidative damage, DNA degradation and enzyme activities. The results revealed that both AgNPs and AgNO3 declined growth of Brassica seedlings due to enhanced accumulation of AgNPs and AgNO3 that subsequently caused severe inhibition in photosynthesis. Further, the results showed that both AgNPs and AgNO3 induced oxidative stress as indicated by histochemical staining of superoxide radical and hydrogen peroxide that was manifested in terms of DNA degradation and cell death. Activities of antioxidants, i.e., ascorbate peroxidase (APX and catalase (CAT were inhibited by AgNPs and AgNO3. Interestingly, damaging impact of AgNPs was lesser than AgNO3 on Brassica seedlings which was due to lesser accumulation of AgNPs and better activities of APX and CAT, which resulted in lesser oxidative stress, DNA degradation and cell death. The results of the present study showed differential impact of AgNPs and AgNO3 on Brassica seedlings, their mode of action, and reasons for their differential impact. The results of the present study could be implied in toxicological research for designing strategies to reduce adverse impact of AgNPs and AgNO3 on crop plants.

  14. Differential Phytotoxic Impact of Plant Mediated Silver Nanoparticles (AgNPs) and Silver Nitrate (AgNO3) on Brassica sp.

    Science.gov (United States)

    Vishwakarma, Kanchan; Shweta; Upadhyay, Neha; Singh, Jaspreet; Liu, Shiliang; Singh, Vijay P; Prasad, Sheo M; Chauhan, Devendra K; Tripathi, Durgesh K; Sharma, Shivesh

    2017-01-01

    Continuous formation and utilization of nanoparticles (NPs) have resulted into significant discharge of nanosized particles into the environment. NPs find applications in numerous products and agriculture sector, and gaining importance in recent years. In the present study, silver nanoparticles (AgNPs) were biosynthesized from silver nitrate (AgNO 3 ) by green synthesis approach using Aloe vera extract. Mustard ( Brassica sp.) seedlings were grown hydroponically and toxicity of both AgNP and AgNO 3 (as ionic Ag + ) was assessed at various concentrations (1 and 3 mM) by analyzing shoot and root length, fresh mass, protein content, photosynthetic pigments and performance, cell viability, oxidative damage, DNA degradation and enzyme activities. The results revealed that both AgNPs and AgNO 3 declined growth of Brassica seedlings due to enhanced accumulation of AgNPs and AgNO 3 that subsequently caused severe inhibition in photosynthesis. Further, the results showed that both AgNPs and AgNO 3 induced oxidative stress as indicated by histochemical staining of superoxide radical and hydrogen peroxide that was manifested in terms of DNA degradation and cell death. Activities of antioxidants, i.e., ascorbate peroxidase (APX) and catalase (CAT) were inhibited by AgNPs and AgNO 3. Interestingly, damaging impact of AgNPs was lesser than AgNO 3 on Brassica seedlings which was due to lesser accumulation of AgNPs and better activities of APX and CAT, which resulted in lesser oxidative stress, DNA degradation and cell death. The results of the present study showed differential impact of AgNPs and AgNO 3 on Brassica seedlings, their mode of action, and reasons for their differential impact. The results of the present study could be implied in toxicological research for designing strategies to reduce adverse impact of AgNPs and AgNO 3 on crop plants.

  15. AgSbSe2 and AgSb(S,Se)2 thin films for photovoltaic applications

    International Nuclear Information System (INIS)

    Garza, J.G.; Shaji, S.; Rodriguez, A.C.; Das Roy, T.K.; Krishnan, B.

    2011-01-01

    Silver antimony selenide (AgSbSe 2 ) thin films were prepared by heating sequentially deposited multilayers of antimony sulphide (Sb 2 S 3 ), silver selenide (Ag 2 Se), selenium (Se) and silver (Ag). Sb 2 S 3 thin film was prepared from a chemical bath containing SbCl 3 and Na 2 S 2 O 3 , Ag 2 Se from a solution containing AgNO 3 and Na 2 SeSO 3 and Se thin films from an acidified solution of Na 2 SeSO 3 , at room temperature on glass substrates. Ag thin film was deposited by thermal evaporation. The annealing temperature was 350 deg. C in vacuum (10 -3 Torr) for 1 h. X-ray diffraction analysis showed that the thin films formed were polycrystalline AgSbSe 2 or AgSb(S,Se) 2 depending on selenium content in the precursor films. Morphology and elemental analysis of these films were done using scanning electron microscopy and energy dispersive X-ray spectroscopy. Optical band gap was evaluated from the UV-visible absorption spectra of these films. Electrical characterizations were done using Hall effect and photocurrent measurements. A photovoltaic structure: glass/ITO/CdS/AgSbSe 2 /Al was formed, in which CdS was deposited by chemical bath deposition. J-V characteristics of this structure showed V oc = 435 mV and J sc = 0.08 mA/cm 2 under illumination using a tungsten halogen lamp. Preparation of a photovoltaic structure using AgSbSe 2 as an absorber material by a non-toxic selenization process is achieved.

  16. Performance evaluation of five types of Ag/AgCl bio-electrodes for cerebral electrical impedance tomography.

    Science.gov (United States)

    Xu, Shiwei; Dai, Meng; Xu, Canhua; Chen, Chaoshuang; Tang, Mengxing; Shi, Xuetao; Dong, Xiuzhen

    2011-07-01

    Electrical impedance tomography (EIT) is an emerging medical imaging technique, which has already been investigated in several clinical applications due to its low-cost, non-invasiveness, non-radioactivity, high temporal resolution, and great sensitivity to impedance changes. One potential use of EIT is to perform long-term continuous imaging monitoring of brain for patients who suffer from severe cerebral diseases. However, this application requires a demanding performance of electrodes because of the characteristics of cerebral EIT measurements. Although Ag/AgCl bio-electrodes are widely used for clinical practices or EIT research at the moment, influences of different types of Ag/AgCl electrodes on cerebral EIT measurements have not been investigated. In this study, five common types of Ag/AgCl bio-electrodes were put into comparison by measuring the forearm and the brain of 10 healthy adult volunteers and evaluating those data in frequency or time domain in terms of contact impedance, uniformity, signal-to-noise ratio, and stability. Results show that Ag/AgCl powder electrode has an overall best performance with as low contact impedance as commercial ECG electrodes (p > 0.05), high SNR (60.3 ± 4.5 dB), better uniformity (coefficient of correlation 0.95 ± 0.03), and greater stability (slope 0.68 ± 0.03). After further improvement in design and instrumentation, Ag/AgCl powder electrode is likely to become the optimal choice for cerebral EIT measurements and provide feasible technical support for further research or application in cerebral EIT.

  17. A Simple Method for the Preparation of TiO2 /Ag-AgCl@Polypyrrole Composite and Its Enhanced Visible-Light Photocatalytic Activity.

    Science.gov (United States)

    Yao, Tongjie; Shi, Lei; Wang, Hao; Wang, Fangxiao; Wu, Jie; Zhang, Xiao; Sun, Jianmin; Cui, Tieyu

    2016-01-01

    A novel and facile method was developed to prepare a visible-light driven TiO2 /Ag-AgCl@polypyrrole (PPy) photocatalyst with Ag-AgCl nanoparticles supported on TiO2 nanofibers and covered by a thin PPy shell. During the synthesis, the PPy shell and Ag-AgCl nanoparticles were prepared simultaneously onto TiO2 nanofibers, which simplified the preparation procedure. In addition, because Ag-AgCl aggregates were fabricated via partly etching the Ag nanoparticles, their size was well controlled at the nanoscale, which was beneficial for improvement of the contact surface area. Compared with reference photocatalysts, the TiO2 /Ag-AgCl@PPy composite exhibited an enhanced photodegradation activity towards rhodamine B under visible-light irradiation. The superior photocatalytic property originated from synergistic effects between TiO2 nanofibers, Ag-AgCl nanoparticles and the PPy shell. Furthermore, the TiO2 /Ag-AgCl@PPy composite could be easily separated and recycled without obvious reduction in activity. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. A study of phase transfer processes of Ag nanoparticles

    Science.gov (United States)

    Li, De-Gang; Chen, Shen-Hao; Zhao, Shi-Yong; Hou, Xian-Ming; Ma, Hou-Yi; Yang, Xue-Geng

    2002-11-01

    With the protection of sodium oleate, Ag nanoparticles are produced through the reduction of AgNO 3 with NaBH 4 in an aqueous solution. The possible mechanism of phase transfer of the Ag nanoparticles was discussed. At a suitable concentration of sodium oleate, after adding NaH 2PO 4, the oleic acid molecule can change its position on the surface of Ag nanoparticles under the effects of water and toluene and become amphipathic. So most of the nanoparticles form a film between water/toluene. For the case of a higher concentration of sodium oleate, excess sodium oleate will form a closed monolayer film on the surface of the Ag nanoparticles. After adding NaH 2PO 4, the oleic acid molecule cannot move on the Ag nanoparticles surface, thus the colloid particles are hydrophobic but not amphipathic. So most of the particles transfer to the organic phase. UV-Vis spectra, TEM and conventional metallographic microscopy are used to characterize the Ag nanoparticles and nanoparticles films.

  19. [Clinical evaluation of a novel HBsAg quantitative assay].

    Science.gov (United States)

    Takagi, Kazumi; Tanaka, Yasuhito; Naganuma, Hatsue; Hiramatsu, Kumiko; Iida, Takayasu; Takasaka, Yoshimitsu; Mizokami, Masashi

    2007-07-01

    The clinical implication of the hepatitis B surface antigen (HBsAg) concentrations in HBV-infected individuals remains unclear. The aim of this study was to evaluate a novel fully automated Chemiluminescence Enzyme Immunoassay (Sysmex HBsAg quantitative assay) by comparative measurements of the reference serum samples versus two independent commercial assays (Lumipulse f or Architect HBsAg QT). Furthermore, clinical usefulness was assessed for monitoring of the serum HBsAg levels during antiviral therapy. A dilution test using 5 reference-serum samples showed linear correlation curve in range from 0.03 to 2,360 IU/ml. The HBsAg was measured in total of 400 serum samples and 99.8% had consistent results between Sysmex and Lumipulse f. Additionally, a positive linear correlation was observed between Sysmex and Architect. To compare the Architect and Sysmex, both methods were applied to quantify the HBsAg in serum samples with different HBV genotypes/subgenotypes, as well as in serum contained HBV vaccine escape mutants (126S, 145R). Correlation between the methods was observed in results for escape mutants and common genotypes (A, B, C) in Japan. Observed during lamivudine therapy, an increase in HBsAg and HBV DNA concentrations preceded the aminotransferase (ALT) elevation associated with drug-resistant HBV variant emergence (breakthrough hepatitis). In conclusion, reliability of the Sysmex HBsAg quantitative assay was confirmed for all HBV genetic variants common in Japan. Monitoring of serum HBsAg concentrations in addition to HBV DNA quantification, is helpful in evaluation of the response to lamivudine treatment and diagnosis of the breakthrough hepatitis.

  20. The AGS Booster high frequency rf system

    International Nuclear Information System (INIS)

    Sanders, R.T.; Cameron, P.; Eng, W.; Goldman, M.A.; Jablonski, E.; Kasha, D.; Keane, J.; McNerney, A.; Meth, M.; Plotkin, M.; Puglisi, M.; Ratti, A.; Spitz, R.

    1991-01-01

    A high level rf system, including a power amplifier and cavity, has been designed and built for the AGS Booster. It covers a frequency range of 2.4 to 4.2 MHz and will be used to accelerate high intensity protons. Low intensity polarized protons and heavy ions, to the 1.5 GeV level. A total accelerating voltage of up to 90 kV will be provided by two cavities, each having two gaps. The internally cross coupled, pushpull cavities are driven by an adjacently located power amplifier. In order to accommodate beam intensities up to 0.75 x 10 13 protons per bunch, a low plate resistance power tetrode is used. The tube anode is magnetically coupled to one of the cavity's two parallel cells. The amplifier is a grounded cathode configuration driven by a remotely located solid-state amplifier. It has been tested in the laboratory at full gap voltage with satisfactory results. 5 refs., 2 figs., 1 tab

  1. Commissioning of the new AGS MMPS transformers

    International Nuclear Information System (INIS)

    Bajon, E.; Badea, V. S.; Bannon, M.; Bonati, R.; Marneris, I. M.; Porqueddu, R.; Roser, T.; Sandberg, J.; Savatteri, S.

    2009-01-01

    The Brookhaven AGS Main Magnet Power Supply (MMPS) is a thyristor control supply rated at 5500 Amps. +/-9000 Volts. The peak magnet power is 50 MWatts. The power supply is fed from a motor/generator manufactured by Siemens. During rectify and invert operation the P Bank power supplies are used. During the flattops the F Bank power supplies are used. The P Bank power supplies are fed from two 23 MVA transformers and the F Bank power supplies are fed from two 5.3 MYA transformers. The fundamental frequency of the F Bank power supplies is 1440 Hz, however the fundamental frequency of the P banks was 720 Hz. It was very important to reduce the ripple during rectify to improve polarized proton operations. For this reason and also because the original transformers were 45 years old we replaced these transformers with new ones and we made the fundamental frequency of both P and F banks 1440 Hz. This paper will highlight the major hurdles that were involved during the installation of the new transformers. It will present waveforms while running at different power levels up to 6MW full load. It will show the transition from the F-Bank power supplies to the P-Banks and also show the improvements in ripple made on the P-Bank power supplies

  2. Superconducting Helical Snake Magnet for the AGS

    CERN Document Server

    Willen, Erich; Escallier, John; Ganetis, George; Ghosh, Arup; Gupta, Ramesh C; Harrison, Michael; Jain, Animesh K; Luccio, Alfredo U; MacKay, William W; Marone, Andrew; Muratore, Joseph F; Okamura, Masahiro; Plate, Stephen R; Roser, Thomas; Tsoupas, Nicholaos; Wanderer, Peter

    2005-01-01

    A superconducting helical magnet has been built for polarized proton acceleration in the Brookhaven AGS. This "partial Snake" magnet will help to reduce the loss of polarization of the beam due to machine resonances. It is a 3 T magnet some 1940 mm in magnetic length in which the dipole field rotates with a pitch of 0.2053 degrees/mm for 1154 mm in the center and a pitch of 0.3920 degrees/mm for 393 mm in each end. The coil cross-section is made of two slotted cylinders containing superconductor. In order to minimize residual offsets and deflections of the beam on its orbit through the Snake, a careful balancing of the coil parameters was necessary. In addition to the main helical coils, a solenoid winding was built on the cold bore tube inside the main coils to compensate for the axial component of the field that is experienced by the beam when it is off-axis in this helical magnet. Also, two dipole corrector magnets were placed on the same tube with the solenoid. A low heat leak cryostat was built so that t...

  3. Electrodeposition of thin Pd-Ag films

    International Nuclear Information System (INIS)

    Hasler, P.; Allmendinger, T.

    1993-01-01

    Thin Pd-Ag layers were electroplated preferably on brass and on nickel substrates using a two-compartment cell separated by an anion exchange membrane. The weakly alkaline electrolyte contained glycine-glycinate as the major complexing agents. The plating experiments were usually carried out without stirring, at different potentials and temperatures and in the absence or in the presence of sodium benzaldehyde-2,4-disulphonate (BDS). The samples were characterized by scanning electron microscopy and light microscopy. Their compositions were determined analytically by the inductively coupled plasma technique. In addition, the film porosity was tested. Electrodeposition in almost limiting current conditions for both components and without simultaneous hydrogen evolution led to deposits with compositions being in good agreement with the molar metal ratio in the electrolyte (77:23). The best results were achieved between 0 and -50 mV with respect to a reversible hydrogen electrode at 0 C in the presence of BDS. These deposits were bright, had good adherence and exhibited no pores at a film thickness of 1.2 μm. At too negative potentials, the deposits became black and powdery. (orig.)

  4. Commissioning of the new AGS MMPS transformers

    Energy Technology Data Exchange (ETDEWEB)

    Bajon,E.; Badea, V. S.; Bannon, M.; Bonati, R.; Marneris, I. M.; Porqueddu, r.; Roser, T.; Sandberg, J.; Savatteri, S.

    2009-05-04

    The Brookhaven AGS Main Magnet Power Supply (MMPS) is a thyristor control supply rated at 5500 Amps. +/-9000 Volts. The peak magnet power is 50 MWatts. The power supply is fed from a motor/generator manufactured by Siemens. During rectify and invert operation the P Bank power supplies are used. During the flattops the F Bank power supplies are used. The P Bank power supplies are fed from two 23 MVA transformers and the F Bank power supplies are fed from two 5.3 MYA transformers. The fundamental frequency of the F Bank power supplies is 1440 Hz, however the fundamental frequency of the P banks was 720 Hz. It was very important to reduce the ripple during rectify to improve polarized proton operations. For this reason and also because the original transformers were 45 years old we replaced these transformers with new ones and we made the fundamental frequency of both P and F banks 1440 Hz. This paper will highlight the major hurdles that were involved during the installation of the new transformers. It will present waveforms while running at different power levels up to 6MW full load. It will show the transition from the F-Bank power supplies to the P-Banks and also show the improvements in ripple made on the P-Bank power supplies.

  5. The AGS Booster high frequency RF system

    International Nuclear Information System (INIS)

    Sanders, R.T.; Cameron, P.; Eng, W.; Goldman, M.A.; Jablonski, E.; Kasha, D.; Keane, J.; McNerney, A.; Meth, M.; Plotkin, M.; Puglisi, M.; Ratti, A.; Spitz, R.

    1991-01-01

    A high level RF system, including a power amplifier and cavity, has been designed and built for the AGS Booster. It covers a frequency range of 2.4 to 4.2 MHz and will be used to accelerate high intensity protons, low intensity polarized protons and heavy ions, to the 1.5 GeV level. A total accelerating voltage of up to 90 kV will be provided by two cavities, each having two gaps. The internally cross-coupled, pushpull cavities are driven by an adjacently located power amplifier. In order to accommodate beam intensities up to 0.75 x 10 13 protons per bunch, a low plate resistance power tetrode is used. The tube anode is magnetically coupled to one of the cavity's two parallel cells. The amplifier is a grounded cathode configuration driven by a remotely located solid-state amplifier. It has been tested in the laboratory at full gap voltage with satisfactory results

  6. Structural and optical properties of Si-doped Ag clusters

    KAUST Repository

    Mokkath, Junais Habeeb

    2014-03-06

    The structural and optical properties of AgN and Ag N-1Si1 (neutral, cationic, and anionic) clusters (N = 5 to 12) are systematically investigated using the density functional based tight binding method and time-dependent density functional theory, providing insight into recent experiments. The gap between the highest occupied and lowest unoccupied molecular orbitals and therefore the optical spectrum vary significantly under Si doping, which enables flexible tuning of the chemical and optical properties of Ag clusters. © 2014 American Chemical Society.

  7. Biosynthesis of Au, Ag and Au-Ag nanoparticles using edible mushroom extract

    Science.gov (United States)

    Philip, Daizy

    2009-07-01

    Integration of green chemistry principles to nanotechnology is one of the key issues in nanoscience research. There is growing need to develop environmentally benign metal nanoparticle synthesis process that do not use toxic chemicals in the synthesis protocols to avoid adverse effects in medical applications. Here, it is a report on extracellular synthesis method for the preparation of Au, Ag and Au-Ag nanoparticles in water, using the extract of Volvariella volvacea, a naturally occurring edible mushroom, as reducing and protecting agents. Gold nanoparticles of different sizes (20-150 nm) and shapes from triangular nanoprisms to nearly spherical and hexagonal are obtained by this novel method. The size and shape of gold nanoparticles are also found to depend on temperature of the extract. The silver nanoparticles are spherical with size ˜15 nm. There is increased productivity of nanoparticles as shown by sharp and intense surface plasmon resonance bands for the nanoparticles prepared using an excess of the extract. The Au-Ag nanoparticles prepared by co-reduction has only one plasmon band due to alloying of the constituents. All the synthesized nanoparticles are found to be photoluminescent and are highly crystalline as shown by SAED and XRD patterns with fcc phase oriented along the (1 1 1) plane. FTIR measurements were carried out to identify the possible biomolecules responsible for capping and efficient stabilization of the nanoparticles. It is found that Au nanoparticles are bound to proteins through free amino groups and silver nanoparticles through the carboxylate group of the amino acid residues. The position and intensity of the emission band is found to depend on composition of the nanoparticles indicating the possible use in therapeutic applications.

  8. Preparation of AgBr Nanoparticles in Microemulsions Via Reaction of AgNO3 with CTAB Counterion

    International Nuclear Information System (INIS)

    Husein, Maen M.; Rodil, Eva; Vera, Juan H.

    2007-01-01

    Nanoparticles of AgBr were prepared by precipitating AgBr in the water pools of microemulsions consisting of CTAB, n-butanol, isooctane and water. An aqueous solution of AgNO 3 added to the microemulsion was the source of Ag + ions. The formation of AgBr nanoparticles in microemulsions through direct reaction with the surfactant counterion is a novel approach aimed at decreasing the role of intermicellar nucleation on nanoparticle formation for rapid reactions. The availability of the surfactant counterion in every reverse micelle and the rapidity of the reaction with the counterion trigger nucleation within individual reverse micelles. The effect of the following variables on the particle size and size distribution was investigated: the surfactant and cosurfactant concentrations, moles of AgNO 3 added, and water to surfactant mole ratio, R. High concentration of the surfactant or cosurfactant, or high water content of the microemulsion favored intermicellar nucleation and resulted in the formation of large particles with broad size distribution, while high amounts of AgNO 3 favored nucleation within individual micelles and resulted in small nanoparticles with narrow size distribution. A blue shift in the UV absorption threshold corresponding to a decrease in the particle size was generally observed. Notably, the variation of the absorption peak size with the nanoparticle size was opposite to those reported by us in previous studies using different surfactants

  9. Pt@Ag and Pd@Ag core/shell nanoparticles for catalytic degradation of Congo red in aqueous solution.

    Science.gov (United States)

    Salem, Mohamed A; Bakr, Eman A; El-Attar, Heba G

    2018-01-05

    Platinum/silver (Pt@Ag) and palladium/silver (Pd@Ag) core/shell NPs have been synthesized in two steps reaction using the citrate method. The progress of nanoparticle formation was followed by the UV/Vis spectroscopy. Transmission electron microscopy revealed spherical shaped core/shell nanoparticles with average particle diameter 32.17nm for Pt@Ag and 8.8nm for Pd@Ag. The core/shell NPs were further characterized by FT-IR and XRD. Reductive degradation of the Congo red dye was chosen to demonstrate the excellent catalytic activity of these core/shell nanostructures. The nanocatalysts act as electron mediators for the transfer of electrons from the reducing agent (NaBH 4 ) to the dye molecules. Effect of reaction parameters such as nanocatalyst dose, dye and NaBH 4 concentrations on the dye degradation was investigated. A comparison between the catalytic activities of both nanocatalysts was made to realize which of them the best in catalytic performance. Pd@Ag was the higher in catalytic activity over Pt@Ag. Such greater activity is originated from the smaller particle size and larger surface area. Pd@Ag nanocatalyst was catalytically stable through four subsequent reaction runs under the utilized reaction conditions. These findings can thus be considered as possible economical alternative for environmental safety against water pollution by dyes. Copyright © 2017. Published by Elsevier B.V.

  10. Soldering of Bi-2223/Ag high temperature superconducting tapes with Sn-Pb-Bi-Ag alloy paste

    Energy Technology Data Exchange (ETDEWEB)

    Guo Wei, E-mail: gwei@tsinghua.edu.c [Department of Mechanical Engineering, Key Laboratory for Advanced Manufacturing by Materials Processing Technology, Tsinghua University, Ministry of Education of PR China, Beijing 100084 (China); School of Mechanical Engineering and Automation, Beijing University of Aeronautics and Astronautics, Beijing 100191 (China); Zou Guisheng; Wu Aiping; Bai Hailin; Ren Jialie [Department of Mechanical Engineering, Key Laboratory for Advanced Manufacturing by Materials Processing Technology, Tsinghua University, Ministry of Education of PR China, Beijing 100084 (China)

    2010-01-15

    Soldered joints of Bi-2223/Ag-sheathed high temperature superconducting multifilamentary tapes were fabricated using 63 wt.%Sn-34 wt.%Pb-1 wt.%Bi-2 wt.%Ag paste. The soldered joints were observed by scanning electron microscope (SEM) and X-ray diffraction (XRD). Moreover, the electrical properties of joints were evaluated by current-voltage curves, and the tensile strengths of the joints were also tested. The results show that the soldered joint consists of Ag sheath - Ag{sub 3}Sn compound layer - PbSn{sub 2} and Ag{sub 3}Sn solder layer - Ag{sub 3}Sn compound layer - Ag sheath. The joints are obeyed with Ohms Law and the magnitude of the joint resistance, which deceases with the increase of the overlap length, can reach the order of 10{sup -8} OMEGA. The tensile strength of the joints with a brittle fracture mode is a little lower than that of the original tapes.

  11. Development of heat resistant Pb-free joints by TLPS process of Ag and Sn-Bi-Ag alloy powders

    Directory of Open Access Journals (Sweden)

    Ohnuma I.

    2012-01-01

    Full Text Available TLPS (Transient Liquid Phase Sintering process is a candidate method of heat-resistant bonding, which makes use of the reaction between low-melting temperature powder of Sn-Bi base alloys and reactive powder of Ag. During heat treatment above the melting temperature of a Sn-Bi base alloy, the molten Sn-Bi reacts rapidly with solid Ag particles, which results in the formation of heat-resistant intermetallic compound (IMC. In this study, the TLPS properties between Sn-17Bi-1Ag (at.% powder with its liquidus temperature of 200°C and pure Ag powder were investigated. During differential scanning calorimetry (DSC measurement, an exothermic reaction and an endothermic reaction occurred, which correspond to the formation of the e-Ag3Sn IMC phase and the melting of the Sn-17Bi-1Ag alloy, respectively. After the overall measurement, the obtained reactant consists of the Ag3Sn-IMC and Bi-rich phases, both of which start melting above 250°C, with a small amount of the residual Sn-Bi eutectic phase. These results suggest that the TLPS process can be applied for Pb-free heatresistant bonding.

  12. Pt@Ag and Pd@Ag core/shell nanoparticles for catalytic degradation of Congo red in aqueous solution

    Science.gov (United States)

    Salem, Mohamed A.; Bakr, Eman A.; El-Attar, Heba G.

    2018-01-01

    Platinum/silver (Pt@Ag) and palladium/silver (Pd@Ag) core/shell NPs have been synthesized in two steps reaction using the citrate method. The progress of nanoparticle formation was followed by the UV/Vis spectroscopy. Transmission electron microscopy revealed spherical shaped core/shell nanoparticles with average particle diameter 32.17 nm for Pt@Ag and 8.8 nm for Pd@Ag. The core/shell NPs were further characterized by FT-IR and XRD. Reductive degradation of the Congo red dye was chosen to demonstrate the excellent catalytic activity of these core/shell nanostructures. The nanocatalysts act as electron mediators for the transfer of electrons from the reducing agent (NaBH4) to the dye molecules. Effect of reaction parameters such as nanocatalyst dose, dye and NaBH4 concentrations on the dye degradation was investigated. A comparison between the catalytic activities of both nanocatalysts was made to realize which of them the best in catalytic performance. Pd@Ag was the higher in catalytic activity over Pt@Ag. Such greater activity is originated from the smaller particle size and larger surface area. Pd@Ag nanocatalyst was catalytically stable through four subsequent reaction runs under the utilized reaction conditions. These findings can thus be considered as possible economical alternative for environmental safety against water pollution by dyes.

  13. Ag-loaded mesoporous bioactive glasses against Enterococcus faecalis biofilm in root canal of human teeth.

    Science.gov (United States)

    Fan, Wei; Wu, Daming; Ma, Tengjiao; Fan, Bing

    2015-01-01

    Ag-loaded mesoporous bioactive glass (Ag-MBG) powders were synthesized and characterized. The ions release of Ag-MBGs in Tris-HCl and the pH stability of simulated body fluids after immersing Ag-MBGs were tested. Root canals were inoculated with Enterococcus faecalis for 4 weeks, and the antibacterial activity of MBGs, Ag-MBGs and calcium hydroxide against E. faecalis biofilm were evaluated. Results showed that Ag-MBGs possessed highly ordered mesoporous structure with silver nanoparticles deposited in the mesopores, which enabled a sustained Ag ions released. The biofilms treated with Ag-MBGs showed a significant structural disruption compared with MBGs. These results indicated that Ag-MBGs possess a potent antibacterial effect against E.faecalis biofilm in root canal, and the antibacterial activity was induced by the release of Ag ions from Ag-MBGs.

  14. Study of Ag and Au Nanoparticles Synthesized by Arc Discharge in Deionized Water

    Directory of Open Access Journals (Sweden)

    Der-Chi Tien

    2010-01-01

    Full Text Available The paper presents a study of Ag and Au nanofluids synthesized by the arc discharge method (ADM in deionized water. The metallic Ag nanoparticle (Ag0 and ionic Ag (Ag+ have played an important role in the battle against germs which are becoming more drug-resistant every year. Our study indicates that Ag nanoparticle suspension (SNPS fabricated by using ADM without added surfactants exclusively contains the metallic Ag nanoparticle and ionic Ag. Besides that, the ADM in deionized water has also been employed for the fabrication process of Au nanoparticles. The experimental results indicate that the prepared Ag nanoparticles can react with the dissolved H2CO3 in deionized water, leading to the formation of Ag2CO3. Significantly different to Ag, the prepared Au nanoparticles with their surfaces bonded by oxygen are suspended in deionized water by the formation of hydrogen bonded with the neighboring water molecules.

  15. Synthesis of AG@AgCl Core-Shell Structure Nanowires and Its Photocatalytic Oxidation of Arsenic (III) Under Visible Light.

    Science.gov (United States)

    Qin, Yanyan; Cui, Yanping; Tian, Zhen; Wu, Yangling; Li, Yilian

    2017-12-01

    Ag@AgCl core-shell nanowires were synthesized by oxidation of Ag nanowires with moderate FeCl 3 , which exhibited excellent photocatalytic activity for As(III) oxidation under visible light. It was proved that the photocatalytic oxidation efficiency was significantly dependent on the mole ratio of Ag:AgCl. The oxidation rate of As(III) over Ag@AgCl core-shell nanowires first increased with the decrease of Ag 0 percentage, up until the optimized synthesis mole ratio of Ag nanowires:FeCl 3 was 2.32:2.20, with 0.023 mg L -1  min -1 As(III) oxidation rate; subsequently, the oxidation rate dropped with the further decrease of Ag 0 percentage. Effects of the pH, ionic strength, and concentration of humic acid on Ag@AgCl photocatalytic ability were also studied. Trapping experiments using radical scavengers confirmed that h + and ·O 2 - acted as the main active species during the visible-light-driven photocatalytic process for As(III) oxidation. The recycling experiments validated that Ag@AgCl core-shell nanowires were a kind of efficient and stable photocatalyst for As(III) oxidation under visible-light irradiation.

  16. Liquidus Projection and Thermodynamic Modeling of a Sn-Ag-Zn System

    Science.gov (United States)

    Chen, Sinn-wen; Chiu, Wan-ting; Gierlotka, Wojciech; Chang, Jui-shen; Wang, Chao-hong

    2017-12-01

    Sn-Ag-Zn alloys are promising Pb-free solders. In this study, the Sn-Ag-Zn liquidus projection was determined, and the Sn-Ag-Zn thermodynamic modeling was developed. Various Sn-Ag-Zn alloys were prepared. Their as-cast microstructures and primary solidification phases were examined. The invariant reaction temperatures of the ternary Sn-Ag-Zn system were determined. The liquidus projection of the Sn-Ag-Zn ternary system was constructed. It was found that the Sn-Ag-Zn ternary system has eight primary solidification phases: ɛ2-AgZn3, γ-Ag5Zn8, β-AgZn, ζ-Ag4Sn, (Ag), ɛ1-Ag3Sn, β-(Sn) and (Zn) phases. There are eight ternary invariant reactions, and the liquid + (Ag) = β-AgZn + ζ-Ag4Sn reaction is of the highest temperature at 935.5 K. Thermodynamic modeling of the ternary Sn-Ag-Zn system was also carried out in this study based on the thermodynamic models of the three constituent binary systems and the experimentally determined liquidus projection. The liquidus projection and the isothermal sections are calculated. The calculated and experimentally determined liquidus projections are in good agreement.

  17. The Antimicrobial Properties of Silver Nanoparticles in Bacillus subtilis Are Mediated by Released Ag+ Ions.

    Directory of Open Access Journals (Sweden)

    Yi-Huang Hsueh

    Full Text Available The superior antimicrobial properties of silver nanoparticles (Ag NPs are well-documented, but the exact mechanisms underlying Ag-NP microbial toxicity remain the subject of intense debate. Here, we show that Ag-NP concentrations as low as 10 ppm exert significant toxicity against Bacillus subtilis, a beneficial bacterium ubiquitous in the soil. Growth arrest and chromosomal DNA degradation were observed, and flow cytometric quantification of propidium iodide (PI staining also revealed that Ag-NP concentrations of 25 ppm and above increased membrane permeability. RedoxSensor content analysis and Phag-GFP expression analysis further indicated that reductase activity and cytosolic protein expression decreased in B. subtilis cells treated with 10-50 ppm of Ag NPs. We conducted X-ray absorption near-edge structure (XANES and extended X-ray absorption fine structure (EXAFS analyses to directly clarify the valence and fine structure of Ag atoms in B. subtilis cells placed in contact with Ag NPs. The results confirmed the Ag species in Ag NP-treated B. subtilis cells as Ag2O, indicating that Ag-NP toxicity is likely mediated by released Ag+ ions from Ag NPs, which penetrate bacterial cells and are subsequently oxidized intracellularly to Ag2O. These findings provide conclusive evidence for the role of Ag+ ions in Ag-NP microbial toxicity, and suggest that the impact of inappropriately disposed Ag NPs to soil and water ecosystems may warrant further investigation.

  18. AgFNS overexpression increase apigenin and decrease anthocyanins in petioles of transgenic celery.

    Science.gov (United States)

    Tan, Guo-Fei; Ma, Jing; Zhang, Xin-Yue; Xu, Zhi-Sheng; Xiong, Ai-Sheng

    2017-10-01

    Apigenin and anthocyanin biosyntheses share common precursors in plants. Flavone synthase (FNS) converts naringenin into apigenin in higher plants. Celery is an important edible and medical vegetable crop that contains apigenin in its tissues. However, the effect of high AgFNS gene expression on the apigenin and anthocyanins contents of purple celery remains to be elucidated. In this study, the AgFNS gene was cloned from purple celery ('Nanxuan liuhe purple celery') and overexpressed in this purple celery to determine its influence on anthocyanins and apigenin contents. Results showed that the AgFNS gene was 1068bp, which encodes 355 amino acid residues. Evolution analysis showed that the AgFNS protein belongs to the FSN I type. In AgFNS transgenic celery, the anthocyanins content in petioles was lower than that wild-type celery plants. Apigenin content increased in the petioles of AgFNS transgenic celery. The transcript levels of the AgPAL, AgC4H, AgCHS, and AgCHI genes were up-regulated, whereas those of the AgF3H, AgF3'H, AgDFR, AgANS, and Ag3GT genes were down-regulated in the petioles of AgFNS transgenic plants compared with wild-type celery plants. This work provides basic knowledge about the function of the AgFNS gene in the anthocyanin and apigenin biosyntheses of celery. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Low thermal emissivity surfaces using AgNW thin films

    Science.gov (United States)

    Pantoja, Elisa; Bhatt, Rajendra; Liu, Anping; Gupta, Mool C.

    2017-12-01

    The properties of silver nanowire (AgNW) films in the optical and infrared spectral regime offer an interesting opportunity for a broad range of applications that require low-emissivity coatings. This work reports a method to reduce the thermal emissivity of substrates by the formation of low-emissivity AgNW coating films from solution. The spectral emissivity was characterized by thermal imaging with an FLIR camera, followed by Fourier transform infrared spectroscopy. In a combined experimental and simulation study, we provide fundamental data of the transmittance, reflectance, haze, and emissivity of AgNW thin films. Emissivity values were finely tuned by modifying the concentration of the metal nanowires in the films. The simulation models based on the transfer matrix method developed for the AgNW thin films provided optical values that show a good agreement with the measurements.

  20. Heparin Increases Food Intake through AgRP Neurons

    Directory of Open Access Journals (Sweden)

    Canjun Zhu

    2017-09-01

    Full Text Available Although the widely used anticoagulant drug heparin has been shown to have many other biological functions independent of its anticoagulant role, its effects on energy homeostasis are unknown. Here, we demonstrate that heparin level is negatively associated with nutritional states and that heparin treatment increases food intake and body weight gain. By using electrophysiological, pharmacological, molecular biological, and chemogenetic approaches, we provide evidence that heparin increases food intake by stimulating AgRP neurons and increasing AgRP release. Our results support a model whereby heparin competes with insulin for insulin receptor binding on AgRP neurons, and by doing so it inhibits FoxO1 activity to promote AgRP release and feeding. Heparin may be a potential drug target for food intake regulation and body weight control.

  1. Antimicrobial activity of tantalum oxide coatings decorated with Ag nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Huiliang, E-mail: hlc@mail.sic.ac.cn; Meng, Fanhao; Liu, Xuanyong, E-mail: xyliu@mail.sic.ac.cn [State Key Laboratory of High Performance Ceramics and Superfine Microstructure, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai 200050 (China)

    2016-07-15

    Silver plasma immersion ion implantation was used to decorate silver nanoparticles (Ag NPs) on tantalum oxide (TO) coatings. The coatings acted against bacterial cells (Staphylococcus epidermidis) in the dark by disrupting their integrity. The action was independent of silver release and likely driven by the electron storage capability of the Schottky barriers established at the interfaces between Ag NPs and the TO support. Moreover, no apparent side effect on the adhesion and differentiation of rat bone mesenchymal stem cells was detected when using Ag NPs-modified TO coatings. These results demonstrate that decoration of tantalum oxide using Ag NPs could be a promising procedure for improving the antibacterial properties for orthopedic and dental implants.

  2. Metallurgical characterization of experimental Ag-based soldering alloys

    Directory of Open Access Journals (Sweden)

    Argyro Ntasi

    2014-10-01

    Conclusion: The experimental alloys tested demonstrated similar microstructures and melting ranges. Ga and Sn might be used as alternative to Cu and Zn to modify the selected properties of Ag based soldering alloys.

  3. An oil-in-water self-assembly synthesis, characterization and photocatalytic properties of nano Ag@AgCl surface-sensitized K2Ti4O9

    International Nuclear Information System (INIS)

    Liang, Yinghua; Lin, Shuanglong; Liu, Li; Hu, Jinshan; Cui, Wenquan

    2014-01-01

    Highlights: • The plasmatic Ag@AgCl surface-sensitized K 2 Ti 4 O 9 composite photocatalysts. • Ag@AgCl greatly increased visible light absorption for K 2 Ti 4 O 9 . • The photocatalysts exhibited enhanced photocatalytic dye degradation. - Abstract: Nano-sized plasmonic Ag@AgCl surface-sensitized K 2 Ti 4 O 9 composite photocatalysts (hereafter designated as Ag@AgCl/K 2 Ti 4 O 9 ) was synthesized via a facile oil-in-water self-assembly method. The photocatalytic activity of the prepared materials for RhB (Rhodamine B) degradation was examined under visible light irradiation. The results reveal that the size of Ag@AgCl, which evenly dispersed on the surface of K 2 Ti 4 O 9 , distributes about 20–50 nm. The UV–vis diffuse reflectance spectra indicate that Ag@AgCl/K 2 Ti 4 O 9 samples have a significantly enhanced optical absorption in 380–700 nm. The photocatalytic activities of the Ag@AgCl/K 2 Ti 4 O 9 samples increase first and then decrease with increasing amount of loading Ag@AgCl and the Ag@AgCl(20 wt.%)/K 2 Ti 4 O 9 sample exhibits the best photocatalytic activity and 94.47% RhB was degraded after irradiation for 2 h. Additionally, studies performed using radical scavengers indicated that O 2 · − and Cl 0 acted as the main reactive species. The electronic interaction was systematically studied and confirmed by the photo-electrochemical measurements

  4. The AGS main magnet power supply upgrade

    International Nuclear Information System (INIS)

    Sandberg, J.N.; Casella, R.; Geller, J.; Marneris, I.; Soukas, A.; Schumburg, N.

    1995-01-01

    The AGS Main Magnet Power Supply consists of a group of thyristor controlled power converters that operate from full rectify to full invert. In order to minimize ripple during the critical periods of injection and extraction 24 pulse converters are used for these portions of the cycle. The maximum voltage available in this mode is nominally 2,000 volts. The converters that are functional during this portion of the cycle are called the flat-top bank or ''F'' bank modules. During acceleration and invert where voltages of up to 12,000 volts are needed and where the ripple requirements are less stringent, groups of twelve pulse converters are operational. These converters are called the Pulsed bank or ''P'' bank modules. The original controlled rectifier system consisted of 96 large mercury filled excitron tubes divided equally between the P bank and F bank converters. These devices were extremely durable and ran successfully for over twenty years. It was, decided to replace the excitron farm with multiple arrangements of three-phase, full-wave, bridge modules that utilize silicon controlled rectifiers (SCR's or thyristors) as the switching element. In order to match the existing transformer connections and buswork, eight identical modules were required; four for the P bank system and four for the F bank system. In order to reduce noise pickup and provide electrical isolation the high level SCR gate triggers are provided via fiberoptic cable. The status of various parameters such as water flow, auxiliary power supply performance, trigger circuitry failure, over voltage, overcurrent, and loss of phase reference are monitored via a programmable logic controller (PLCs). The PLCs use isolated input and output modules for various voltage levels from TTL to 150 Vdc to 125 Vac. These devices are extremely flexible and have allowed modifications and improvements that have enhanced the performance over any equivalent hard wired system

  5. Performance of the new AGS RFQ preinjector

    International Nuclear Information System (INIS)

    Alessi, J.G.; Brennan, J.M.; Brodowski, J.

    1989-01-01

    In the fall of 1988, the 750 keV Cockcroft-Walton (C-W) preinjector for the AGS 200 MeV H/sup /minus// linac was replaced by an RFQ, in what has proved to be a very successful upgrade. The motivations for the upgrade included improved reliability, simpler maintenance, and the added convenience of having the ion source located at nearly ground potential. At the same time, the controls and instrumentation in the preinjector area were modernized. The linac has been operating full time with this RFQ preinjector since January 1, 1989, and the reliability has been excellent. The source, RFQ, and linac operate at a 5 Hz repetition rate, and the beam pulse width is approximately 450 μs. At this time, the H/sup /minus// current at 200 MeV is typically 23-25 mA, the same as previous operation with the C-W, although the capability is there to reach higher currents in the future. The layout of the new preinjector is shown in Figure 1. An important consideration in the layout of this line was the decision to leave the final 2.4 m section before the linac intact, so the optics of a second C-W injector line and polarized H/sup /minus// injection from another RFQ remained the same. The resulting line has a distance of almost 6 m from the RFQ to the linac, and there are three ''rebuncher'' cavities to maintain the bunching of the beam from the RFQ. The following sections will describe some details of the preinjector line, and then discuss the installation and performance

  6. New tariffs of BKW Energie AG (Switzerland)

    International Nuclear Information System (INIS)

    Guillelmon, B.

    1995-01-01

    The tariff increase of BKW Energie AG in October 1994 was, seen as a chance to review the tariff structure. First of all, the different products delivered to the customers were clearly defined, according to the following criteria: quantity of electricity intake at high tariff, degree of freedom at intake as well as supply and measurement point of the intake. In a second step the objectives to be fulfilled with the new structure were set: the tariffs should be customer-friendly easy to understand and to apply, foreseeable, cost-related as well as take into account the new findings in energy economics and finally give the right signals for a sparing use of natural resources. Some more considerations, especially on the allocation of the demand costs on demand and consumption rates were made. The new tariffs of BKW offer more flexibility and choices for the customers: retail customers can choose between single and two-rate tariffs. Moreover, they can choose a tariff for interruptable intake as a supplementary subscription. Big customers can choose among different options according to the utilisation time. The setting up of clear names and good information as well as specific offer of energy advice to the customers at the moment of the tariff increase were considered as highly valuable. The new tariff structure is one step in the right direction. The structure must still be ameliorated in the future. The trend will possibly be in a higher differentiation of tariffs for big customers and a high valuation of simplicity for the tariffs for retail customers. (author)

  7. Accelerating polarized beams at the AGS

    International Nuclear Information System (INIS)

    Roser, T.

    1995-01-01

    The acceleration of polarized beams in circular accelerators is complicated by the presence of numerous depolarizing resonances. During acceleration, a depolarizing resonance is crossed whenever the spin precession frequency equals the frequency with which spin-perturbing magnetic fields are encountered. There are two main types of depolarizing resonances corresponding to the possible sources of such fields: imperfection resonances, which are driven by magnet errors and misalignments, and intrinsic resonances, driven by the focusing fields. The resonance conditions are usually expressed in terms of the spin tune ν s , which is defined as the number of spin precessions per revolution. For an ideal planar accelerator, where orbiting particles experience only the vertical guide field, the spin tune is equal to Gγ, where G = 1.7928 is the anomalous magnetic moment of the proton and γ is the relativistic Lorentz factor. The resonance condition for imperfection depolarizing resonances arise when ν s = Gγ = n, where n is an integer. Imperfection resonances are therefore separated by only 523 MeV energy steps. The condition for intrinsic resonances is ν s = Gγ = kP ± ν y , where k is an integer, ν y is the vertical betatron tune and P is the superperiodicity. For the AGS, P = 12 and ν y ∼ 8.8. For most of the time during the acceleration cycle, the precession direction, or stable spin direction, coincides with the main vertical magnetic field. Close to a resonance, the stable spin direction is perturbed away from the vertical direction by the resonance driving fields. When a polarized beam is accelerated through an isolated resonance, the final polarization can be calculated analytically

  8. Spin coupling resonance and suppression in the AGS

    Directory of Open Access Journals (Sweden)

    V. H. Ranjbar

    2004-05-01

    Full Text Available A spin matching method to cure intrinsic coupled spin resonances in the AGS is proposed and explored using an extension of the existing DEPOL program algorithm. The extension of DEPOL to handle linear coupling in the polarized beam acceleration is documented. Data collected from recent polarized proton experiments in the AGS are compared with the predictions derived from the extended DEPOL program.

  9. Datenqualitäts-Modell der Volkswagen Financial Services AG

    Science.gov (United States)

    Moser, Helena

    Im Rahmen der Vertriebsaktivitäten und der umfangreichen rechtlichen und regulatorischen Anforderungen u. a. Basel II hat die Volkswagen Financial Services AG (nachfolgend VW FS AG) beschlossen, dem Thema Datenqualität und Datenqualitätsmanagement, insbesondere unter dem Blickwinkel der Konzern Leitlinien Kundennähe, Schaffung von Werten und Höchstleistung, eine hohe Priorität einzuräumen.

  10. Ag-based semiconductor photocatalysts in environmental purification

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jiade; Fang, Wen [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou 341000, Jiangxi Province (China); Yu, Changlin, E-mail: yuchanglinjx@163.com [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou 341000, Jiangxi Province (China); School of Environment Engineering and biology Engineering, Guangdong University of Petrochemical Technology, Maoming, 525000 Guangdong Province (China); Zhou, Wanqin [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou 341000, Jiangxi Province (China); State Key Laboratory of Photocatalysis on Energy and Environment, Fuzhou University, Fuzhou, 350002 (China); Zhu, Lihua [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou 341000, Jiangxi Province (China); Xie, Yu, E-mail: xieyu_121@163.com [College of Environment and Chemical Engineering, Nanchang Hangkong University, Nanchang 330063, Jiangxi (China)

    2015-12-15

    Graphical abstract: Ag-based semiconductors as promising visible light-driven photocatalysts have aroused much interesting due to their strong visible light responsibility. Formation of heterojunction could largely promote the electron/hole pair separation, resulting in highly photocatalytic activity and stability. - Highlights: • Recent research progress in the fabrication and application of Ag-based semiconductor photocatalyts. • The advantages and disadvantages of Ag-based semiconductor as photocatalysts. • Strategies in design Ag-based semiconductor photocatalysts with high performance. - Abstract: Over the past decades, with the fast development of global industrial development, various organic pollutants discharged in water have become a major source of environmental pollution in waste fields. Photocatalysis, as green and environmentally friendly technology, has attracted much attention in pollutants degradation due to its efficient degradation rate. However, the practical application of traditional semiconductor photocatalysts, e.g. TiO{sub 2}, ZnO, is limited by their weak visible light adsorption due to their wide band gaps. Nowadays, the study in photocatalysts focuses on new and narrow band gap semiconductors. Among them, Ag-based semiconductors as promising visible light-driven photocatalysts have aroused much interesting due to their strong visible light responsibility. Most of Ag-based semiconductors could exhibit high initial photocatalytic activity. But they easy suffer from poor stability because of photochemical corrosion. Design heterojunction, increasing specific surface area, enriching pore structure, regulating morphology, controlling crystal facets, and producing plasmonic effects were considered as the effective strategies to improve the photocatalytic performance of Ag-based photocatalyts. Moreover, combining the superior properties of carbon materials (e.g. carbon quantum dots, carbon nano-tube, carbon nanofibers, graphene) with Ag

  11. Performance testing of a prototype Pd-Ag diffuser

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, G. A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hodge, B. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-09-21

    The fusion fuel cycle has gained significant attention over the last decade as interest in fusion programs has increased. One of the critical components of the fusion process is the tritium fuel cycle. The tritium fuel cycle is designed to supply and recycle process tritium at a specific throughput rate. One of the most important processes within the tritium fuel cycle is the clean-up of the of the process tritium. This step will initially separate the hydrogen isotopes (H2, D2, and T2) from the rest of the process gas using Pd-Ag diffusers or permeators. The Pd-Ag diffuser is an integral component for any tritium purification system; whether part of the United States’ defense mission or fusion programs. Domestic manufacturers of Pd-Ag diffusers are extremely limited and only a few manufacturers exist. Johnson-Matthey (JM) Pd-Ag diffusers (permeators) have previously been evaluated for the separation of hydrogen isotopes from non-hydrogen gas species in the process. JM is no longer manufacturing Pd-Ag diffusers and a replacement vendor needs to be identified to support future needs. A prototype Pd-Ag diffuser has been manufactured by Power and Energy, and is considered a potential replacement for the JM diffuser for tritium service. New diffuser designs for a tritium facility for any fusion energy applications must be characterized by evaluating their operating envelope prior to installation in a tritium processing facility. The prototype Pd-Ag diffuser was characterized to determine the overall performance as a function of the permeation of hydrogen through the membrane. The tests described in this report consider the effects of feed gas compositions, feed flow rates, pump configuration and internal tube pressure on the permeation of H2 through the Pd-Ag tubes.

  12. Study of diffusion of Ag in Cu single crystals

    CERN Document Server

    Wang, R

    2002-01-01

    4.0 MeV sup 7 Li sup + sup + RBS and AES were used for investigations of thermal diffusion of Ag in Cu single crystals. The annealing of samples was carried out in vacuum in the temperature range from 498 to 613 K. The element depth concentration profiles transformed from RBS spectra indicate that the diffusion of Ag into Cu is a typical volume diffusion. The Arrhenius parameters corresponding to the diffusion were obtained.

  13. Spectroscopic and lasing properties of Ho:Tm:LuAG

    Science.gov (United States)

    Barnes, Norman P.; Filer, Elizabeth D.; Naranjo, Felipe L.; Rodriguez, Waldo J.; Kokta, Milan R.

    1993-01-01

    Ho:Tm:LuAG has been grown, examined spectroscopically, and lased at 2.1 microns. Ho:Tm:LuAG was selected for this experimental investigation when quantum-mechanical modeling predicted that it would be a good laser material for Ho laser operation on one of the 5I7 to 5I8 transitions. Lasing was achieved at 2.100 microns, one of the three wavelengths predicted to be most probable for laser action.

  14. Polarized proton acceleration program at the AGS and RHIC

    International Nuclear Information System (INIS)

    Lee, Y.Y.

    1995-01-01

    Presented is an overview of the program for acceleration of polarized protons in the AGS and their injection into the RHIC collider. The problem of depolarizing resonances in strong focusing circulator accelerators is discussed. The intrinsic resonances are jumped over by the fast tune jump, and a partial Siberian Snake is used to compensate for over forty imperfection resonances in the AGS. Two sets of full Siberian Snake and spin rotators will be employed in RHIC

  15. Photochemical generation of antimicrobial Ag-nanoparticles in intraocular lenses

    Science.gov (United States)

    Badur, Thorben; Kim, Hee-Cheol; Hampp, Norbert

    2017-02-01

    The antimicrobial properties of silver (Ag) nanoparticles (NP) have been investigated in depth during the last decades.[1] For cataract treatment minimal invasive surgery has become state-of-the-art. The physicians are still fighting against postoperative inflammations, such as endophthalmitis.[2] We present a novel approach to reduce these postoperative complications by equipping the hydrophilic intraocular lenses (IOL) with a Ag NP depot. As the Ag NP are completely entrapped inside the polymeric IOL no direct contact of the nanoparticles with epithelial cells may occur. Using 1-hydroxybenzotriazole (HOBt) or 7-hydroxycumarine (7HOCum) as photo reduction mediators (PRM) the formation of the Ag NP is accomplished in situ. PRM and Ag nitrate are diffused into the ready made IOL. By means of two-photon-absorption (TPA) photochemistry at λTPA = 532 nm the Ag NP generation is precisely controlled to occur inside the IOL only. At no point NP are directly exposed to the surface.[3] Interesting dependencies between the used PRM and the resulting particle size distribution or the effectiveness of the silver ion reduction inside the polymer matrix are reported. The Ag NP were prepared in the outer area of the IOL not to affect the optical properties of the ophthalmic implant. The amount of Ag ions released was determined and found to be sufficient to effectively reduce the counts of airborne germs. Besides HOBt and 7HOCum we also investigated the photo reductive properties of several other organic reagents, such as benzophenone (BP) and 4-hydroxybenzophenone (4HOBP) for the ability to produce even three-dimensional nanoparticle structures inside a polymer matrix.

  16. Textile electrodes in Electrical Bioimpedance measurements - a comparison with conventional Ag/AgCl electrodes.

    Science.gov (United States)

    Marquez, J C; Seoane, F; Välimäki, E; Lindecrantz, K

    2009-01-01

    Work has been intensified around the integration of textile and measurement technology for physiological measurements in the last years. As a result nowadays it is possible to find available commercial products for cardiovascular personal healthcare monitoring. Most of the efforts have been focused in the acquisition of EKG for cardiovascular monitoring where textile electrodes have shown satisfactory performance. Electrical Bioimpedance is another type of physiological measurement that can be used for personal healthcare monitoring where the integration and the performance of the textile electrodes has not been investigated that thoroughly. In this work, the influence of the textile electrodes on the measurements and on the estimation of the Cole (R(0), R(infinity), f(C) and alpha) and body composition (TBW, ICW, ECW and FFM) parameters has been especially addressed. Complex Spectroscopy 4-electrode wrist-to-ankle electrical bioimpedance measurements taken with conventional Ag/AgCl and textile-electrodes on customized bracelets have been compared and analyzed in the frequency range 3 to 500 kHz. The obtained results suggest that the use of textile electrodes do not influence remarkably on the complex spectral measurements neither in the estimation of Cole nor body composition parameter. In any case any possible effect introduced by the use of textile is smaller than the effect of preparing the skin by the using abrasive conductive paste.

  17. Electrical and mechanical properties of Bi-2223/Ag/barrier/Ag composite tapes

    International Nuclear Information System (INIS)

    Kovac, P.; Husek, I.; Goemoery, F.; Oduleye, O.O.; Alford, N.McN.; Pachla, W.; Diduszko, R.

    2000-01-01

    Bi-2223/Ag/barrier/Ag single-core tapes with various oxide barrier materials (BaZrO 3 , SrCO 3 , ZrO 2 and Al 2 O 3 ) have been prepared by PIT. The I-V curves and ac susceptibility measurements have been performed for tapes with identical heat treatment history. Young's moduli of these tape samples have been evaluated by three-point bending and the structure of barrier powders and BSCCO cores was analysed by SEM and XRD, respectively. It was found that the shape of I-V curves, the current transfer lengths and the mechanical properties of tapes are all affected by the oxide barrier type and the barrier thickness, as well as by its porosity and uniformity. This is because the oxide barrier controls the oxygen diffusion during the tape heat treatment and simultaneously the HTS phase formation kinetics, its purity and content within the superconducting core. On the base of the results obtained for single-core tapes, two kinds of multifilamentary composite were made and tested. (author)

  18. Indentation Size Effect on Ag Nanoparticle-Modified Graphene/Sn-Ag-Cu Solders

    Science.gov (United States)

    Xu, L. Y.; Zhang, S. T.; Jing, H. Y.; Wang, L. X.; Wei, J.; Kong, X. C.; Han, Y. D.

    2018-01-01

    This paper presents the results for the indentation size effect (ISE) on the creep stress exponent and hardness of 0.03 wt.% Ag-modified graphene nanosheet Sn-Ag-Cu solder alloys, using constant loading/holding and multi-cycle (CMC) loading methods, respectively. At each maximum load, with increasing indentation depth, the creep exponent first decreased and then increased. At the same strain rate, the stress exponent also showed the same tendency, increasing as the indentation depth (peak load) increased and then decreased. The hardness was measured continuously with increasing indentation depth by the CMC loading method. The hardness did not exhibit a decrease as the indentation depth increased, which differs from the classical description of the ISE. After an initial decrease, the hardness then increased and finally decreased as the indentation depth increased. This study reviews the existing theories and formulations describing ISE with hardening effects. The experimental results fit well with the empirical formulation. The phenomenon of ISE accompanied by hardening effects has been explained physically via the interaction between geometrically necessary dislocations and grain boundaries.

  19. Evaluation of SD BIOLINEH. pyloriAg rapid test against double ELISA with SDH. pyloriAg ELISA and EZ-STEPH. pyloriAg ELISA tests.

    Science.gov (United States)

    Negash, Markos; Kassu, Afework; Amare, Bemnet; Yismaw, Gizachew; Moges, Beyene

    2018-01-01

    Helicobacter pylori antibody titters fall very slowly even after successful treatment. Therefore, tests detecting H. pylori antibody lack specificity and sensitivity. On the other hand, H. pylori stool antigen tests are reported as an alternative assay because of their reliability and simplicity. However, the comparative performance of H. pylori stool antigen tests for detecting the presence of the bacterium in clinical specimens in the study area is not assessed. Therefore, in this study we evaluated the performance of SD BIOLINE H. pylori Ag rapid test with reference to the commercially available EZ- STEP ELISA and SD BIOLINE H. pylori Ag ELISA tests. Stool samples were collected to analyse the diagnostic performance of SD BIOLINE H. pylori Ag rapid test kit using SD H. pylori Ag ELISA kit and EZ- STEP ELISA tests as a gold standard. Serum samples were also collected from each patient to test for the presence of H. pylori antibodies using dBest H. pylori Test Disk. Sensitivity, specificity, predictive values and kappa value are assessed. P values rapid test were: 95.6% (95% CI, 88.8-98.8), 92.5% (95%CI, 89-94.1%), 86.7% (95% CI, 80.5-89.6), and 97.6% (95% CI, 993.9-99.3) respectively. The performance of SD BIOLINE H. pylori Ag rapid test was better than the currently available antibody test in study area. Therefore, the SD BIOLINE Ag rapid stool test could replace and be used to diagnose active H. pylori infection before the commencement of therapy among dyspeptic patients.

  20. Synthesis and Property of Ag(NP)/catechin/Gelatin Nanofiber

    Science.gov (United States)

    Nasir, Muhamad; Apriani, Dita

    2017-12-01

    Nanomaterial play important role future industry such as for the medical, food, pharmaceutical and cosmetic industry. Ag (NP) and catechin exhibit antibacterial property. Ag(NP) with diameter around 15 nm was synthesis by microwaved method. We have successfully produce Ag(NP)/catechin/gelatin nanofiber composite by electrospinning process. Ag(NP)/catechin/gelatin nanofiber was synthesized by using gelatin from tuna fish, polyethylene oxide (PEO), acetic acid as solvent and silver nanoparticle(NP)/catechin as bioactive component, respectively. Morphology and structure of bioactive catechin-gelatin nanofiber were characterized by scanning electron microscopy (SEM) and fourier transform infrared spectroscopy (FTIR), respectively. SEM analysis showed that morphology of nanofiber composite was smooth and had average diameter 398.97 nm. FTIR analysis results were used to confirm structure of catechin-gelatin nanofiber. It was confirmed by FTIR that specific vibration band peak amide A (N-H) at 3286,209 cm-1, amide B (N-H) 3069,396 cm-1, amide I (C=O) at 1643,813 cm-1, amide II (N-H and CN) at 1538,949 cm-1, amide III (C-N) at 1276,789 cm-1, C-O-C from polyethylene oxide at 1146,418 cm-1, respectively. When examined to S. Aureus bacteria, Ag/catechin/gelatin nanofiber show inhabitation performance around 40.44%. Ag(NP)/catechin/gelatin nanofiber has potential application antibacterial medical application.

  1. Spectroscopic laser parameters of Ag/CdTe nanostructure

    Energy Technology Data Exchange (ETDEWEB)

    Giba, A.E., E-mail: alaadin85@niles.edu.eg [Department of Laser Science and Interaction, National Institute of Laser Enhanced Science, Cairo University, 12613 Giza (Egypt); Gadallah, A.-S. [Department of Laser Science and Interaction, National Institute of Laser Enhanced Science, Cairo University, 12613 Giza (Egypt); Mohamed, M.B. [Department of Laser Applications in Metrology, Photochemistry & Agriculture, National Institute of Laser Enhanced Science, Cairo University, 12613 Giza (Egypt); Azzouz, I.M. [Department of Laser Science and Interaction, National Institute of Laser Enhanced Science, Cairo University, 12613 Giza (Egypt)

    2015-11-15

    We report spectroscopic laser parameters analysis for CdTe quantum dots (QDs) in the presence of Ag nanoparticles (NPs). Absorption and emission cross-sections of about 2 nm-particle size of aqueous CdTe QDs were estimated, when different contents of about 40 nm Ag nanoparticles were added. The fluorescence, radiative lifetimes and the energy transfer between Ag NPs and CdTe QDs have been investigated. Lasing parameters that evaluate the possibility of getting laser action for these nanomaterials were calculated. The energy transfer mechanism between Ag NPs and CdTe QDs was occurred by Forster resonance energy transfer (FRET) as the average distance between them is about 50 nm. - Highlights: • Absorption and emission cross sections of Ag/CdTe have been calculated. • Lasing parameters of these nanomaterials have been also estimated. • The energy transfer mechanism between Ag NPs and CdTe QDs was determined. • Our findings are promising candidate for photonic devices.

  2. Quantifying the origin of released Ag+ ions from nanosilver.

    Science.gov (United States)

    Sotiriou, Georgios A; Meyer, Andreas; Knijnenburg, Jesper T N; Panke, Sven; Pratsinis, Sotiris E

    2012-11-13

    Nanosilver is most attractive for its bactericidal properties in modern textiles, food packaging, and biomedical applications. Concerns, however, about released Ag(+) ions during dispersion of nanosilver in liquids have limited its broad use. Here, nanosilver supported on nanostructured silica is made with closely controlled Ag size both by dry (flame aerosol) and by wet chemistry (impregnation) processes without any surface functionalization that could interfere with its ion release. It is characterized by electron microscopy, atomic absorption spectroscopy, and X-ray diffraction, and its Ag(+) ion release in deionized water is monitored electrochemically. The dispersion method of nanosilver in solutions affects its dissolution rate but not the final Ag(+) ion concentration. By systematically comparing nanosilver size distributions to their equilibrium Ag(+) ion concentrations, it is revealed that the latter correspond precisely to dissolution of one to two surface silver oxide monolayers, depending on particle diameter. When, however, the nanosilver is selectively conditioned by either washing or H(2) reduction, the oxide layers are removed, drastically minimizing Ag(+) ion leaching and its antibacterial activity against E. coli . That way the bactericidal activity of nanosilver is confined to contact with its surface rather than to rampant ions. This leads to silver nanoparticles with antibacterial properties that are essential for medical tools and hospital applications.

  3. Optical Properties of Plasmon Resonances with Ag/SiO2/Ag Multi-Layer Composite Nanoparticles

    International Nuclear Information System (INIS)

    Ye-Wan, Ma; Li-Hua, Zhang; Zhao-Wang, Wu; Jie, Zhang

    2010-01-01

    Optical properties of plasmon resonance with Ag/SiO 2 /Ag multi-layer nanoparticles are studied by numerical simulation based on Green's function theory. The results show that compared with single-layer Ag nanoparticles, the multi-layer nanoparticles exhibit several distinctive optical properties, e.g. with increasing the numbers of the multi-layer nanoparticles, the scattering efficiency red shifts, and the intensity of scattering enhances accordingly. It is interesting to find out that slicing an Ag-layer into multi-layers leads to stronger scattering intensity and more 'hot spots' or regions of stronger field enhancement. This property of plasmon resonance of surface Raman scattering has greatly broadened the application scope of Raman spectroscopy. The study of metal surface plasmon resonance characteristics is critical to the further understanding of surface enhanced Raman scattering as well as its applications. (fundamental areas of phenomenology (including applications))

  4. Synthesis of Ag or Pt Nanoparticles by Hydrolysis of Either Ag2Na or PtNa

    Directory of Open Access Journals (Sweden)

    Huabin Wang

    2008-01-01

    Full Text Available Ag and Pt nanoparticles have successfully been synthesized by hydrolysis of either Ag2Na or PtNa at room temperature. The oxidation of sodium in the Pt-Na pellets was much faster than that in the Ag-Na pellets since Pt is a catalyst for H2O formation reaction from hydrogen and oxygen at room temperature. The hydrolysis byproduct, NaOH, has a high solubility and easily is removed. This method offers a simple method of preparing transition metal nanoparticles. The Ag and Pt nanoparticles prepared by this method were crystalline in nature, and spherical in shape with a mean size of around 10 nm.

  5. Transparent Conducting Film Fabricated by Metal Mesh Method with Ag and Cu@Ag Mixture Nanoparticle Pastes

    Directory of Open Access Journals (Sweden)

    Hyun Min Nam

    2017-05-01

    Full Text Available Transparent conducting electrode film is highly desirable for application in touch screen panels (TSPs, flexible and wearable displays, sensors, and actuators. A sputtered film of indium tin oxide (ITO shows high transmittance (90% at low sheet resistance (50 Ω/cm2. However, ITO films lack mechanical flexibility, especially under bending stress, and have limitation in application to large-area TSPs (over 15 inches due to the trade-off in high transmittance and low sheet resistance properties. One promising solution is to use metal mesh-type transparent conducting film, especially for touch panel application. In this work, we investigated such inter-related issues as UV imprinting process to make a trench layer pattern, the synthesis of core-shell-type Ag and Cu@Ag composite nanoparticles and their paste formulation, the filling of Ag and Cu@Ag mixture nanoparticle paste to the trench layer, and touch panel fabrication processes.

  6. Temperature and composition dependent structural evolution of AgPd bimetallic nanoparticle: phase diagram of (AgPd)151 nanoparticle.

    Science.gov (United States)

    Kim, Hyun You; Kim, Da Hye; Lee, Hyuck Mo

    2011-03-01

    We study the structural evolution of a 151 atom Ag-Pd bimetallic nanoparticle with composition and temperature. The solid-to-liquid transition region was investigated using molecular dynamics simulations with an improved collision method, and the solid-state structure of the nanoparticle was explored with a combination of molecular dynamics and density functional theory. Results show that an fcc-to-icosahedron transformation occurs at high temperature in all composition range and that a composition of nanoparticles concerns the atomic distribution of the (AgPd)151 nanoparticle. As a result, we constructed a phase diagram of the (AgPd)151 nanoparticle. Our phase diagram offers guidance on the application of Ag-Pd nanoparticles.

  7. Microstructure, mechanical properties, bio-corrosion properties and antibacterial properties of Ti-Ag sintered alloys.

    Science.gov (United States)

    Chen, Mian; Zhang, Erlin; Zhang, Lan

    2016-05-01

    In this research, Ag element was selected as an antibacterial agent to develop an antibacterial Ti-Ag alloy by a powder metallurgy. The microstructure, phase constitution, mechanical properties, corrosion resistance and antibacterial properties of the Ti-Ag sintered alloys have been systematically studied by X-ray diffraction (XRD), scanning electron microscope (SEM), compressive test, electrochemical measurements and antibacterial test. The effects of the Ag powder size and the Ag content on the antibacterial property and mechanical property as well as the anticorrosion property have been investigated. The microstructure results have shown that Ti-Ag phase, residual pure Ag and Ti were the mainly phases in Ti-Ag(S75) sintered alloy while Ti2Ag was synthesized in Ti-Ag(S10) sintered alloy. The mechanical test indicated that Ti-Ag sintered alloy showed a much higher hardness and the compressive yield strength than cp-Ti but the mechanical properties were slightly reduced with the increase of Ag content. Electrochemical results showed that Ag powder size had a significant effect on the corrosion resistance of Ti-Ag sintered alloy. Ag content increased the corrosion resistance in a dose dependent way under a homogeneous microstructure. Antibacterial tests have demonstrated that antibacterial Ti-Ag alloy was successfully prepared. It was also shown that the Ag powder particle size and the Ag content influenced the antibacterial activity seriously. The reduction in the Ag powder size was benefit to the improvement in the antibacterial property and the Ag content has to be at least 3wt.% in order to obtain a strong and stable antibacterial activity against Staphylococcus aureus bacteria. The bacterial mechanism was thought to be related to the Ti2Ag and its distribution. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Effects of reducing agents on the synthesis of Ag/rGO nanocomposites

    Science.gov (United States)

    Li, Yaya; Song, Qiong; Fan, Bingbing; Zhang, Rui

    2017-01-01

    A facile and rapid microwave-assisted green route has been used for the formation of Ag nanoparticles (AgNPs) and the reduction of graphene oxide (GO) simultaneously with five different reducing agents, sodium hydroxide (NaOH), potassium hydroxide (KOH), sodium citrate, urea and ascorbic acid. The experimental results show that the structural properties and phase of Ag/reduced graphene oxide (Ag/rGO) nanocomposites are connected with reducing agent. AgNPs can be uniformly and compactly anchored on reduced GO (rGO) surface in the microwave field for 2 min by the assist of NaOH or KOH as reducing agent. The OH- can not only accelerate the ionization of acidic functional groups but also act as the nucleophile for Ag+. By addition of sodium citrate and urea, the GO sample remains its original structure, and Ag+ tends to form Ag2CO3, which then decomposes into Ag2O. While in the urea solution, Ag2O turns into [Ag(NH3)2]+ ions with abundant urea, then [Ag(NH3)2]+ ions are reduced to Ag0 by electrons, which leads to both Ag and Ag2O phase coexisting in the urea treated samples. In addition, it can be found that NaOH shows the best results in terms of the crystallinity and purity of Ag grains anchored on rGO surface.

  9. Study on antibacterial activity of chemically synthesized PANI-Ag-Au nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Boomi, Pandi [Department of Industrial Chemistry, School of Chemical Sciences, Alagappa University, Karaikudi 630 003, Tamil Nadu (India); Prabu, Halliah Gurumallesh, E-mail: hgprabu2010@gmail.com [Department of Industrial Chemistry, School of Chemical Sciences, Alagappa University, Karaikudi 630 003, Tamil Nadu (India); Manisankar, Paramasivam [Department of Industrial Chemistry, School of Chemical Sciences, Alagappa University, Karaikudi 630 003, Tamil Nadu (India); Ravikumar, Sundaram [Department of Oceanography and Coastal Area Studies, School of Marine Sciences, Alagappa University, Thondi Campus 623 409, Tamil Nadu (India)

    2014-05-01

    Graphical abstract: - Highlights: • New method of synthesizing PANI-Ag-Au nanocomposite. • Surface Plasmon resonance and formation of composite at nano level were analyzed. • HR-TEM study revealed uniform distribution of nanoparticles. • PANI-Ag-Au nanocomposite exhibited good antibacterial activity. - Abstract: Pristine polyaniline (PANI), PANI-Ag, PANI-Au and PANI-Ag-Au nanocomposites have been successfully synthesized by chemical oxidative polymerization method using aniline as monomer, ammonium persulphate as oxidant and metal (Ag, Au and Ag-Au) colloids. UV-Vis analysis exhibited surface Plasmon resonances of Ag, Au, Ag-Au nanoparticles. FT-IR spectra revealed the shift in peak position of N-H stretching. X-ray diffraction (XRD) results confirm the presence of Ag, Au and Au-Ag nanoparticles. HR-TEM images show nanosizes of Ag, Au, Ag-Au and the incorporation of such nanoparticles into the PANI matrix. Pristine PANI, PANI-Ag, PANI-Au and PANI-Ag-Au nanocomposites were tested for antibacterial activity by agar well diffusion method. PANI-Ag-Au nanocomposite exhibited higher antibacterial activity against both gram-positive [Streptococcus sp. (MTCC 890), Staphylococcus sp. (MTCC 96)] and gram-negative bacteria [Escherichia coli (MTCC 1671) and Klebsiella sp. (MTCC 7407)] when compared with PANI-Ag nanocomposite, PANI-Au nanocomposite and pristine PANI. The novelty of this study is the polymer-bimetal synthesis and its antibacterial potential.

  10. Synthesis of Ag-coated polystyrene colloids by an improved surface seeding and shell growth technique

    International Nuclear Information System (INIS)

    Tian Chungui; Wang Enbo; Kang Zhenhui; Mao Baodong; Zhang Chao; Lan Yang; Wang Chunlei; Song Yanli

    2006-01-01

    In this paper, an improved surface seeding and shell growth technique was developed to prepare Ag-polystyrene core shell composite. Polyethyleneimine (PEI) could act as the linker between Ag ions (Ag nanoparticles) and polystyrene (PS) colloids and the reducing agent in the formation of Ag nanoparticles. Due to the multi-functional characteristic of PEI, Ag seeds formed in-situ and were immobilized on the surface of PEI-modified PS colloids and no free Ag clusters coexist with the Ag 'seeding' PS colloids in the system. Then, the additional agents could be added into the resulting dispersions straightly to produce a thick Ag nanoshell. The Ag nanoshell with controllable thickness was formed on the surface of PS by the 'one-pot' surface seeding and shell growth method. The Ag-coverage increased gradually with the increasing of mass ratio of AgNO 3 /PS. The optical properties of the Ag-PS colloids could be tailored by changing the coverage of Ag. - Graphical abstract: An improved surface seeding and shell growth technique was developed to prepare Ag-polystyrene core shell composite. The optical properties of the Ag-PS colloids could be tailored by changing the coverage of Ag. Display Omitted

  11. Fabrication of graphene oxide enwrapped Z-scheme Ag{sub 2}SO{sub 3}/AgBr nanoparticles with enhanced visible-light photocatalysis

    Energy Technology Data Exchange (ETDEWEB)

    Wan, Yujuan; Liang, Chunyan; Xia, Yue, E-mail: xiayue_chem@126.com; Huang, Wei; Li, Zelin

    2017-02-28

    Highlights: • A novel GO/Ag{sub 2}SO{sub 3}/AgBr composite was prepared via a solution method. • It showed enhanced photocatalytic performance to degrade dyes under visible light irradiation. • Its photocatalytic ability was effectively maintained for 4 cycles without sacrificial reagents. - Abstract: A novel graphene oxide (GO) enwrapped Ag{sub 2}SO{sub 3}/AgBr (GO/Ag{sub 2}SO{sub 3}/AgBr) composite was fabricated through a facile solution approach via electrostatic interaction and precipitation transformation reaction for the first time. The results of XRD, Raman, SEM, TEM and XPS confirmed the structure, morphology and composition of the GO/Ag{sub 2}SO{sub 3}/AgBr composite very well. The Ag{sub 2}SO{sub 3}/AgBr nanoparticles were found to be encapsulated by GO sheets. The photocatalytic activity of the composite was investigated by the degradation of methyl orange (MO), rhodamine B (RhB) and methylene blue (MB) in water under visible light. The incorporation of GO sheets not only significantly enhanced the photocatalytic activity but also improved the reusability of Ag{sub 2}SO{sub 3}/AgBr nanoparticles. The photocatalytic ability of GO/Ag{sub 2}SO{sub 3}/AgBr can be maintained at a high level for 4 times cycle experiments. The trapping experiments confirmed that holes and superoxide ion radicals were the main active species responsible for the degradation reaction. A plasmonic Z-scheme photocatalytic mechanism was proposed to illustrate the possible transferred and separated behavior of electron-hole pairs among Ag, Ag{sub 2}SO{sub 3}, AgBr and GO quaternary system under visible light irradiation.

  12. Influence of the surface properties on bactericidal and fungicidal activity of magnetron sputtered Ti–Ag and Nb–Ag thin films

    Energy Technology Data Exchange (ETDEWEB)

    Wojcieszak, D., E-mail: damian.wojcieszak@pwr.edu.pl [Faculty of Microsystem Electronics and Photonics, Wroclaw University of Technology, Janiszewskiego 11/17, 50-372 Wrocław (Poland); Mazur, M.; Kaczmarek, D. [Faculty of Microsystem Electronics and Photonics, Wroclaw University of Technology, Janiszewskiego 11/17, 50-372 Wrocław (Poland); Mazur, P. [Institute of Experimental Physics, University of Wrocław, Max Born 9, 50-204 Wrocław (Poland); Szponar, B. [Institute of Immunology and Experimental Therapy, Polish Academy of Sciences, Rudolfa Weigla 12, 53–114 Wrocław (Poland); Domaradzki, J. [Faculty of Microsystem Electronics and Photonics, Wroclaw University of Technology, Janiszewskiego 11/17, 50-372 Wrocław (Poland); Kepinski, L. [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, Okólna 2, 50-422 Wrocław (Poland)

    2016-05-01

    In this study the comparative investigations of structural, surface and bactericidal properties of Ti–Ag and Nb–Ag thin films have been carried out. Ti–Ag and Nb–Ag coatings were deposited on silicon and fused silica substrates by magnetron co-sputtering method using innovative multi-target apparatus. The physicochemical properties of prepared thin films were examined with the aid of X-ray diffraction, grazing incidence X-ray diffraction, scanning electron microscopy, atomic force microscopy and X-ray photoelectron spectroscopy methods. Moreover, the wettability of the surface was determined. It was found that both, Ti–Ag and Nb–Ag thin films were nanocrystalline. In the case of Ag–Ti film presence of AgTi{sub 3} and Ag phases was identified, while in the structure of Nb–Ag only silver occurred in a crystal form. In both cases the average size of crystallites was ca. 11 nm. Moreover, according to scanning electron microscopy and atomic force microscopy investigations the surface of Nb–Ag thin films was covered with Ag-agglomerates, while Ti–Ag surface was smooth and devoid of silver particles. Studies of biological activity of deposited coatings in contact with Bacillus subtilis, Pseudomonas aeruginosa, Enterococcus hirae, Klebisiella pneumoniae, Escherichia coli, Staphylococcus aureus and Candida albicans were performed. It was found that prepared coatings were bactericidal and fungicidal even in a short term-contact, i.e. after 2 h. - Highlights: • Surface and biological properties of Ti–Ag and Nb–Ag thin films were examined. • Ag content was related to sputtering yields and nucleation of Ti and Nb. • For Nb–Ag film the agglomeration of silver at the surface was observed. • Composition and surface topography had an impact on antimicrobial properties. • Fine-grained surface was important in Ag ions release process.

  13. Effect of thermal annealing on the microstructures and photocatalytic performance of silver orthophosphate: The synergistic mechanism of Ag vacancies and metallic Ag

    International Nuclear Information System (INIS)

    Yan, Tingjiang; Guan, Wenfei; Xiao, Ying; Tian, Jun; Qiao, Zheng; Zhai, Huishan; Li, Wenjuan; You, Jinmao

    2017-01-01

    Highlights: • Ag 3 PO 4 was initially prepared via ion-exchange reaction and then annealed in air. • Thermal annealing also resulted in the formation of metallic Ag and Ag vacancies. • The annealed samples exhibited superior activity to the pristine sample. • Both Ag vacancies and metallic Ag contributed to the high activity. - Abstract: In this work, a simple thermal annealing route has been developed to improve the photocatalytic performance of silver orthophosphate (Ag 3 PO 4 ) photocatalyst toward organic pollutants degradation under visible light irradiation. The experimental results indicated that thermal treatment of Ag 3 PO 4 led to an obvious lattice shift towards right and significantly narrowed band gap energies due to the formation of Ag vacancies and metallic Ag during Ag 3 PO 4 decomposition. These structural variations notably affected the photocatalytic performance of Ag 3 PO 4 photocatalysts. The activity of the annealed samples was found to be significantly enhanced toward the degradation of MO dye. The highest activity was observed over the sample annealed at 400 °C, which exceeded that of pristine Ag 3 PO 4 by a factor of about 21 times. By means of photoluminescence spectroscopy and photoelectrochemical measurements, we propose that the enormous enhancement in activity was mainly attributed to the efficient separation of photogenerated electrons and holes driven by the synergistic effect of Ag vacancies and metallic Ag. The strong interaction between annealed particles also inhibited the dissolution of Ag + from Ag 3 PO 4 into aqueous solution, contributing to an improved photocatalytic stability. The strategy presented here provides an ideal platform for the design of other highly efficient and stable Ag-based photocatalysts for broad applications in the field of photocatalysis.

  14. Direct in situ activation of Ag0 nanoparticles in synthesis of Ag/TiO2 and its photoactivity

    International Nuclear Information System (INIS)

    Jaafar, N.F.; Jalil, A.A.; Triwahyono, S.; Efendi, J.; Mukti, R.R.; Jusoh, R.; Jusoh, N.W.C.; Karim, A.H.; Salleh, N.F.M.; Suendo, V.

    2015-01-01

    Graphical abstract: - Highlights: • Ag 0 loaded on TiO 2 was prepared by a direct in situ electrochemical method. • 5 wt% Ag–TiO 2 demonstrated the best photocatalytic degradation of 2-CP. • Isomorphous substitution of Ag with Ti occurred to form Ti−O−Ag bonds. • Ag 0 and oxygen vacancies trapped electrons to enhance e–H + separation. • Substitution of Ag in the TiO 2 structure decreased the number of oxygen vacancies. - Abstract: Metallic Ag nanoparticles (Ag 0 ) were successfully activated using a direct in situ electrochemical method before being supported on TiO 2 . Catalytic testing showed that 5 wt% Ag–TiO 2 gave the highest photodegradation (94%) of 50 mg L −1 2-chlorophenol (2-CP) at pH 5 using 0.375 g L −1 catalyst within 6 h, while under similar conditions, 1 wt% and 10 wt% Ag–TiO 2 only gave 75% and 78% degradation, respectively. Characterization results illustrated that the photoactivity was affected by the amount of Ag 0 and oxygen vacancies which act as an electrons trap to enhance the electron–hole separation. While, the Ag−O−Ti bonds formation reduced the photoactivity. The degradation followed a pseudo-first order Langmuir–Hinshelwood model where adsorption was the controlling step. Study on the effect of scavengers showed that the hole (H + ) and hydroxyl radical (OH·) play important roles in the photodegradation. The regenerated photocatalyst was still stable after five cycling runs

  15. Study of Ag induced bimetallic (Au-Ag) nanowires on silicon (5 5 12) surfaces: Experiment and theoretical aspects

    Science.gov (United States)

    Bhukta, Anjan; Bagarti, Trilochan; Guha, Puspendu; Ravulapalli, Sathyavathi; Satpati, Biswarup; Rakshit, Bipul; Maiti, Paramita; Parlapalli, Venkata Satyam

    2017-10-01

    The reconstructed vicinal (high index) silicon surfaces, such as, Si (5 5 12) composes row-like structures that can be used as templates for growing aligned nanowires. By using a sub-monolayers of Ag, prior to Au deposition on reconstructed Si (5 512) surface, intermixing of Au and Ag, enhancement of aspect ratio of bimetallic Au-Ag nanowires with tunable morphology is reported. This is attributed to a combined effect of pre-grown Ag strips as nucleation centers for incoming Au ad-atoms and anisotropic Au-Ag intermixing. To achieve optimum conditions for the growth of larger aspect ratio Au-Ag nanostructures, the growth kinetics have been studied by varying growth and annealing temperatures. At ≈400 °C, the Ag diffused into silicon substrate and the inter-diffusion found to inhibit the formation of Au-Ag bimetallic nanostructures. Controlled experiments under ultra-high vacuum condition in a molecular beam epitaxy system and in-situ scanning tunneling microscopy measurements along with ex-situ scanning transmission and secondary electron microscopy measurements have been carried out to understand the bimetallic nanostructure growth. Kinetic Monte Carlo (KMC) simulations based on kinematics of ad-atoms on an anisotropic template with a solid on solid model in which the relative ratios of binding energies (that are obtained from the Density Functional Theory) have been used and the KMC simulations results agree with the experimental observations. Advantage of having bimetallic structures as effective substrates for Surface enhanced Raman spectroscopy application is demonstrated by detecting Rhodamine 6 G (R6G) molecule at the concentration of 10-7M.

  16. Plasticity and microstructure of epitaxial Ag/Ni multilayers; Mechanische Eigenschaften und Mikrostruktur epitaktischer Ag/Ni-Multilagenschichten

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, Tobias K.

    2007-10-15

    To meet the still increasing technical demands of new materials, it is required to improve basic knowledge of thin films and multilayers. This thesis describes the microstructure and mechanical behaviour of thin epitaxial Ag/Ni-multilayers. Former investigations were only done on polycrystalline multilayers or epitaxial single layers. The manufacture of epitaxial Ag/Ni-multilayers on (111) orientated Si-substrates was performed by a magnetron sputtering technique under ultra high vacuum (UHV). The thickness of the alternating Ag- and Ni-layers varies between 100 and 400 nm, the thickness of the whole film varies between 200 and 800 nm. Hardness and flow stress of Ag/Ni-multilayers were measured with a nanoindentation technique, a substrate curvature method and by X-ray diffraction. The hardness of these multilayers varies between 1.5 and 2.0 GPa. The Ag single film hardness is 0.5 GPa and Ni film 1.8 GPa. The flow stress of the Ag/Ni-multilayers varies between 350 and 800 MPa. The Ag single layer shows a flow stress of 100 MPa and Ni of 450 MPa. Both hardness and flow stress increase with decreasing layer thickness. In situ TEM and HRTEM experiments showed a semicoherent Ag/Ni-interface. It was observed that these interfaces act as sources and sinks. Dislocation loops formed at the interface expand and shrink according to the stress state. They combine with loops from the opposite interface or with the interface itself and form threading dislocations. Dislocation loops penetrating an interface were not observed. Results were compared with various models which simulate flow stress in thin films and multilayers. The most important models are calculated by Nix-Freund, the Source-model after von Blanckenhagen and the Hall-Petch-model. (orig.)

  17. Global optimization of bimetallic cluster structures. I. Size-mismatched Ag-Cu, Ag-Ni, and Au-Cu systems

    Science.gov (United States)

    Rapallo, Arnaldo; Rossi, Giulia; Ferrando, Riccardo; Fortunelli, Alessandro; Curley, Benjamin C.; Lloyd, Lesley D.; Tarbuck, Gary M.; Johnston, Roy L.

    2005-05-01

    A genetic algorithm approach is applied to the optimization of the potential energy of a wide range of binary metallic nanoclusters, Ag-Cu, Ag-Ni, Au-Cu, Ag-Pd, Ag-Au, and Pd-Pt, modeled by a semiempirical potential. The aim of this work is to single out the driving forces that make different structural motifs the most favorable at different sizes and chemical compositions. Paper I is devoted to the analysis of size-mismatched systems, namely, Ag-Cu, Ag-Ni, and Au-Cu clusters. In Ag-Cu and Ag-Ni clusters, the large size mismatch and the tendency of Ag to segregate at the surface of Cu and Ni lead to the location of core-shell polyicosahedral minimum structures. Particularly stable polyicosahedral clusters are located at size N =34 (at the composition with 27 Ag atoms) and N =38 (at the composition with 32 and 30 Ag atoms). In Ag-Ni clusters, Ag32Ni13 is also shown to be a good energetic configuration. For Au-Cu clusters, these core-shell polyicosahedra are less common, because size mismatch is not reinforced by a strong tendency to segregation of Au at the surface of Cu, and Au atoms are not well accommodated upon the strained polyicosahedral surface.

  18. Structure determination of AgPO3 and (AgPO3)0.5(AgI)0.5 glasses by neutron diffraction and small angle neutron scattering

    International Nuclear Information System (INIS)

    Tachez, M.; Mercier, R.; Malugani, J.P.; Chieux, P.

    1987-01-01

    Neutron diffraction and small angle neutron scattering (SANS) were performed on AgPO 3 and (AgPO 3 ) 0.5 (AgI) 0.5 glasses. AgPO 3 glass is made up of long chains of PO 4 tetrahedra joined together by Ag atoms. When silver iodide is added, the radial distribution function shows a large peak at 2.83 A, due to Ag-I interactions. AgI does not modify the network forming unit. The existence of small clusters is confirmed by analysing the coordination number of Ag-I pairs obtained by subtracting the experimental structure function of the AgPO 3 glass from that of the corresponding AgI-doped glasses. A rough estimation of their size is given by SANS experiments. Not all the AgI pairs are involved in AgI cluster units. The compatibility of the results obtained with recent structural investigations by non diffractometric techniques is examined. 23 refs.; 5 figs.; 3 tabs

  19. The Effect of Cu:Ag Atomic Ratio on the Properties of Sputtered Cu–Ag Alloy Thin Films

    Directory of Open Access Journals (Sweden)

    Janghsing Hsieh

    2016-11-01

    Full Text Available Cu–Ag thin films with various atomic ratios were prepared using a co-sputtering technique, followed by rapid thermal annealing at various temperatures. The films’ structural, mechanical, and electrical properties were then characterized using X-ray diffractometry (XRD, atomic force microscopy (AFM, FESEM, nano-indentation, and TEM as functions of compositions and annealing conditions. In the as-deposited condition, the structure of these films transformed from a one-phase to a dual-phase state, and the resistivity shows a twin-peak pattern, which can be explained in part by Nordheim’s Rule and the miscibility gap of Cu–Ag alloy. After being annealed, the films’ resistivity followed the mixture rule in general, mainly due to the formation of a dual-phase structure containing Ag-rich and Cu-rich phases. The surface morphology and structure also varied as compositions and annealing conditions changed. The recrystallization of these films varied depending on Ag–Cu compositions. The annealed films composed of 40 at % to 60 at % Cu had higher hardness and lower roughness than those with other compositions. Particularly, the Cu50Ag50 film had the highest hardness after being annealed. From the dissolution testing, it was found that the Cu-ion concentration was about 40 times higher than that of Ag. The galvanic effect and over-saturated state could be the cause of the accelerated Cu dissolution and the reduced dissolution of the Ag.

  20. Exploring the Optical and Morphological Properties of Ag and Ag/TiO₂ Nanocomposites Grown by Supersonic Cluster Beam Deposition.

    Science.gov (United States)

    Cavaliere, Emanuele; Benetti, Giulio; Van Bael, Margriet; Winckelmans, Naomi; Bals, Sara; Gavioli, Luca

    2017-12-13

    Nanocomposite systems and nanoparticle (NP) films are crucial for many applications and research fields. The structure-properties correlation raises complex questions due to the collective structure of these systems, often granular and porous, a crucial factor impacting their effectiveness and performance. In this framework, we investigate the optical and morphological properties of Ag nanoparticles (NPs) films and of Ag NPs/TiO₂ porous matrix films, one-step grown by supersonic cluster beam deposition. Morphology and structure of the Ag NPs film and of the Ag/TiO₂ (Ag/Ti 50-50) nanocomposite are related to the optical properties of the film employing spectroscopic ellipsometry (SE). We employ a simple Bruggeman effective medium approximation model, corrected by finite size effects of the nano-objects in the film structure to gather information on the structure and morphology of the nanocomposites, in particular porosity and average NPs size for the Ag/TiO₂ NP film. Our results suggest that SE is a simple, quick and effective method to measure porosity of nanoscale films and systems, where standard methods for measuring pore sizes might not be applicable.

  1. Decay kinetics study of Ag0 in silver doped barium aluminoborate glasses

    International Nuclear Information System (INIS)

    Pontuschka, W.M.; Santos, J.T. dos; Isotani, S.; Rabbani, S.R.

    1989-12-01

    EPR measurements of 30BaO.50B 2 O 3 .20Al 2 O 3 at. % glasses containing different amounts of silver impurity, X-and γ-irradiated at room temperature, showed the presence of Ag 0 and Ag ++ centers. Decay kinetics of Ag 0 was determined for different temperatures in glass containing 0.1% of silver. We show that our model of stabilization energy of H 0 in B-O rings through van der Waals forces is not applicable to Ag 0 . Thus, we propose the model of reduction of Ag 0 to Ag + as the mechanism of the Ag 0 decay kinetics. (author) [pt

  2. Toxic effects and bioaccumulation of nano-, micron-, and ionic-Ag on the polychaete, Nereis diversicolor

    DEFF Research Database (Denmark)

    Cong, Yi; Banta, Gary Thomas; Selck, Henriette

    2011-01-01

    There is increasing concern about the toxicities and potential risks, both still poorly understood, of silver nanoparticles for the aquatic environment after their eventual release via wastewater discharges. In this study, the toxicities of sediment associated nano (...)- and ionic (AgNO3)- Ag on the sediment-dwelling polychaete, Nereis diversicolor, were compared after 10 days of sediment exposure, using survival, DNA damage (comet assay) and bioaccumulation as endpoints. The nominal concentrations used in all exposure scenarios were 0, 1, 5, 10, 25, and 50 g Ag/g dry......-Ag treatments and at 50 g/g dw in the ionic-Ag treatment compared to the controls (0 g/g dw). The nano-Ag treatment had the greatest genotoxic effect of the three tested Ag forms, and the ionic-Ag treatment was the least genotoxic. N. diversicolor did accumulate sediment-associated Ag from all three forms. Ag...

  3. Toxic effects and bioaccumulation of nano-, micron- and ionic-Ag in the polychaete, Nereis diversicolor

    DEFF Research Database (Denmark)

    cong, Yi; Banta, Gary Thomas; Selck, Henriette

    There is increasing concern about the toxicities and potential risks, both still poorly understood, of silver nanoparticles for the aquatic environment after their eventual release. In this study, the toxicities of nano (ionic (AgNO3)-Ag on the sediment...... to cause DNA damage in Nereis coelomocytes and that this effect is both concentration- and Ag form-related. There were significantly greater genotoxity (higher tail moment and tail DNA intensities) at 25 and 50 µg/g dw in nano- and micron-Ag treated groups and at 50 µg/g dw in ionic-Ag treated group...... compared to the controls (0 µg/g dw). Nano-Ag has the greatest genotoxic effect of the three tested Ag forms and ionic-Ag is the least genotoxic, indicating different mechanisms are possibly involved to cause DNA damage by the different Ag forms. N. diversicolor did accumulate sediment-associated Ag from...

  4. Irradiation-induced displacement of Ag atoms from lattice sites in an Al-0.2% Mg-0.1% Ag crystal

    International Nuclear Information System (INIS)

    Swanson, M.L.; Howe, L.M.; Quenneville, A.F.

    1976-01-01

    In irradiated alloys of Al containing approximately 0.1 at% Ag, the backscattering - channelling method shows that Al-Ag dumbells are created by the trapping of Al interstitial atoms at Ag solute atoms. The present results demonstrate that the addition of 0.2 at% Mg to such irradiated alloys retards not only the formation of Al-Ag dumbells during annealing from 30 to 100 K but also their annihilation during annealing from 180 to 240 K. Al interstitials are released from Mg traps at 100 to 160 K, causing further trapping at Ag atoms. Approximately 70% of the Ag atoms return to lattice sites at approximately 200 K (stage III) (compared with 100% in the Al-0.1% Ag alloys) and the remainder return to lattice sites at approximately 260 K. These results favour migration of Al-Ag dumbells rather than vacancies during stage III annealing. (author)

  5. Compare the Difference of B-cell Epitopes of EgAgB1 and EgAgB3 Proteins Selected through Bioinformatic Analysis

    Science.gov (United States)

    An, Mengting; Zhang, Fengbo; Zhu, Yuejie; Zhao, Xiao; Ding, Jianbing

    2018-01-01

    Cystic echinococcosis, as a zoonosis, seriously endangers humans and animals, so early diagnosis of this disease is particularly important. Therefore, this study is to predict B-cell epitopes of EgAgB1 and EgAgB3 proteins by bioinformatics software. B-cell epitopes of EgAgB1 and EgAgB3 proteins are predicted using DNAStar and IEDB software. The results suggest that there are two potential B-cell epitopes in EgAgB1, which located in the 8-15 and 31-37 amino acid residue segments. And two potential B-cell epitopes in EgAgB2, located in the 20∼27 and 47∼53 amino acid residue segments. This study predicted the B-cell epitopes of EgAgB1 and EgAgB3 proteins, which laid the foundation for the early diagnosis of Cystic echinococcosis.

  6. Formation of AgFeO2, α-FeOOH, and Ag2O from mixed Fe(NO3)3-AgNO3 solutions at high pH

    Science.gov (United States)

    Krehula, Stjepko; Musić, Svetozar

    2013-07-01

    Precipitation of ternary oxide silver ferrite (AgFeO2), iron oxyhydroxide goethite (α-FeOOH) and silver(I) oxide (Ag2O) from mixed Fe(NO3)3-AgNO3 solutions in a whole [Ag+]:[Fe3+] concentration ratio range at high pH was investigated using X-ray powder diffraction (XRD), 57Fe Mössbauer, FT-IR and UV-Vis-NIR spectroscopies and field emission scanning electron microscopy (FE-SEM). Strong alkalis organic tetramethylammonium hydroxide (TMAH) or inorganic NaOH were used as precipitating agents. Monodispersed lath-like α-FeOOH particles were formed from a pure Fe(NO3)3 solution. The presence of Ag+ ions influenced the formation of the delafossite-type ternary oxide AgFeO2 beside α-FeOOH. The positions of XRD and Mössbauer lines did not suggest any significant incorporation of Ag+ ions into the α-FeOOH structure. AgFeO2 was formed in the precipitation system with the equimolar initial [Ag+]:[Fe3+] concentration ratio. The size and shape of AgFeO2 particles, as well as their structural polytype (2H or 3R), were dependent on reaction temperature, aging time and alkali used. In systems with an excess of Ag+ ions mixtures of AgFeO2 and Ag2O were formed. Single phase Ag2O precipitated from a pure AgNO3 solution.

  7. Distinct metal-exchange pathways of doped Ag25 nanoclusters

    KAUST Repository

    Bootharaju, Megalamane Siddaramappa

    2016-09-09

    Atomically precise metal nanoclusters (NCs) containing more than one type of metal atom (i.e., doped or alloyed), due to synergistic effects, open new avenues for engineering the catalytic and optical properties of NCs in a manner that homometal NCs cannot. Unfortunately, it is still a major challenge to controllably introduce multimetallic dopants in NCs, understanding the dopants\\' positions, mechanism, and synergistic effects. To overcome these challenges, we designed a metal-exchange approach involving NCs as molecular templates and metal ions as the source of the incoming dopant. In particular, two structurally similar monodoped silver-rich NCs, [MAg24(SR)(18)](2-) (M = Pd/Pt and SR: thiolate), were synthesized as templates to study their mechanistic transformation in response to the introduction of gold atoms. The controllable incorporation of Au atoms into the MAg24 framework facilitated the elucidation of distinct doping pathways through high-resolution mass spectrometry, optical spectroscopy and elemental analysis. Interestingly, gold replaced the central Pd atom of [PdAg24(SR)(18)](2-) clusters to produce predominantly bimetallic [AuAg24(SR)(18)](-) clusters along with a minor product of an [Au2Ag23(SR)(18)](-) cluster. In contrast, the central Pt atom remained intact in [PtAg24(SR)(18)](2-) clusters, and gold replaced the noncentral Ag atoms to form trimetallic [AuxPtAg24-x(SR)(18)](2-) NCs, where x = 1-2, with a portion of the starting [PtAg24(SR)(18)](2-) NCs remaining. This study reveals some of the unusual metal-exchange pathways of doped NCs and the important role played by the initial metal dopant in directing the position of a second dopant in the final product.

  8. Synthesis, Characterization, and Evaluation of Ag-based Electrical Contact Materials

    OpenAIRE

    Mao, Fang

    2017-01-01

    Ag is a widely used electrical contact material due to its excellent electrical properties. The problems with Ag are that it is soft and has poor tribological properties (high friction and wear in Ag/Ag sliding contacts). For smart grid applications, friction and wear became increasingly important issues to be improved, due to much higher sliding frequency in the harsh operation environment. The aim of this thesis is to explore several different concepts to improve the properties of Ag electr...

  9. Microstructure, mechanical properties, bio-corrosion properties and antibacterial properties of Ti–Ag sintered alloys

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Mian [Key Lab. for Anisotropy and Texture of Materials, Education Ministry of China, Northeastern University, Shenyang 110819 (China); Zhang, Erlin, E-mail: zhangel@atm.neu.edu.cn [Key Lab. for Anisotropy and Texture of Materials, Education Ministry of China, Northeastern University, Shenyang 110819 (China); Zhang, Lan [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China)

    2016-05-01

    In this research, Ag element was selected as an antibacterial agent to develop an antibacterial Ti–Ag alloy by a powder metallurgy. The microstructure, phase constitution, mechanical properties, corrosion resistance and antibacterial properties of the Ti–Ag sintered alloys have been systematically studied by X-ray diffraction (XRD), scanning electron microscope (SEM), compressive test, electrochemical measurements and antibacterial test. The effects of the Ag powder size and the Ag content on the antibacterial property and mechanical property as well as the anticorrosion property have been investigated. The microstructure results have shown that Ti–Ag phase, residual pure Ag and Ti were the mainly phases in Ti–Ag(S75) sintered alloy while Ti{sub 2}Ag was synthesized in Ti–Ag(S10) sintered alloy. The mechanical test indicated that Ti–Ag sintered alloy showed a much higher hardness and the compressive yield strength than cp-Ti but the mechanical properties were slightly reduced with the increase of Ag content. Electrochemical results showed that Ag powder size had a significant effect on the corrosion resistance of Ti–Ag sintered alloy. Ag content increased the corrosion resistance in a dose dependent way under a homogeneous microstructure. Antibacterial tests have demonstrated that antibacterial Ti–Ag alloy was successfully prepared. It was also shown that the Ag powder particle size and the Ag content influenced the antibacterial activity seriously. The reduction in the Ag powder size was benefit to the improvement in the antibacterial property and the Ag content has to be at least 3 wt.% in order to obtain a strong and stable antibacterial activity against Staphylococcus aureus bacteria. The bacterial mechanism was thought to be related to the Ti{sub 2}Ag and its distribution. - Highlights: • Ti–Ag alloy with up to 99% antibacterial rate was developed by powder metallurgy. • The effects of the Ag powder size and the Ag content on the

  10. Silver bioaccumulation dynamics in a freshwater invertebrate after aqueous and dietary exposures to nanosized and ionic Ag.

    Science.gov (United States)

    Croteau, Marie-Noële; Misra, Superb K; Luoma, Samuel N; Valsami-Jones, Eugenia

    2011-08-01

    We compared silver (Ag) bioavailability and toxicity to a freshwater gastropod after exposure to ionic silver (Ag(+)) and to Ag nanoparticles (Ag NPs) capped with citrate or with humic acid. Silver form, exposure route, and capping agent influence Ag bioaccumulation dynamics in Lymnaea stagnalis. Snails efficiently accumulated Ag from all forms after either aqueous or dietary exposure. For both exposure routes, uptake rates were faster for Ag(+) than for Ag NPs. Snails efficiently assimilated Ag from Ag NPs mixed with diatoms (assimilation efficiency (AE) ranged from 49 to 58%) and from diatoms pre-exposed to Ag(+) (AE of 73%). In the diet, Ag NPs damaged digestion. Snails ate less and inefficiently processed the ingested food, which adversely impacted their growth. Loss rates of Ag were faster after waterborne exposure to Ag NPs than after exposure to dissolved Ag(+). Once Ag was taken up from diet, whether from Ag(+) or Ag NPs, Ag was lost extremely slowly. Large Ag body concentrations are thus expected in L. stagnalis after dietborne exposures, especially to citrate-capped Ag NPs. Ingestion of Ag associated with particulate materials appears as the most important vector of uptake. Nanosilver exposure from food might trigger important environmental risks.

  11. Ag@AgCl QDs decorated g-C3N4 nanoplates: The photoinduced charge transfer behavior under visible light and full arc irradiation

    Science.gov (United States)

    Li, Junqi; Hao, Hongjuan; Zhou, Jian; Li, Weijie; Lei, Nan; Guo, Liu

    2017-11-01

    The quantum dots (QDs) Ag@AgCl decorated g-C3N4 nanoplates was synthesized via a facile oil-in-water self-assembly method, which possessed high dispersion by characterization of scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The as-obtained Ag@AgCl/g-C3N4 nano-heterostructure contained a wide band gap of AgCl nanoparticles (NPs), the surface plasmon resonance (SPR) of Ag NPs and a narrow band gap of g-C3N4 nanoplates. The AgCl NPs with a wide band gap was excited under UV-light, which played a key role on the photoinduced charge transfer of Ag@AgCl/g-C3N4. Under the visible light irradiation, the electrons transfered to the CB of AgCl (electron acceptor) and the holes lefted in the VB of g-C3N4. Nevertheless, under the full arc irradiation, the electrons and holes stayed in the CB of g-C3N4 and VB of AgCl, respectively, then the AgCl was electron donor. The photoinduced charge transfer behavior of Ag@AgCl/g-C3N4 was verified by the photoelectrochemical measurements under the visible light and the full arc irradiation. The results showed that the difference of charge transfer behavior under visible light and the full arc influences on the photoinduced charge transfer ability, further leading to changing the water redox potential in the Ag@AgCl/g-C3N4 nano-heterostructure

  12. Preparation of Ag{sub 2}O/Ag{sub 2}CO{sub 3}/MWNTs composite photocatalysts for enhancement of ciprofloxacin degradation

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Huiqin [School of Materials Science & Engineering, Jiangsu University, Zhenjiang 212013 (China); Li, Jinze [School of Chemistry & Chemical Engineering, Jiangsu University, Zhenjiang 212013 (China); Huo, Pengwei, E-mail: huopw1@163.com [School of Chemistry & Chemical Engineering, Jiangsu University, Zhenjiang 212013 (China); Institute of Green Chemistry and Chemical Technology, Jiangsu University, Zhenjiang 212013 (China); Yan, Yongsheng [School of Chemistry & Chemical Engineering, Jiangsu University, Zhenjiang 212013 (China); Institute of Green Chemistry and Chemical Technology, Jiangsu University, Zhenjiang 212013 (China); Guan, Qingfeng [School of Materials Science & Engineering, Jiangsu University, Zhenjiang 212013 (China)

    2016-03-15

    Graphical abstract: - Highlights: • Ag{sub 2}O/Ag{sub 2}CO{sub 3}/MWNTs were prepared by calcination of the obtained precipitate. • The holes were main contributor for the degradation processes of ciprofloxacin. • The synergistic effect enhanced the activity and stability of composites. - Abstract: The Ag{sub 2}O/Ag{sub 2}CO{sub 3}/multi-walled carbon nanotube (MWNTs) composite photocatalysts were prepared by calcination of the obtained precipitate. The structures and morphology of as-prepared composite photocatalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDS), diffuse reflectance spectroscopy (DRS), photoluminescence (PL) spectroscopy, X-ray photoelectron spectroscopy (XPS). The Ag{sub 2}O/Ag{sub 2}CO{sub 3}/MWNTs composite photocatalysts exhibit higher degradation rate of ciprofloxacin (CIP) than the pure Ag{sub 2}CO{sub 3}, Ag{sub 2}O/Ag{sub 2}CO{sub 3} and Ag{sub 2}CO{sub 3}/MWNTs under visible light irradiation. The amount of loaded Ag{sub 2}CO{sub 3} onto MWNTs and calcined time for Ag{sub 2}CO{sub 3}/MWNTs were systematically investigated, and the optimal amount of loaded Ag{sub 2}CO{sub 3} and calcined time of Ag{sub 2}CO{sub 3}/MWNTs are 150 wt% and 10 min, respectively. The highest photocatalytic degradation rate of CIP could reach 76% under optimal conditions. The active species trapping experiments were also analyzed, the results show that the holes are main contributor for the degradation processes of CIP, furthermore the electrons, ·O{sub 2}{sup −} and ·OH are also crucially influenced the photocatalytic degradation processes of CIP. The possible photocatalytic processes of CIP with Ag{sub 2}O/Ag{sub 2}CO{sub 3}/MWNTs composite photocatalyst are also proposed.

  13. Dielectric properties of nanophase Ag2HgI4 and Ag2HgI4–Al2O3 ...

    Indian Academy of Sciences (India)

    Unknown

    Abstract. The dielectric properties of nanophase Ag2HgI4 and Ag2HgI4–Al2O3 nanocomposites at different frequencies have been studied over a temperature range covering the stability range of β phase of Ag2HgI4 and beyond the β to α phase transition temperature. ε′, tan δ and σa.c. of nanophase Ag2HgI4 and ...

  14. Photo-catalytic activity of Plasmonic Ag@AgCl nanoparticles (synthesized via a green route) for the effective degradation of Victoria Blue B from aqueous phase.

    Science.gov (United States)

    Devi, Th Babita; Begum, Shamima; Ahmaruzzaman, M

    2016-07-01

    This study reports a green process for the fabrication of Ag@AgCl (silver@silver chloride) nanoparticles by using Aquilaria agallocha (AA) leaves juice without using any external reagents. The effect of various reaction parameters, such as reaction temperature, reaction time and concentration of Aquilaria agallocha leaves juice in the formation of nanoparticles have also been investigated. From the FTIR spectra of leaves juice and phytochemicals test, it was found that flavonoids present in the leaves are responsible for the reduction of Ag(+) ions to Ag(0) species and leads to the formation of Ag@AgCl NPs. The synthesized Ag@AgCl NPs were utilized for the removal of toxic and hazardous dyes, such as Victoria Blue B from aqueous phase. Approximately, 99.46% degradation of Victoria Blue B dye were observed with Ag@AgCl NPs. Furthermore, the photocatalytic activity of the Ag@AgCl nanoparticles was unchanged after 5cycles of operation. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Preparation, characterization and photocatalytic activity of visible-light-driven plasmonic Ag/AgBr/ZnFe2O4 nanocomposites

    International Nuclear Information System (INIS)

    Li, Xiaojuan; Tang, Duanlian; Tang, Fan; Zhu, Yunyan; He, Changfa; Liu, Minghua; Lin, Chunxiang; Liu, Yifan

    2014-01-01

    Highlights: • A plasmonic Ag/AgBr/ZnFe 2 O 4 photocatalyst has been successfully synthesized. • Ag/AgBr/ZnFe 2 O 4 nanocomposites exhibit high visible light photocatalytic activity. • Ag/AgBr/ZnFe 2 O 4 photocatalyst is stable and magnetically separable. - Abstract: A visible-light-driven plasmonic Ag/AgBr/ZnFe 2 O 4 nanocomposite has been successfully synthesized via a deposition–precipitation and photoreduction through a novel one-pot process. X-ray diffraction spectroscopy, X-ray photoelectron spectroscopy, scanning electron microscopy, transmission electron microscopy and UV–vis diffuse reflectance spectroscopy were employed to investigate the crystal structure, chemical composition, morphology, and optical properties of the as-prepared nanocomposites. The photocatalytic activities of the nanocomposites were evaluated by photodegradation of Rhodamine B (RhB) and phenol under visible light. The results demonstrated that the obtained Ag/AgBr/ZnFe 2 O 4 nanocomposites exhibited higher photocatalytic activity as compared to pure ZnFe 2 O 4 . In addition, the sample photoreduced for 20 min and calcined at 500 °C achieved the highest photocatalytic activity. Furthermore, the Ag/AgBr/ZnFe 2 O 4 nanocomposite has high stability under visible light irradiation and could be conveniently separated by using an external magnetic field

  16. Controlled preparation of Ag nanoparticle films by a modified photocatalytic method on TiO{sub 2} films with Ag seeds for surface-enhanced Raman scattering

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Xin; Pan, Lujun, E-mail: lpan@dlut.edu.cn; Li, Shuai; Wang, Qiao; Qin, Jun; Huang, Yingying

    2016-02-15

    Graphical abstract: - Highlights: • Uniform Ag nanoparticle films were synthesized by a modified photocatalytic method on TiO{sub 2} films with Ag seeds for surface-enhanced Raman scattering. • This modified photocatalytic method combine the advantages of the spurting method (high nucleation density) and the traditional photocatalytic method (suitable particle size). • The Raman enhancement of as-prepared Ag NP films was calculated by finite-difference time-domain to validate the experiment data. - Abstract: Uniform Ag nanoparticle (NP) films were synthesized by a modified photocatalytic method on TiO{sub 2} films with Ag seeds for surface-enhanced Raman scattering, which combine the advantages of the spurting method (high nucleation density) and the traditional photocatalytic method (suitable particle size). The Ag seeds were prepared by magnetron sputtering with different time, which would adjust the distribution and transfer of electrons on the surface of TiO{sub 2} film in the process of photocatalytic reduction. The distribution and morphology of Ag NP films can be adjusted by the sputtering time and the UV irradiation time. The Raman enhancement of as-prepared Ag NP films was calculated by finite-difference time-domain to validate the experiment data. It is found that the Ag NP films synthesized on TiO{sub 2} films with suitable pre-deposited Ag seeds exhibit a much higher Raman enhancement activity than the optimum Ag NP film synthesized directly on the TiO{sub 2} film without Ag seeds.

  17. A new family of clusters containing a silver-centered tetracapped [Ag@Ag4(μ3-P)4] tetrahedron, inscribed within a N12icosahedron.

    Science.gov (United States)

    Artem'ev, Alexander V; Bagryanskaya, Irina Yu; Doronina, Evgeniya P; Tolstoy, Peter M; Gushchin, Artem L; Rakhmanova, Mariana I; Ivanov, Alexander Yu; Suturina, Anastasiya O

    2017-09-26

    An unprecedented silver-centered P-tetracapped [Ag@Ag 4 (μ 3 -P) 4 ] tetrahedron inscribed within a N 12 icosahedral cage has been discovered in the novel family of luminescent clusters. The latter are easily self-assembled by reacting Ag I salts with tris(2-pyridyl)phosphine (Py 3 P).

  18. Tribological properties of CrAgN thin films

    Directory of Open Access Journals (Sweden)

    Peter Jurči

    2013-02-01

    Full Text Available CrN and CrAgN thin films were magnetron sputtered onto the substrate made from Vanadis 6 cold work tool steel. The films were examined on tribological properties using a high temperature Pin-on-disc tribometer. Obtained results show that there is almost no effect of Ag addition on the friction coefficient when tested at a room temperature against alumina. The testing against the same counterpart at higher temperature gave positive effect of the silver addition on the m. The testing against 100Cr6 ball bearing steel gave higher friction coefficient than that against alumina while the testing against CuSn6-bronze led to much lower m. When tested at a room temperature, the wear performance of the films was positively affected only in the case of the CrAg3N film developed at 500 oC. On the other hand, addition of 3 wt% Ag into the CrN increased the wear performance at elevated temperatures while the addition of 15 wt% Ag has made the film too soft and sensitive to wear.

  19. Antibacterial effect assessment of ZnS: Ag nanoparticles

    Directory of Open Access Journals (Sweden)

    Najme Parvin

    2016-07-01

    Full Text Available Objective(s: A large ratio of surface to volume of nanoparticles in comparison with bulk ones, will increase the cell penetration and therefore their toxicity. Materials and Methods: Chemical precipitation method was used in order to synthesis of ZnS:Ag quantum dots. Their Physical properties and characteristics were assessed by X-ray diffraction, Ultra Violet-Visible Spectrophotometer, Transmission Electron Microscope and it was shown that the obtained ZnS:Ag quantum dots are cubic with high-quality. Antibacterial effects of ZnS:Ag nanoparticles against Pseudomonas aeroginosa, Staphylococcus aureus and Salmonella typhi were investigated. Disc bacteriological tests were used in order to assessment of the antibacterial effects of ZnS:Ag nanoparticles. Results: The size of inhibition zone was different according to the type of bacteria and the concentrations of ZnS:Ag QDs. The maximum diameter was happened for S. aureus. The results of  MICs obtained fromBroth Dilution for Pseudomonas aeruginosa , Staphylococcus aureus and Salmonella typhi, are 3.05 , 3.05 and 6.1 mg/ml whereas the amounts of obtained MBCs are 12.2 , 6.1 and 12.2 mg/ml respectively. Conclusion: In conclusion, by increasing the nanoparticle concentration in wells and discs, the growth inhibition and diameter of inhibition zone has also been increased.

  20. Ag-graphene hybrid conductive ink for writing electronics.

    Science.gov (United States)

    Xu, L Y; Yang, G Y; Jing, H Y; Wei, J; Han, Y D

    2014-02-07

    With the aim of preparing a method for the writing of electronics on paper by the use of common commercial rollerball pens loaded with conductive ink, hybrid conductive ink composed of Ag nanoparticles (15 wt%) and graphene-Ag composite nanosheets (0.15 wt%) formed by depositing Ag nanoparticles (∼10 nm) onto graphene sheets was prepared for the first time. Owing to the electrical pathway effect of graphene and the decreased contact resistance of graphene junctions by depositing Ag nanoparticles (NPs) onto graphene sheets, the concentration of Ag NPs was significantly reduced while maintaining high conductivity at a curing temperature of 100 ° C. A typical resistivity value measured was 1.9 × 10(-7) Ω m, which is 12 times the value for bulk silver. Even over thousands of bending cycles or rolling, the resistance values of writing tracks only increase slightly. The stability and flexibility of the writing circuits are good, demonstrating the promising future of this hybrid ink and direct writing method.

  1. Contrasting antibody responses to intrasubtype superinfection with CRF02_AG.

    Directory of Open Access Journals (Sweden)

    Colleen R Courtney

    Full Text Available HIV superinfection describes the sequential infection of an individual with two or more unrelated HIV strains. Intersubtype superinfection has been shown to cause a broader and more potent heterologous neutralizing antibody response when compared to singly infected controls, yet the effects of intrasubtype superinfection remain controversial. Longitudinal samples were analyzed phylogenetically for pol and env regions using Next-Generation Sequencing and envelope cloning. The impact of CRF02_AG intrasubtype superinfection was assessed for heterologous neutralization and antibody binding responses. We compared two cases of CRF02_AG intrasubtype superinfection that revealed complete replacement of the initial virus by superinfecting CRF02_AG variants with signs of recombination. NYU6564, who became superinfected at an early time point, exhibited greater changes in antibody binding profiles and generated a more potent neutralizing antibody response post-superinfection compared to NYU6501. In contrast, superinfection occurred at a later time point in NYU6501 with strains harboring significantly longer V1V2 regions with no observable changes in neutralization patterns. Here we show that CRF02_AG intrasubtype superinfection can induce a cross-subtype neutralizing antibody response, and our data suggest timing and/or superinfecting viral envelope characteristics as contributing factors. These results highlight differential outcomes in intrasubtype superinfection and provide the first insight into cases with CRF02_AG, the fourth most prevalent HIV-1 strain worldwide.

  2. The AGS Ggamma Meter and Calibrating the Gauss Clock

    Energy Technology Data Exchange (ETDEWEB)

    Ahrens, Leif [Brookhaven National Laboratory (BNL), Upton, NY (United States). Collider-Accelerator Dept.

    2014-03-31

    During AGS Polarized Proton acceleration periods, one output from the AGS Ggamma Meter, namely the energy (or Ggamma) calculated from the magnetic field in the AGS main magnets and the beam radius- both measured in particular instant, is used to figure out the times in the AGS magnet acceleration cycle when the beam passes through a particular set of depolarizing resonances. The resonance set occur whenever a particle’s Ggamma (energy*(G/m) becomes nearly equal to n*Qx (i.e. any integer multiplied by the horizontal betatron tune). This deliverable is why the machinery is referred to as the ''Ggamma Meter'' rather than the AGS energy meter. The Ggamma Meter takes as inputs a set of measurements of frequency (F(t)), radius (r(t)), and gauss clock counts (GCC(t)). The other energy (GgammaBr) assumes the field when the gauss clock starts counting is known. The change in field to time t is given by the measured accumulated gauss clock counts multiplied by the gauss clock calibration (gauss/GCC). In order to deal with experimental data, this calibration factor gets an added ad hoc complication, namely a correction dependent on the rate of change the counting rate. The Ggamma meter takes GCC(t) and together with the past history for this cycle calculates B(t).

  3. Coating of hydroxyapatite doped Ag on commercially pure titanium surface

    International Nuclear Information System (INIS)

    Vieira, Jonas de Oliveira; Vercik, Luci Cristina de Oliveira; Rigo, Eliana Cristina da Silva

    2012-01-01

    This paper presents results of bioactive coating on commercially pure titanium surface (CpTi) doped with Ag ions. The coating consists of 3 steps, in step 1- surface chemical treatment of the samples with NaOH, step 2 - immersing the substrate in question in a sodium silicate solution (SS) to the nucleation and step 3 - reimmersion these substrates in synthetic solution that simulates the blood serum for precipitation and growth of apatite layer. After the coating step the AgNO 3 substrates were immersed in solutions with concentrations of 20 ppm and 100 ppm at 37 ° C for 48h. The substrates were characterized by scanning electron microscopy (SEM), infrared spectroscopy (IR) and X-ray diffraction (XRD). By the results verified the formation of an apatite layer with aspects of cells, on the surface of CpTi. The increase in Ag concentration causes an increase in Ag amount doped in apatite layer. With the results we concluded that it is possible to obtain an apatite layer on a metal surface as the CpTi doped with Ag ions

  4. CrAg lateral flow assay for cryptococcosis.

    Science.gov (United States)

    Kozel, Thomas R; Bauman, Sean K

    2012-05-01

    Importance of field: Cryptococcal meningitis is a leading cause of death globally among people with AIDS. In sub-Saharan Africa, cryptococcosis is estimated to kill more people than tuberculosis. Cryptococcosis is also an important infectious disease among immunosuppressed patients in countries with advanced medical care. Early diagnosis is the key to effective treatment, particularly in patients in resource-limited settings. A new lateral flow immunoassay (LFA) for cryptococcal antigen (CrAg) allows for rapid and inexpensive diagnosis of cryptococcosis at or near the point of patient contact. This article reviews the need for improved diagnostics for cryptococcal meningitis and describes the features of an ideal diagnostic. The design of a new LFA for CrAg is described as well as the results of initial clinical evaluation of the CrAg LFA. The CrAg LFA is recommended for use with serum, plasma or CSF for diagnosis of cryptococcal meningitis or non-meningeal cryptococcal disease in symptomatic patients. There is a need for further evaluation of LFA for screening of asymptomatic patients. However, the LFA is emerging as a valuable tool for screening of serum or plasma in ART-naive adults with CD4 counts less than 100 cells/mm(3) in geographic regions with a high prevalence of cryptococcal antigenemia. CrAg screening has the potential to identify patients with asymptomatic cryptococcal infection who should receive preemptive antifungal therapy.

  5. thermal, electrical and structural characterization of fast ion conducting glasses (Ag Br)x(AgPO)1-x

    International Nuclear Information System (INIS)

    Kartini, E.; Yufus, S.; Priyanto, T; Indayaningsih, N; Collins, M F

    2001-01-01

    Fast ion conducting glasses are of considerable technological interest because of their possible application in batteries, sensors, and displays. One of the main scientific challenges is to explain how the disordered structure of the glass is related to the high ionic conductivity that can be achieved at ambient temperature. Fast ion conducting glasses (AgBr) x (AgPO3) 1- x with x=0.0; 0.2; 0.3; 0.4; 0.5; 0.7; and 0.85 were prepared by rapid quenching. The studies of structure, thermal property and electrical conductivity have been made. The X-ray diffraction patterns of this system show that the sample are glasses for x 0.5. The neutron diffraction data shows that all AgBr doped glasses exhibit a strong and relatively sharp diffraction peak at anomalously low momentum transfer value, Q∼ 0.7 Α - 1. The low Q-peak is not observed in AgPO 3 glass, and in the X-ray data. The results of electrical conductivity show that the conduction is essentially ionic and due to silver ions alone. The logarithm of the ionic conductivity increases with increasing AgBr mole fraction, and reaches maximum for x = 0.5. The thermal property results measured by differential scanning calorimetric show that the temperatures of the glass transition, the crystallization and the melt reach minimum for the glass with composition x 0.5. We conclude that there appears to be a relation between higher conductivity at ambient temperature, and the low Q-peak. Based on this investigation a better fast ion conducting glass proposed is (AgBr) 0 .5(AgPO 3 ) 0 .5 with the conductivity of 8 x 10 - 5 S/cm

  6. Application of a newly developed high-sensitivity HBsAg chemiluminescent enzyme immunoassay for hepatitis B patients with HBsAg seroclearance.

    Science.gov (United States)

    Shinkai, Noboru; Matsuura, Kentaro; Sugauchi, Fuminaka; Watanabe, Tsunamasa; Murakami, Shuko; Iio, Etsuko; Ogawa, Shintaro; Nojiri, Shunsuke; Joh, Takashi; Tanaka, Yasuhito

    2013-11-01

    We modified and automated a highly sensitive chemiluminescent enzyme immunoassay (CLEIA) for surface antigen (HBsAg) detection using a combination of monoclonal antibodies, each for a specific epitope of HBsAg, and by improving an earlier conjugation technique. Of 471 hepatitis B virus (HBV) carriers seen in our hospital between 2009 and 2012, 26 were HBsAg seronegative as determined by the Abbott Architect assay. The Lumipulse HBsAg-HQ assay was used to recheck those 26 patients who demonstrated seroclearance by the Abbott Architect assay. The performance of the Lumipulse HBsAg-HQ assay was compared with that of a quantitative HBsAg detection system (Abbott Architect) and the Roche Cobas TaqMan HBV DNA assay (CTM) (lower limit of detection, 2.1 log copies/ml) using blood serum samples from patients who were determined to be HBsAg seronegative by the Abbott Architect assay. Ten patients had spontaneous HBsAg loss. Of 8 patients treated with nucleotide analogues (NAs), two were HBsAg seronegative after stopping lamivudine therapy and 6 were HBsAg seronegative during entecavir therapy. Eight acute hepatitis B (AH) patients became HBsAg seronegative. Of the 26 patients, 16 were HBsAg positive by the Lumipulse HBsAg-HQ assay but negative by the Abbott Architect assay. The differences between the two assays in terms of detectable HBsAg persisted over the long term in the spontaneous loss group (median, 10 months), the NA-treated group (2.5 months), and the AH group (0.5 months). In 9 patients, the Lumipulse HBsAg-HQ assay detected HBsAg when HBV DNA was negative by the CTM assay. HBsAg was also detected by the Lumipulse HBsAg-HQ assay in 4 patients with an anti-HBs concentration of >10 mIU/ml, 3 of whom had no HBsAg escape mutations. The automatic, highly sensitive HBsAg CLEIA Lumipulse HBsAg-HQ is a convenient and precise assay for HBV monitoring.

  7. The Study on the Prevalence and Significance of Urinary HBsAg Detection

    International Nuclear Information System (INIS)

    Han, Jin Suk; Pyo, Heui Jung; Shin, Young Tae; Park, Jeong Sik; Kim, Suhng Gwon; Choe, Kang Won; Lee, Jung Sang; Lee, Mon Ho

    1981-01-01

    HBsAg. was identified in the urine of the patients positive for serum HBsAg. by Tripatzis in 1970. In 1977, Hourani et al reported the incidence of HBsAg. in urine was about 52% in the patients positive for serum HBsAg. with hemodialysis treatment due to chronic renal failure. A series of studies on the HBsAg. in urine has revealed the urine of the patients positive for serum HBsAg. to be important source of infection. But there's much room to debate on the relationship of HBsAg. in urine with infectivity and the exact mechanism of urinary emergence of HBsAg. The authors detected HBsAg. in serum and urine by employing sandwitch solid-phase radioimmunoassay, and performed urinalysis, liver function test and renal function evaluation. Percutanous liver and/or kidney biopsies were done. Among 38 renal disease patients, 9 cases(23.4%) were shown to be positive for serum HBsAg. and 5 cases(55.5%) among above 9 patients positive for urine HBsAg. 56 cases(67.4%) of 83 liver disease patients revealed positive for serum HBsAg. All 10 renal and liver disease patients revealed positive serum HBsAg., and among the 9 cases(90%) positive for urine HBsAg. In the 25 patients positive for urine HBsAg. all of 5 renal patients and 9 renal and liver patients had hematuria or/and proteinuria above 2 positive for albumin. But in the 11 liver patients 6 cases(55.1%) were normal findings. And there's no significant in cpm of urine HBsAg. between the patient positive for serum HBsAg. and negative, and in cpm of serum HBsAg. between liver and renal disease patients. But there's statistical significance in cm of urine HBsAg. between renal and liver diseases.

  8. Plants for H- acceleration in the AGS Linac

    International Nuclear Information System (INIS)

    Barton, D.S.; Witkover, R.L.

    1979-01-01

    Since its commissioning in 1970, the 200 MeV Linac at the Brookhaven AGS has been capable of producing peak proton beam current of greater than 100 mA with pulse lengths up to 300 μsec at a repetition rate of 10 pulses/second. The linac typically runs at 5 pulses per second, providing a 60 mA pulse of 120 μsec duration every 1.6 to 2.4 seconds for conventional multiturn injection into the AGS. The intervening pulses of length up to 300 μsec are used by the radio-isotope production, chemistry and medical facilities. Preparations are now being made to inject and accelerate H - ions in order to implement charge exchange injection into the AGS. This paper describes the aspects of this work leading to an H - beam at 200 MeV

  9. The average orbit system upgrade for the Brookhaven AGS

    International Nuclear Information System (INIS)

    Ciardullo, D.J.; Brennan, J.M.

    1995-01-01

    The flexibility of the AGS to accelerate protons, polarized protons and heavy ions requires average orbit instrumentation capable of performing over a wide range of beam intensity (10 9 to 6 x 10 13 charges) and accelerating frequency (1.7MHz to 4.5MHz). In addition, the system must be tolerant of dramatic changes in bunch shape, such as those occurring near transition. Reliability and maintenance issues preclude the use of active electronics within the high radiation environment of the AGS tunnel, prompting the use of remote bunch signal processing. The upgrade for the AGS Average Orbit system is divided into three areas: (1) a new Pick Up Electrode (PUE) signal delivery system; (2) new average orbit processing electronics; and (3) centralized peripheral and data acquisition hardware. A distributed processing architecture was chosen to minimize the PUE signal cable lengths, the group of four from each detector location being phase matched to within ±5 degree

  10. Anomalous scaling of Cu-island dynamics on Ag(100)

    Energy Technology Data Exchange (ETDEWEB)

    Zaum, Christopher; Morgenstern, Karina [Institut fuer Festkoerperphysik, Gottfried Wilhelm Leibniz Universitaet, Appelstr. 2, D-30167 Hannover (Germany)

    2008-07-01

    We deposited Cu-islands containing 10 to 500 atoms on a clean Ag(100) surface at room temperature and investigated diffusion and decay of these islands with a fast scanning tunneling microscope. Islands at sizes above 80 atoms per island are adsorbed in hollow-sites. Islands at sizes below 80 atoms per island are adsorbed in bridge-sites. Diffusion and decay behavior of the hollow-site islands is similar to the behavior of both Ag-islands on Ag(100) and Cu-islands on Cu(100). In contrast, the diffusivity and the decay time of the bridge-site islands are significantly higher than any previously measured values. This indicates a novel mechanism of diffusion.

  11. The creep behavior of In-Ag eutectic solder joints

    International Nuclear Information System (INIS)

    Reynolds, H.L.; Kang, S.H.; Morris, J.W. Jr.; Univ. of California, Berkeley, CA

    1999-01-01

    The addition of 3 wt.% Ag to In results in a eutectic composition with improved mechanical properties while only slightly lowering the melting temperature. Steady-state creep properties of In-Ag eutectic solder joints have been measured using constant load tests at 0, 30, 60, and 90 C. Constitutive equations are derived to describe the creep behavior. The data are well represented by an equation of the form proposed by Dorn: a power-law equation applies to each independent creep mechanism. Two parallel mechanisms were observed for the In-Ag eutectic joints. The high-stress mechanism is a bulk mechanism with a thermal dependence dominated by the thermal dependence of creep in the In-rich matrix. The low-stress mechanism is a grain boundary mechanism. Results of this work are discussed with regard to creep behavior of typical eutectic systems

  12. Multilayer silicene: clear evidence of Ag-terminated bulk silicon

    Science.gov (United States)

    Curcella, A.; Bernard, R.; Borensztein, Y.; Lazzeri, M.; Resta, A.; Garreau, Y.; Prévot, G.

    2017-06-01

    The existence of silicite, a new allotrope of silicon based on a stacking of hexagonal silicene planes, is one of the most discussed topics in the field of two-dimensional materials. Using grazing incidence x-ray diffraction (GIXD), we have followed the in situ growth of Si films on Ag(1 1 1) in the low-temperature growth regime (510-520 K). GIXD experiments demonstrate that Si films have a diamond-like structure, with an average lattice constant slightly different from that of bulk Si. The diffracted intensities associated with Si films are well reproduced by the Ag/Si(1 1 1) ≤ft(\\sqrt{3}× \\sqrt{3}\\right)R{{30}{^\\circ}} honeycomb chain model, whereas models with Ag-free Si surfaces fail to reproduce the experimental data.

  13. Why is AgBr not a superionic conductor

    International Nuclear Information System (INIS)

    Andreoni, W.; Tosi, M.P.

    1982-03-01

    The behaviour of AgCl and AgBr is contrasted with that of fluorite-type crystals, which also are Frenkel conductors at low temperatures but undergo a diffuse transition to a superionic phase before melting. Concentrating on AgBr for which the relevant defect parameters are better known, a Debye-Hueckel model for the interactions between defects, modified for saturation of screening at high defect concentrations, is used to show that both Frenkel and Schottky disorder are present and rapidly increasing with temperature in the hot solid, with the Schottky component rapidly overtaking the Frenkel component. It is suggested that this defect behaviour frustrates a superionic transition and leads to melting accompanied by an anomalous ionic conductivity in the premelting region. The model is tested by a comparison with data on the Frenkel defect concentration in superionic PbF 2 . (author)

  14. Precipitation behavior of Ag-Pd-In dental alloys.

    Science.gov (United States)

    Suh, Y C; Lee, Z H; Ohta, M

    2000-01-01

    Age-hardening characteristics and precipitation behavior of Ag-25%Pd-3%In-1%Zn-0.5%Ir alloy were investigated in detail by means of hardness testing, X-ray diffraction, electron microscopy and resistivity measurement. The solution treating could be accomplished at 980 degrees C and the aging in the temperature range from 950 to 850 degrees C occurred by continuous precipitation. The aging in the temperature range from 850 to 450 degrees C occurred first, forming GP-zones with a hardness increase and then in overaging stage by forming discontinuous precipitation, which consisted of lamellae of solute (Pd, In, Zn) depleted Ag-rich phase and (Pd,Ag)3(In,Zn) intermetallic phase. The hardness increased very fast to its peak in 10 min during aging at temperatures between 450 and 550 degrees C. Copyright 2000 Kluwer Academic Publishers

  15. Object-oriented programming techniques for the AGS Booster

    International Nuclear Information System (INIS)

    Skelly, J.F.

    1991-01-01

    The applications software developed for the control system of the AGS Booster Project was written in the object-oriented language, C++. A the start of the Booster Project, the programming staff of the AGS Controls Section comprised some dozen programmer/analysts, all highly fluent in C but novices in C++. During the coarse of this project, nearly the entire staff converted to using C++ for a large fraction of their assignments. Over 100 C++ software modules are now available for Booster and general AGS use, of which a large fraction are broadly applicable tools. The transition from C to C++ from a managerial perspective is discussed and an overview is provided of the ways in which object classes have been applied in Booster software development

  16. Cladding technique for development of Ag-In-Cd decoupler

    International Nuclear Information System (INIS)

    Teshigawara, M.; Harada, M.; Saito, S.; Kikuchi, K.; Kogawa, H.; Ikeda, Y.; Kawai, M.; Kurishita, H.; Konashi, K.

    2005-01-01

    To develop a Ag (silver)-In (indium)-Cd (cadmium) alloy decoupler, a method is needed to bond the decoupler between two plates of the Al alloy (A6061-T6). We found that a better HIP condition was temperature, pressure and holding time at 803 K, 100 MPa and 1 h, respectively, for small test pieces (φ 22 mm in diam. x 5 mm in height). Especially, a sandwich case (a Ag-In plate with thickness of 0.5 mm between two Ag-Cd plates with thickness of 1.25 mm) gave easier (or better) bonding results. Though a hardened layer is found in the bonding layer, the rupture strength of the bonding layer is more than 30 MPa, which is higher than the design stress in our application

  17. The Catalytic Behaviour of NanoAg@montmorillonite Composite Materials

    Science.gov (United States)

    Karlíková, Martina; Kvítek, Libor; Prucek, Robert; Panáček, Aleš; Filip, Jan; Pechoušek, Jiří; Adegboyega, Nathaniel F.

    The preparation of nanoAg@montmorillonite composite materials and their catalytic activity is reported in this article. The nanoAg@montmorillonite composite materials were prepared by the adsorption of silver NPs, with an average size about 30 nm, from their aqueous dispersion onto two types of montmorillonite with different chemical composition. Silver NPs were prepared via modified Tollens process, which involves the reduction of [Ag(NH3)2]+ complex cation by maltose. The amount of silver NPs anchored onto the MMT surfaces was determined by UV-VIS spectroscopy; the decrease in absorbance of the dispersion after the adsorption was monitored. Prepared nanocomposite materials were subsequently characterized by means of transmission electron microscopy (TEM) and powder X-ray diffraction (XRD). The reduction of 4-nitrophenol by sodium borohydride was chosen to examine the catalytic properties of the synthesized silver nanocomposite materials.

  18. The RHIC/AGS Online Model Environment: Design and Overview

    International Nuclear Information System (INIS)

    Satogata, T.; Brown, K.; Pilat, F.; Tafti Alai, A.; Tepikian, S.; Vanzeijtz

    1999-01-01

    An integrated online modeling environment is currently under development for use by AGS and RHIC physicists and commissioners. This environment combines the modeling efforts of both groups in a CDEV[1] client-server design, providing access to expected machine optics and physics parameters based on live and design machine settings. An abstract modeling interface has been designed as a set of adapters[2] around core computational modeling engines such as MAD and UAL/Teapot++[3]. This approach allows us to leverage existing survey, lattice, and magnet infrastructure, as well as easily incorporate new model engine developments. This paper describes the architecture of the RHIC/AGS modeling environment, including the application interface through CDEV and general tools for graphical interaction with the model using Tcl/Tk. Separate papers at this conference address the specifics of implementation and modeling experience for AGS and RHIC

  19. High intensity proton acceleration at the Brookhaven AGS -- An update

    International Nuclear Information System (INIS)

    Ahrens, L.; Alessi, J.; Blaskiewicz, M.

    1997-01-01

    The AGS accelerator complex is into its third year of 60+ x 10 12 (teraproton = Tp) per cycle operation. The hardware making up the complex as configured in 1997 is briefly mentioned. The present level of accelerator performance is discussed. This includes beam transfer efficiencies at each step in the acceleration process, i.e. losses; which are a serious issue at this intensity level. Progress made in understanding beam behavior at the Linac-to-Booster (LtB) injection, at the Booster-to-AGS (BtA) transfer as well as across the 450 ms AGS accumulation porch is presented. The state of transition crossing, with the gamma-tr jump is described. Coherent effects including those driven by space charge are important at all of these steps

  20. Thermal Behavior of Ag Micro/Nano Wires Formed by Low-Temperature Sintering of Ag Nanoparticles

    Science.gov (United States)

    Wang, Wen; Zhong, Yinghui; Li, Dongxue; Wang, Pan; Cai, Yuwei; Duan, Zhiyong

    2015-12-01

    Ag nanoparticles of 30 nm size were deposited onto a Si substrate to form Ag microwires. The nanoparticles were transformed into continuous Ag wires with low-temperature heat treatment at temperatures not higher than 200°C. The morphology, electrical properties, and interface of the sintered Ag nanoparticle wires are described. It is shown that the neck between the nanoparticles begins to form at 150°C, and obvious metallization was found at 170°C. The changes of the crystal structure of the Ag wires at different sintering temperatures were analyzed by x-ray diffractometry. The grain boundary resistance decreased as the crystal grain size increased above 130 nm. The corresponding resistivity of the microstructure is close to that of the bulk. Through the comparison between the Mayadas-Shatzkes's model and experimental data, the range of the grain boundary reflection coefficient C at different temperatures is obtained. This research lays the foundation for the study of nanoimprint lithography with a pseudoplastic metal nanoparticle fluid.

  1. Microwave assisted hydrothermal synthesis of Ag/AgCl/WO3 photocatalyst and its photocatalytic activity under simulated solar light

    International Nuclear Information System (INIS)

    Adhikari, Rajesh; Gyawali, Gobinda; Sekino, Tohru; Wohn Lee, Soo

    2013-01-01

    Simulated solar light responsive Ag/AgCl/WO 3 composite photocatalyst was synthesized by microwave assisted hydrothermal process. The synthesized powders were characterized by X-Ray Diffraction (XRD) spectroscopy, X-Ray Photoelectron Spectroscopy (XPS), Transmission Electron Microscopy (TEM), Diffuse Reflectance Spectroscopy (UV–Vis DRS), and BET surface area analyzer to investigate the crystal structure, morphology, chemical composition, optical properties and surface area of the composite photocatalyst. This photocatalyst exhibited higher photocatalytic activity for the degradation of rhodamine B under simulated solar light irradiation. Dye degradation efficiency of composite photocatalyst was found to be increased significantly as compared to that of the commercial WO 3 nanopowder. Increase in photocatalytic activity of the photocatalyst was explained on the basis of surface plasmon resonance (SPR) effect caused by the silver nanoparticles present in the composite photocatalyst. Highlights: ► Successful synthesis of Ag/AgCl/WO 3 nanocomposite. ► Photocatalytic experiment was performed under simulated solar light. ► Nanocomposite photocatalyst was very active as compared to WO 3 commercial powder. ► SPR effect due to Ag nanoparticles enhanced the photocatalytic activity.

  2. Inhibition of carbon monoxide on methanol oxidation over γ-alumina supported Ag, Pd and Ag Pd catalysts

    Science.gov (United States)

    Wang, Jin-an; Aguilar-Ríos, G.; Wang, Ren

    1999-05-01

    The activities of CH 3OH and CO oxidative reactions over the γ-alumina supported Ag, Pd and Ag-Pd catalysts were measured with the MR-GC method. The CO-temperature-programmed desorption (CO-TPD) and in situ IR techniques were used to characterize the CO adsorption behavior on the surface of the catalysts. The oxidative activity for CO to CO 2 increased in the following sequence: 5% Ag/γ-Al 2O 3<0.1% Pd/γ-Al 2O 3<5% Ag-0.1% Pd/γ-Al 2O 3. An inhibition action of CO to CH 3OH oxidation, that is dependent of the active components of the catalysts, was observed when CO was present in the methanol-fed stream. The results of IR and CO-TPD showed that the poor oxidative activity of CO over Ag catalyst was due to its low adsorption capacity on this catalyst. The very strong adsorption ability of CO on the Pd catalyst was responsible for the strong inhibition of CO to CH 3OH oxidation activity. The plausible mechanisms of CO strong inhibition behavior on methanol oxidation over the different catalysts are discussed in detail from the viewpoints of both electronic and geometric effects.

  3. The RAG AG. The company in the course of energy supply; Die RAG AG. Konzern im Wandel der Energieversorgung

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, Peter; Dyga, Ricarda [RAG Aktiengesellschaft, Herne (Germany)

    2013-02-15

    The RAG AG (Herne, Federal Republic of Germany) as a company in the energy supply sector unifies the RAG Deutsche Steinkohle AG (Herne, Federal Republic of Germany), The RAG Anthrazit Ibbenbueren (Ibbenbueren, Federal Republic of Germany), the RAG Montan Immobilien GmbH (Essen, Federal Republic of Germany) and the RAG Mining Solutions GmbH (Herne, Federal Republic of Germany) under the same. The group of companies with the headquarters in Herne (Federal Republic of Germany) consists of branch offices in North Rhine-Westphalia and Saarland. Until the end of the year 2012, only three mines in the Ruhr district and one mine in the county Steinfurt were in operation. Still it is said that the withdrawal of the mining industry is beginning. With the political decision to cancel the revision clause in the Hard Coal Mining Financing Law, it was determined to cease the subsidised hard coal mining in Germany up to the end of the year 2018. This implies for the concern, that RAG AG will discontinue the promotion of coal as its core business. Following the year 2018, RAG AG will apply oneself to their technical staffs: Old shafts / near-surface mining, eternity tasks, mining damages, permissions / water rights / geodata management and real estates. Moreover, RAG AG already today uses mining establishments in order to implement projects and ideas for renewable energies.

  4. Transformation of AgCl nanoparticles in a sewer system — A field study

    Energy Technology Data Exchange (ETDEWEB)

    Kaegi, Ralf, E-mail: ralf.kaegi@eawag.ch [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Überlandstrasse 133, 8600 Dübendorf (Switzerland); Voegelin, Andreas; Sinnet, Brian [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Überlandstrasse 133, 8600 Dübendorf (Switzerland); Zuleeg, Steffen [KUSTER + HAGER Group, Oberstrasse 222, 9014 St. Gallen (Switzerland); Siegrist, Hansruedi [Eawag, Swiss Federal Institute of Aquatic Science and Technology, Überlandstrasse 133, 8600 Dübendorf (Switzerland); Burkhardt, Michael [HSR University of Applied Sciences, Institute of Environmental and Process Engineering (UMTEC), Oberseestrasse 10, 8640 Rapperswil (Switzerland)

    2015-12-01

    Silver nanoparticles (Ag-NP) are increasingly used in consumer products and their release during the use phase may negatively affect aquatic ecosystems. Research efforts, so far, have mainly addressed the application and use of metallic Ag(0)-NP. However, as shown by recent studies on the release of Ag from textiles, other forms of Ag, especially silver chloride (AgCl), are released in much larger quantities than metallic Ag(0). In this field study, we report the release of AgCl-NP from a point source (industrial laundry that applied AgCl-NP during a piloting phase over a period of several months to protect textiles from bacterial regrowth) to the public sewer system and investigate the transformation of Ag during its transport in the sewer system and in the municipal wastewater treatment plant (WWTP). During the study period, the laundry discharged ~ 85 g of Ag per day, which dominated the Ag loads in the sewer system from the respective catchment (72–95%) and the Ag in the digested WWTP sludge (67%). Combined results from electron microscopy and X-ray absorption spectroscopy revealed that the Ag discharged from the laundry to the sewer consisted of about one third AgCl and two thirds Ag{sub 2}S, both forms primarily occurring as nanoparticles with diameters < 100 nm. During the 800 m transport in the sewer channel to the nearby WWTP, corresponding to a travel time of ~ 30 min, the remaining AgCl was transformed into nanoparticulate Ag{sub 2}S. Ag{sub 2}S-NP also dominated the Ag speciation in the digested sludge. In line with results from earlier studies, the very low Ag concentrations measured in the effluent of the WWTP (< 0.5 μg L{sup −1}) confirmed the very high removal efficiency of Ag from the wastewater stream (> 95%). - Highlights: • First field study on the transformation of AgCl nanoparticles released from a point source into the municipal sewer system. • Transformation of AgCl-NP into Ag{sub 2}S already occurred during 30-min transport in the

  5. Transformation of AgCl nanoparticles in a sewer system — A field study

    International Nuclear Information System (INIS)

    Kaegi, Ralf; Voegelin, Andreas; Sinnet, Brian; Zuleeg, Steffen; Siegrist, Hansruedi; Burkhardt, Michael

    2015-01-01

    Silver nanoparticles (Ag-NP) are increasingly used in consumer products and their release during the use phase may negatively affect aquatic ecosystems. Research efforts, so far, have mainly addressed the application and use of metallic Ag(0)-NP. However, as shown by recent studies on the release of Ag from textiles, other forms of Ag, especially silver chloride (AgCl), are released in much larger quantities than metallic Ag(0). In this field study, we report the release of AgCl-NP from a point source (industrial laundry that applied AgCl-NP during a piloting phase over a period of several months to protect textiles from bacterial regrowth) to the public sewer system and investigate the transformation of Ag during its transport in the sewer system and in the municipal wastewater treatment plant (WWTP). During the study period, the laundry discharged ~ 85 g of Ag per day, which dominated the Ag loads in the sewer system from the respective catchment (72–95%) and the Ag in the digested WWTP sludge (67%). Combined results from electron microscopy and X-ray absorption spectroscopy revealed that the Ag discharged from the laundry to the sewer consisted of about one third AgCl and two thirds Ag 2 S, both forms primarily occurring as nanoparticles with diameters < 100 nm. During the 800 m transport in the sewer channel to the nearby WWTP, corresponding to a travel time of ~ 30 min, the remaining AgCl was transformed into nanoparticulate Ag 2 S. Ag 2 S-NP also dominated the Ag speciation in the digested sludge. In line with results from earlier studies, the very low Ag concentrations measured in the effluent of the WWTP (< 0.5 μg L −1 ) confirmed the very high removal efficiency of Ag from the wastewater stream (> 95%). - Highlights: • First field study on the transformation of AgCl nanoparticles released from a point source into the municipal sewer system. • Transformation of AgCl-NP into Ag 2 S already occurred during 30-min transport in the sewer system.

  6. Thermodynamic Measurements on Alloys and Compounds in Ag-Au-Se and Ag-Pd systems by the Electromotive Force Method

    OpenAIRE

    Feng, Dawei

    2014-01-01

    Gold and silver chalcogenides are significant minerals and major carriers of precious metals, and silver palladium alloy is one of the most important silver alloys with various industrial applications. The Ag-Au-Se ternary system and the Ag-Pd binary system have been investigated by the electromotive force (EMF) method in this study. For the Ag-Au-Se ternary system, the numerical values of the standard thermodynamic functions of the compounds Ag2Se (naumannite), AuSe, and Ag3AuSe2 (fisches...

  7. How Structure-Directing Agents Control Nanocrystal Shape: Polyvinylpyrrolidone-Mediated Growth of Ag Nanocubes.

    Science.gov (United States)

    Qi, Xin; Balankura, Tonnam; Zhou, Ya; Fichthorn, Kristen A

    2015-11-11

    The importance of structure-directing agents (SDAs) in the shape-selective synthesis of colloidal nanostructures has been well documented. However, the mechanisms by which SDAs actuate shape control are poorly understood. In the polyvinylpyrrolidone (PVP)-mediated growth of {100}-faceted Ag nanocrystals, this capability has been attributed to preferential binding of PVP to Ag(100). We use molecular dynamics simulations to probe the mechanisms by which Ag atoms add to Ag(100) and Ag(111) in ethylene glycol solution with PVP. We find that PVP induces kinetic Ag nanocrystal shapes by regulating the relative Ag fluxes to these facets. Stronger PVP binding to Ag(100) leads to a larger Ag flux to Ag(111) and cubic nanostructures through two mechanisms: enhanced Ag trapping by more extended PVP films on Ag(111) and a reduced free-energy barrier for Ag to cross lower-density films on Ag(111). These flux-regulating capabilities depend on PVP concentration and chain length, consistent with experiment.

  8. The AGS accelerator complex with the new fast extraction system

    International Nuclear Information System (INIS)

    Tanaka, M.; Bleser, E.J.; Glenn, J.W.; Lee, Y.Y.; Soukas, A.

    1995-01-01

    The delivery of a beam with characteristics appropriate for the g-2 muon storage ring and the filling of the RHIC heavy ion collider from the AGS main ring requires a new fast extracted beam (FEB) system. The new FEB system will be capable of performing both one-turn fast extraction and single bunch multiple extraction of either a heavy ion beam or a high intensity proton beam at a rate of 30 Hz up to 12 times per AGS cycle. The new system consists of a fast multi-pulsing kicker and an ejector septum magnet with local extraction orbit bumps

  9. Level Structure of 103Ag at high spins

    OpenAIRE

    Ray, S.; Pattabiraman, N. S.; Krishichayan; Chakraborty, A.; Mukhopadhyay, S.; Ghugre, S. S.; Chintalapudi, S. N.; Sinha, A. K.; Garg, U.; Zhu, S.; Kharraja, B.; Almehed, D.

    2007-01-01

    High spin states in $^{103}$Ag were investigated with the Gammasphere array, using the $^{72}$Ge($^{35}$Cl,$2p2n$)$^{103}$Ag reaction at an incident beam energy of 135 MeV. A $\\Delta J$=1 sequence with predominantly magnetic transitions and two nearly-degenerate $\\Delta J=1$ doublet bands have been observed. The dipole band shows a decreasing trend in the $B(M1)$ strength as function of spin, a well established feature of magnetic bands. The nearly-degenerate band structures satisfy the three...

  10. AGS to RHIC transfer line: Design and commissioning

    International Nuclear Information System (INIS)

    MacKay, W.W.; Ahrens, L.; Bennan, M.; Brown, K.

    1996-01-01

    In the fall of 1995, we successfully completed a major milestone in the RHIC (Relativistic Heavy Ion Collider) project: the first beam test of the AGS (Alternating Gradient Synchrotron) to RHIC (ATR) transfer line. The ATR serves as a test bed for the new RHIC control system. This transfer line is highly instrumented, with several types of instrumentation for characterizing the extracted beam from AGS and for matching the beam into RHIC. We describe the design and performance of ATR with gold ions with an eye to reaching the design criteria for RHIC operation, both in beam quality and controls

  11. Synthesis of Ag@Silica Nanoparticles by Assisted Laser Ablation

    OpenAIRE

    González-Castillo, JR; Rodriguez, E.; Jimenez-Villar, E.; Rodríguez, D.; Salomon-García, I.; de Sá, Gilberto F.; García-Fernández, T.; Almeida, DB; Cesar, CL; Johnes, R.; Ibarra, Juana C.

    2015-01-01

    This paper reports the synthesis of silver nanoparticles coated with porous silica (Ag@Silica NPs) using an assisted laser ablation method. This method is a chemical synthesis where one of the reagents (the reducer agent) is introduced in nanometer form by laser ablation of a solid target submerged in an aqueous solution. In a first step, a silicon wafer immersed in water solution was laser ablated for several minutes. Subsequently, an AgNO3 aliquot was added to the aqueous solution. The redo...

  12. Early history of the Cosmotron and AGS at Brookhaven

    International Nuclear Information System (INIS)

    Courant, E.D.

    1989-01-01

    Early work is described on the design and construction of the two Brookhaven particle accelerators of the 1950s, the Cosmotron and the AGS (alternating-gradient synchrotron). The Cosmotron, finished by the Spring of 1952, was the smaller machine reaching 3GeV and was the first to pass the billion electron volt mark. Suggested alterations to magnet orientations meant that the alternating gradients produced would stabilize the design. This ''strong-focusing'' idea was central to the second AGS machine, which also overcame the problems of resonances and transition energy, with the inclusion of an electron analog accelerator. (UK)

  13. Microprocessor based beam loss monitor system for the AGS

    International Nuclear Information System (INIS)

    Witkover, R.L.

    1979-01-01

    An array of 120 long radiation monitors (LRM) have been installed around the AGS. Each monitor is an extended coaxial ion chamber, 5 meters long, made from hollow core coaxial transmission cable pressured with argon. The LRM's are each connected to a low current preamplifier and voltage-to-frequency converter (VFC). The digital output of each channel is fed to a 16 bit counter chip which bridges the bus of an 8085 microprocessor. This circuit is connected to the AGS PD-10 for data taking or may function as a stand-alone unit. Various operating modes can be selected for data readout. System design and operating performance are described

  14. First principle study of PEO-AgI polymer systems

    Science.gov (United States)

    Rao, B. Keshav; Verma, Mohan L.

    2017-07-01

    First principle calculations based on density functional theory is performed to analyze cation (Ag+) conductivity in polyethylene oxide (PEO) based systems. The relaxed polymer structures are simulated, bond lengths and the charge density distributions around interacting atoms provides the strong bonding nature between higher electro-negative oxygen and silver atoms. Projected density of states and density of states explain s-p hybridization between orbitals, to increase in cation concentration in polymer systems, to reduce in the forbidden energy gap and to increase the ionic conductivity due to gradual increase the number of dispersing AgI molecules in polymer systems.

  15. Silicon nano-ribbons on Ag(110): a computational investigation

    International Nuclear Information System (INIS)

    Kara, Abdelkader; Vizzini, Sebastien; Leandri, Cristel; Ealet, Benedicte; Aufray, Bernard; LeLay, Guy; Oughaddou, Hamid

    2010-01-01

    We report results of a computational investigation, based on density functional theory, of silicon self-assembled nano-ribbons (Si NRs) on Ag(110). These NRs present a honeycomb-like structure arched on the substrate and forming a closed-packed structure. The calculated STM images match the experimental ones, hinting to a possible new Si structure, mediated by the Ag substrate. The observed new electronic states near the Fermi level were reproduced by the calculations and attributed to a confinement/hybridization tandem.

  16. Analysis of resonance-driving imperfections in the AGS Booster

    International Nuclear Information System (INIS)

    Gardner, C.; Shoji, Y.; Danby, G.; Glenn, J.W.; Jackson, G.J.; Soukas, A.; van Asselt, W.; Whalen, C.

    1994-01-01

    At the design intensity of 1.5 x 10 13 ppp, the space charge tune shift in the AGS Booster at injection has been estimated to be about 0.35. The beam tunes are therefore spread over many lower order resonance lines and the associated stopbands must be corrected in order to minimize the amplitude growth due to resonance excitation. This requires proper compensation of the resonance-driving harmonics which result from random magnetic field errors. The observation and correction of second and third order resonance stopbands in the AGS Booster is reviewed, and an analysis of magnetic field imperfections based on the required corrections is given

  17. Observation and correction of resonance stopbands in the AGS Booster

    International Nuclear Information System (INIS)

    Gardner, C.; Shoji, Y.; Ahrens, L.; Glenn, J.W.; Lee, Y.Y.; Roser, T.; Soukas, A.; van Asselt, W.; Weng, W.T.

    1993-01-01

    At the design intensity of 1.5 x 10 13 ppp, the space charge tune shift in the AGS Booster at injection has been estimated to be about 0.35. Therefore, the beam is spread over may lower order resonance lines and the stopbands have to be corrected to minimize the amplitude growth by proper compensation of the driving harmonics resulting from random errors. The observation and correction of second and third order resonance stopbands in the AGS Booster, and the establishment of a favorable operating point at high intensity are discussed

  18. Enhanced photocatalytic performances and magnetic recovery capacity of visible-light-driven Z-scheme ZnFe2O4/AgBr/Ag photocatalyst

    Science.gov (United States)

    He, Jie; Cheng, Yahui; Wang, Tianzhao; Feng, Deqiang; Zheng, Lingcheng; Shao, Dawei; Wang, Weichao; Wang, Weihua; Lu, Feng; Dong, Hong; Zheng, Rongkun; Liu, Hui

    2018-05-01

    High efficiency, high stability and easy recovery are three key factors for practical photocatalysts. Z-scheme heterostructure is one of the most promising photocatalytic systems to meet all above requirements. However, efficient Z-scheme photocatalysts which could absorb visible light are still few and difficult to implement at present. In this work, the composite photocatalysts ZnFe2O4/AgBr/Ag were prepared through a two-step method. A ∼92% photodegradation rate on methyl orange was observed within 30 min under visible light, which is much better than that of individual ZnFe2O4 or AgBr/Ag. The stability was also greatly improved compared with AgBr/Ag. The increased performance is resulted from the suitable band alignment of ZnFe2O4 and AgBr, and it is defined as Z-scheme mechanism which was demonstrated by detecting active species and electrochemical impedance spectroscopy. Besides, ZnFe2O4/AgBr/Ag is ferromagnetic and can be recycled by magnet. These results show that ZnFe2O4/AgBr/Ag is a potential magnetically recyclable photocatalyst which can be driven by visible light.

  19. Impact of HBV genotype and mutations on HBV DNA and qHBsAg levels in patients with HBeAg-negative chronic HBV infection.

    Science.gov (United States)

    Kuhnhenn, L; Jiang, B; Kubesch, A; Vermehren, J; Knop, V; Susser, S; Dietz, J; Carra, G; Finkelmeier, F; Grammatikos, G; Zeuzem, S; Sarrazin, C; Hildt, E; Peiffer, K-H

    2018-04-10

    HBV DNA and quantitative (q)HBsAg levels as prognostic markers for HBV-related disease are mostly validated in Asia and their significance in Western populations is uncertain. To analyse the impact of the HBV genotype and frequent mutations in precore (PC), basal core promoter (BCP) and preS on HBV DNA and qHBsAg levels. HBV DNA and qHBsAg serum levels of 465 patients with HBeAg-negative chronic HBV infection were correlated with the HBV genotype and mutations in PC, BCP and preS. For a detailed analysis of the molecular virology, genotype A2 genomes harbouring these mutations were analysed for replication efficacy and HBsAg release in cell culture. While no impact of the HBV genotype on HBV DNA levels was observed, qHBsAg levels differed up to 1.4 log among the genotypes (P HBV DNA levels (P HBV genome harbouring a preS deletion. In contrast, a perinuclear HBsAg accumulation was detected for the PC and BCP-variants, reflecting an impaired HBsAg release. qHBsAg serum levels depend on the HBV genotype and together with HBV DNA levels on frequent mutations in PC, BCP and preS in HBeAg-negative patients. qHBsAg cut-offs when used as prognostic markers require genotype-dependent validation. © 2018 John Wiley & Sons Ltd.

  20. Comparison of partial structures of melts of superionic AgI and CuI and non-superionic AgCl.

    Science.gov (United States)

    Kawakita, Yukinobu; Tahara, Shuta; Fujii, Hiroyuki; Kohara, Shinji; Takeda, Shin'ichi

    2007-08-22

    Neutron and high-energy x-ray diffraction analyses of molten AgI have been performed and the partial structures are discussed in detail with the aid of the structural modelling procedure of the reverse Monte Carlo (RMC) technique by comparison with those of molten CuI and AgCl. It is well known that AgI and CuI have a superionic solid phase below the melting point, in which the cations favour a tetrahedral configuration, while solid AgCl has a rock-salt structure with an octahedral environment around both Ag and Cl atoms. Even in the molten states, there is a significant difference between superionic and non-superionic melts. The cation is located on the triangular plain formed by three iodine ions in molten AgCl and CuI, while molten AgCl favours a 90° Cl-Ag-Cl bond angle, which is understood to maintain a similar local environment to that in the solid state. The atomic configurations of the RMC model suggest that the cation distributions in superionic melts of CuI and AgI exhibit large fluctuations, while Ag ions in the non-superionic melts of AgCl are distributed much more uniformly.

  1. Influence of Ag contents on structure and tribological properties of TiSiN-Ag nanocomposite coatings on Ti-6Al-4V

    Science.gov (United States)

    Dang, Chaoqun; Li, Jinlong; Wang, Yue; Yang, Yitao; Wang, Yongxin; Chen, Jianmin

    2017-02-01

    TiSiN-Ag nanocomposite coatings with different Ag contents were deposited on Ti-6Al-4V using reactive co-sputtering in multi-arc ion plating system. Influence of Ag contents on structure and tribological properties of TiSiN-Ag nanocomposite coatings was investigated. The TiSiN-Ag coatings were found to have unique nanocomposite structures composed of nanocrystallite and amorphous nc-TiN/nc-Ag/a-Si3N4. When the silver content was 1.4 at.%, the coating exhibited high hardness (36 GPa), but poor wear resistance. When the silver content was increased from 5.3 to 8.7 at.%, the coatings possessed homogeneous distribution and small variation in hardness. Although these coatings revealed obvious decrease in hardness, significantly reduced in the friction coefficient and possessed excellent tribological properties, besides, the coating with the Ag content of 5.3 at.% showed best wear resistance in artificial seawater and the coating (7.9 at.% Ag) revealed the best wear resistance in ambient air. However, with a further increased incorporation of Ag into the TiSiN-Ag coating (17.0 at.%) resulted in the formation of a large volume fraction of metallic silver, which caused a decrease both in hardness and wear resistance. The coating containing highest Ag concentration (21.0 at.%) exhibited low friction coefficient both in ambient air and artificial seawater, although possessing low hardness.

  2. Asymmetrical Precipitation of Ag3Sn Intermetallic Compounds Induced by Thermomigration of Ag in Pb-Free Microbumps During Solid-State Aging

    Science.gov (United States)

    Su, Yu-Ping; Wu, Chun-Sen; Ouyang, Fan-Yi

    2016-01-01

    Three-dimensional integrated circuit technology has become a major trend in electronics packaging in the microelectronics industry. To effectively remove heat from stacked integrated circuitry, a temperature gradient must be established across the chips. Furthermore, because of the trend toward higher device current density, Joule heating is more serious and temperature gradients across soldered joints are expected to increase. In this study we used heat-sink and heat-source devices to establish a temperature gradient across SnAg microbumps to investigate the thermomigration behavior of Ag in SnAg solder. Compared with isothermal conditions, small Ag3Sn particles near the hot end were dissolved and redistributed toward the cold end under a temperature gradient. The results indicated that temperature gradient-induced movement of Ag atoms occurred from the hot side toward the cold side, and asymmetrical precipitation of Ag3Sn resulted. The mechanism of growth of the intermetallic compound (IMC) Ag3Sn, caused by thermomigration of Ag, is discussed. The rate of growth Ag3Sn IMC at the cold side was found to increase linearly with solid-aging time under a temperature gradient. To understand the force driving Ag diffusion under the temperature gradient, the molar heat of transport ( Q*) of Ag in Sn was calculated as +13.34 kJ/mole.

  3. Facile formation of Ag2WO4/AgX (X = Cl, Br, I) hybrid nanorods with enhanced visible-light-driven photoelectrochemical properties

    International Nuclear Information System (INIS)

    Li, Jingjing; Yu, Caiyun; Zheng, Changcheng; Etogo, Atangana; Xie, Yunlong; Zhong, Yijun; Hu, Yong

    2015-01-01

    Highlights: • Ag 2 WO 4 /AgX hybrid nanorods were prepared by a facile in-situ anion exchange reaction. • Ag 2 WO 4 nanorods and different X − ions were reacted in water at room temperature. • The hybrids possess significantly enhanced photoelectrochemical properties. • Ag 2 WO 4 /AgBr hybrids exhibit the highest photocatalytic activity among three samples. • The active species tests were also investigated to confirm photocatalytic mechanism. - Abstract: In this work, we demonstrated a general strategy for the preparation of a series of uniform Ag 2 WO 4 /AgX (X = Cl, Br, I) hybrid nanorods by a facile in-situ anion exchange reaction occurring at room temperature between pregrown Ag 2 WO 4 nanorods and different X − ions in water. Compared with Ag 2 WO 4 nanorods, further investigation has revealed that the as-prepared hybrid nanorods possess significantly enhanced photocurrent response and photocatalytic activity in degrading methyl orange (MO) under visible-light irradiation. In particular, the Ag 2 WO 4 /AgBr hybrid nanorods exhibit the highest photocatalytic activity among the three kinds of samples. The active species tests indicate that superoxide anion radicals and photogenerated holes are responsible for the enhanced photocatalytic performance

  4. Fabrication, characterization and photocatalytic properties of Ag/AgI/BiOI heteronanostructures supported on rectorite via a cation-exchange method

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Yunfang [School of Chemistry and Environment, South China Normal University, Guangzhou 510006, Guangdong (China); Fang, Jianzhang, E-mail: fangjzh@scnu.edu.cn [School of Chemistry and Environment, South China Normal University, Guangzhou 510006, Guangdong (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China); Lu, Shaoyou [Shenzhen Center for Disease Control and Prevention, Shenzhen 518055 (China); Wu, Yan; Chen, Dazhi; Huang, Liyan [Institute of Engineering Technology of Guangdong Province, Key Laboratory of Water Environmental Pollution Control of Guangdong Province, Guangzhou 510440 (China); Xu, Weicheng; Zhu, Ximiao [School of Chemistry and Environment, South China Normal University, Guangzhou 510006, Guangdong (China); Fang, Zhanqiang [School of Chemistry and Environment, South China Normal University, Guangzhou 510006, Guangdong (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 510006 (China)

    2015-04-15

    Highlights: • Ag/AgI/BiOI-rectorite was prepared by twice cation-exchange process. • Ag/AgI/BiOI-rectorite photocatalyst possessed SPR and adsorption capacity. • Ag/AgI/BiOI-rectorite exhibited highly photocatalytic activity. • Trapped holes and ·O{sub 2}{sup −} were formed active species in the photocatalytic system. - Abstract: In this work, a new plasmonic photocatalyst Ag/AgI/BiOI-rectorite was prepared via a cation exchange process. The photocatalyst had been characterized by X-ray powder diffraction (XRD), Raman spectra, nitrogen sorption (BET), field-emission scanning electron microscope (FE-SEM), X-ray photoelectron spectroscopy (XPS) and UV–vis diffuse reflectance spectroscopy (DRS). The photocatalytic activity, which was evaluated by degradation of rhodamine B (RhB) and bisphenol A (BPA) under visible light irradiation, was enhanced significantly by loading Ag/AgI/BiOI nanoparticles onto rectorite. The photogenerated holes and superoxide radical (·O{sub 2}{sup −}) were both formed as active species for the photocatalytic reactions under visible light irradiation. The existence of metallic Ag particles, which possess the surface plasmon resonance effect, acted as an indispensable role in the photocatalytic reaction.

  5. One-pot preparation of nanoporous Ag-Cu@Ag core-shell alloy with enhanced oxidative stability and robust antibacterial activity.

    Science.gov (United States)

    Liu, Xue; Du, Jing; Shao, Yang; Zhao, Shao-Fan; Yao, Ke-Fu

    2017-08-31

    Metallic core-shell nanostructures have inspired prominent research interests due to their better performances in catalytic, optical, electric, and magnetic applications as well as the less cost of noble metal than monometallic nanostructures, but limited by the complicated and expensive synthesis approaches. Development of one-pot and inexpensive method for metallic core-shell nanostructures' synthesis is therefore of great significance. A novel Cu network supported nanoporous Ag-Cu alloy with an Ag shell and an Ag-Cu core was successfully synthesized by one-pot chemical dealloying of Zr-Cu-Ag-Al-O amorphous/crystalline composite, which provides a new way to prepare metallic core-shell nanostructures by a simple method. The prepared nanoporous Ag-Cu@Ag core-shell alloy demonstrates excellent air-stability at room temperature and enhanced oxidative stability even compared with other reported Cu@Ag core-shell micro-particles. In addition, the nanoporous Ag-Cu@Ag core-shell alloy also possesses robust antibacterial activity against E. Coli DH5α. The simple and low-cost synthesis method as well as the excellent oxidative stability promises the nanoporous Ag-Cu@Ag core-shell alloy potentially wide applications.

  6. A novel metal-to-metal bonding process through in-situ formation of Ag nanoparticles using Ag2O microparticles

    International Nuclear Information System (INIS)

    Hirose, Akio; Tatsumi, Hiroaki; Takeda, Naoya; Akada, Yusuke; Ogura, Tomo; Ide, Eiichi; Morita, Toshiaki

    2009-01-01

    The metal-to-metal bonding has been successfully achieved via the bonding process using Ag metallo-organic nanoparticles at a bonding temperature of around 300-, which can be alternative to the current microsoldering in electronics assembly using high-temperature solders. However, further reduction of bonding temperature and/or bonding pressure is needed. In the present research, a novel bonding process through in-situ formation of Ag nanoparticles instead of the filler material of the Ag metallo-organic nanoparticles has been developed. The Ag nanoparticles can form by the reduction of Ag 2 O particles. In this study, the Ag 2 O particles were mixed with triethylene glycol as a reducing agent to form a paste for bonding. The Au coated cylindrical specimens were bonded using the paste. The Ag nanoparticles formed at around 130 to 160 through the reduction process of Ag2O particles with triethylene glycol. The Ag nanoparticles were immediately sintered each other due to a great surface energy per volume. A transmission electron microscope observation revealed that the sintered Ag metallurgically bonded to the Au substrate at around 160 and a dense Ag layer formed after further heating. The tensile strength of the joint bonded at 250 under a bonding pressure of 5MPa was around 60MPa

  7. Primary immunization-like response without hepatitis following transfusion of HBeAg-positive blood

    DEFF Research Database (Denmark)

    Gluud, C; Aldershvile, J; Kryger, P

    1983-01-01

    An accidental transfusion of hepatitis B surface antigen (HBsAg) and hepatitis B e antigen (HBeAg) positive whole blood was given to a 19-yr-old male, bleeding after tonsillectomy. Serum obtained from the patient before the transfusion revealed no hepatitis B antigens or antibodies. After...... the transfusion the patient became HBsAg-positive, cleared this antigen and developed antibodies to both HBsAg and HBeAg. The transfusion blood was positive for total antibody and IgM antibody to hepatitis B core antigen (HBcAg). The patient's blood became positive for these antibodies after the transfusion...

  8. 78 FR 39971 - Implementation of the Understandings Reached at the 2012 Australia Group (AG) Plenary Meeting and...

    Science.gov (United States)

    2013-07-03

    ...-02] RIN 0694-AF76 Implementation of the Understandings Reached at the 2012 Australia Group (AG... understandings reached at the June 2012 plenary meeting of the Australia Group (AG) and the 2012 AG... 2012 Australia Group (AG) Plenary Meeting and the 2012 AG Intersessional Decisions; Changes to Select...

  9. Synthesis and Characterization of Ag-Ag2O/TiO2@polypyrrole Heterojunction for Enhanced Photocatalytic Degradation of Methylene Blue

    Directory of Open Access Journals (Sweden)

    Rajeev Kumar

    2016-05-01

    Full Text Available Hybrid multi-functional nanomaterials comprising two or more disparate materials have become a powerful approach to obtain advanced materials for environmental remediation applications. In this work, an Ag-Ag2O/TiO2@polypyrrole (Ag/TiO2@PPy heterojunction has been synthesized by assembling a self-stabilized Ag-Ag2O (p type semiconductor (denoted as Ag and polypyrrole (π-conjugated polymer on the surface of rutile TiO2 (n type. Ag/TiO2@PPy was synthesized through simultaneous oxidation of pyrrole monomers and reduction of AgNO3 in an aqueous solution containing well-dispersed TiO2 particles. Thus synthesized Ag/TiO2@PPy was characterized using X-ray diffraction (XRD, X-ray photoelectron spectroscopy (XPS, field emission scanning electron microscopy (FE-SEM, transmission electron microscopy (TEM, and UV-Vis diffuse reflectance spectroscopy (UV-vis DSR. The photocatalytic activity of synthesized heterojunction was investigated for the decomposition of methylene blue (MB dye under UV and visible light irradiation. The results revealed that π-conjugated p-n heterojunction formed in the case of Ag/TiO2@PPy significantly enhanced the photodecomposition of MB compared to the p-n type Ag/TiO2 and TiO2@PPy (n-π heterojunctions. A synergistic effect between Ag-Ag2O and PPy leads to higher photostability and a better electron/hole separation leads to an enhanced photocatalytic activity of Ag/TiO2@PPy under both UV and visible light irradiations.

  10. Efficient removal of radioactive iodide ions from water by three-dimensional Ag2O–Ag/TiO2 composites under visible light irradiation

    International Nuclear Information System (INIS)

    Liu, Shuaishuai; Wang, Na; Zhang, Yuchang; Li, Yaru; Han, Zhuo; Na, Ping

    2015-01-01

    Highlights: • 3D Ag 2 O–Ag/TiO 2 composites have been synthesized through a facile method. • 3D Ag 2 O–Ag/TiO 2 composites exhibit large photocatalytic adsorption capacity, high selectivity, and excellent trace removal performance of I − under visible light. • 3D Ag 2 O–Ag/TiO 2 composites could be easily separated and regenerated. • The adsorption capacity of Ag 2 O for I − is enlarged 4.4 times by the photooxidation of Ag/TiO 2 . • The cooperative effects mechanism between Ag 2 O and Ag/TiO 2 is proposed and verified. - Abstract: Three-dimensional Ag 2 O and Ag co-loaded TiO 2 (3D Ag 2 O–Ag/TiO 2 ) composites have been synthesized through a facile method, characterized using SEM, EDX, TEM, XRD, XPS, UV–vis DRS, BET techniques, and applied to remove radioactive iodide ions (I − ). The photocatalytic adsorption capacity (207.6 mg/g) of the 3D Ag 2 O–Ag/TiO 2 spheres under visible light is four times higher than that in the dark, which is barely affected by other ions, even in simulated salt lake water where the concentration of Cl − is up to 590 times that of I − . The capability of the composites to remove even trace amounts of I − from different types of water, e.g., deionized or salt lake water, is demonstrated. The composites also feature good reusability, as they were separated after photocatalytic adsorption and still performed well after a simple regeneration. Furthermore, a mechanism explaining the highly efficient removal of radioactive I − has been proposed according to characterization analyses of the composites after adsorption and subsequently been verified by adsorption and desorption experiments. The proposed cooperative effects mechanism considers the interplay of three different phenomena, namely, the adsorption performance of Ag 2 O for I − , the photocatalytic ability of Ag/TiO 2 for oxidation of I − , and the readsorption performance of AgI for I 2

  11. Staircase bands in odd-odd Ag isotopes: 107Ag a case study

    International Nuclear Information System (INIS)

    Datta, P.; Rather, Niyaz; Roy, Santosh; Chattopadhyay, S.; Goswami, A; Nag, S.; Palit, R.; Saha, S.; Trevadi, T.

    2012-01-01

    Nuclei near Z=50 shell closer display various facets of tilted axis rotation (TAR) as predicted both from mean field tilted axis cranking results (TAC) as well as more intuitive, geometrical model approach, popularly known as Shears mechanism. These include pure TAC features such as the observation of Chiral bands, Anti-magnetic rotation and Magnetic Rotation (MR). These excitations are predominantly generated by the valance neutrons in low-Ω orbitals of h 11/2 and the valance protons in high-Ω orbitals of g 9/2 . In contrary to the common notion of MR, significant core rotation were reported in these nuclei which were attributed to the neutron occupation in shape driving h 11/2 orbital. However, the interplay/competition between the core rotation (Principal axis rotation (PAR)) and the tilted angular momentum generated by the Shears structure, exhibit variety of phenomena already observed by our group in Ag and Cd isotopes. It is to be noted that the relatively small level densities near the Fermi levels for both neutron and proton sector in mass-100 region allow us to study such subtle effects which otherwise are not reported in any other mass region

  12. Visible-light photoactive Ag-AgBr/α-Ag3VO4 nanostructures prepared in a water-soluble ionic liquid for degradation of wastewater

    Science.gov (United States)

    Padervand, Mohsen

    2016-11-01

    Ag-AgBr/α-Ag3VO4 photocatalysts, prepared by an ionic liquid-assisted precipitation method, were used as an efficient visible light-driven photocatalytic system for removal of wastewater and pathogenic bacteria from the aqueous medium. X-ray diffraction powder, diffuse reflectance spectroscopy, Fourier transform infrared, scanning electron microscopy, and nitrogen adsorption-desorption isotherm (BET) analysis methods were used to characterize the nanostructures. Photodegradation mechanism was investigated and the results showed that the prepared samples were too efficient for the degradation of Acid Blue 92 (AB92) azo dye, and E. coli cells under visible light. The photogenerated electron-hole pairs reacted with the species in the solution and produced super active radicals such as {{O}}{{{H}}^ \\cdot }, {{H}}{{{O}}^ \\cdot }_{{2}}, and {{{O}}^{ \\cdot - }}_{{2}} which are responsible for the degradation of the environmental pollutions. TEM images were used to clarify the antibacterial activity of the products. Finally, as a practical application of the prepared photocatalysts, their ability evaluated for degradation of a real wastewater sample which was provided from the textile industries.

  13. Submonolayer nucleation and growth and the initial stage of multilayer kinetic roughening during Ag/Ag (100) homoepitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, C.

    1996-08-01

    A comprehensive Scanning Tunneling Microscopy (STM) study of submonolayer nucleation and growth of 2D islands in Ag/Ag(100) homoepitaxy for temperature between 295K and 370K is presented. The initial stages of multilayer kinetic roughening is also studied. Analysis of an appropriate model for metal (100) homoepitaxy, produces estimates of 350 meV for the terrace diffusion barrier, 400 meV for the adatom bond energy, and 25 meV for the additional Ehrlich-Schwoebel step-edge barrier.

  14. Dynamic viscosities of pure tin and Sn-Ag, Sn-Cu, and Sn-Ag-Cu eutectic melts

    Science.gov (United States)

    Rozhitsina, E. V.; Gruner, S.; Kaban, I.; Hoyer, W.; Sidorov, V. E.; Popel', P. S.

    2011-02-01

    The dynamic viscosities of the melts of pure tin and eutectic Sn-Ag, Sn-Cu, and Sn-Ag-Cu alloys are studied in heating followed by cooling, and the maximum heating temperature was 1200°C. An irreversible decrease in the viscosity is found in the temperature range 800-1000°C in the polytherms of all melts. This finding is related to the loss of a local order in a melt and can be used to develop temperature regimes for the production of lead-free solders.

  15. Grid expansion: a rhombiclike [L4Fe2(Ag2)2] complex containing Ag2 dumbbells at two vertices.

    Science.gov (United States)

    Schneider, Benjamin; Demeshko, Serhiy; Dechert, Sebastian; Meyer, Franc

    2012-05-07

    The pyrazolate-based ditopic ligand HL forms a strongly hydrogen-bonded corner complex dimer [Fe(II)(HL)(2)](2)(BF(4))(4) (1) with a [2 × 2] gridlike arrangement of four ligand strands. The two empty vertices can then be filled with {Ag(2)}(2+) dumbbells, yielding the unprecedented diferric complex [L(4)Fe(III)(2)(Ag(I)(2))(2)](BF(4))(6) (2) that features a rhombiclike structure with an almost planar hexagon of metal ions.

  16. Synthesis and characterization of Ag-containing calcium phosphates with various Ca/P ratios.

    Science.gov (United States)

    Gokcekaya, Ozkan; Ueda, Kyosuke; Narushima, Takayuki; Ergun, Celaletdin

    2015-08-01

    Ag-containing calcium phosphate (CaP) powders were synthesized by a precipitation method using aqueous solutions of calcium nitrate, silver nitrate, and ammonium phosphate. The powders were sintered at temperatures ranging from 1173 to 1473 K. The charged atomic ratios of (Ca+Ag)/P and Ag/(Ca+Ag) in solution were varied from 1.33 to 1.67 and from 0 to 0.30, respectively. The Ag content in the as-precipitated CaP powders increased with the charged Ag/(Ca+Ag) atomic ratio in solution and was lower than the charged Ag/(Ca+Ag) value. The as-precipitated CaP powders consisted of hydroxyapatite (HA) as the main phase. Ag nanoparticles were observed on the as-precipitated HA particles under all conditions of Ag addition. After the sintering, HA, β-TCP (tricalcium phosphate), α-TCP, and β-CPP (calcium pyrophosphate) were mainly detected as CaPs on the basis of the Ca/P atomic ratio of the as-precipitated powders. The addition of Ag stabilized the β-TCP phase, and the distribution of Ag in β-TCP was homogeneous. A metallic Ag phase coexisted with HA. The solubility of Ag in HA was estimated to be 0.0019-0.0061 (Ag/(Ca+Ag)) atomic ratio, which was lower than that in β-TCP (higher than 0.0536) and higher than that of β-CPP (below the detection limit of analyses). Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Microstructure and phase evolution during the dealloying of bi-phase Al–Ag alloy

    International Nuclear Information System (INIS)

    Song, T.T.; Gao, Y.L.; Zhang, Z.H.; Zhai, Q.J.

    2013-01-01

    Highlights: ► Selective leaching of α-Al(Ag) and Ag 2 Al occurs simultaneously during dealloying. ► Diffusion of Al and vacancy controlled mechanism dominate the etching of Ag 2 Al. ► The coarsening of ligaments in NPS follows a time dependence of d ∝t 2/5 . - Abstract: The chemical dealloying of bi-phase Al-35Ag alloy has been investigated within the parting limit. The dealloying of α-Al(Ag) and Ag 2 Al commenced simultaneously, and all α-Al(Ag) and part of Ag 2 Al were dealloyed, leaving residual Ag 2 Al to be dealloyed afterwards. The dealloying of the residual Ag 2 Al is associated with vacancy controlled mechanism and diffusion of Al atoms. It is revealed that the diffusions of the Al and Ag atoms during dealloying are significant. The Ag skeletons formed at the initial stage, and became coarsened gradually with a time dependence of d ∝t 2/5 , illustrating the vital role of diffusion of Ag atoms.

  18. Controllable Charge Transfer in Ag-TiO2 Composite Structure for SERS Application

    Directory of Open Access Journals (Sweden)

    Yaxin Wang

    2017-06-01

    Full Text Available The nanocaps array of TiO2/Ag bilayer with different Ag thicknesses and co-sputtering TiO2-Ag monolayer with different TiO2 contents were fabricated on a two-dimensional colloidal array substrate for the investigation of Surface enhanced Raman scattering (SERS properties. For the TiO2/Ag bilayer, when the Ag thickness increased, SERS intensity decreased. Meanwhile, a significant enhancement was observed when the sublayer Ag was 10 nm compared to the pure Ag monolayer, which was ascribed to the metal-semiconductor synergistic effect that electromagnetic mechanism (EM provided by roughness surface and charge-transfer (CT enhancement mechanism from TiO2-Ag composite components. In comparison to the TiO2/Ag bilayer, the co-sputtered TiO2-Ag monolayer decreased the aggregation of Ag particles and led to the formation of small Ag particles, which showed that TiO2 could effectively inhibit the aggregation and growth of Ag nanoparticles.

  19. Effects of Bi Addition on the Microstructure and Mechanical Properties of Nanocrystalline Ag Coatings

    Directory of Open Access Journals (Sweden)

    Yuxin Wang

    2017-08-01

    Full Text Available In this study we investigated the effects of Bi addition on the microstructure and mechanical properties of an electrodeposited nanocrystalline Ag coating. Microstructural features were investigated with transmission electron microscopy (TEM. The results indicate that the addition of Bi introduced nanometer-scale Ag-Bi solid solution particles and more internal defects to the initial Ag microstructures. The anisotropic elastic-plastic properties of the Ag nanocrystalline coating with and without Bi addition were examined with nanoindentation experiments in conjunction with the recently-developed inverse method. The results indicate that the as-deposited nanocrystalline Ag coating contained high mechanical anisotropy. With the addition of 1 atomic percent (at% Bi, the anisotropy within Ag-Bi coating was very small, and yield strength of the nanocrystalline Ag-Bi alloy in both longitudinal and transverse directions were improved by over 100% compared to that of Ag. On the other hand, the strain-hardening exponent of Ag-Bi was reduced to 0.055 from the original 0.16 of the Ag coating. Furthermore, the addition of Bi only slightly increased the electrical resistivity of the Ag-Bi coating in comparison to Ag. Results of our study indicate that Bi addition is a promising method for improving the mechanical and physical performances of Ag coating for electrical contacts.

  20. Polyester fabric coated with Ag/ZnO composite film by magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, Xiaohong, E-mail: yxhong1981_2004@126.com [Key Laboratory of Eco-Textiles, Ministry of Education, Jiangnan University, Wuxi 214122, Jiangsu (China); Faculty of Clothing and Design, Minjiang University, Fuzhou 350121, Fujian (China); Xu, Wenzheng, E-mail: xwz8199@126.com [Key Laboratory of Eco-Textiles, Ministry of Education, Jiangnan University, Wuxi 214122, Jiangsu (China); Huang, Fenglin, E-mail: windhuang325@163.com [Key Laboratory of Eco-Textiles, Ministry of Education, Jiangnan University, Wuxi 214122, Jiangsu (China); Chen, Dongsheng, E-mail: mjuchen@126.com [Faculty of Clothing and Design, Minjiang University, Fuzhou 350121, Fujian (China); Wei, Qufu, E-mail: qfwei@jiangnan.edu.cn [Key Laboratory of Eco-Textiles, Ministry of Education, Jiangnan University, Wuxi 214122, Jiangsu (China)

    2016-12-30

    Highlights: • Ag/ZnO composite film was successfully deposited on polyester fabric by magnetron sputtering technique. • Ag film was easily oxidized into Ag{sub 2}O film in high vacuum oxygen environment. • The zinc film coated on the surface of Ag film before RF reactive sputtering could protect the silver film from oxidation. • Polyester fabric coated with Ag/ZnO composite film can obtained structural color. • The anti-ultraviolet and antistatic properties of polyester fabric coated with Ag/ZnO composite film all were good. - Abstract: Ag/ZnO composite film was successfully deposited on polyester fabric by using direct current (DC) magnetron sputtering and radio frequency (RF) magnetron reaction sputtering techniques with pure silver (Ag) and zinc (Zn) targets. X-ray photoelectron spectroscopy (XPS) and X-ray diffraction (XRD) were used to examine the deposited film on the fabric. It was found that the zinc film coated on Ag film before RF reactive sputtering could protect the silver film from oxidation. Anti-ultraviolet property and antistatic property of the coated samples using different magnetron sputtering methods were also investigated. The experimental results showed that Ag film was oxidized into in Ag{sub 2}O film in high vacuum oxygen environment. The deposition of Zn film on the surface of the fabric coated with Ag film before RF reactive sputtering, could successfully obtained Ag/ZnO composite film, and also generated structural color on the polyester fabric.

  1. The irradiation influence on the properties of silver sulfide (Ag2S) colloidal nanoparticles

    Science.gov (United States)

    Rempel, S. V.; Kuznetsova, Yu. V.; Gerasimov, E. Yu.; Rempel', A. A.

    2017-08-01

    The aqueous solutions of different stability containing silver sulfide (Ag2S) nanoparticles are studied. The stable, transparent, and turbid solutions have been subjected to daylight for 7 months, to ultraviolet and laser irradiation, as well as to an electron beam. Solar radiation is found to favor the Ag2S reduction to Ag and/or the formation of Ag2S/Ag hybrid nanoparticles in the solution. At a high amount of hybrid nanoparticles, the exciton-plasmon interaction causes asymmetry in the absorption spectra. The exposure of Ag2S particles precipitated from the solution with the electron beam leads to the reversible growth of Ag threads. The possible exciton-plasmon interplay mechanisms in Ag2S/Ag hybrid nanoparticles are considered. The physical mechanisms of the changing Ag2S stoichiometry, the formation of metallic Ag and Ag2S/Ag hybrid nanoparticles are the generation of hot carriers and the energy transfer (exciton-plasmon interaction) in a metal-semiconductor hybrid nanosystem are elucidated, as well.

  2. Inhibitory effect of Ti-Ag alloy on artificial biofilm formation.

    Science.gov (United States)

    Nakajo, Kazuko; Takahashi, Masatoshi; Kikuchi, Masafumi; Takada, Yukyo; Okuno, Osamu; Sasaki, Keiichi; Takahashi, Nobuhiro

    2014-01-01

    Titanium-silver (Ti-Ag) alloy has been improved for machinability and mechanical properties, but its anti-biofilm properties have not been elucidated yet. Thus, this study aimed to evaluate the effects of Ti-Ag alloy on biofilm formation and bacterial viability in comparison with pure Ti, pure Ag and silver-palladium (Ag-Pd) alloy. Biofilm formation on the metal plates was evaluated by growing Streptococcus mutans and Streptococcus sobrinus in the presence of metal plates. Bactericidal activity was evaluated using a film contact method. There were no significant differences in biofilm formation between pure Ti, pure Ag and Ag-Pd alloy, while biofilm amounts on Ti-20% Ag and Ti-25% Ag alloys were significantly lower (p<0.05). In addition, Ti-Ag alloys and pure Ti were not bactericidal, although pure Ag and Ag-Pd alloy killed bacteria. These results suggest that Ti-20% Ag and Ti-25% Ag alloys are suitable for dental material that suppresses biofilm formation without disturbing healthy oral microflora.

  3. AGS experiments in nuclear/QCD physics at medium energies

    International Nuclear Information System (INIS)

    Lo Presti, P.

    1998-07-01

    This report contains a diagram of the experimental setup for each experiment as well as giving a brief discussion of its purpose and list of collaborators for the experiment. Thirty-one experiments in the areas of nuclear physics and particle physics are covered. It concludes with a list of publications of the AGS experiments

  4. Antibaryon production in AU+AU collisions at the AGS

    International Nuclear Information System (INIS)

    Heintzelman, G.A.; Back, B. B.; Betts, R. R.; Chang, J.; Chang, W. C.; Chi, C. Y.; Gillitzer, A.; Henning, W. F.; Hofman, D. J.; Nanal, V.; Wuosmaa, A. H.

    1999-01-01

    Experiment E917 at the Brookhaven AGS has made a measurement of near-mid-rapidity antibaryon production in both the antiproton and antilambda channel. Results on dN/dy and inverse slope parameters are shown. A preliminary measurement of the ratio bar Λ/bar p is also presented

  5. Flexible Nonstick Replica Mold for Transfer Printing of Ag Ink.

    Science.gov (United States)

    Lee, Bong Kuk; Yu, Han Young; Kim, Yarkyeon; Yoon, Yong Sun; Jang, Won Ik; Do, Lee-Mi; Park, Ji-Ho; Park, Jaehoon

    2016-03-01

    We report the fabrication of flexible replica molds for transfer printing of Ag ink on a rigid glass substrate. As mold precursors, acrylic mixtures were prepared from silsesquioxane-based materials, silicone acrylate, poly(propylene glycol) diacrylate, 3,3,4,4,5,5,6,6,7,7,8,8, 9,9,10,10,10-heptadecafluorodecyl methacrylate, and photoinitiator. By using these materials, the replica molds were fabricated from a silicon master onto a flexible substrate by means of UV-assisted molding process at room temperature. The wettability of Ag ink decreased with increase in the water contact angle of replica molds. On the other hand, the transfer rate of Ag ink onto adhesive-modified substrates increased with increase in the water contact angle of replica molds. Transferred patterns were found to be thermally stable on the photocurable adhesive layer, whereas Ag-ink patterns transferred on non-photocurable adhesives were distorted by thermal treatment. We believe that these characteristics of replica molds and adhesives offer a new strategy for the development of the transfer printing of solution-based ink materials.

  6. The RF beam control system for the Brookhaven AGS synchrotron

    Energy Technology Data Exchange (ETDEWEB)

    Brennan, J.M.

    1992-01-01

    The new 1.5 GeV Booster synchrotron completes the injector chain for the Relativistic Heavy Ion Collider, RHIC. It enables the AGS to accelerate all heavy ions to 14 GeV/c for collider operation and also in the intensity of the AGS for fixed-target experiments by a factor of four. The ultra-high vacuum enables acceleration of partially stripped ions from the Tandem Van de Graaff to energies sufficient for complete stripping. For high intensities, it accelerates the 200 MeV linac beam in four batches of three bunches per AGS cycle. At 1.5 {times} 10{sup 13} protons per batch, it has the same space charge tune spread as the AGS at 200 MeV. This variety of applications means the Booster must accommodate a very wide range of particle masses and intensities. Since it operates in a Pulse-by-Pulse Modulation mode at 7.5 Hz, the computer controlled functions of time and magnetic field, and the 64 timing triggers of the beam control system take on unique values for each of four PPM users. Beams of {sup 197}Au{sup +33} ions and protons have been accelerated in the same PPM cycle.

  7. The RF beam control system for the Brookhaven AGS synchrotron

    Energy Technology Data Exchange (ETDEWEB)

    Brennan, J.M.

    1992-09-01

    The new 1.5 GeV Booster synchrotron completes the injector chain for the Relativistic Heavy Ion Collider, RHIC. It enables the AGS to accelerate all heavy ions to 14 GeV/c for collider operation and also in the intensity of the AGS for fixed-target experiments by a factor of four. The ultra-high vacuum enables acceleration of partially stripped ions from the Tandem Van de Graaff to energies sufficient for complete stripping. For high intensities, it accelerates the 200 MeV linac beam in four batches of three bunches per AGS cycle. At 1.5 {times} 10{sup 13} protons per batch, it has the same space charge tune spread as the AGS at 200 MeV. This variety of applications means the Booster must accommodate a very wide range of particle masses and intensities. Since it operates in a Pulse-by-Pulse Modulation mode at 7.5 Hz, the computer controlled functions of time and magnetic field, and the 64 timing triggers of the beam control system take on unique values for each of four PPM users. Beams of {sup 197}Au{sup +33} ions and protons have been accelerated in the same PPM cycle.

  8. Ag Data Commons: Adding Value to Open Agricultural Research Data

    Science.gov (United States)

    Public access to results of federally-funded research is a new mandate for large departments of the United States government. Public access to scholarly literature from U.S. investments is straightforward, with policies and systems like PubMed Central and PubAg (http://pubag.nal.usda.gov) already im...

  9. Investigation of chiral bands in {sup 106}Ag

    Energy Technology Data Exchange (ETDEWEB)

    Lieder, Evgenia [Themba LABS, Somerset West (South Africa); FhG, INT, Euskirchen (Germany); Lieder, Rainer; Bark, Rob; Lawrie, Elena; Lawrie, Kobus; Ntshangase, Sifiso; Mullins, Simon; Papka, Paul; Kheswa, Ntombi [Themba LABS, Somerset West (South Africa); Meng, Jie [PhS, PKU, Beijing (China); PhS, BUAA, Beijing (China); Qi, Bin [SDU, Weihai (China); Zhang, Shuangquan; Li, Zhipan [PhS, PKU, Beijing (China)

    2010-07-01

    Dipole bands in {sup 106}Ag have been studied with the {gamma}-detector array AFRODITE at iThemba LABS, South Africa. A {sup 96}Zr({sup 14}N,4n){sup 106}Ag reaction at a beam energy of 71 MeV has been used. The three previously known negative-parity bands in {sup 106}Ag have been extended. Bands 1 and 2 were proposed to be chiral partner bands. However, in view of the present results, bands 2 and 3 seem to be better candidates for chiral partner bands since their staggering parameters, B(M1)/B(E2) ratios, kinematic moments of inertia and quasiparticle alignments agree much better than those of bands 1 and 2. Triaxial relativistic mean field (RMF) and particle-rotor model (PRM) calculations support this interpretation. In the potential energy surface of {sup 106}Ag, obtained in RMF calculations, two minima have been found in the {beta}{sub 2}-{gamma} plane. Based on PRM calculations using the deformation parameters of the two minima and a {nu}h{sub 11/2} x {pi}g{sup -1}{sub 9/2} particle-hole configuration, bands 2 and 3 may represent partners with chiral vibration at {gamma}{approx}12degree. Band 1, located in the other minimum, may be a magnetic dipole band or the partner of a second pair of chiral bands.

  10. Magnetic relaxation effects in Fe/Ag(100) multilayers

    Science.gov (United States)

    Mørup, S.; Christiansen, G.; Koon, N. C.

    1992-02-01

    Mössbauer spectra of Fe/Ag(100) superlattice films have been analysed using a model for interacting magnetic clusters (superferromagnetism). It is found that the temperature dependence of the order parameter, deduced from the spectra, is in good agreement with the model.

  11. Species specificity for HBsAg binding protein endonexin II

    NARCIS (Netherlands)

    deBruin, WCC; Leenders, WPJ; Moshage, H; vanHaelst, UJGM

    Background/Aims: Hepatitis B virus displays a distinct species and tissue tropism, Previously we have demonstrated that a human liver plasma membrane protein,vith a molecular weight of approximately 34 kiloDalton specifically binds to HBsAg. This protein was identified as endonexin II, a Ca2+

  12. Noble silver nanoparticles (AgNPs) synthesis and characterization ...

    African Journals Online (AJOL)

    Nanotechnology is rapidly growing with nanoparticles produced and utilized in a wide range of pharmaceutical and commercial products throughout the world. In this study, fig (Ficus carica) leaf extracts were used for ecofriendly extracellular synthesis of stable silver nanoparticles (AgNPs) by treating an aqueous silver ...

  13. Antimicrobial Properties and Cytocompatibility of PLGA/Ag Nanocomposites

    Directory of Open Access Journals (Sweden)

    Mariangela Scavone

    2016-01-01

    Full Text Available The purpose of this study was to investigate the antimicrobial properties of multifunctional nanocomposites based on poly(dl-Lactide-co-Glycolide (PLGA and increasing concentration of silver (Ag nanoparticles and their effects on cell viability for biomedical applications. PLGA nanocomposite films, produced by solvent casting with 1 wt%, 3 wt% and 7 wt% of Ag nanoparticles were investigated and surface properties were characterized by atomic force microscopy and contact angle measurements. Antibacterial tests were performed using an Escherichia coli RB and Staphylococcus aureus 8325-4 strains. The cell viability and morphology were performed with a murine fibroblast cell line (L929 and a human osteosarcoma cell line (SAOS-2 by cell viability assay and electron microscopy observations. Matrix protein secretion and deposition were also quantified by enzyme-linked immunosorbent assay (ELISA. The results suggest that the PLGA film morphology can be modified introducing a small percentage of silver nanoparticles, which induce the onset of porous round-like microstructures and also affect the wettability. The PLGA/Ag films having silver nanoparticles of more than 3 wt% showed antibacterial effects against E. coli and S. aureus. Furthermore, silver-containing PLGA films displayed also a good cytocompatibility when assayed with L929 and SAOS-2 cells; indicating the PLGA/3Ag nanocomposite film as a promising candidate for tissue engineering applications.

  14. E3-transitions in sup(105, 107, 109, 111)Ag

    International Nuclear Information System (INIS)

    Shevelev, G.A.; Troitskaya, A.G.; Kartashov, V.M.

    1978-01-01

    Electron radiation of the isomeric transitions of the sup(105-111)Ag odd nuclei was studied using an iron magnetic πsup(√2) beta spectrometer. For most isomeric transitions, relative intensities of the K, L, M, and N lines have been measured; for sup(105-111)Ag and 111 Cd they were measured for the first time. Energy of gamma transitions, relative intensities of internal conversion electrons (ICE) compared with the theoretical ICE values for the E3 transitions are presented. The observations for all the shells are in a fairly gool agreement with the calculations. Systematics of low-lying excited states of the silver nuclei involved is proposed. It has been established that spins and parities of the first excited states of the sup(105-111)Ag odd nuclei are 7/2 + . Multipolarities of isomeric transitions from these staes are pure E3. Spin and parity 9/2 + of the second excited states may be uniquely determined unly for 109 Ag from direct measurements of the ICE transition at 45.8 keV

  15. Simulation of proton RF capture in the AGS Booster

    International Nuclear Information System (INIS)

    Khiari, F.Z.; Luccio, A.U.; Weng, W.T.

    1988-01-01

    RF capture of the proton beam in the AGS Booster has been simulated with the longitudinal phase-space tracking code ESME. Results show that a capture in excess of 95% can be achieved with multiturn injection of a chopped beam

  16. Electrical resistivity of liquid Ag-Au alloy

    International Nuclear Information System (INIS)

    Anis Alam, M.; Tomak, M.

    1983-01-01

    Calculations of the dependence of the electrical resistivity in liquid Ag-Au binary alloy on composition are reported. The structure of the binary alloy is described as a hard-sphere system. A one-parameter local pseudopotential, which incorporates s-d hybridization effects phenomenologically, is employed in the resistivity calculation. A reasonable agreement with experimental trend is observed. (author)

  17. Imaging and manipulation of a polar molecule oil Ag(111)

    DEFF Research Database (Denmark)

    Lin, Rong; Braun, K.F.; Tang, H.

    2001-01-01

    A scanning tunneling microscope (STM) was applied to image and laterally manipulate isolated phosphangulene molecules on Ag(111) at 6 K. Atomic-resolution images clearly revealed three characteristic types of appearances (three-lobed, fish and bump shape) for the adsorbed molecules, which could...

  18. Surface plasmon resonance of Ag organosols: Experimental and theoretical investigations

    Directory of Open Access Journals (Sweden)

    Vodnik Vesna

    2012-01-01

    Full Text Available The aim of this paper is to investigate and compare the changes in surface plasmon resonance (SPR of silver (Ag hydrosol and organosols obtained by experimental and theoretical approaches. Silver nanoparticles (Ag NPs of 5 ± 1.5 nm in diameter were prepared in water by reduction of silver nitrate with sodium borohydride. Nanoparticles were subsequently transferred into different organic solvents (chloroform, hexane, toluene, 1,2-dichlorobenzene using oleylamine as a transfer agent. These solvents were chosen because of the differences in their refractive indices. Using UV-Vis absorption spectrophotometry and transmission electron microscopy (TEM, we confirmed that there were no shape and size changes of the nanoparticles upon the transfer to the organic phase. The absorption spectra of the obtained Ag organosols showed only changes in the position of SPR band depending on dielectric property of the used solvent. To analyze these changes, absorption spectra were modelled using Mie theory for small spherical particles. The experimental and theoretical resonance values were compared with those predicted by Drude model and its limitations in the analysis of absorption behavior of Ag NPs in organic solvents were briefly discussed.

  19. Structure effects on the magnetism of AgCo nanoparticles

    International Nuclear Information System (INIS)

    Crisan, O.; Angelakeris, M.; Simeonidis, K.; Kehagias, Th.; Komninou, Ph.; Giersig, M.; Flevaris, N.K.

    2006-01-01

    Fabrication by colloidal chemistry and an extended structural and magnetic investigation are reported for AgCo bimetallic colloidal nanoparticles using X-ray diffraction, transmission electron microscopy and superconducting quantum interference device magnetometry. The AgCo nanoparticles exhibit a core-shell structure, with a face-centred cubic Ag core and a hexagonal close-packed Co (either complete or partial) shell. A bimodal size distribution of superparamagnetic (SPM) nanoparticles together with a small fraction of nanoparticles ferromagnetic at room temperature has been determined and their influence on magnetic properties is discussed. The arrays of self-assembled nanoparticles exhibit a lack of saturation of magnetisation and typical SPM behaviour. The annealing of the arrays greatly enhances the ferromagnetic character of the samples. Finally, the observed magnetic behaviour of the AgCo nanoparticles is correlated with surface spin disorder induced by the particular structural features of the sample, high fraction of magnetic atoms in surface states and finite-size effects

  20. A New Biosensor for Hydrogen Peroxide Based on Ag Colloid ...

    African Journals Online (AJOL)

    The sensor was highly sensitive to H2O2 with a detection limit of 1.0 x 10-6 M and the sensor achieved 95% of the steady-state current within 5 s. The sensor exhibited high sensitivity and stability. Keywords: Horseradish peroxidase; Ag colloid; Azure C; Hydrogen peroxide. South African Journal of Chemistry Vol.58 2005: 4- ...

  1. Electrochemical sensing and photocatalysis using Ag-TiO 2 ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 124; Issue 5. Electrochemical ... Anatase Ag-TiO2 microwires with high sensitivity and photocatalytic activity were synthesized via polyol synthesis route followed by a simple surface modification and chemical reduction approach for attachment of silver. The superior ...

  2. Communication: UV photoionization of cytosine catalyzed by Ag{sup +}

    Energy Technology Data Exchange (ETDEWEB)

    Taccone, Martín I.; Berdakin, Matías; Pino, Gustavo A., E-mail: gpino@fcq.unc.edu.ar [INFIQC (CONICET – Universidad Nacional de Córdoba), Dpto. de Fisicoquímica, Facultad de Ciencias Químicas, Centro Láser de Ciencias Moleculares, Universidad Nacional de Córdoba, Ciudad Universitaria, X5000HUA Córdoba (Argentina); Féraud, Geraldine; Dedonder-Lardeux, Claude; Jouvet, Christophe [Physique des Interactions Ioniques et Moléculaires (PIIM): UMR- 7345, CNRS, Aix Marseille Université, 13397 Marseille (France)

    2015-07-28

    The photo-induced damages of DNA in interaction with metal cations, which are found in various environments, still remain to be characterized. In this paper, we show how the complexation of a DNA base (cytosine (Cyt)) with a metal cation (Ag{sup +}) changes its electronic properties. By means of UV photofragment spectroscopy of cold ions, it was found that the photoexcitation of the CytAg{sup +} complex at low energy (315-282) nm efficiently leads to ionized cytosine (Cyt{sup +}) as the single product. This occurs through a charge transfer state in which an electron from the p orbital of Cyt is promoted to Ag{sup +}, as confirmed by ab initio calculations at the TD-DFT/B3LYP and RI-ADC(2) theory level using the SV(P) basis set. The low ionization energy of Cyt in the presence of Ag{sup +} could have important implications as point mutation of DNA upon sunlight exposition.

  3. Mesoporous silica supported Pd/Ag bimetallic nanoparticles as a ...

    Indian Academy of Sciences (India)

    Priyanka Verma

    2017-09-19

    Sep 19, 2017 ... bUnit of Elements Strategy Initiative for Catalysts and Batteries, Kyoto University, Katsura, Kyoto 615-8520,. Japan. cJST, PRESTO, 4-1-8 Honcho, Kawaguchi, ... Silver-based bimetallic Pd/Ag plasmonic catalysts supported on mesoporous silica catalyze the chemoselective reduction of nitrostyrene (NS) to ...

  4. The AgMIP Framework to Evaluate Agricultural Pathways

    Science.gov (United States)

    Ruane, Alex

    2015-01-01

    This talk will describe the community and research framework that AgMIP has built to enable evidence-based adaptation investment. We provide expertise on the ground and connect various disciplines in order to allow specific adaptations to be evaluated for their biophysical and socio-economic ramifications.

  5. Facile growth of Ag@Pt bimetallic nanorods on electrochemically ...

    Indian Academy of Sciences (India)

    Abstract. An efficient transducer was constructed by the direct growth of bimetallic Ag@Pt nanorods. (NRDs) on L−tryptophan functionalized electrochemically reduced graphene oxide (L−ERGO) modified elec- trode using galvanic displacement method for the electrooxidation of hydrazine. Initially, one dimensional.

  6. Photocurrent analysis of AgIn5S8 crystal

    Indian Academy of Sciences (India)

    cell applications [13–16]. Impurities and/or oxygen in many crystals play impor- ... literature on the application of solar cells by using AgIn5S8 crystals. Even in this work there is no information about the ..... ther study is certainly required to know how the photoelectric properties are affected by the density and the distribution ...

  7. Workshop on the AGS fixed-target research program

    Energy Technology Data Exchange (ETDEWEB)

    Ahrens, L; Schewe, P; Wanderer, P; Weisberg, H [eds.

    1978-01-01

    The summarized results of a two day workshop to determine experiment programs for the Brookhaven AGS during the construction period of the ISABELLE storage rings and after are presented. Topics covered include: experiments with low-energy beams; experiments with higher energy beams; neutrino physics; and polarized protons. (GHT)

  8. Interface controlled growth of nanostructures in discontinuous Ag ...

    Indian Academy of Sciences (India)

    The growth of discontinuous thin films of Ag and Au by low energy ion beam sputter deposition is reported. The study ... nance of the metal nanostructures can be tuned over a wide range of wavelengths from 400 to 700 nm by controlling the film–substrate ... on lithographic techniques such as electron beam lithogra-.

  9. Prevalence of HBsAg, knowledge, and vaccination practice against ...

    African Journals Online (AJOL)

    Among the respondents, 56.7% had good knowledge and 94.8% reported poor practice of vaccination against viral hepatitis B infection. Mean knowledge and vaccination practices scores (%) were 72.54+7.60 and 29.44+14.37 respectively. Only 29% of the respondents did post vaccination testing for anti HBsAg.

  10. Radial, sideward and elliptic flow at AGS energies

    Indian Academy of Sciences (India)

    Abstract. We study the baryon transverse in-plane (sideward) and elliptic flow from SIS to AGS energies for Au+Au collisions in a relativistic dynamical simulation model that includes all baryon resonances up to a mass of 2 GeV as well as string degrees of freedom for the higher mass continuum. There are two factors which ...

  11. Future technological developments to fulfill AG2020 targets

    DEFF Research Database (Denmark)

    Markussen, Mads Ville; Østergård, Hanne; Borch, Kristian

    2010-01-01

    . Based on the technological narratives and imperatives, we select a set of present available technologies that are able to support the society in reaching the targets set up by AG2020. For each of these technologies, we evaluate the strengths and weaknesses of the technology to reach the target as well...

  12. Photocurrent analysis of AgIn5S8 crystal

    Indian Academy of Sciences (India)

    The photocurrent (PC) spectrum of AgIn 5 S 8 crystal consists of a single peak, which provides to determine the bandgap energy by applying the Moss rule. The temperature dependence of the bandgap energy was alsocalculated. The PC dramatically increased by pre-illumination with light having wavelength ...

  13. Polarized beams at the ZGS and the AGS

    International Nuclear Information System (INIS)

    Ratner, L.G.

    1989-01-01

    I have had, and still do, a feeling of deja Vu as I have gone through the development of the polarized beam at the AGS. There were many similarities both scientifically and sociologically, and of course, some significant differences between the AGS and the ZGS. We traded the 12 GeV ZGS for the 28 GeV AGS, we traded Ron Martin for Derek Lowenstein, but having the lowest energy, high energy machine did not change. Paraphrasing some remarks of Bob Sachs, the AGS replaced the ZGS as the tail of the dog, and it appears that now the tail loppers are again on the loose. You will probably see them again somewhere in the world using body english to help polarize a beam. Basically, I would like to describe a little of the progression of events and the hardware in both accelerators that allowed Kent and his colleagues to do a great deal of very interesting spin physics. 6 refs., 30 figs

  14. An experimental investigation of Fang's Ag superlens suitable for integration

    DEFF Research Database (Denmark)

    Jeppesen, Claus; Nielsen, Rasmus Bundgaard; Xiao, Sanshui

    2009-01-01

    We report on experimental realization of the Fang Ag superlens structure [1] suitable for further processing and integration in bio-chips by replacing PMMA with a highly chemical resistant cyclo-olefin copolymer, mr-I T85 (Micro Resist Technology, Berlin, Germany). The superlens was able to resolve...

  15. AGS experiments in nuclear/QCD physics at medium energies

    Energy Technology Data Exchange (ETDEWEB)

    Lo Presti, P.

    1998-07-01

    This report contains a diagram of the experimental setup for each experiment as well as giving a brief discussion of its purpose and list of collaborators for the experiment. Thirty-one experiments in the areas of nuclear physics and particle physics are covered. It concludes with a list of publications of the AGS experiments.

  16. Seven-Year Treatment Outcome of Entecavir in a Real-World Cohort: Effects on Clinical Parameters, HBsAg and HBcrAg Levels.

    Science.gov (United States)

    Lam, Yuk-Fai; Seto, Wai-Kay; Wong, Danny; Cheung, Ka-Shing; Fung, James; Mak, Lung-Yi; Yuen, John; Chong, Chun-Kong; Lai, Ching-Lung; Yuen, Man-Fung

    2017-10-26

    We aimed to determine the levels of alanine aminotransferase (ALT), hepatitis B virus DNA (HBV DNA), HBsAg, and a novel viral marker (hepatitis B core-related antigen (HBcrAg)); hepatitis B e antigen (HBeAg) seroconversion and drug resistance rates after 7 years of entecavir treatment in chronic hepatitis B (CHB) patients. Two hundred and twenty-two Chinese CHB patients on continuous entecavir treatment were recruited. Serologic, virologic, biochemical outcomes, and the occurrence of entecavir signature mutations were determined. The rates of ALT normalization, HBeAg seroconversion, and undetectable HBV DNA were 98.3%, 82.1%, and 98.7%, respectively, after 7 years of entecavir treatment. The genotypic resistance rate was 1.2%. Decline of HBsAg level was modest with a median decline rate of 0.107 log IU/ml/year. Among patients with baseline HBsAg <1,000 IU/ml and annual HBsAg decline rate of ≥0.166 log IU/ml, all have HBsAg of <200 IU/ml (a level highly predictive for HBsAg seroclearance) at year 7. In contrast, in patients with baseline HBsAg ≥1,000 IU/ml and annual HBsAg decline rate of <0.166 log IU/ml, 95.5% had HBsAg of ≥200 IU/ml at year 7. Decline of HBcrAg levels was moderate with a median decline rate of 0.244 log kU/ml/year. Forty-seven patients (32.0%) had undetectable HBcrAg level at year 7. Long-term entecavir therapy continued to have good responses with low drug resistance rate. However, the decline of HBsAg with treatment was suboptimal. HBcrAg level declined at a relatively better rate. Baseline HBsAg level of <1,000 IU/ml and annual decline of 0.166 log IU/ml could be used to predict HBsAg response.

  17. Effects of TLC-Ag dressings on skin inflammation.

    Science.gov (United States)

    Bisson, Jean-François; Hidalgo-Lucas, Sophie; Bouschbacher, Marielle; Thomassin, Laetitia

    2013-06-01

    The TLC-Ag dressings, a combination of technology lipido-colloid and silver salts, are used to promote healing in wounds with risks or signs of local infection, thanks to the antimicrobial properties of the silver salts. Nanocrystalline silver dressings containing nanocrystalline silver, also used to improve wound healing, present both antimicrobial and anti-inflammatory effects. The aim of this study was to investigate the anti-inflammatory effects of TLC-Ag dressings in a model of chronic skin inflammation induced by repeated application of 12-O-tetradecanoylphorbol-13-acetate to the skin of hairless mice, in comparison with TLC dressing, Silcryst nanocrystalline dressing, desonide cream 0.05%, a corticoid cream used as positive control, and gauze. Daily treatments of the mice began 7 days after the start of induction of chronic skin inflammation and lasted for 7 days. A macroscopic score was performed daily during the treatment period until the mice killing on day 15 and skin samples were taken for histopathological analysis. TLC-Ag reduced significantly the macroscopic score of chronic skin inflammation from day 10 in comparison with gauze and TLC dressing, similarly to Silcryst nanocrystalline dressing and desonide cream, which presented the best anti-inflammatory effects. No significant differences were observed between TLC dressing and gauze. TLC-Ag reduced significantly the microscopic score of chronic skin inflammation in comparison with TLC dressing and gauze, similarly to Silcryst nanocrystalline dressing but significantly less than desonide cream. These results demonstrate that TLC-Ag dressings present significant anti-inflammatory effects on chronic skin inflammation. They can improve wound healing, due to both the antimicrobial and anti-inflammatory properties. © 2013 Japanese Dermatological Association.

  18. Rapid microwave-assisted nonaqueous synthesis and growth mechanism of AgCl/Ag, and its daylight-driven plasmonic photocatalysis.

    Science.gov (United States)

    Jiang, Jing; Zhang, Lizhi

    2011-03-21

    We report on a rapid microwave-assisted nonaqueous synthesis and the growth mechanism of AgCl/Ag with controlled size and shape. By rationally varying the reaction temperature and the microwave irradiation time, we achieved the transformation of nanocubes to rounded triangular pyramids by a combined process of "oriented attachment" and Ostwald ripening. The surface plasmon resonance (SPR) properties of the as-prepared AgCl/Ag have been found to be somewhat dependent on the size, morphology, and composition. The as-prepared AgCl/Ag exhibits high photocatalytic activity and good reusability for decomposing organic pollutants (such as methyl orange (MO), rhodamine B (RhB), and pentachlorophenol (PCP)) under indoor artificial daylight illumination (ca. 1 mW cm(-2)). The AgCl/Ag has also been found to display a superior ability to harvest diffuse indoor daylight (ca. 5 mW cm(-2)), and could complete the degradation of 10 mg  L(-1) MO within 15 min. Experiments involving the trapping of active species have shown that the photocatalytic degradation of organic pollutants in the AgCl/Ag system may proceed through direct hole transfer. This study has revealed that plasmonic daylight photocatalysis may open a new frontier for indoor pollutant control around the clock under fluorescent lamp illumination. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. A Spectral Active Material Interference in the Electrical Conductivity of the Internal Electrolyte and the Potential Shift of the Ag/AgCl Electrode

    International Nuclear Information System (INIS)

    Yun, Myung Hee; Yeon, Jei Won; Hwang, Jae Sik; Song, Kyu Seok

    2009-01-01

    The Ag/AgCl electrode is a type of reference electrode, commonly used in electrochemical measurements, because it is simple and stable. For these reasons, the Ag/AgCl electrode has long been used to provide a reliable potential monitoring of ions in a solution. However, when a reference electrode is used in an aqueous solution containing a very low electrolyte for a long period of time, this could cause a considerable potential shift of the reference electrode due to a dilution of the internal electrolyte. If the potential of the reference electrode shifts, undesirable conditions may occur. Therefore, many studies have been applied to improve the long-term performance of the reference electrode. However, these attempts have not completely resolved the problem of an electrolyte dilution by the test solution. In the present study, we developed a creative technique to correct the concentration change of the internal electrolyte by a long-term exposure of the Ag/AgCl electrode in very dilute solutions. We measured the electrical conductivity and UV/VIS absorbance of the internal electrolyte. From these measurements, we observed the linear relationship between KCl concentration and the potential of the Ag/AgCl electrode. In order to accelerate the diffusion of the internal electrolyte into the test solution, an Ag/AgCl electrode with a tiny perforation was used. We confirmed the feasibility of the creative calibration technique

  20. Synchrotron Micro-XRF Mapping of Ag Storage in a Coastal Marine Diatom: Implications for Ag as a Novel Paleoproductivity Proxy

    Science.gov (United States)

    King, M. W.; Hendy, I. L.; Lai, B.

    2012-12-01

    Silver (Ag) has potential for use as a paleoproductivity proxy in environments where a high flux of organic matter creates reducing conditions in sediments. Its proposed sequestration under reducing conditions as the species Ag2S confers an advantage over the more conventional productivity proxy barite, which becomes unreliable when sulfate reduction occurs in sediments. Other conventional productivity proxies (organic carbon and biogenic silica) are subject to rapid remineralization during early diagenesis, whereas Ag is likely to be preserved. Prior studies have hinted that Ag may be delivered to sediments via diatom debris. However, whether Ag is primarily associated with the frustule silica matrix or with diatom organic matter has not been established, and hence the mechanism of Ag delivery to sediments remains ambiguous. In this study we investigated the location of Ag storage in diatoms using synchrotron micro-XRF to map Ag, along with Ca, P, S, Si, and Fe, in single cells of the coastal marine diatom Thalassiosira pseudonana. Diatoms were cultured in the laboratory with Ag added to the growth medium at 50 and 100 ppb. Samples were analyzed at the sub-micron scale at the Advanced Photon Source, Argonne National Laboratory. Detectable Ag concentrations appear to be localized to intracellular "hotspots" that are not associated with frustule Si, either as part of the matrix or surface-adsorbed. Silver "hotspots" are co-localized with Fe, suggesting that Ag is stored within vacuoles, as recently shown for Fe in centric diatoms. Overall, our results support the hypothesis that Ag is delivered to sediments with diatom organic matter and suggest a common strategy by centric diatoms for intracellular sequestration of micronutrient (Fe) and nonessential (Ag) trace metals.

  1. Ternary ZnO/AgI/Ag2CO3 nanocomposites: Novel visible-light-driven photocatalysts with excellent activity in degradation of different water pollutants

    International Nuclear Information System (INIS)

    Golzad-Nonakaran, Behrouz; Habibi-Yangjeh, Aziz

    2016-01-01

    ZnO/AgI/Ag 2 CO 3 nanocomposites with different Ag 2 CO 3 contents were fabricated by a facile ultrasonic-irradiation method. The resultant samples were fairly characterized using XRD, EDX, SEM, TEM, UV–vis DRS, FT-IR, and PL techniques to reveal their microstructure, purity, morphology, and spectroscopic properties. Photocatalytic activity of the prepared samples was investigated by photodegradation of four dye pollutants (rhodamine B, methyl orange, methylene blue, and fuchsine) under visible-light irradiation. The photocatalytic experiments in degradation of rhodamine B showed that the ternary ZnO/AgI/Ag 2 CO 3 (30%) nanocomposite has an enhanced activity nearly 19 and 14 times higher than those of the binary ZnO/Ag 2 CO 3 and ZnO/AgI photocatalysts, respectively. Based on the obtained results, the highly enhanced activity was attributed to generation of more electron-hole pairs under visible-light irradiation and separation of the photogenerated charge carriers due to formation of tandem n-n heterojunctions between counterparts of the nanocomposite. The active species trapping experiments were also examined and it was showed that superoxide ion radicals play a vital role in the photocatalytic degradation reaction. More importantly, the ternary photocatalyst demonstrated good photostability. - Highlights: • ZnO/AgI/Ag 2 CO 3 nanocomposites were fabricated by an ultrasonic-irradiation method. • The activity was investigated by photodegradation of four dyes under visible light. • ZnO/AgI/Ag 2 CO 3 (30%) nanocomposite has the best activity under visible light. • Activity is 19 and 14-folds higher than ZnO/Ag 2 CO 3 and ZnO/AgI in degradation of RhB.

  2. File list: Unc.CDV.50.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.CDV.50.AllAg.Atrioventicular_canals mm9 Unclassified Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.CDV.50.AllAg.Atrioventicular_canals.bed ...

  3. File list: His.CDV.20.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.20.AllAg.Atrioventicular_canals mm9 Histone Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.CDV.20.AllAg.Atrioventicular_canals.bed ...

  4. File list: His.CDV.10.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.10.AllAg.Atrioventicular_canals mm9 Histone Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.CDV.10.AllAg.Atrioventicular_canals.bed ...

  5. File list: His.CDV.50.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.50.AllAg.Atrioventicular_canals mm9 Histone Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.CDV.50.AllAg.Atrioventicular_canals.bed ...

  6. File list: DNS.CDV.05.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.CDV.05.AllAg.Atrioventicular_canals mm9 DNase-seq Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/DNS.CDV.05.AllAg.Atrioventicular_canals.bed ...

  7. File list: His.CDV.05.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.05.AllAg.Atrioventicular_canals mm9 Histone Cardiovascular Atrioventicular canals http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.CDV.05.AllAg.Atrioventicular_canals.bed ...

  8. File list: Pol.CDV.50.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CDV.50.AllAg.Atrioventicular_canals mm9 RNA polymerase Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.CDV.50.AllAg.Atrioventicular_canals.bed ...

  9. File list: Unc.CDV.20.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.CDV.20.AllAg.Atrioventicular_canals mm9 Unclassified Cardiovascular Atrioventicular canals http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.CDV.20.AllAg.Atrioventicular_canals.bed ...

  10. File list: Unc.CDV.10.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.CDV.10.AllAg.Atrioventicular_canals mm9 Unclassified Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.CDV.10.AllAg.Atrioventicular_canals.bed ...

  11. File list: DNS.CDV.50.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.CDV.50.AllAg.Atrioventicular_canals mm9 DNase-seq Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/DNS.CDV.50.AllAg.Atrioventicular_canals.bed ...

  12. File list: Pol.CDV.20.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CDV.20.AllAg.Atrioventicular_canals mm9 RNA polymerase Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.CDV.20.AllAg.Atrioventicular_canals.bed ...

  13. File list: Unc.CDV.05.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.CDV.05.AllAg.Atrioventicular_canals mm9 Unclassified Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.CDV.05.AllAg.Atrioventicular_canals.bed ...

  14. File list: DNS.CDV.10.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.CDV.10.AllAg.Atrioventicular_canals mm9 DNase-seq Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/DNS.CDV.10.AllAg.Atrioventicular_canals.bed ...

  15. File list: DNS.CDV.20.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.CDV.20.AllAg.Atrioventicular_canals mm9 DNase-seq Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/DNS.CDV.20.AllAg.Atrioventicular_canals.bed ...

  16. File list: Pol.CDV.10.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CDV.10.AllAg.Atrioventicular_canals mm9 RNA polymerase Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.CDV.10.AllAg.Atrioventicular_canals.bed ...

  17. File list: Pol.CDV.05.AllAg.Atrioventicular_canals [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.CDV.05.AllAg.Atrioventicular_canals mm9 RNA polymerase Cardiovascular Atrioventicular canals... http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.CDV.05.AllAg.Atrioventicular_canals.bed ...

  18. CHEMICALLY MODIFIED FIELD-EFFECT TRANSISTORS - POTENTIOMETRIC AG+ SELECTIVITY OF PVC MEMBRANES BASED ON MACROCYCLIC THIOETHERS

    NARCIS (Netherlands)

    BRZOZKA, Z; COBBEN, PLHM; REINHOUDT, DN; EDEMA, JJH; KELLOGG, RM

    1993-01-01

    A chemically modified field-effect transistor (CHEMFET) with satisfactory Ag+ selectivity is described. The potentiometric Ag+ selectivities of CHEMFETs with plasticized PVC membranes based on macrocyclic thioethers have been determined. All the macrocyclic thioethers tested showed silver response

  19. Data of evolutionary structure change: 1YDVA-1AG1T [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-1AG1T 1YDV 1AG1 A T --RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDV...EPVWAIGTGKVATPQQAQEAHALIRSWVSSKIGADVAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPEFVDIIKATQ -- EEEE HH...in> 1YDV A 1YDVA NLDFDPSKLDV 1YDV A 1YDVA

  20. Data of evolutionary structure change: 1YDVA-1AG1O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YDVA-1AG1O 1YDV 1AG1 A O --RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDV...SGAFTGEVSLPILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGFMVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPVWAIGTGKVATPQQAQEAHALIRSWVSSKIGADVA.../index> 1YDV A 1YDVA 1 1YDV A 1YDVA...> CYS CA 492 1YDV A 1YDVA

  1. Study of energy transfer between riboflavin (vitamin B2) and AgNPs

    Science.gov (United States)

    Mokashi, Vidya V.; Walekar, Laxman S.; Anbhule, Prashant V.; Lee, Sang Hak; Patil, Shivajirao R.; Kolekar, Govind B.

    2014-03-01

    Here, we report the studies on the interaction and formation of nanobiocomplex between silver nanoparticle (AgNPs) and vitamin B2, i.e., riboflavin (RF). The binding study of AgNP to RF was studied by fluorescence, UV-Vis, and TEM techniques. AgNPs were prepared by reducing AgNO3 with trisodium citrate. Prepared nanoparticles size obtained at 20 nm having surface Plasmon resonance band at 426 nm. The absorbance band of RF at 264, 374, and 444 nm changes significantly in the presence of AgNPs suggests that there is change in the chemical environment surrounding AgNPs. A fluorescence spectral change for a solution of RF upon the addition of AgNPs and rapid quenching is suggestive of a rapid adsorption of RF on AgNPs.

  2. Long-term effects of Ag-containing alloys on mucous tissue present in biopsy samples.

    Science.gov (United States)

    Aoyagi, Hidekazu; Katagiri, Masataka

    2004-09-01

    The aim of this study was to investigate the long-term effects of alloys containing silver (mainly Ag-Sn alloy) on oral mucous tissue. We observed biopsy tissue specimens from patients diagnosed as having amalgam tattoo and/or metal pigmentation by light and electron microscopy and electron-probe microanalysis (EPMA). In most cases, Ag-Sn alloy was present in the tissue but it could not be confirmed if the alloy originated from amalgam. Distributions of both Ag-S and Ag-Sn have typical patterns. Most Ag forms Ag2S and is stably deposited in three patterns along the collagen, basement membrane, and fibrous cells without inducing any host reaction. On the other hand, Sn forms large granules that contain Ag, S, C, N, P, and Ca, and is in soft state in the tissue. Tissue reactions to the alloy become weaker as time passes.

  3. File list: ALL.Neu.10.AllAg.Induced_neural_progenitors [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Neu.10.AllAg.Induced_neural_progenitors mm9 All antigens Neural Induced neural prog....biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.10.AllAg.Induced_neural_progenitors.bed ...

  4. File list: ALL.Neu.50.AllAg.Induced_neural_progenitors [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Neu.50.AllAg.Induced_neural_progenitors mm9 All antigens Neural Induced neural prog....biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.50.AllAg.Induced_neural_progenitors.bed ...

  5. File list: Unc.CDV.50.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.CDV.50.AllAg.Endocardial_cells hg19 Unclassified Cardiovascular Endocardial cel...ls http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.CDV.50.AllAg.Endocardial_cells.bed ...

  6. File list: DNS.CDV.05.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.CDV.05.AllAg.Endocardial_cells hg19 DNase-seq Cardiovascular Endocardial cells ...http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.CDV.05.AllAg.Endocardial_cells.bed ...

  7. File list: His.CDV.20.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.20.AllAg.Endocardial_cells hg19 Histone Cardiovascular Endocardial cells ht...tp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.CDV.20.AllAg.Endocardial_cells.bed ...

  8. File list: DNS.CDV.20.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.CDV.20.AllAg.Endocardial_cells hg19 DNase-seq Cardiovascular Endocardial cells ...http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.CDV.20.AllAg.Endocardial_cells.bed ...

  9. File list: DNS.CDV.10.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.CDV.10.AllAg.Endocardial_cells hg19 DNase-seq Cardiovascular Endocardial cells ...http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.CDV.10.AllAg.Endocardial_cells.bed ...

  10. File list: Unc.CDV.05.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.CDV.05.AllAg.Endocardial_cells hg19 Unclassified Cardiovascular Endocardial cel...ls http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.CDV.05.AllAg.Endocardial_cells.bed ...

  11. File list: DNS.CDV.50.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.CDV.50.AllAg.Endocardial_cells hg19 DNase-seq Cardiovascular Endocardial cells ...http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.CDV.50.AllAg.Endocardial_cells.bed ...

  12. File list: Unc.CDV.20.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.CDV.20.AllAg.Endocardial_cells hg19 Unclassified Cardiovascular Endocardial cel...ls http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.CDV.20.AllAg.Endocardial_cells.bed ...

  13. File list: His.CDV.05.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.05.AllAg.Endocardial_cells hg19 Histone Cardiovascular Endocardial cells ht...tp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.CDV.05.AllAg.Endocardial_cells.bed ...

  14. File list: His.CDV.50.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.50.AllAg.Endocardial_cells hg19 Histone Cardiovascular Endocardial cells ht...tp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.CDV.50.AllAg.Endocardial_cells.bed ...

  15. File list: His.CDV.10.AllAg.Endocardial_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.10.AllAg.Endocardial_cells hg19 Histone Cardiovascular Endocardial cells ht...tp://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.CDV.10.AllAg.Endocardial_cells.bed ...

  16. File list: ALL.Lar.10.AllAg.Dorsal_mesothoracic_disc [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Lar.10.AllAg.Dorsal_mesothoracic_disc dm3 All antigens Larvae Dorsal mesothorac...barchive.biosciencedbc.jp/kyushu-u/dm3/assembled/ALL.Lar.10.AllAg.Dorsal_mesothoracic_disc.bed ...

  17. File list: ALL.Lar.50.AllAg.Dorsal_mesothoracic_disc [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Lar.50.AllAg.Dorsal_mesothoracic_disc dm3 All antigens Larvae Dorsal mesothorac...barchive.biosciencedbc.jp/kyushu-u/dm3/assembled/ALL.Lar.50.AllAg.Dorsal_mesothoracic_disc.bed ...

  18. File list: ALL.Lar.05.AllAg.Dorsal_mesothoracic_disc [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Lar.05.AllAg.Dorsal_mesothoracic_disc dm3 All antigens Larvae Dorsal mesothorac...barchive.biosciencedbc.jp/kyushu-u/dm3/assembled/ALL.Lar.05.AllAg.Dorsal_mesothoracic_disc.bed ...

  19. File list: ALL.Lar.20.AllAg.Dorsal_mesothoracic_disc [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Lar.20.AllAg.Dorsal_mesothoracic_disc dm3 All antigens Larvae Dorsal mesothorac...barchive.biosciencedbc.jp/kyushu-u/dm3/assembled/ALL.Lar.20.AllAg.Dorsal_mesothoracic_disc.bed ...

  20. File list: His.Dig.50.AllAg.Intestinal_adenoma [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.50.AllAg.Intestinal_adenoma mm9 Histone Digestive tract Intestinal adenoma ...http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Dig.50.AllAg.Intestinal_adenoma.bed ...

  1. File list: His.Dig.20.AllAg.Intestinal_adenoma [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.20.AllAg.Intestinal_adenoma mm9 Histone Digestive tract Intestinal adenoma ...http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Dig.20.AllAg.Intestinal_adenoma.bed ...

  2. File list: His.Dig.05.AllAg.Intestinal_crypt [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Dig.05.AllAg.Intestinal_crypt mm9 Histone Digestive tract Intestinal crypt http...://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Dig.05.AllAg.Intestinal_crypt.bed ...

  3. Growth of Au@Ag core-shell pentatwinned nanorods: tuning the end facets.

    Science.gov (United States)

    Zhang, Weiqing; Goh, Hao Ying Johnny; Firdoz, Shaik; Lu, Xianmao

    2013-09-16

    Au@Ag core-shell nanorods with tunable end facets are obtained by coating Au bipyramids (BPs) with Ag. The resultant nanorods exhibit a pentatwinned crystal structure with tips terminated with either {110} or {111} facets. The control over the end facets is achieved by varying the capping agents and tuning the reduction rate of Ag. Specifically, when Ag is reduced slowly, Au@Ag nanorods with flat {110} end facets are formed with cetyltrimethylammonium bromide (CTAB) as the capping agent. If CTAB is replaced with cetyltrimethylammonium chloride (CTAC), Au@Ag nanorods with tips terminated with {111} facets are obtained. However, at a high Ag reduction rate, dumbbell-shaped Au@Ag nanorods are formed, with either CTAB or CTAC as the capping agent. The morphological evolution of the nanorods in each case is closely followed and a growth mechanism is proposed. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. File list: His.Adp.10.AllAg.White_adipocytes [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Adp.10.AllAg.White_adipocytes mm9 Histone Adipocyte White adipocytes SRX800009 ...http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Adp.10.AllAg.White_adipocytes.bed ...

  5. File list: His.Adp.50.AllAg.White_adipocytes [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Adp.50.AllAg.White_adipocytes mm9 Histone Adipocyte White adipocytes SRX800009 ...http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Adp.50.AllAg.White_adipocytes.bed ...

  6. File list: Unc.CDV.50.AllAg.Carotid_Arteries [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.CDV.50.AllAg.Carotid_Arteries hg19 Unclassified Cardiovascular Carotid Arteries... http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.CDV.50.AllAg.Carotid_Arteries.bed ...

  7. File list: His.CDV.50.AllAg.Carotid_Arteries [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.50.AllAg.Carotid_Arteries hg19 Histone Cardiovascular Carotid Arteries http...://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.CDV.50.AllAg.Carotid_Arteries.bed ...

  8. File list: Unc.CDV.05.AllAg.Carotid_Arteries [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.CDV.05.AllAg.Carotid_Arteries hg19 Unclassified Cardiovascular Carotid Arteries... http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.CDV.05.AllAg.Carotid_Arteries.bed ...

  9. File list: His.CDV.20.AllAg.Carotid_Arteries [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.20.AllAg.Carotid_Arteries hg19 Histone Cardiovascular Carotid Arteries http...://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.CDV.20.AllAg.Carotid_Arteries.bed ...

  10. File list: His.CDV.10.AllAg.Carotid_Arteries [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.CDV.10.AllAg.Carotid_Arteries hg19 Histone Cardiovascular Carotid Arteries http...://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.CDV.10.AllAg.Carotid_Arteries.bed ...

  11. File list: Pol.Unc.50.AllAg.Unclassified [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Unc.50.AllAg.Unclassified mm9 RNA polymerase Unclassified Unclassified SRX25462...9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.Unc.50.AllAg.Unclassified.bed ...

  12. File list: Pol.Unc.05.AllAg.Unclassified [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Unc.05.AllAg.Unclassified dm3 RNA polymerase Unclassified Unclassified SRX11077...4 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.Unc.05.AllAg.Unclassified.bed ...

  13. File list: Pol.Unc.05.AllAg.Unclassified [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Unc.05.AllAg.Unclassified mm9 RNA polymerase Unclassified Unclassified SRX25462...9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.Unc.05.AllAg.Unclassified.bed ...

  14. File list: Unc.Unc.10.AllAg.Unclassified [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Unc.10.AllAg.Unclassified dm3 Unclassified Unclassified Unclassified SRX113302,...SRX041398 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Unc.Unc.10.AllAg.Unclassified.bed ...

  15. File list: Unc.Unc.20.AllAg.Unclassified [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Unc.20.AllAg.Unclassified dm3 Unclassified Unclassified Unclassified SRX113302,...SRX041398 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Unc.Unc.20.AllAg.Unclassified.bed ...

  16. File list: Pol.Unc.10.AllAg.Unclassified [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Unc.10.AllAg.Unclassified sacCer3 RNA polymerase Unclassified Unclassified http...://dbarchive.biosciencedbc.jp/kyushu-u/sacCer3/assembled/Pol.Unc.10.AllAg.Unclassified.bed ...

  17. File list: Unc.Unc.05.AllAg.Unclassified [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Unc.05.AllAg.Unclassified dm3 Unclassified Unclassified Unclassified SRX113302,...SRX041398 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Unc.Unc.05.AllAg.Unclassified.bed ...

  18. File list: Pol.Unc.10.AllAg.Unclassified [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Unc.10.AllAg.Unclassified dm3 RNA polymerase Unclassified Unclassified SRX11077...4 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/Pol.Unc.10.AllAg.Unclassified.bed ...

  19. File list: His.Bld.05.AllAg.Hematopoietic_Stem_Cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Bld.05.AllAg.Hematopoietic_Stem_Cells mm9 Histone Blood Hematopoietic Stem Cell...://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Bld.05.AllAg.Hematopoietic_Stem_Cells.bed ...

  20. File list: His.Bld.20.AllAg.Hematopoietic_Stem_Cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Bld.20.AllAg.Hematopoietic_Stem_Cells mm9 Histone Blood Hematopoietic Stem Cell...://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Bld.20.AllAg.Hematopoietic_Stem_Cells.bed ...