Crystal Structure of VC0702 at 2.0 Angstrom: Conserved Hypothetical Protein from Vibrio Cholerae
International Nuclear Information System (INIS)
Ni, S.; Forouhar, F.; Bussiere, D.; Robinson, H.; Kennedy, M.
2006-01-01
VC0702, a conserved hypothetical protein of unknown function from Vibrio cholerae, resides in a three-gene operon containing the MbaA gene that encodes for a GGDEF and EAL domain-containing protein which is involved in regulating formation of the extracellular matrix of biofilms in Vibrio cholerae. The VC0702 crystal structure has been determined at 2.0 Angstroms and refined to R work = 22.8% and R free = 26.3%. VC0702 crystallized in an orthorhombic crystal lattice in the C2221 space group with dimensions of a = 66.61 Angstroms, b = 88.118 Angstroms, and c = 118.35 Angstroms with a homodimer in the asymmetric unit. VC0702, which forms a mixed α + β three-layered αβα sandwich, belongs to the Pfam DUF84 and COG1986 families of proteins. Sequence conservation within the DUF84 and COG1986 families was used to identify a conserved patch of surface residues that define a cleft and potential substrate-binding site in VC0702. The three-dimensional structure of VC0702 is similar to that of Mj0226 from Methanococcus janeschii, which has been identified as a novel NTPase that binds NTP in a deep cleft similarly located to the conserved patch of surface residues that define an analogous cleft in VC0702. Collectively, the data suggest that VC0702 may have a biochemical function that involves NTP binding and phosphatase activity of some kind, and is likely involved in regulation of the signaling pathway that controls biofilm formation and maintenance in Vibrio cholerae
Identification of the conserved hypothetical protein BPSL0317 in Burkholderia pseudomallei K96243
Yusoff, Nur Syamimi; Damiri, Nadzirah; Firdaus-Raih, Mohd
2014-09-01
Burkholderia pseudomallei K96243 is the causative agent of melioidosis, a disease which is endemic in Northern Australia and Southeastern Asia. The genome encodes several essential proteins including those currently annotated as hypothetical proteins. We studied the conservation and the essentiality of expressed hypothetical proteins in normal and different stress conditions. Based on the comparative genomics, we identified a hypothetical protein, BPSL0317, a potential essential gene that is being expressed in all normal and stress conditions. BPSL0317 is also phylogenetically conserved in the Burkholderiales order suggesting that this protein is crucial for survival among the order's members. BPSL0317 therefore has a potential to be a candidate antimicrobial drug target for this group of bacteria.
Structure of the conserved hypothetical protein MAL13P1.257 from Plasmodium falciparum
International Nuclear Information System (INIS)
Holmes, Margaret A.; Buckner, Frederick S.; Van Voorhis, Wesley C.; Mehlin, Christopher; Boni, Erica; Earnest, Thomas N.; DeTitta, George; Luft, Joseph; Lauricella, Angela; Anderson, Lori; Kalyuzhniy, Oleksandr; Zucker, Frank; Schoenfeld, Lori W.; Hol, Wim G. J.; Merritt, Ethan A.
2006-01-01
The crystal structure of a conserved hypothetical protein, MAL13P1.257 from P. falciparum, has been determined at 2.17 Å resolution. The structure represents a new protein fold and is the first structural representative for Pfam sequence family PF05907. The structure of a conserved hypothetical protein, PlasmoDB sequence MAL13P1.257 from Plasmodium falciparum, Pfam sequence family PF05907, has been determined as part of the structural genomics effort of the Structural Genomics of Pathogenic Protozoa consortium. The structure was determined by multiple-wavelength anomalous dispersion at 2.17 Å resolution. The structure is almost entirely β-sheet; it consists of 15 β-strands and one short 3 10 -helix and represents a new protein fold. The packing of the two monomers in the asymmetric unit indicates that the biological unit may be a dimer.
Testing the feasibility of a hypothetical whaling-conservation permit market in Norway.
Huang, Biao; Abbott, Joshua K; Fenichel, Eli P; Muneepeerakul, Rachata; Perrings, Charles; Gerber, Leah R
2017-08-01
A cap-and-trade system for managing whale harvests represents a potentially useful approach to resolve the current gridlock in international whale management. The establishment of whale permit markets, open to both whalers and conservationists, could reveal the strength of conservation demand, about which little is known. This lack of knowledge makes it difficult to predict the outcome of a hypothetical whale permit market. We developed a bioeconomic model to evaluate the influence of economic uncertainty about demand for whale conservation or harvest. We used simulations over a wide range of parameterizations of whaling and conservation demands to examine the potential ecological consequences of the establishment of a whale permit market in Norwegian waters under bounded (but substantial) economic uncertainty. Uncertainty variables were slope of whaling and conservation demand, participation level of conservationists and their willingness to pay for whale conservation, and functional forms of demand, including linear, quadratic, and log-linear forms. A whale-conservation market had the potential to yield a wide range of conservation and harvest outcomes, the most likely outcomes were those in which conservationists bought all whale permits. © 2017 Society for Conservation Biology.
Aerosol Angstrom Absorption Coefficient Comparisons during MILAGRO.
Marley, N. A.; Marchany-Rivera, A.; Kelley, K. L.; Mangu, A.; Gaffney, J. S.
2007-12-01
Measurements of aerosol absorption were obtained as part of the MAX-Mex component of the MILAGRO field campaign at site T0 (Instituto Mexicano de Petroleo in Mexico City) by using a 7-channel aethalometer (Thermo- Anderson) during the month of March, 2006. The absorption measurements obtained in the field at 370, 470, 520, 590, 660, 880, and 950 nm were used to determine the aerosol Angstrom absorption exponents by linear regression. Since, unlike other absorbing aerosol species (e.g. humic like substances, nitrated PAHs), black carbon absorption is relatively constant from the ultraviolet to the infrared with an Angstrom absorption exponent of -1 (1), a comparison of the Angstrom exponents can indicate the presence of aerosol components with an enhanced UV absorption over that expected from BC content alone. The Angstrom exponents determined from the aerosol absorption measurements obtained in the field varied from - 0.7 to - 1.3 during the study and was generally lower in the afternoon than the morning hours, indicating an increase in secondary aerosol formation and photochemically generated UV absorbing species in the afternoon. Twelve-hour integrated samples of fine atmospheric aerosols (Petroleo (IMP) and CENICA.
International Nuclear Information System (INIS)
Erdman, P.W.; Zipf, E.C.
1987-01-01
Recent sounding rocket and satellite studies suggest that simultaneous measurements of the O I λ989-angstrom and λ1,304-angstrom resonance lines and of the forbidden λ1,172.6-angstrom and λ1641.3-angstrom transitions which also originate from the 3s'3D degree and 3s 3S degree states would form the basis of a useful remote sensing technique for measuring the O I density and optical of a planetary or stellar atmosphere. Because the λ1,172.6-angstrom and λ1641.3-angstrom emissions are weak lines and are emitted in a wavelength region rich in spectral features, it is important to determine whether typical flight instruments can make measurements with sufficient spectral purity so that the remote sensing observations will yield accurate results. We have made a detailed, high-resolution study of the far ultraviolet emission features in the regions surrounding the atomic oxygen transitions at λ1,172.6-angstrom and λ1,641.3-angstrom. These spectra, which were excited by electron impact on O 2 and N 2 , are presented in an attempt to display some potential sources of interference in aeronomical measurements of these O I lines. Both atomic and molecular emissions are found, and the spectral resolution necessary to make unambiguous measurements is discussed
Directory of Open Access Journals (Sweden)
Qi Zhai
Full Text Available The genome sequences of Eimeria tenella have been sequenced, but >70% of these genes are currently categorized as having an unknown function or annotated as conserved hypothetical proteins, and few of them have been studied. In the present study, a conserved hypothetical protein gene of E. tenella, designated EtCHP559, was cloned using rapid amplification of cDNA 5'-ends (5'RACE based on the expressed sequence tag (EST. The 1746-bp full-length cDNA of EtCHP559 contained a 1224-bp open reading frame (ORF that encoded a 407-amino acid polypeptide with the predicted molecular weight of 46.04 kDa. Real-time quantitative PCR analysis revealed that EtCHP559 was expressed at higher levels in sporozoites than in the other developmental stages (unsporulated oocysts, sporulated oocysts and second generation merozoites. The ORF was inserted into pCold-TF to produce recombinant EtCHP559. Using western blotting, the recombinant protein was successfully recognized by rabbit serum against E. tenella sporozoites. Immunolocalization by using EtCHP559 antibody showed that EtCHP559 was mainly distributed on the parasite surface in free sporozoites and became concentrated in the anterior region after sporozoites were incubated in complete medium. The EtCHP559 became uniformly dispersed in immature and mature schizonts. Inhibition of EtCHP559 function using anti-rEtCHP559 polyclonal antibody reduced the ability of E. tenella sporozoites to invade host cells by >70%. Animal challenge experiments demonstrated that the recombinant EtCHP559 significantly increased the average body weight gain, reduced the oocyst outputs, alleviated cecal lesions of the infected chickens, and resulted in anticoccidial index >160 against E. tenella. These results suggest that EtCHP559 plays an important role in sporozoite invasion and could be an effective candidate for the development of a new vaccine against E. tenella.
Soft x-ray amplification in lithium-like Al XI (154 /angstrom/) and Si XII (129 /angstrom/)
International Nuclear Information System (INIS)
Kim, D.; Skinner, C.H.; Wouters, A.; Valeo, E.; Voorhees, D.; Suckewer, S.
1988-03-01
Recent experiments on soft x-ray amplification in lithium-like ions in a CO 2 laser-produced recombining plasma confined in a magnetic field are presented. The maximum gain-length products observed are GL ≅ 3 to 4 for the 154 /angstrom/, 4f-3d transition in Al XI and GL (approxreverse arrowequal/ 1 to 2 for the 129 /angstrom/, 4f-3d transition in Si XII, respectively. A one-dimensional hydrodynamic code with a collisional-radiative atomic model was used to model the plasma and the theoretical predictions of gain agree well with the observations. Descriptions of both hydrodynamic and atomic physics code are given. 36 refs., 10 figs
Akhir, Nor Azurah Mat; Nadzirin, Nurul; Mohamed, Rahmah; Firdaus-Raih, Mohd
2015-09-01
Hypothetical proteins of bacterial pathogens represent a large numbers of novel biological mechanisms which could belong to essential pathways in the bacteria. They lack functional characterizations mainly due to the inability of sequence homology based methods to detect functional relationships in the absence of detectable sequence similarity. The dataset derived from this study showed 550 candidates conserved in genomes that has pathogenicity information and only present in the Burkholderiales order. The dataset has been narrowed down to taxonomic clusters. Ten proteins were selected for ORF amplification, seven of them were successfully amplified, and only four proteins were successfully expressed. These proteins will be great candidates in determining the true function via structural biology.
International Nuclear Information System (INIS)
Chin, Ko-Hsin; Huang, Zhao-Wei; Wei, Kun-Chou; Chou, Chia-Cheng; Lee, Cheng-Chung; Shr, Hui-Lin; Gao, Fei Philip; Lyu, Ping-Chiang; Wang, Andrew H.-J.; Chou, Shan-Ho
2005-01-01
A conserved hypothetical protein XC1692 from X. campestris pv. campestris has been overexpressed in E. coli. The purified recombinant protein crystallized in a variety of forms and diffracted to a resolution of at least 1.45 Å. Xanthomonas campestris pv. campestris strain 17 is a Gram-negative yellow-pigmented pathogenic bacterium that causes black rot, one of the major worldwide diseases of cruciferous crops. Its genome contains approximately 4500 genes, one third of which have no known structure and/or function yet are highly conserved among several different bacterial genuses. One of these gene products is XC1692 protein, containing 141 amino acids. It was overexpressed in Escherichia coli, purified and crystallized in a variety of forms using the hanging-drop vapour-diffusion method. The crystals diffract to at least 1.45 Å resolution. They are hexagonal and belong to space group P6 3 , with unit-cell parameters a = b = 56.9, c = 71.0 Å. They contain one molecule per asymmetric unit
Energy Technology Data Exchange (ETDEWEB)
Elias, Dwayne A.; Mukhopadhyay, Aindrila; Joachimiak, Marcin P.; Drury, Elliott C.; Redding, Alyssa M.; Yen, Huei-Che B.; Fields, Matthew W.; Hazen, Terry C.; Arkin, Adam P.; Keasling, Jay D.; Wall, Judy D.
2008-10-27
Hypothetical and conserved hypothetical genes account for>30percent of sequenced bacterial genomes. For the sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough, 347 of the 3634 genes were annotated as conserved hypothetical (9.5percent) along with 887 hypothetical genes (24.4percent). Given the large fraction of the genome, it is plausible that some of these genes serve critical cellular roles. The study goals were to determine which genes were expressed and provide a more functionally based annotation. To accomplish this, expression profiles of 1234 hypothetical and conserved genes were used from transcriptomic datasets of 11 environmental stresses, complemented with shotgun LC-MS/MS and AMT tag proteomic data. Genes were divided into putatively polycistronic operons and those predicted to be monocistronic, then classified by basal expression levels and grouped according to changes in expression for one or multiple stresses. 1212 of these genes were transcribed with 786 producing detectable proteins. There was no evidence for expression of 17 predicted genes. Except for the latter, monocistronic gene annotation was expanded using the above criteria along with matching Clusters of Orthologous Groups. Polycistronic genes were annotated in the same manner with inferences from their proximity to more confidently annotated genes. Two targeted deletion mutants were used as test cases to determine the relevance of the inferred functional annotations.
Imaging Lithium Atoms at Sub-Angstrom Resolution
Energy Technology Data Exchange (ETDEWEB)
O' Keefe, Michael A.; Shao-Horn, Yang
2005-01-03
John Cowley and his group at ASU were pioneers in the use of transmission electron microscopy (TEM) for high-resolution imaging. Three decades ago they achieved images showing the crystal unit cell content at better than 4A resolution. Over the years, this achievement has inspired improvements in resolution that have enabled researchers to pinpoint the positions of heavy atom columns within the cell. More recently, this ability has been extended to light atoms as resolution has improved. Sub-Angstrom resolution has enabled researchers to image the columns of light atoms (carbon, oxygen and nitrogen) that are present in many complex structures. By using sub-Angstrom focal-series reconstruction of the specimen exit surface wave to image columns of cobalt, oxygen, and lithium atoms in a transition metal oxide structure commonly used as positive electrodes in lithium rechargeable batteries, we show that the range of detectable light atoms extends to lithium. HRTEM at sub-Angstrom resolution will provide the essential role of experimental verification for the emergent nanotech revolution. Our results foreshadow those to be expected from next-generation TEMs with CS-corrected lenses and monochromated electron beams.
Variations of aerosol optical depth and Angstrom parameters at a ...
Indian Academy of Sciences (India)
In this paper, aerosol optical properties including aerosol optical depth (AOD), Angstrom exponent () and Angstrom turbidity coefficient () have been investigated during December 2009 to October 2010, in a suburban area of Zanjan (36°N, 43°E, 1700 m), in the north–west of Iran, using meteorological and sun ...
HRTEM Imaging of Atoms at Sub-Angstrom Resolution
Energy Technology Data Exchange (ETDEWEB)
O' Keefe, Michael A.; Allard, Lawrence F.; Blom, Douglas A.
2005-04-06
John Cowley and his group at Arizona State University pioneered the use of transmission electron microscopy (TEM) for high-resolution imaging. Images were achieved three decades ago showing the crystal unit cell content at better than 4 Angstrom resolution. This achievement enabled researchers to pinpoint the positions of heavy atom columns within the unit cell. Lighter atoms appear as resolution is improved to sub-Angstrom levels. Currently, advanced microscopes can image the columns of the light atoms (carbon, oxygen, nitrogen) that are present in many complex structures, and even the lithium atoms present in some battery materials. Sub-Angstrom imaging, initially achieved by focal-series reconstruction of the specimen exit surface wave, will become common place for next-generation electron microscopes with CS-corrected lenses and monochromated electron beams. Resolution can be quantified in terms of peak separation and inter-peak minimum, but the limits imposed on the attainable resolution by the properties of the micro-scope specimen need to be considered. At extreme resolution the ''size'' of atoms can mean that they will not be resolved even when spaced farther apart than the resolution of the microscope.
Sub-Angstrom Atomic-Resolution Imaging of Heavy Atoms to Light Atoms
Energy Technology Data Exchange (ETDEWEB)
O' Keefe, Michael A.; Shao-Horn, Yang
2003-05-23
Three decades ago John Cowley and his group at ASU achieved high-resolution electron microscope images showing the crystal unit cell contents at better than 4Angstrom resolution. Over the years, this achievement has inspired improvements in resolution that have enabled researchers to pinpoint the positions of heavy atom columns within the cell. More recently, this ability has been extended to light atoms as resolution has improved. Sub-Angstrom resolution has enabled researchers to image the columns of light atoms (carbon, oxygen and nitrogen) that are present in many complex structures. By using sub-Angstrom focal-series reconstruction of the specimen exit surface wave to image columns of cobalt, oxygen, and lithium atoms in a transition metal oxide structure commonly used as positive electrodes in lithium rechargeable batteries, we show that the range of detectable light atoms extends to lithium. HRTEM at sub-Angstrom resolution will provide the essential role of experimental verification for the emergent nanotech revolution. Our results foreshadow those to be expected from next-generation TEMs with Cs-corrected lenses and monochromated electron beams.
Jiang, Yi; Liu, Haican; Wang, Xuezhi; Li, Guilian; Qiu, Yan; Dou, Xiangfeng; Wan, Kanglin
2015-01-01
Host immune pressure and associated parasite immune evasion are key features of host-pathogen co-evolution. A previous study showed that human T cell epitopes of Mycobacterium tuberculosis are evolutionarily hyperconserved and thus it was deduced that M. tuberculosis lacks antigenic variation and immune evasion. Here, we selected 151 clinical Mycobacterium tuberculosis isolates from China, amplified gene encoding Rv1977 and compared the sequences. The results showed that Rv1977, a conserved hypothetical protein, is not conserved in M. tuberculosis strains and there are polymorphisms existed in the protein. Some mutations, especially one frameshift mutation, occurred in the antigen Rv1977, which is uncommon in M.tb strains and may lead to the protein function altering. Mutations and deletion in the gene all affect one of three T cell epitopes and the changed T cell epitope contained more than one variable position, which may suggest ongoing immune evasion.
Observation of melting in 30 angstrom diameter CdS nanocrystals
International Nuclear Information System (INIS)
Goldstein, A.N.; Colvin, V.L.; Alivisatos, A.P.
1991-01-01
In this paper temperature dependent electron diffraction studies on 30 Angstrom diameter CdS nanocrystals are described. The linear thermal expansion coefficient of the nanocrystals is 2.75 * 10 -5 Angstrom/K, and the melting point is 575 K. These data are in contrast to bulk CdS which has a melting point of 1750 K and a linear expansion coefficient of 5.5 * 10 -6 Angstrom/K. The observed depression in the melting point of these semiconductor clusters is similar to effects observed in metals and molecular crystals, indicating that the phenomenon of reduced melting point in small systems is a general one regardless of the type of material. The observation of melting point depression in these clusters also has far reaching implications for the preparation of highly crystalline clusters of CdS, as well as for the use of these nanocrystals as precursors to thin films
International Nuclear Information System (INIS)
Wouters, A.; Schwob, J.L.; Suckewer, S.; Seely, J.F.; Feldman, U.; Dave, J.H.
1988-03-01
High resolution spectra of the elements Fe, Ni, Zn, Ge, Se, and Mo injected into the PLT tokamak were recorded by the 2-meter Schwob-Fraenkel soft X-ray multichannel spectrometer (SOXMOS). Spectra were recorded every 50 ms during the time before and after injection. The spectral lines of the injected element were very strong in the spectrum recorded immedately after injection, and the transition in the injected element were easily distinguished from the transitions in te intrinsic elements (C, O, Ti, Cr, Fe, and Ni). An accurate wavelength scale was established using well-known reference transitions in the intrinsic elements. The spectra recorded just prior to injection were substracted from the spectra recorded after injection, and the resulting spectrum was composed almost entirely of transitions from the injected element. A large number of Δn + 0 transitions between the ground and the first excited configurations in the Li I through K I isoelectronic sequences of the injected elements were identified in the wavelength region 60 /angstrom/ to 345 /angstrom/. 33 refs., 5 figs., 1 tab
Conservation potential of agricultural water conservation subsidies
Huffaker, Ray
2008-07-01
A current policy subsidizes farmers to invest in improved on-farm irrigation efficiency, expecting water to be conserved off farm. Contrary to expectation, water has been increasingly depleted in some regions after such improvements. This paper investigates the policy's failure to conserve water consistently by (1) formulating an economic model of irrigated crop production to determine a profit-maximizing irrigator's range of responses to a subsidy and (2) embedding these responses into hypothetical streamflow diagrams to ascertain their potential to conserve water under various hydrologic regimes. Testable hypotheses are developed to predict the conservation potential of a subsidy in real-world application.
Directory of Open Access Journals (Sweden)
Timoteo E. Simone
2017-09-01
Full Text Available Payments for Environmental Services (PES are relatively novel mechanisms whereby the adoption of sustainable management practices by a stakeholder is rewarded by incentives linked to external markets. Adoption of PES for conservation agricultural practices (CAPS by smallholder farmers may provide opportunities to increase household income or cover the technology costs of adoption if the carbon sequestration benefits of CAPS are quantifiable, adoption rates are accelerated and maintained, a mechanism exists whereby carbon sequestration services can be compensated, and carbon offset exchange markets are viable. This research suggests a methodology to examine a PES market for carbon offsets generated by the adoption of CAPS by farmers in Mozambique. Assuming a cumulative adoption of 60% over a 20-year period, revenue from PES market participation to CA adopters was two times higher than revenue earned when disadoption occurred midway through the simulation. Lower adoption targets are associated with higher per household returns when fertilizer rates typical to the region are increased. Establishing and maintaining a sustainable PES system in the study region would require significant investment in time and resources. The lack of on-the-ground institutions or local support for such a program would also challenge successful implementation. Finally, the programs where participant success depends on external markets, such as the hypothetical one suggested here, are subject to the ebb and flow of foreign demand for carbon offsets. Addressing these three broad constraints to a PES/CAPS program in the region would require grass-roots driven policy initiatives with buy-in at multiple social, economic, and political levels.
Sub-Angstrom microscopy through incoherent imaging and image reconstruction
International Nuclear Information System (INIS)
Pennycook, S.J.; Jesson, D.E.; Chisholm, M.F.; Ferridge, A.G.; Seddon, M.J.
1992-03-01
Z-contrast scanning transmission electron microscopy (STEM) with a high-angle annular detector breaks the coherence of the imaging process, and provides an incoherent image of a crystal projection. Even in the presence of strong dynamical diffraction, the image can be accurately described as a convolution between an object function, sharply peaked at the projected atomic sites, and the probe intensity profile. Such an image can be inverted intuitively without the need for model structures, and therefore provides the important capability to reveal unanticipated interfacial arrangements. It represents a direct image of the crystal projection, revealing the location of the atomic columns and their relative high-angle scattering power. Since no phase is associated with a peak in the object function or the contrast transfer function, extension to higher resolution is also straightforward. Image restoration techniques such as maximum entropy, in conjunction with the 1.3 Angstrom probe anticipated for a 300 kV STEM, appear to provide a simple and robust route to the achievement of sub-Angstrom resolution electron microscopy
Modeling the 6,300-angstrom low-latitude nightglow
International Nuclear Information System (INIS)
Fesen, C.G.; Abreu, V.J.
1987-01-01
Observations of the 6,300-angstrom nightglow form the Visible Airglow Experiment (VAE) instrument on AE-E are presented for spring equinox, solar cycle maximum conditions. The data comprise altitude profiles and integrated column brightness maps from ∼1,800 to 0400 LT and within ±30 degrees of the dip equator. The data clearly show near-midnight enhancements of the 6,300-angstrom emission. Attempts to model the column brightness maps indicated that these enhancements are due to tidal effects: the enhancements were only reproduced in the theoretical calculations which included upward propagating tidal components in the neutral winds. Further, low equatorial intensities were observed by the VCAE which could only be simulated by assuming that the phase of the E x B drift by shifted 1 hour LT; i.e., upward drift persists until 2,000 LT instead of 1,900 LT. The VAE observations could be reasonably simulated with the phase shift in the E x B drift and with the dip and geographic equators offset. The major discrepancy is in the magnitude of the nightglow maxima: the calculated intensities are a maximum of 2 times too large. Possible sources are uncertainties in the neutral densities, chemistry, and rate coefficients and in the neutral winds
Radiological consequences of a hypothetical ''roof breakdown'' accident of the Chernobyl sarcophagus
International Nuclear Information System (INIS)
Pretzsch, G.
1997-01-01
On behalf of the German Federal Ministry for Environment, Nature Conservation and Nuclear Safety GRS performed investigations with the aim to improve the safety of the Chernobyl Unit 4 shelter in close connection with the Ministry for Environment and Nuclear Safety of the Ukraina from 1992 to 1995. One of the tasks of the working programme was concerned with the analysis of hypothetical accidents of the present shelter, which comprises the newly built Sarcophagus and the remaining ruins of Unit 4. In close collaboration with Ukrainian and Russian experts the maximum hypothetical accident was defined to be the breakdown of the roof of the Sarcophagus and subsequent release of the radioactive dust which is mainly located in the destroyed reactor hall and the neighboring rooms
Diffraction patterns from 7-Angstroms tubular halloysite
International Nuclear Information System (INIS)
Eggleton, T.
1998-01-01
Full text: The diffraction patterns from 7-Angstroms tubular halloysite are superficially like those from kaolinite. Diffraction from a tubular aggregate of atoms, however, differs from that from a crystal because there is no linear repetition in two of the three conventional crystallographic directions. In tubular halloysite, the tube axis is [010] or [110] and in this direction the unit cell repeats in the normal linear fashion. The x-axis, by contrast, changes direction tangentially around the tube circumference, and there can be no true z-axis, because unit cells in the radial direction do not superimpose, since each successive tubular layer has a larger radius than its predecessor and therefore must contain more unit cells than its predecessor. Because tubular 'crystals' do not have a lattice repeat, use of Bragg 'hkl' indices is not appropriate. In the xy plane, a small area of the structure approximates a flat layer silicate, and hk indices may been used to label diffraction maxima. Similarly, successive 1:1 layers tangential to the tube walls yield a series of apparent 001 diffraction maxima. Measurement of these shows that the d-spacings do not form an exact integral series. The reason for this lies in the curvature of the structure. Calculated electron and powder X-ray diffraction patterns, based on a model of concentric 1:1 layers with no regular relation between them other than the 7.2 Angstroms spacing, closely simulate the observed data. Evidence for the 2-layer structure that is generally accepted may need to be reassessed in the light of these results
THE Na 8200 Angstrom-Sign DOUBLET AS AN AGE INDICATOR IN LOW-MASS STARS
Energy Technology Data Exchange (ETDEWEB)
Schlieder, Joshua E.; Simon, Michal [Department of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794 (United States); Lepine, Sebastien; Rice, Emily [Department of Astrophysics, American Museum of Natural History, Central Park West at 79th Street, New York, NY 10024 (United States); Fielding, Drummond [Department of Physics and Astronomy, Johns Hopkins University, 366 Bloomberg Center, 3400 North Charles Street, Baltimore, MD 21218 (United States); Tomasino, Rachael, E-mail: michal.simon@stonybrook.edu, E-mail: schlieder@mpia-hd.mpg.de, E-mail: lepine@amnh.org, E-mail: erice@amnh.org, E-mail: dfieldi1@jhu.edu, E-mail: tomas1r@cmich.edu [Department of Physics, Central Michigan University, Mount Pleasant, MI 48859 (United States)
2012-05-15
We investigate the use of the gravity sensitive neutral sodium (Na I) doublet at 8183 Angstrom-Sign and 8195 Angstrom-Sign (Na 8200 Angstrom-Sign doublet) as an age indicator for M dwarfs. We measured the Na doublet equivalent width (EW) in giants, old dwarfs, young dwarfs, and candidate members of the {beta} Pic moving group using medium-resolution spectra. Our Na 8200 A doublet EW analysis shows that the feature is useful as an approximate age indicator in M-type dwarfs with (V - K{sub s}) {>=} 5.0, reliably distinguishing stars older and younger than 100 Myr. A simple derivation of the dependence of the Na EW on temperature and gravity supports the observational results. An analysis of the effects of metallicity shows that this youth indicator is best used on samples with similar metallicity. The age estimation technique presented here becomes useful in a mass regime where traditional youth indicators are increasingly less reliable, is applicable to other alkali lines, and will help identify new low-mass members in other young clusters and associations.
Ma, Wen-Long; Liu, Ren-Bao
2016-08-01
Single-molecule sensitivity of nuclear magnetic resonance (NMR) and angstrom resolution of magnetic resonance imaging (MRI) are the highest challenges in magnetic microscopy. Recent development in dynamical-decoupling- (DD) enhanced diamond quantum sensing has enabled single-nucleus NMR and nanoscale NMR. Similar to conventional NMR and MRI, current DD-based quantum sensing utilizes the "frequency fingerprints" of target nuclear spins. The frequency fingerprints by their nature cannot resolve different nuclear spins that have the same noise frequency or differentiate different types of correlations in nuclear-spin clusters, which limit the resolution of single-molecule MRI. Here we show that this limitation can be overcome by using "wave-function fingerprints" of target nuclear spins, which is much more sensitive than the frequency fingerprints to the weak hyperfine interaction between the targets and a sensor under resonant DD control. We demonstrate a scheme of angstrom-resolution MRI that is capable of counting and individually localizing single nuclear spins of the same frequency and characterizing the correlations in nuclear-spin clusters. A nitrogen-vacancy-center spin sensor near a diamond surface, provided that the coherence time is improved by surface engineering in the near future, may be employed to determine with angstrom resolution the positions and conformation of single molecules that are isotope labeled. The scheme in this work offers an approach to breaking the resolution limit set by the "frequency gradients" in conventional MRI and to reaching the angstrom-scale resolution.
Black Carbon, Aerosol optical depth and Angstrom Exponent in São Paulo, Brazil
Miranda, R. M.; Perez-Martinez, P. J.; Andrade, M. D. F.
2017-12-01
Black carbon (BC) is a major absorber of solar radiation, and its impact on the radiative balance is therefore considered important. Fossil fuel combustion processes and biomass burning result in the emission of BC. Black carbon is being monitored since 2014 with a Multi-Angle Absorption Photometer-MAAP (5012; Thermo Scientific) in the East Zone of São Paulo, Brazil. São Paulo Metropolitan Area with more than 19 million inhabitants, 7 million vehicles, has high concentrations of air pollutants, especially in the winter. Vehicles can be considered the principal source of particles emitted to the atmosphere. Concentration of the pollutant had an average of 1.95 ug.m-3 ± 2.06 and a maximum value of 19.93 ug.m-3. These large variations were due to meteorological effects and to the influence of anthropogenic activities, since samples were collected close to important highways. Winds coming from the East part predominate. Higher concentrations were found in the winter months (June, July and August). Optical data from AERONET (Aerosol Optical Depth-AOD 550 nm and Angstrom Exponent 440-675 nm) were related to BC concentrations for the period from August, 2016. Average values of AOD at 500 nm and Angstrom Parameter (440-675nm) were 0.16±0.11 and 1.44±0.23, respectively. Higher BC concentrations were related to lower Angstrom values.
Towards sub-{Angstrom} resolution through incoherent imaging
Energy Technology Data Exchange (ETDEWEB)
Pennycook, S.J.; Chisholm, M.F. [Oak Ridge National Lab., TN (United States); Nellist, P.D. [Cavendish Lab., Cambridge, (United Kingdom)
1997-04-01
As first pointed out by Lord Rayleigh a century ago, incoherent imaging offers a substantial resolution enhancement compared to coherent imaging, together with freedom from phase contrast interference effects and contrast oscillations. In the STEM configuration, with a high angle annular detector to provide the transverse incoherence, the image also shows strong Z-contrast, sufficient in the case of a 300 kV STEM to image single Pt and Rh atoms on a {gamma}-alumina support. The annular detector provides complementarity to a bright field detector of the same size. For weakly scattering specimens, it shows greater contrast than the incoherent bright field image, and also facilitates EELS analysis at atomic resolution, using the Z-contrast image to locate the probe with sub-{angstrom} precision. The inner radius of the annular detector can be chosen to reduce the transverse coherence length to well below the spacings needed to resolve the object, a significant advantage compared to light microscopy.
Electromagnetic Saturation of Angstrom-Sized Quantum Barriers at Terahertz Frequencies
Bahk, Young-Mi; Kang, Bong Joo; Kim, Yong Seung; Kim, Joon-Yeon; Kim, Won Tae; Kim, Tae Yun; Kang, Taehee; Rhie, Jiyeah; Han, Sanghoon; Park, Cheol-Hwan; Rotermund, Fabian; Kim, Dai-Sik
2015-09-01
Metal-graphene-metal hybrid structures allow angstrom-scale van der Waals gaps, across which electron tunneling occurs. We squeeze terahertz electromagnetic waves through these λ /10 000 000 gaps, accompanied by giant field enhancements. Unprecedented transmission reduction of 97% is achieved with the transient voltage across the gap saturating at 5 V. Electron tunneling facilitated by the transient electric field strongly modifies the gap index, starting a self-limiting process related to the barrier height. Our work enables greater interplay between classical optics and quantum tunneling, and provides optical indices to the van der Waals gaps.
Electromagnetic Saturation of Angstrom-Sized Quantum Barriers at Terahertz Frequencies.
Bahk, Young-Mi; Kang, Bong Joo; Kim, Yong Seung; Kim, Joon-Yeon; Kim, Won Tae; Kim, Tae Yun; Kang, Taehee; Rhie, Jiyeah; Han, Sanghoon; Park, Cheol-Hwan; Rotermund, Fabian; Kim, Dai-Sik
2015-09-18
Metal-graphene-metal hybrid structures allow angstrom-scale van der Waals gaps, across which electron tunneling occurs. We squeeze terahertz electromagnetic waves through these λ/10 000 000 gaps, accompanied by giant field enhancements. Unprecedented transmission reduction of 97% is achieved with the transient voltage across the gap saturating at 5 V. Electron tunneling facilitated by the transient electric field strongly modifies the gap index, starting a self-limiting process related to the barrier height. Our work enables greater interplay between classical optics and quantum tunneling, and provides optical indices to the van der Waals gaps.
International Nuclear Information System (INIS)
Xu, Ling; Sedelnikova, Svetlana E.; Baker, Patrick J.; Rice, David W.
2006-01-01
SA0961 is an unknown hypothetical protein from Staphylococcus aureus that can be identified in the Firmicutes division of Gram-positive bacteria. SA0961 was cloned and the protein was overexpressed in Escherichia coli, purified and subsequently crystallized. SA0961 is an unknown hypothetical protein from Staphylococcus aureus that can be identified in the Firmicutes division of Gram-positive bacteria. The gene for the homologue of SA0961 in Bacillus subtilis, ylaN, has been shown to be essential for cell survival, thus identifying the protein encoded by this gene as a potential target for the development of novel antibiotics. SA0961 was cloned and the protein was overexpressed in Escherichia coli, purified and subsequently crystallized. Crystals of selenomethionine-labelled SA0961 diffract to beyond 2.4 Å resolution and belong to the monoclinic space group P2 1 , with unit-cell parameters a = 31.5, b = 42.7, c = 62.7 Å, β = 92.4° and two molecules in the asymmetric unit. A full structure determination is under way to provide insights into the function of this protein
Energy Technology Data Exchange (ETDEWEB)
Xu, Ling; Sedelnikova, Svetlana E.; Baker, Patrick J.; Rice, David W., E-mail: d.rice@sheffield.ac.uk [Krebs Institute for Biomolecular Research, Department of Molecular Biology and Biotechnology, The University of Sheffield, Sheffield S10 2TN (United Kingdom)
2006-08-01
SA0961 is an unknown hypothetical protein from Staphylococcus aureus that can be identified in the Firmicutes division of Gram-positive bacteria. SA0961 was cloned and the protein was overexpressed in Escherichia coli, purified and subsequently crystallized. SA0961 is an unknown hypothetical protein from Staphylococcus aureus that can be identified in the Firmicutes division of Gram-positive bacteria. The gene for the homologue of SA0961 in Bacillus subtilis, ylaN, has been shown to be essential for cell survival, thus identifying the protein encoded by this gene as a potential target for the development of novel antibiotics. SA0961 was cloned and the protein was overexpressed in Escherichia coli, purified and subsequently crystallized. Crystals of selenomethionine-labelled SA0961 diffract to beyond 2.4 Å resolution and belong to the monoclinic space group P2{sub 1}, with unit-cell parameters a = 31.5, b = 42.7, c = 62.7 Å, β = 92.4° and two molecules in the asymmetric unit. A full structure determination is under way to provide insights into the function of this protein.
In Silico screening for functional candidates amongst hypothetical proteins
Directory of Open Access Journals (Sweden)
Sanderhoff May
2009-09-01
Full Text Available Abstract Background The definition of a hypothetical protein is a protein that is predicted to be expressed from an open reading frame, but for which there is no experimental evidence of translation. Hypothetical proteins constitute a substantial fraction of proteomes of human as well as of other eukaryotes. With the general belief that the majority of hypothetical proteins are the product of pseudogenes, it is essential to have a tool with the ability of pinpointing the minority of hypothetical proteins with a high probability of being expressed. Results Here, we present an in silico selection strategy where eukaryotic hypothetical proteins are sorted according to two criteria that can be reliably identified in silico: the presence of subcellular targeting signals and presence of characterized protein domains. To validate the selection strategy we applied it on a database of human hypothetical proteins dating to 2006 and compared the proteins predicted to be expressed by our selecting strategy, with their status in 2008. For the comparison we focused on mitochondrial proteins, since considerable amounts of research have focused on this field in between 2006 and 2008. Therefore, many proteins, defined as hypothetical in 2006, have later been characterized as mitochondrial. Conclusion Among the total amount of human proteins hypothetical in 2006, 21% have later been experimentally characterized and 6% of those have been shown to have a role in a mitochondrial context. In contrast, among the selected hypothetical proteins from the 2006 dataset, predicted by our strategy to have a mitochondrial role, 53-62% have later been experimentally characterized, and 85% of these have actually been assigned a role in mitochondria by 2008. Therefore our in silico selection strategy can be used to select the most promising candidates for subsequent in vitro and in vivo analyses.
Energy Technology Data Exchange (ETDEWEB)
Belbeoch nee Goldsztein, B [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1958-06-15
Information on the structure of polyethylene is deduced from a comparison of the results obtained by central diffusion and by other X-ray methods. The structure depends on the thermal and mechanical treatment to which the samples are subjected, as well as on the observation temperature. The central diffusion due to the heterogeneity of the material at the scale of 100-200 Angstrom is bound up with the presence of both the amorphous and crystalline phases. Stretched polythene shows a more or less regular succession of orderly and disorderly regions. When released it has a structure of recrystallisation preceded by 'amorphization'. (author) [French] Les informations sur la structure du polyethylene sont deduites de la confrontation des resultats obtenus par la diffusion centrale et par d'autres methodes de rayons X. La structure depend des traitements thermiques et mecaniques subis par les echantillons ainsi que la temperature d'observation. La diffusion centrale due a l'existence d'heterogeneites de la matiere a l'echelle 100-200 Angstrom est lie a la presence des deux phases amorphe et cristallisee. Le polyethylene etire comporte une succession plus ou moins reguliere de domaines ordonnes et desordonnes. Le polyethylene relaxe a une structure de recristallisation precedee d'une 'amorphisation'. (auteur)
LID: Computer code for identifying atomic and ionic lines below 3500 Angstroms
International Nuclear Information System (INIS)
Peek, J.M.; Dukart, R.J.
1987-08-01
An interactive computer code has been written to search a data base containing information useful for identifying lines in experimentally-observed spectra or for designing experiments. The data base was the basis for the Kelly and Palumbo critical review of well-resolved lines below 2000 Angstroms, includes lines below 3500 Angstroms for atoms and ions of hydrogen through krypton, and was obtained from R.L. Kelly. This code allows the user to search the data base for a user-specified wavelength region, with this search either limited to atoms or ions of the user's choice for all atoms and ions contained in the data base. The line information found in the search is stored in a local file for later reference. A plotting capability is provided to graphically display the lines resulting from the search. Several options are available to control the nature of these graphs. It is also possible to bring in data from another source, such as an experimental spectra, for display along with the lines from the data-base search. Options for manipulating the experimental spectra's background intensity and wavelength scale are also available to the user. The intensities for the lines from each ion found in the data-base search can be scaled by a multiplicative constant to better simulate the observed spectrum
ATOMIC DATA FOR ABSORPTION-LINES FROM THE GROUND-LEVEL AT WAVELENGTHS GREATER-THAN-228-ANGSTROM
VERNER, DA; BARTHEL, PD; TYTLER, D
1994-01-01
We list wavelengths, statistical weigths and oscillator strengths for 2249 spectral lines arising from the ground states of atoms and ions. The compilation covers all wavelengths longward of the HeII Lyman limit at 227.838 Angstrom and all the ion states of all elements from hydrogen to bismuth (Z =
Modelling of melting and solidification transport phenomena during hypothetical NPP severe accidents
International Nuclear Information System (INIS)
Sarler, B.
1992-01-01
A physical and mathematical framework to deal with the transport phenomena occuring during melting and solidification of the hypothetical NPP severe accidents is presented. It concentrates on the transient temperature, velocity, and species concentration distributions during such events. The framework is based on the Mixture Continuum Formulation of the components and phases, cast in the boundary-domain integral shape structured by the fundamental solution of the Laplace equation. The formulation could cope with various solid-liquid sub-systems through the inclusion of the specific closure relations. The deduced system of boundary-domain integral equations for conservation of mass, energy, momentum, and species could be solved by the boundary element discrete approximative method. (author) [sl
Shen, Yue-Xiao; Song, Woochul C; Barden, D Ryan; Ren, Tingwei; Lang, Chao; Feroz, Hasin; Henderson, Codey B; Saboe, Patrick O; Tsai, Daniel; Yan, Hengjing; Butler, Peter J; Bazan, Guillermo C; Phillip, William A; Hickey, Robert J; Cremer, Paul S; Vashisth, Harish; Kumar, Manish
2018-06-12
Synthetic polymer membranes, critical to diverse energy-efficient separations, are subject to permeability-selectivity trade-offs that decrease their overall efficacy. These trade-offs are due to structural variations (e.g., broad pore size distributions) in both nonporous membranes used for Angstrom-scale separations and porous membranes used for nano to micron-scale separations. Biological membranes utilize well-defined Angstrom-scale pores to provide exceptional transport properties and can be used as inspiration to overcome this trade-off. Here, we present a comprehensive demonstration of such a bioinspired approach based on pillar[5]arene artificial water channels, resulting in artificial water channel-based block copolymer membranes. These membranes have a sharp selectivity profile with a molecular weight cutoff of ~ 500 Da, a size range challenging to achieve with current membranes, while achieving a large improvement in permeability (~65 L m -2 h -1 bar -1 compared with 4-7 L m -2 h -1 bar -1 ) over similarly rated commercial membranes.
Reducing hypothetical bias in choice experiments
DEFF Research Database (Denmark)
Ladenburg, Jacob; Olsen, Søren Bøye; Nielsen, Rasmus Christian Fejer
eliminate some of the hypothetical bias. The present paper tests an addition to Cheap Talk, an Opt-Out Reminder. The Opt-Out Reminder is an objective short script presented prior to the choice sets, prompting the respondent to choose the opt-out alternative, if he/she finds the proposed policy generated...... alternatives in a choice set too expensive. The results suggest that adding an Opt-Out Reminder to Cheap Talk can in fact reduce hypothetical bias even further and reduces some of the ineffectiveness of CT in relation to the survey bid range and experienced respondents....
International Nuclear Information System (INIS)
Fu, Tian-Min; Liu, Xiang; Li, Lanfen; Su, Xiao-Dong
2010-01-01
The crystal structure of smu.1377c, a hypothetical protein from S. mutans, shows a similar fold to Sua5-YciO-YrdC-family proteins and indicates its functional role in tRNA modification. Members of the Sua5-YciO-YrdC protein family are found in both eukaryotes and prokaryotes and possess a conserved α/β twisted open-sheet fold. The Escherichia coli protein YrdC has been shown to be involved in modification of tRNA. The crystal structure of smu.1377c, a hypothetical protein from Streptococcus mutans, has been determined to 2.25 Å resolution. From structure analysis and comparison, it is shown that smu.1377c is a member of the Sua5-YciO-YrdC family and that it may play the same role as E. coli YrdC
BOLD responses in reward regions to hypothetical and imaginary monetary rewards.
Miyapuram, Krishna P; Tobler, Philippe N; Gregorios-Pippas, Lucy; Schultz, Wolfram
2012-01-16
Monetary rewards are uniquely human. Because money is easy to quantify and present visually, it is the reward of choice for most fMRI studies, even though it cannot be handed over to participants inside the scanner. A typical fMRI study requires hundreds of trials and thus small amounts of monetary rewards per trial (e.g. 5p) if all trials are to be treated equally. However, small payoffs can have detrimental effects on performance due to their limited buying power. Hypothetical monetary rewards can overcome the limitations of smaller monetary rewards but it is less well known whether predictors of hypothetical rewards activate reward regions. In two experiments, visual stimuli were associated with hypothetical monetary rewards. In Experiment 1, we used stimuli predicting either visually presented or imagined hypothetical monetary rewards, together with non-rewarding control pictures. Activations to reward predictive stimuli occurred in reward regions, namely the medial orbitofrontal cortex and midbrain. In Experiment 2, we parametrically varied the amount of visually presented hypothetical monetary reward keeping constant the amount of actually received reward. Graded activation in midbrain was observed to stimuli predicting increasing hypothetical rewards. The results demonstrate the efficacy of using hypothetical monetary rewards in fMRI studies. Copyright © 2011 Elsevier Inc. All rights reserved.
In Silico screening for functional candidates amongst hypothetical proteins
DEFF Research Database (Denmark)
Desler, Claus; Suravajhala, Prashanth; Sanderhoff, May
2009-01-01
eukaryotes. With the general belief that the majority of hypothetical proteins are the product of pseudogenes, it is essential to have a tool with the ability of pinpointing the minority of hypothetical proteins with a high probability of being expressed. RESULTS: Here, we present an in silico selection...
Computational mining for hypothetical patterns of amino acid side chains in protein data bank (PDB)
Ghani, Nur Syatila Ab; Firdaus-Raih, Mohd
2018-04-01
The three-dimensional structure of a protein can provide insights regarding its function. Functional relationship between proteins can be inferred from fold and sequence similarities. In certain cases, sequence or fold comparison fails to conclude homology between proteins with similar mechanism. Since the structure is more conserved than the sequence, a constellation of functional residues can be similarly arranged among proteins of similar mechanism. Local structural similarity searches are able to detect such constellation of amino acids among distinct proteins, which can be useful to annotate proteins of unknown function. Detection of such patterns of amino acids on a large scale can increase the repertoire of important 3D motifs since available known 3D motifs currently, could not compensate the ever-increasing numbers of uncharacterized proteins to be annotated. Here, a computational platform for an automated detection of 3D motifs is described. A fuzzy-pattern searching algorithm derived from IMagine an Amino Acid 3D Arrangement search EnGINE (IMAAAGINE) was implemented to develop an automated method for searching of hypothetical patterns of amino acid side chains in Protein Data Bank (PDB), without the need for prior knowledge on related sequence or structure of pattern of interest. We present an example of the searches, which is the detection of a hypothetical pattern derived from known structural motif of C2H2 structural pattern from zinc fingers. The conservation of particular patterns of amino acid side chains in unrelated proteins is highlighted. This approach can act as a complementary method for available structure- and sequence-based platforms and may contribute in improving functional association between proteins.
Performance assessment for a hypothetical low-level waste disposal facility
International Nuclear Information System (INIS)
Smith, C.S.; Rohe, M.J.; Ritter, P.D.
1997-01-01
Disposing of low-level waste (LLW) is a concern for many states throughout the United States. A common disposal method is below-grade concrete vaults. Performance assessment analyses make predictions of contaminant release, transport, ingestion, inhalation, or other routes of exposure, and the resulting doses for various disposal methods such as the below-grade concrete vaults. Numerous assumptions are required to simplify the processes associated with the disposal facility to make predictions feasible. In general, these assumptions are made conservatively so as to underestimate the performance of the facility. The objective of this report is to describe the methodology used in conducting a performance assessment for a hypothetical waste facility located in the northeastern United States using real data as much as possible. This report consists of the following: (a) a description of the disposal facility and site, (b) methods used to analyze performance of the facility, (c) the results of the analysis, and (d) the conclusions of this study
Performance assessment for a hypothetical low-level waste disposal facility
Energy Technology Data Exchange (ETDEWEB)
Smith, C.S.; Rohe, M.J.; Ritter, P.D. [and others
1997-01-01
Disposing of low-level waste (LLW) is a concern for many states throughout the United States. A common disposal method is below-grade concrete vaults. Performance assessment analyses make predictions of contaminant release, transport, ingestion, inhalation, or other routes of exposure, and the resulting doses for various disposal methods such as the below-grade concrete vaults. Numerous assumptions are required to simplify the processes associated with the disposal facility to make predictions feasible. In general, these assumptions are made conservatively so as to underestimate the performance of the facility. The objective of this report is to describe the methodology used in conducting a performance assessment for a hypothetical waste facility located in the northeastern United States using real data as much as possible. This report consists of the following: (a) a description of the disposal facility and site, (b) methods used to analyze performance of the facility, (c) the results of the analysis, and (d) the conclusions of this study.
33 CFR Appendix B to Part 277 - Hypothetical Example of Cost Apportionment
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Hypothetical Example of Cost... APPORTIONMENT OF BRIDGE ALTERATIONS Pt. 277, App. B Appendix B to Part 277—Hypothetical Example of Cost... bridge was completed in 1908 and the superstructure completed in 1909. For this hypothetical example it...
Research and development toward a 4.5-1.5{angstrom} linac coherent light source (LCLS) at SLAC
Energy Technology Data Exchange (ETDEWEB)
Tatchyn, R.; Arthur, J.; Baltay, M. [Stanford Univ., CA (United States)] [and others
1995-12-31
In recent years significant studies have been initiated on the theoretical and technical feasibility of utilizing a portion of the 3km S-band accelerator at the Stanford Linear Accelerator Center (SLAC) to drive a short wavelength (4.5-1.5 {Angstrom}) Linac Coherent Light Source (LCLS), a Free-Electron Laser (FEL) operating in the Self-Amplified Spontaneous Emission (SASE) regime. Electron beam requirements for single-pass saturation include: (1) a peak current in the 3-7 kA range, (2) a relative energy spread of <0.05%, ad (3) a transverse emittance, {epsilon}{le}{lambda}/4{pi}, where {lambda}[m] is the output wavelength. Requirements on the insertion device include field error levels of 0.1-0.2% for keeping the electron bunch centered on and in phase with the amplified photons, and a focusing beta of 4-8 m for inhibiting the dilution of its transverse density. Although much progress techniques necessary for LCLS operation down to {approximately}20 {angstrom}, a substantial amount of research and development is still required in a number of theoretical and experimental areas leading to the construction and operation of a 4.5-1.5 {angstrom} LCLS. In this paper we report on a research and development program underway and in planning at SLAC for addressing critical questions in these areas. These include the construction and operation of a linac test stand for developing laser-driven photocathode rf guns with normalized emittances approaching 1 mm-mr; development of advanced beam compression, stability, an emittance control techniques at multi-GeV energies; the construction and operation of a FEL Amplifier Test Experiment (FATE) for theoretical and experimental studies of SASE at IR wavelengths; an undulator development program to investigate superconducting, hybrid/permanent magnet (hybrid/PM), and pulsed-Cu technologies; theoretical and computational studies of high-gain FEL physics and LCLS component designs.
International Nuclear Information System (INIS)
Jain, S.; Jain, P.C.
1985-12-01
Linear regression analysis of the monthly average daily global irradiation and the sunshine duration data of 8 Zambian locations has been performed using the least square technique. Good correlation (r>0.95) is obtained in all the cases showing that the Angstrom equation is valid for Zambian locations. The values of the correlation parameters thus obtained show substantial unsystematic scatter. The analysis was repeated after incorporating the effects of (i) multiple reflections of radiation between the ground and the atmosphere, and (ii) not burning of the sunshine recorder chart, into the Angstrom equation. The surface albedo measurements at Lusaka were used. The scatter in the correlation parameters was investigated by graphical representation, by regression analysis of the data of the individual stations as well as the combined data of the 8 stations. The results show that the incorporation of none of the two effects reduces the scatter significantly. A single linear equation obtained from the regression analysis of the combined data of the 8 stations is found to be appropriate for estimating the global irradiation over Zambian locations with reasonable accuracy from the sunshine duration data. (author)
Computational structural and functional analysis of hypothetical proteins of Staphylococcus aureus
Mohan, Ramadevi; Venugopal, Subhashree
2012-01-01
Genome sequencing projects has led to an explosion of large amount of gene products in which many are of hypothetical proteins with unknown function. Analyzing and annotating the functions of hypothetical proteins is important in Staphylococcus aureus which is a pathogenic bacterium that cause multiple types of diseases by infecting various sites in humans and animals. In this study, ten hypothetical proteins of Staphylococcus aureus were retrieved from NCBI and analyzed for their structural ...
47 CFR 69.608 - Carrier Common Line hypothetical net balance.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Carrier Common Line hypothetical net balance. 69.608 Section 69.608 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER... net balance. The hypothetical net balance shall be equal to a Carrier Common Line revenue requirement...
CARNSORE: Hypothetical reactor accident study
International Nuclear Information System (INIS)
Walmod-Larsen, O.; Jensen, N.O.; Kristensen, L.; Meide, A.; Nedergaard, K.L.; Nielsen, F.; Lundtang Petersen, E.; Petersen, T.; Thykier-Nielsen, S.
1984-06-01
Two types of design-basis accident and a series of hypothetical core-melt accidents to a 600 MWe reactor are described and their consequences assessed. The PLUCON 2 model was used to calculate the consequences which are presented in terms of individual and collective doses, as well as early and late health consequences. The site proposed for the nucelar power station is Carnsore Point, County Wexford, south-east Ireland. The release fractions for the accidents described are those given in WASH-1400. The analyses are based on the resident population as given in the 1979 census and on 20 years of data from the meteorological stations at Rosslare Harbour, 8.5 km north of the site. The consequences of one of the hypothetical core-melt accidents are described in detail in a meteorological parametric study. Likewise the consequences of the worst conceivable combination of situations are described. Finally, the release fraction in one accident is varied and the consequences of a proposed, more probable ''Class 9 accident'' are presented. (author)
International Nuclear Information System (INIS)
Boel, E.; Jensen, V.J.; Petersen, S.B.; Thim, L.; Woldike, H.F.; Brady, L.; Brzozowski, AM.; Derewenda, Z.; Dodson, G.G.; Swift, H.
1990-01-01
X-ray diffraction analysis (at 2.1-angstrom resolution) of an acid alpha-amylase from Aspergillus niger allowed a detailed description of the stereochemistry of the calcium-binding sites. The primary site (which is essential in maintaining proper folding around the active site) contains a tightly bound Ca 2+ with an unusually high number of eight ligands. A secondary binding site was identified at the bottom of the substrate binding cleft; it involves the residues presumed to play a catalytic role (Asp206 and Glu230). This explains the inhibitory effect of calcium observed at higher concentrations. Neutral Aspergillus oryzae (TAKA) α-amylase was also refined in a new crystal at 2.1-angstrom resolution. The structure of this homologous (over 80%) enzyme and addition kinetic studies support all the structural conclusions regarding both calcium-binding sites
Measuring rural homeowners' willingness to pay for land conservation easements
Seong-Hoon Cho; David H. Newman; J. Michael Bowker
2005-01-01
Rapid growth of rural communities in the Blue Ridge Mountains of Macon County, North Carolina has been giving rise to concerns over declining environmental quality and increasing need for land-use policy. This paper examines willingness to pay (WTP) for hypothetical conservation easements as an alternative land-use policy for the county. Despite the fact that Macon...
Angstrom analysis with dynamic in-situ aberration corrected electron microscopy
International Nuclear Information System (INIS)
Gai, P L; Boyes, E D
2010-01-01
Following the pioneering development of atomic resolution in-situ environmental TEM (ETEM) for direct probing of gas-solid reactions, recent developments are presented of dynamic real time in-situ studies at the Angstrom level in an aberration corrected electron microscope. The in-situ data from Pt-Pd nanoparticles on carbon with the corresponding FFT/optical diffractogram (OD) illustrate an achieved resolution of 0 C and higher, in a double aberration corrected JEOL 2200 FS TEM/STEM employing a wider gap objective pole piece and gas tolerant TMP column pumping system. Direct observations of dynamic biofuel catalysts under controlled calcinations conditions and quantified with catalytic reactivity and physico-chemical studies show the benefits in-situ aberration correction in unveiling the evolution of surface active sites necessary for the development efficient heterogeneous catalysts. The new results open up opportunities for dynamic studies of materials in an aberration corrected environment and direct future development activities.
International Nuclear Information System (INIS)
Fukano, Yoshitaka
2013-01-01
Experimental studies on local fault (LF) accidents in fast breeder reactors have been performed in many countries because LFs have been historically considered as one of the possible causes of severe accidents. Comprehensive and consistent interpretations of in-pile and out-of-pile experiments related to LF were arrived at in this study based on state-of-the-art review and data analysis techniques. Safety margins for a hypothetical local overpower accident, which was evaluated as a LF accident in the licensing document of the construction permit for a prototype fast breeder reactor called Monju, were also studied. Based on comprehensive interpretations of the latest experimental database, including those performed after the permission of Monju construction, it was clarified that the evaluation of the hypothetical local overpower accident in the Monju licensing was sufficiently conservative. Furthermore, it incorporated adequate safety margins in terms of failure thresholds of the fuel pin, molten fuel ejection, fuel sweep-out behavior after molten fuel ejection, and pin-to-pin failure propagation. Moreover, these comprehensive interpretations are valid and applicable to the safety evaluation of LF accidents of other fast breeder reactors with various fuel and core designs. (author)
Consequence analyses of hypothetical accidents of high temperature gas-cooled reactors. Pt. 2/3
International Nuclear Information System (INIS)
Mueller, A.; Badur, A.
1978-06-01
With regard to a hypothetical accident which is characterized by the rupture of the primary circuit and by the additional failure of active engineered safeguards, the fission product release resulting from the unlimited core heat-up is analyzed. The applied models are explained and the data base being used is documented. The generally conservative treatment yields pessimistic activity release rates into the containment. The results show in particular that spontaneous massive fission product release does not occur. The time-dependency of the activity release from the fuel elements, the primary circuit and at last from the containment leads to a time delay in the range of at least several hours, before the environmental radiation load is raised. Ultimately the maximum radiation load itself proves relatively favourable. (orig.) 891 HP [de
Energy Technology Data Exchange (ETDEWEB)
Park, J. W.; Chang, K.; Kim, C. L. [Nuclear Enviroment Technology Institute, Taejon (Korea, Republic of)
2001-04-01
A radiological safety assessment was performed for a hypothetical near-surface radioactive waste repository as a simple screening calculation to identify important nuclides and to provide insights on the data needs for a successful demonstration of compliance. Individual effective doses were calculated for a conservative groundwater pathway scenario considering well drilling near the site boundary. Sensitivity of resulting ingestion dose to input parameter values was also analyzed using Monte Carlo sampling. Considering peak dose rate and assessment timescale, C-14 and I-129 were identified as important nuclides and U-235 and U-238 as potentially important nuclides. For C-14, the does was most sensitive to Darcy velocity in aquifer. The distribution coefficient showed high degree of sensitivity for I-129 release.
International Nuclear Information System (INIS)
Park, J. W.; Chang, K.; Kim, C. L.
2001-01-01
A radiological safety assessment was performed for a hypothetical near-surface radioactive waste repository as a simple screening calculation to identify important nuclides and to provide insights on the data needs for a successful demonstration of compliance. Individual effective doses were calculated for a conservative groundwater pathway scenario considering well drilling near the site boundary. Sensitivity of resulting ingestion dose to input parameter values was also analyzed using Monte Carlo sampling. Considering peak dose rate and assessment timescale, C-14 and I-129 were identified as important nuclides and U-235 and U-238 as potentially important nuclides. For C-14, the does was most sensitive to Darcy velocity in aquifer. The distribution coefficient showed high degree of sensitivity for I-129 release
Reactions to Hypothetical, Jealousy Producing Events.
Hansen, Gary L.
1982-01-01
Asked subjects (N=220) how they would feel about their mates' behavior in eight hypothetical situations designed to measure jealousy. Responses indicated that jealousy is likely to be a major issue. Sex role orientation is most consistently related to jealousy with sex role traditional subjects being the most jealous. (Author)
Pouwels, J Loes; Lansu, Tessa A M; Cillessen, Antonius H N
2017-07-01
This study examined how adolescents evaluate bullying at three levels of specificity: (a) the general concept of bullying, (b) hypothetical peers in different bullying participant roles, and (c) actual peers in different bullying participant roles. Participants were 163 predominantly ethnic majority adolescents in The Netherlands (58% girls; M age =16.34years, SD=0.79). For the hypothetical peers, we examined adolescents' explicit evaluations as well as their implicit evaluations. Adolescents evaluated the general concept of bullying negatively. Adolescents' explicit evaluations of hypothetical and actual peers in the bullying roles depended on their own role, but adolescents' implicit evaluations of hypothetical peers did not. Adolescents' explicit evaluations of hypothetical peers and actual peers were different. Hypothetical bullies were evaluated negatively by all classmates, whereas hypothetical victims were evaluated relatively positively compared with the other roles. However, when adolescents evaluated their actual classmates, the differences between bullies and the other roles were smaller, whereas victims were evaluated the most negatively of all roles. Further research should take into account that adolescents' evaluations of hypothetical peers differ from their evaluations of actual peers. Copyright © 2017 Elsevier Inc. All rights reserved.
Development of XUV-interferometry (155 angstrom) using a soft x-ray laser
International Nuclear Information System (INIS)
Da Silva, L.B.; Barbee, T.W.; Cauble, R.
1995-01-01
Over the past several years the authors have developed a variety of techniques for probing plasmas with x-ray lasers. These have included direct high resolution plasma imaging to quantify laser produced plasma uniformities and moire deflectometry to measure electron density profiles in one-dimension. Although these techniques have been valuable, a need existed for direct two dimensional measurements of electron densities in large high density plasmas. For this reason the authors have worked on developing a xuv interferometer compatible with the harsh environment of laser produced plasmas. This paper describes the design and presents some results showing excellent fringe visibility using the neon-like yttrium x-ray laser operating at 155 angstrom. The coherence properties of this x-ray laser source were measured using interferometry and are also discussed
The multiple roles of hypothetical gene BPSS1356 in Burkholderia pseudomallei.
Directory of Open Access Journals (Sweden)
Hokchai Yam
Full Text Available Burkholderia pseudomallei is an opportunistic pathogen and the causative agent of melioidosis. It is able to adapt to harsh environments and can live intracellularly in its infected hosts. In this study, identification of transcriptional factors that associate with the β' subunit (RpoC of RNA polymerase was performed. The N-terminal region of this subunit is known to trigger promoter melting when associated with a sigma factor. A pull-down assay using histidine-tagged B. pseudomallei RpoC N-terminal region as bait showed that a hypothetical protein BPSS1356 was one of the proteins bound. This hypothetical protein is conserved in all B. pseudomallei strains and present only in the Burkholderia genus. A BPSS1356 deletion mutant was generated to investigate its biological function. The mutant strain exhibited reduced biofilm formation and a lower cell density during the stationary phase of growth in LB medium. Electron microscopic analysis revealed that the ΔBPSS1356 mutant cells had a shrunken cytoplasm indicative of cell plasmolysis and a rougher surface when compared to the wild type. An RNA microarray result showed that a total of 63 genes were transcriptionally affected by the BPSS1356 deletion with fold change values of higher than 4. The expression of a group of genes encoding membrane located transporters was concurrently down-regulated in ΔBPSS1356 mutant. Amongst the affected genes, the putative ion transportation genes were the most severely suppressed. Deprivation of BPSS1356 also down-regulated the transcriptions of genes for the arginine deiminase system, glycerol metabolism, type III secretion system cluster 2, cytochrome bd oxidase and arsenic resistance. It is therefore obvious that BPSS1356 plays a multiple regulatory roles on many genes.
HAZES, B; MAGNUS, KA; BONAVENTURA, C; BONAVENTURA, J; DAUTER, Z; KALK, KH; HOL, WGJ
The crystal structure of Limulus polyphemus subunit type II hemocyanin in the deoxygenated state has been determined to a resolution of 2.18 angstrom. Phase information for this first structure of a cheliceratan hemocyanin was obtained by molecular replacement using the crustacean hemocyanin
Differences in Behavior and Brain Activity during Hypothetical and Real Choices.
Camerer, Colin; Mobbs, Dean
2017-01-01
Real behaviors are binding consequential commitments to a course of action, such as harming another person, buying an Apple watch, or fleeing from danger. Cognitive scientists are generally interested in the psychological and neural processes that cause such real behavior. However, for practical reasons, many scientific studies measure behavior using only hypothetical or imagined stimuli. Generalizing from such studies to real behavior implicitly assumes that the processes underlying the two types of behavior are similar. We review evidence of similarity and differences in hypothetical and real mental processes. In many cases, hypothetical choice tasks give an incomplete picture of brain circuitry that is active during real choice. Copyright © 2016. Published by Elsevier Ltd.
Evaluation of hypothetical (153)Gd source for use in brachytherapy.
Ghorbani, Mahdi; Behmadi, Marziyeh
2016-01-01
The purpose of this work is to evaluate the dosimetric parameters of a hypothetical (153)Gd source for use in brachytherapy and comparison of the dosimetric parameters with those of (192)Ir and (125)I sources. Dose rate constant, the radial dose function and the two dimensional (2D) anisotropy function data for the hypothetical (153)Gd source were obtained by simulation of the source using MCNPX code and then were compared with the corresponding data reported by Enger et al. A comprehensive comparison between this hypothetical source and a (192)Ir source with similar geometry and a (125)I source was performed as well. Excellent agreement was shown between the results of the two studies. Dose rate constant values for the hypothetical (153)Gd, (192)Ir, (125)I sources are 1.173 cGyh(-1) U(-1), 1.044 cGyh(-1) U(-1), 0.925 cGyh(-1) U(-1), respectively. Radial dose function for the hypothetical (153)Gd source has an increasing trend, while (192)Ir has more uniform and (125)I has more rapidly falling off radial dose functions. 2D anisotropy functions for these three sources indicate that, except at 0.5 cm distance, (192)Ir and (125)I have more isotropic trends as compared to the (153)Gd source. A more uniform radial dose function, and 2D anisotropy functions with more isotropy, a much higher specific activity are advantages of (192)Ir source over (153)Gd. However, a longer half-life of (153)Gd source compared to the other two sources, and lower energy of the source with respect to (192)Ir are advantages of using (153)Gd in brachytherapy versus (192)Ir source.
Assessing Hypothetical Gravity Control Propulsion
Millis, Marc G.
2006-01-01
Gauging the benefits of hypothetical gravity control propulsion is difficult, but addressable. The major challenge is that such breakthroughs are still only notional concepts rather than being specific methods from which performance can be rigorously quantified. A recent assessment by Tajmar and Bertolami used the rocket equation to correct naive misconceptions, but a more fundamental analysis requires the use of energy as the basis for comparison. The energy of a rocket is compared to an ide...
Estimation of monthly solar exposure on horizontal surface by Angstrom-type regression equation
International Nuclear Information System (INIS)
Ravanshid, S.H.
1981-01-01
To obtain solar flux intensity, solar radiation measuring instruments are the best. In the absence of instrumental data there are other meteorological measurements which are related to solar energy and also it is possible to use empirical relationships to estimate solar flux intensit. One of these empirical relationships to estimate monthly averages of total solar radiation on a horizontal surface is the modified angstrom-type regression equation which has been employed in this report in order to estimate the solar flux intensity on a horizontal surface for Tehran. By comparing the results of this equation with four years measured valued by Tehran's meteorological weather station the values of meteorological constants (a,b) in the equation were obtained for Tehran. (author)
X-ray study of the structure of polyethylene at the scale of 100-200 Angstrom
International Nuclear Information System (INIS)
Belbeoch nee Goldsztein, B.
1958-06-01
Information on the structure of polyethylene is deduced from a comparison of the results obtained by central diffusion and by other X-ray methods. The structure depends on the thermal and mechanical treatment to which the samples are subjected, as well as on the observation temperature. The central diffusion due to the heterogeneity of the material at the scale of 100-200 Angstrom is bound up with the presence of both the amorphous and crystalline phases. Stretched polythene shows a more or less regular succession of orderly and disorderly regions. When released it has a structure of recrystallisation preceded by 'amorphization'. (author) [fr
Hypothetical Scenario Generator for Fault-Tolerant Diagnosis
James, Mark
2007-01-01
The Hypothetical Scenario Generator for Fault-tolerant Diagnostics (HSG) is an algorithm being developed in conjunction with other components of artificial- intelligence systems for automated diagnosis and prognosis of faults in spacecraft, aircraft, and other complex engineering systems. By incorporating prognostic capabilities along with advanced diagnostic capabilities, these developments hold promise to increase the safety and affordability of the affected engineering systems by making it possible to obtain timely and accurate information on the statuses of the systems and predicting impending failures well in advance. The HSG is a specific instance of a hypothetical- scenario generator that implements an innovative approach for performing diagnostic reasoning when data are missing. The special purpose served by the HSG is to (1) look for all possible ways in which the present state of the engineering system can be mapped with respect to a given model and (2) generate a prioritized set of future possible states and the scenarios of which they are parts.
Structural Conservation of the Myoviridae Phage Tail Sheath Protein Fold
Energy Technology Data Exchange (ETDEWEB)
Aksyuk, Anastasia A.; Kurochkina, Lidia P.; Fokine, Andrei; Forouhar, Farhad; Mesyanzhinov, Vadim V.; Tong, Liang; Rossmann, Michael G. (SOIBC); (Purdue); (Columbia)
2012-02-21
Bacteriophage phiKZ is a giant phage that infects Pseudomonas aeruginosa, a human pathogen. The phiKZ virion consists of a 1450 {angstrom} diameter icosahedral head and a 2000 {angstrom}-long contractile tail. The structure of the whole virus was previously reported, showing that its tail organization in the extended state is similar to the well-studied Myovirus bacteriophage T4 tail. The crystal structure of a tail sheath protein fragment of phiKZ was determined to 2.4 {angstrom} resolution. Furthermore, crystal structures of two prophage tail sheath proteins were determined to 1.9 and 3.3 {angstrom} resolution. Despite low sequence identity between these proteins, all of these structures have a similar fold. The crystal structure of the phiKZ tail sheath protein has been fitted into cryo-electron-microscopy reconstructions of the extended tail sheath and of a polysheath. The structural rearrangement of the phiKZ tail sheath contraction was found to be similar to that of phage T4.
Identification of a Hypothetical Protein from Podospora anserina as a Nitroalkane Oxidase
Energy Technology Data Exchange (ETDEWEB)
Tormos, Jose R.; Taylor, Alexander B.; Daubner, S. Colette; Hart, P. John; Fitzpatrick, Paul F. (Texas-HSC); (St. Mary)
2010-08-23
The flavoprotein nitroalkane oxidase (NAO) from Fusarium oxysporum catalyzes the oxidation of primary and secondary nitroalkanes to their respective aldehydes and ketones. Structurally, the enzyme is a member of the acyl-CoA dehydrogenase superfamily. To date no enzymes other than that from F. oxysporum have been annotated as NAOs. To identify additional potential NAOs, the available database was searched for enzymes in which the active site residues Asp402, Arg409, and Ser276 were conserved. Of the several fungal enzymes identified in this fashion, PODANSg2158 from Podospora anserina was selected for expression and characterization. The recombinant enzyme is a flavoprotein with activity on nitroalkanes comparable to the F. oxysporum NAO, although the substrate specificity is somewhat different. Asp399, Arg406, and Ser273 in PODANSg2158 correspond to the active site triad in F. oxysporum NAO. The k{sub cat}/K{sub M}-pH profile with nitroethane shows a pK{sub a} of 5.9 that is assigned to Asp399 as the active site base. Mutation of Asp399 to asparagine decreases the k{sub cat}/K{sub M} value for nitroethane over 2 orders of magnitude. The R406K and S373A mutations decrease this kinetic parameter by 64- and 3-fold, respectively. The structure of PODANSg2158 has been determined at a resolution of 2.0 {angstrom}, confirming its identification as an NAO.
Young, Richard P.; Gibbons, James M.; Jones, Julia P. G.
2018-01-01
There is a major gap in funding required for conservation, especially in low income countries. Given the significant contribution of taxpayers in industrialized countries to funding conservation overseas, and donations from membership organisation, understanding the preferences of ordinary people in a high income country for different attributes of conservation projects is valuable for future marketing of conservation. We conducted a discrete choice experiment with visitors to a UK zoo, while simultaneously conducting a revealed preference study through a real donation campaign on the same sample. Respondents showed the highest willingness to pay for projects that have local community involvement in management (95% confidence interval £9.82 to £15.83), and for improvement in threatened species populations (£2.97 - £13.87). Both of these were significantly larger than the willingness to pay for projects involving provision of alternative livelihoods, or improving the condition of conservation sites. Results of the simultaneous donation campaign showed that respondents were very willing to donate the suggested £1 or above donation (88% made a donation, n = 1798); there was no effect of which of the two campaigns they were exposed to (threatened species management or community involvement in management). The small number of people who did not make a donation had a higher stated willingness to pay within the choice experiment, which may suggest hypothetical bias. Conservationists increasingly argue that conservation should include local communities in management (for both pragmatic and moral reasons). It is heartening that potential conservation donors seem to agree. PMID:29451923
Using respondent uncertainty to mitigate hypothetical bias in a stated choice experiment
Richard C. Ready; Patricia A. Champ; Jennifer L. Lawton
2010-01-01
In a choice experiment study, willingness to pay for a public good estimated from hypothetical choices was three times as large as willingness to pay estimated from choices requiring actual payment. This hypothetical bias was related to the stated level of certainty of respondents. We develop protocols to measure respondent certainty in the context of a choice...
Láser de monóxido de carbono : Estudio espectroscópico del sistema Angstrom
Schinca, Daniel Carlos
1985-01-01
En el presente trabajo se intenta resumir la labor desarrollada en láseres gaseosos de moléculas diatómicas de excitación pulsada, particularmente en lo que respecta a láseres de monóxido de carbono de geometría axial. De esta manera, se realiza un detallado análisis espectroscópico tanto de la salida láser de las bandas de emisión del Sistema Angstrom como de la emisión espontánea de las mismas bajo diferentes condiciones experimentales. Es sabido que la molécula de monóxido de car...
Can a Repeated Opt-Out Reminder remove hypothetical bias in discrete choice experiments?
DEFF Research Database (Denmark)
Alemu, Mohammed Hussen; Olsen, Søren Bøye
hypothetical bias in stated DCE. The data originates from a field experiment concerning consumer preferences for a novel food product made from cricket flour. Utilizing a between-subject design with three treatments, we find significantly higher marginal willingness to pay values in hypothetical than...
Energy Technology Data Exchange (ETDEWEB)
Huang, Li-shar; Borders, Toni M.; Shen, John T.; Wang, Chung-Jen; Berry, Edward A.
2004-12-17
Procedure is presented for preparation of diffraction-quality crystals of a vertebrate mitochondrial respiratory Complex II. The crystals have the potential to diffract to at least 2.0 Angstrom with optimization of post-crystal-growth treatment and cryoprotection. This should allow determination of the structure of this important and medically relevant membrane protein complex at near-atomic resolution and provide great detail of the mode of binding of substrates and inhibitors at the two substrate-binding sites.
Structure of Lmaj006129AAA, a hypothetical protein from Leishmania major
International Nuclear Information System (INIS)
Arakaki, Tracy; Le Trong, Isolde; Phizicky, Eric; Quartley, Erin; DeTitta, George; Luft, Joseph; Lauricella, Angela; Anderson, Lori; Kalyuzhniy, Oleksandr; Worthey, Elizabeth; Myler, Peter J.; Kim, David; Baker, David; Hol, Wim G. J.; Merritt, Ethan A.
2006-01-01
The crystal structure of a conserved hypothetical protein from L. major, Pfam sequence family PF04543, structural genomics target ID Lmaj006129AAA, has been determined at a resolution of 1.6 Å. The gene product of structural genomics target Lmaj006129 from Leishmania major codes for a 164-residue protein of unknown function. When SeMet expression of the full-length gene product failed, several truncation variants were created with the aid of Ginzu, a domain-prediction method. 11 truncations were selected for expression, purification and crystallization based upon secondary-structure elements and disorder. The structure of one of these variants, Lmaj006129AAH, was solved by multiple-wavelength anomalous diffraction (MAD) using ELVES, an automatic protein crystal structure-determination system. This model was then successfully used as a molecular-replacement probe for the parent full-length target, Lmaj006129AAA. The final structure of Lmaj006129AAA was refined to an R value of 0.185 (R free = 0.229) at 1.60 Å resolution. Structure and sequence comparisons based on Lmaj006129AAA suggest that proteins belonging to Pfam sequence families PF04543 and PF01878 may share a common ligand-binding motif
Jinyuan Xin; Yuesi Wang; Zhanqing Li; Pucai Wang; Wei Min Hao; Bryce L. Nordgren; Shigong Wang; Guangren Lui; Lili Wang; Tianxue Wen; Yang Sun; Bo Hu
2007-01-01
To reduce uncertainties in the quantitative assessment of aerosol effects on regional climate and environmental changes, extensive measurements of aerosol optical properties were made with handheld Sun photometers in the Chinese Sun Hazemeter Network (CSHNET) starting in August 2004. Regional characteristics of the aerosol optical depth (AOD) at 500 nm and Angstrom...
Processing counterfactual and hypothetical conditionals: an fMRI investigation.
Kulakova, Eugenia; Aichhorn, Markus; Schurz, Matthias; Kronbichler, Martin; Perner, Josef
2013-05-15
Counterfactual thinking is ubiquitous in everyday life and an important aspect of cognition and emotion. Although counterfactual thought has been argued to differ from processing factual or hypothetical information, imaging data which elucidate these differences on a neural level are still scarce. We investigated the neural correlates of processing counterfactual sentences under visual and aural presentation. We compared conditionals in subjunctive mood which explicitly contradicted previously presented facts (i.e. counterfactuals) to conditionals framed in indicative mood which did not contradict factual world knowledge and thus conveyed a hypothetical supposition. Our results show activation in right occipital cortex (cuneus) and right basal ganglia (caudate nucleus) during counterfactual sentence processing. Importantly the occipital activation is not only present under visual presentation but also with purely auditory stimulus presentation, precluding a visual processing artifact. Thus our results can be interpreted as reflecting the fact that counterfactual conditionals pragmatically imply the relevance of keeping in mind both factual and supposed information whereas the hypothetical conditionals imply that real world information is irrelevant for processing the conditional and can be omitted. The need to sustain representations of factual and suppositional events during counterfactual sentence processing requires increased mental imagery and integration efforts. Our findings are compatible with predictions based on mental model theory. Copyright © 2013 Elsevier Inc. All rights reserved.
CSIR Research Space (South Africa)
Roux, JR
2008-01-01
Full Text Available that are largely contained within this park. Physical river types, fish species and invertebrate families or genera were used as surrogates of riverine biodiversity. Conservation planning software was used to select an optimal set of planning units to represent...
Structural and Functional Annotation of Hypothetical Proteins of O139
Directory of Open Access Journals (Sweden)
Md. Saiful Islam
2015-06-01
Full Text Available In developing countries threat of cholera is a significant health concern whenever water purification and sewage disposal systems are inadequate. Vibrio cholerae is one of the responsible bacteria involved in cholera disease. The complete genome sequence of V. cholerae deciphers the presence of various genes and hypothetical proteins whose function are not yet understood. Hence analyzing and annotating the structure and function of hypothetical proteins is important for understanding the V. cholerae. V. cholerae O139 is the most common and pathogenic bacterial strain among various V. cholerae strains. In this study sequence of six hypothetical proteins of V. cholerae O139 has been annotated from NCBI. Various computational tools and databases have been used to determine domain family, protein-protein interaction, solubility of protein, ligand binding sites etc. The three dimensional structure of two proteins were modeled and their ligand binding sites were identified. We have found domains and families of only one protein. The analysis revealed that these proteins might have antibiotic resistance activity, DNA breaking-rejoining activity, integrase enzyme activity, restriction endonuclease, etc. Structural prediction of these proteins and detection of binding sites from this study would indicate a potential target aiding docking studies for therapeutic designing against cholera.
Amlung, Michael; MacKillop, James
2015-04-01
Alcohol purchase tasks (APTs) are increasingly being used to assess behavioral economic demand for alcohol. Prior studies utilizing APTs have typically assessed demand for hypothetical outcomes, making the extent to which these hypothetical measures reflect preferences when actual rewards are at stake an important empirical question. This study examined alcohol demand across hypothetical and incentivized APTs. Nineteen male heavy drinkers completed two APTs - one for hypothetical alcohol and another in which one randomly-selected outcome was provided. Participants were given an opportunity to consume the alcohol associated with their choice on the incentivized APT during a self-administration period in a simulated bar environment. Results indicated generally close correspondence between APT versions, though participants were more sensitive to increases in price and tended to consume more at low prices on the incentivized version. Estimated consumption on the incentivized APT was highly correlated with the amount of alcohol consumed in the laboratory (r=.87, pdecision-making when rewards are hypothetical vs. actually available. Implications for behavioral economic approaches to addictive behavior and directions for future research are discussed. Copyright © 2015 Elsevier B.V. All rights reserved.
Astrophysical implications of hypothetical stable TeV-scale black holes
International Nuclear Information System (INIS)
Giddings, Steven B.; Mangano, Michelangelo L.
2008-01-01
We analyze macroscopic effects of TeV-scale black holes, such as could possibly be produced at the LHC, in what is regarded as an extremely hypothetical scenario in which they are stable and, if trapped inside Earth, begin to accrete matter. We examine a wide variety of TeV-scale gravity scenarios, basing the resulting accretion models on first-principles, basic, and well-tested physical laws. These scenarios fall into two classes, depending on whether accretion could have any macroscopic effect on the Earth at times shorter than the Sun's natural lifetime. We argue that cases with such an effect at shorter times than the solar lifetime are ruled out, since in these scenarios black holes produced by cosmic rays impinging on much denser white dwarfs and neutron stars would then catalyze their decay on time scales incompatible with their known lifetimes. We also comment on relevant lifetimes for astronomical objects that capture primordial black holes. In short, this study finds no basis for concerns that TeV-scale black holes from the LHC could pose a risk to Earth on time scales shorter than the Earth's natural lifetime. Indeed, conservative arguments based on detailed calculations and the best-available scientific knowledge, including solid astronomical data, conclude, from multiple perspectives, that there is no risk of any significance whatsoever from such black holes.
Shock loading of reactor vessel following hypothetical core disruptive accident
International Nuclear Information System (INIS)
Srinivas, G.; Doshi, J.B.
1990-01-01
Hypothetical Core Disruptive Accident (HCDA) has been historically considered as the maximum credible accident in Fast Breeder Reactor systems. Environmental consequences of such an accident depends to a great extent on the ability of the reactor vessel to maintain integrity during the shock loading following an HCDA. In the present paper, a computational model of the reactor core and the surrounding coolant with a free surface is numerical technique. The equations for conservation of mass, momentum and energy along with an equation of state are considered in two dimensional cylindrical geometry. The reactor core at the end of HCDA is taken as a bubble of hot, vaporized fuel at high temperature and pressure, formed at the center of the reactor vessel and expanding against the surrounding liquid sodium coolant. The free surface of sodium at the top of the vessel and the movement of the core bubble-liquid coolant interface are tracked by Marker and Cell (MAC) procedure. The results are obtained for the transient pressure at the vessel wall and also for the loading on the roof plug by the impact of the slug of liquid sodium. The computer code developed is validated against a benchmark experiment chosen to be ISPRA experiment reported in literature. The computer code is next applied to predict the loading on the Indian Prototype Fast Breeder Reactor (PFBR) being developed at Kalpakkam
The 2.3 {angstrom} crystal structure of cholera toxin B subunit pentamer: Choleragenoid
Energy Technology Data Exchange (ETDEWEB)
Zhang, Rong-Guang; Westbrook, M.L. [Argonne National Lab., IL (United States); Maulik, P.R.; Reed, R.A.; Shipley, G. [Boston Univ., MA (United States). School of Medicine; Westbrook, E.M. [Argonne National Lab., IL (United States)]|[Northwestern Univ., Evanston, IL (United States); Scott, D.L.; Otwinowski, Z. [Yale Univ., New Haven, CT (United States)
1996-02-01
Cholera toxin, a heterohexameric AB{sub 5} enterotoxin released by Vibrio cholera, induces a profuse secretory diarrhea in susceptible hosts. Choleragenoid, the B subunit pentamer of cholera toxin, directs the enzymatic A subunit to its target by binding to GM{sub 1} gangliosides exposed on the luminal surface of intestinal epithelial cells. We have solved the crystal structure of choleragenoid at 2.3 {Angstrom} resolution by combining single isomorphous replacement with non-crystallographic symmetry averaging. The structure of the B subunits, and their pentameric arrangement, closely resembles that reported for the intact holotoxin (choleragen), the heat-labile enterotoxin from E. coli, and for a choleragenoid-GM{sub 1} pentasaccharide complex. In the absence of the A subunit the central cavity of the B pentamer is a highly solvated channel. The binding of the A subunit or the receptor pentasaccharide to choleragenoid has only a modest effect on the local stereochemistry and does not perceptibly alter the subunit interface.
An angstrom equation analysis of solar insolation data in Malaysia
International Nuclear Information System (INIS)
Lee Fai Tsen
2000-01-01
Solar energy systems rely extensively on the availability of global solar radiation for optimum performances. Standard method of measurements involves the use of sunshine recorders to record the sunshine hours, solarimeters and chart recorders to record the diffuse and direct solar radiation. The method tends to be expensive and time consuming. As a result, fewer stations may be set up to monitor the solar insulation data Linear regression method using Angstrom equation of the type G = G 0 (a +bn/N) has been used extensively to analyze global radiation at the site of the station. The equation gives the linear regression coefficients a and h which are characteristics of the station. The equation may therefore be used to predict global radiation at and around the station, if the area surrounding the station is geographically similar, or if it is not characteristically changed due to developments over the years. We present here an analysis of the solar insulation data of several meteorological stations in West Malaysia to obtain the linear regression coefficient a and b base on yearly analysis. It is interesting to find that the values of a and b have changed over the years. This may have been due to the global warming effect, or extensive land clearing for local developments which have resulted in haze and pollution that could affect the solar insulation data received at the station. (Author)
DEFF Research Database (Denmark)
Suravajhala, Prashanth; Burri, Harsha Vardhan Reddy; Heiskanen, Arto
2014-01-01
We present the potential role of aptamers in elucidating the function of hypothetical proteins, as well as the possibilities provided by bioinformatics for establishing a benchmark for aptamer-protein prediction methods. With these future perspectives, the role of hypothetical proteins as target ...... molecules for diagnostics and therapies could prove to be very useful in development of medical technology....
Demand curves for hypothetical cocaine in cocaine-dependent individuals.
Bruner, Natalie R; Johnson, Matthew W
2014-03-01
Drug purchasing tasks have been successfully used to examine demand for hypothetical consumption of abused drugs including heroin, nicotine, and alcohol. In these tasks, drug users make hypothetical choices whether to buy drugs, and if so, at what quantity, at various potential prices. These tasks allow for behavioral economic assessment of that drug's intensity of demand (preferred level of consumption at extremely low prices) and demand elasticity (sensitivity of consumption to price), among other metrics. However, a purchasing task for cocaine in cocaine-dependent individuals has not been investigated. This study examined a novel Cocaine Purchasing Task and the relation between resulting demand metrics and self-reported cocaine use data. Participants completed a questionnaire assessing hypothetical purchases of cocaine units at prices ranging from $0.01 to $1,000. Demand curves were generated from responses on the Cocaine Purchasing Task. Correlations compared metrics from the demand curve to measures of real-world cocaine use. Group and individual data were well modeled by a demand curve function. The validity of the Cocaine Purchasing Task was supported by a significant correlation between the demand curve metrics of demand intensity and O max (determined from Cocaine Purchasing Task data) and self-reported measures of cocaine use. Partial correlations revealed that after controlling for demand intensity, demand elasticity and the related measure, P max, were significantly correlated with real-world cocaine use. Results indicate that the Cocaine Purchasing Task produces orderly demand curve data, and that these data relate to real-world measures of cocaine use.
The effectiveness of celebrities in conservation marketing.
Duthie, Elizabeth; Veríssimo, Diogo; Keane, Aidan; Knight, Andrew T
2017-01-01
Celebrities are frequently used in conservation marketing as a tool to raise awareness, generate funding and effect behaviour change. The importance of evaluating effectiveness is widely recognised in both marketing and conservation but, to date, little research into the effectiveness of celebrity endorsement as a tool for conservation marketing has been published. Using a combination of interviews and an online choice survey instrument, we investigated the extent to which a sample of UK-based conservation organisations, and other charities, evaluate their own usage of celebrity endorsement, and then carried out an experimental evaluation of a hypothetical marketing campaign. This experiment compared participants' willingness-to-engage (WTE) with, and recall of, a conservation message presented in versions of an advert featuring one of three prominent UK celebrities (David Beckham, Chris Packham or HRH Prince William) or a non-celebrity control treatment (featuring Crawford Allan, a director of TRAFFIC USA). We find that the organisations we interviewed did not routinely evaluate their marketing campaigns featuring celebrities. Furthermore, our experiment provides evidence that celebrity endorsement can produce both positive and negative effects. Participants were more willing to engage when presented with an advert featuring one of the three celebrities than the non-celebrity control, and WTE varied according to the characteristics of the celebrity and the respondent. However, celebrities were less effective at generating campaign message recall than non-celebrities. These findings suggest that celebrity endorsement should be used carefully. Further work is required to fully understand the role celebrity endorsers can play in conservation but, drawing on best practice from the field of marketing, this study introduces an approach to evaluation which could be applied more widely to improve the effectiveness of conservation marketing.
The effectiveness of celebrities in conservation marketing.
Directory of Open Access Journals (Sweden)
Elizabeth Duthie
Full Text Available Celebrities are frequently used in conservation marketing as a tool to raise awareness, generate funding and effect behaviour change. The importance of evaluating effectiveness is widely recognised in both marketing and conservation but, to date, little research into the effectiveness of celebrity endorsement as a tool for conservation marketing has been published. Using a combination of interviews and an online choice survey instrument, we investigated the extent to which a sample of UK-based conservation organisations, and other charities, evaluate their own usage of celebrity endorsement, and then carried out an experimental evaluation of a hypothetical marketing campaign. This experiment compared participants' willingness-to-engage (WTE with, and recall of, a conservation message presented in versions of an advert featuring one of three prominent UK celebrities (David Beckham, Chris Packham or HRH Prince William or a non-celebrity control treatment (featuring Crawford Allan, a director of TRAFFIC USA. We find that the organisations we interviewed did not routinely evaluate their marketing campaigns featuring celebrities. Furthermore, our experiment provides evidence that celebrity endorsement can produce both positive and negative effects. Participants were more willing to engage when presented with an advert featuring one of the three celebrities than the non-celebrity control, and WTE varied according to the characteristics of the celebrity and the respondent. However, celebrities were less effective at generating campaign message recall than non-celebrities. These findings suggest that celebrity endorsement should be used carefully. Further work is required to fully understand the role celebrity endorsers can play in conservation but, drawing on best practice from the field of marketing, this study introduces an approach to evaluation which could be applied more widely to improve the effectiveness of conservation marketing.
NCBI nr-aa BLAST: CBRC-BTAU-01-0778 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-BTAU-01-0778 ref|ZP_01680223.1| conserved hypothetical protein [Vibrio cholerae... V52] ref|ZP_01956103.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gb|EAX62933.1| conserved hy...pothetical protein [Vibrio cholerae V52] gb|EAY41665.1| conserved hypothetical protein [Vibrio cholerae MZO-3] ZP_01680223.1 0.003 24% ...
International Nuclear Information System (INIS)
Atabak, Mehrdad; Unverdi, Ozhan; Ozer, H. Ozguer; Oral, Ahmet
2009-01-01
We report the first results from novel sub-Angstrom oscillation amplitude non-contact atomic force microscopy developed for lateral force gradient measurements. Quantitative lateral force gradients between a tungsten tip and Si(1 1 1)-(7 x 7) surface can be measured using this microscope. Simultaneous lateral force gradient and scanning tunnelling microscope images of single and multi atomic steps are obtained. In our measurement, tunnel current is used as feedback. The lateral stiffness contrast has been observed to be 2.5 N/m at single atomic step, in contrast to 13 N/m at multi atomic step on Si(1 1 1) surface. We also carried out a series of lateral stiffness-distance spectroscopy. We observed lateral stiffness-distance curves exhibit sharp increase in the stiffness as the sample is approached towards the surface. We usually observed positive stiffness and sometimes going into slightly negative region.
Using a choice experiment and birder preferences to guide bird-conservation funding.
Steven, Rochelle; Smart, James C R; Morrison, Clare; Castley, J Guy
2017-08-01
Conservation of biodiversity, including birds, continues to challenge natural-area managers. Stated-preference methods (e.g., choice experiment [CE]) are increasingly used to provide data for valuation of natural ecosystems. We used a CE to calculate birders' willingness to pay for different levels of bioecological attributes (threatened species, endemic species, and diversity) of birding sites with hypothetical entry fees. The CE was delivered at popular birding and avitourism sites in Australia and the United Kingdom. Latent-class modeling results revealed heterogeneous preferences among birders and correspondingly variable willingness to pay. Four clear groups were apparent: quantity-driven birders, special-birds seekers, confused respondents, and price-is-no-object birders. Quantity-driven birders were attracted to sites that deliver high levels of diversity and endemic species for which they were willing to pay $135 and $66 to visit, respectively, above what they were willing to pay to visit a site with low levels of diversity and few endemic and threatened species . Special-bird seekers valued threatened species and high levels of endemic species most (willingness to pay $45 and $46, respectively). Confused respondents' preferences were difficult to determine, but they were the most sensitive to the hypothetical entry fees, unlike the price-is-no-object birders, who were not at all sensitive to cost. Our findings demonstrate that birders are amenable to paying for their preferred birding experience. These payments could provide an alternative source of funding in some avitourism sites on both public and private land. Such alternative revenue streams should be explored and given full consideration in increasingly competitive conservation-financing environments. © 2016 Society for Conservation Biology.
Icek Ajzen; Thomas C. Brown; Franklin Carvajal
2004-01-01
An experiment was designed to account for intention-behavior discrepancies by applying the theory of planned behavior to contingent valuation. College students (N = 160) voted in hypothetical and real payment referenda to contribute $8 to a scholarship fund. Overestimates of willingness to pay in the hypothetical referendum could not be attributed to moderately...
Genome-wide screens for expressed hypothetical proteins
DEFF Research Database (Denmark)
Madsen, Claus Desler; Durhuus, Jon Ambæk; Rasmussen, Lene Juel
2012-01-01
A hypothetical protein (HP) is defined as a protein that is predicted to be expressed from an open reading frame, but for which there is no experimental evidence of translation. HPs constitute a substantial fraction of proteomes of human as well as of other organisms. With the general belief that...... that the majority of HPs are the product of pseudogenes, it is essential to have a tool with the ability of pinpointing the minority of HPs with a high probability of being expressed....
Modelling of melting and solidification transport phenomena during hypothetical NPP severe accidents
Energy Technology Data Exchange (ETDEWEB)
Sarler, B [Inst. Jozef Stefan, Ljubljana (Slovenia)
1992-07-01
A physical and mathematical framework to deal with the transport phenomena occuring during melting and solidification of the hypothetical NPP severe accidents is presented. It concentrates on the transient temperature, velocity, and species concentration distributions during such events. The framework is based on the Mixture Continuum Formulation of the components and phases, cast in the boundary-domain integral shape structured by the fundamental solution of the Laplace equation. The formulation could cope with various solid-liquid sub-systems through the inclusion of the specific closure relations. The deduced system of boundary-domain integral equations for conservation of mass, energy, momentum, and species could be solved by the boundary element discrete approximative method. (author) [Slovenian] Predstavljeno je fizikalno in matematicno ogrodje za obravnavo prenosnih pojavov taljenja in strjevanja med hipoteticnimi tezkimi nezgodami v jedrskih elektrarnah. Osredotoceno je na popis neustaljene porazdelitve temperatur, hitrosti in koncentracij sestavin med taksnimi dogodki. Ogrodje temelji na formulaciji kontinuuma mesanice komponent in faz, v obliki robno obmocnih integralskih enacb, ki so sestavljena na podlagi fundamentalne resitve Laplace-ove enacbe. Formulacija lahko popisuje stevilne trdno-tekoce pod-sisteme na podlagi specificnih sklopitvenih relacij. Izpeljan sistem robno-obmocnih integralskih enacb za popis ohranitve mase, energije, gibalne kolicine in sestavin lahko resimo na podlagi diskretne aproksimativne metode robnih elementov. (author)
Analysis of hypothetical LMFBR whole-core accidents in the USA
International Nuclear Information System (INIS)
Ferguson, D.R.; Deitrich, L.W.; Brown, N.W.; Waltar, A.E.
1978-01-01
Methods used for analysis of material behaviour, accident phenomenology and integrated accident calculations are reviewed. Applications of these methods to hypothetical LOF and TOP accidents are discussed. Recent results obtained from applications to FFTF and CRBRP are presented. (author)
Directory of Open Access Journals (Sweden)
Matthias Schröter
Full Text Available Inclusion of spatially explicit information on ecosystem services in conservation planning is a fairly new practice. This study analyses how the incorporation of ecosystem services as conservation features can affect conservation of forest biodiversity and how different opportunity cost constraints can change spatial priorities for conservation. We created spatially explicit cost-effective conservation scenarios for 59 forest biodiversity features and five ecosystem services in the county of Telemark (Norway with the help of the heuristic optimisation planning software, Marxan with Zones. We combined a mix of conservation instruments where forestry is either completely (non-use zone or partially restricted (partial use zone. Opportunity costs were measured in terms of foregone timber harvest, an important provisioning service in Telemark. Including a number of ecosystem services shifted priority conservation sites compared to a case where only biodiversity was considered, and increased the area of both the partial (+36.2% and the non-use zone (+3.2%. Furthermore, opportunity costs increased (+6.6%, which suggests that ecosystem services may not be a side-benefit of biodiversity conservation in this area. Opportunity cost levels were systematically changed to analyse their effect on spatial conservation priorities. Conservation of biodiversity and ecosystem services trades off against timber harvest. Currently designated nature reserves and landscape protection areas achieve a very low proportion (9.1% of the conservation targets we set in our scenario, which illustrates the high importance given to timber production at present. A trade-off curve indicated that large marginal increases in conservation target achievement are possible when the budget for conservation is increased. Forty percent of the maximum hypothetical opportunity costs would yield an average conservation target achievement of 79%.
Ecosystem Services and Opportunity Costs Shift Spatial Priorities for Conserving Forest Biodiversity
Schröter, Matthias; Rusch, Graciela M.; Barton, David N.; Blumentrath, Stefan; Nordén, Björn
2014-01-01
Inclusion of spatially explicit information on ecosystem services in conservation planning is a fairly new practice. This study analyses how the incorporation of ecosystem services as conservation features can affect conservation of forest biodiversity and how different opportunity cost constraints can change spatial priorities for conservation. We created spatially explicit cost-effective conservation scenarios for 59 forest biodiversity features and five ecosystem services in the county of Telemark (Norway) with the help of the heuristic optimisation planning software, Marxan with Zones. We combined a mix of conservation instruments where forestry is either completely (non-use zone) or partially restricted (partial use zone). Opportunity costs were measured in terms of foregone timber harvest, an important provisioning service in Telemark. Including a number of ecosystem services shifted priority conservation sites compared to a case where only biodiversity was considered, and increased the area of both the partial (+36.2%) and the non-use zone (+3.2%). Furthermore, opportunity costs increased (+6.6%), which suggests that ecosystem services may not be a side-benefit of biodiversity conservation in this area. Opportunity cost levels were systematically changed to analyse their effect on spatial conservation priorities. Conservation of biodiversity and ecosystem services trades off against timber harvest. Currently designated nature reserves and landscape protection areas achieve a very low proportion (9.1%) of the conservation targets we set in our scenario, which illustrates the high importance given to timber production at present. A trade-off curve indicated that large marginal increases in conservation target achievement are possible when the budget for conservation is increased. Forty percent of the maximum hypothetical opportunity costs would yield an average conservation target achievement of 79%. PMID:25393951
The Relationship Between Personality and Schadenfreude in Hypothetical Versus Live Situations.
Greenier, Keegan D
2018-06-01
This study sought to investigate how individual differences are related to schadenfreude (pleasure derived from another's misfortune) by replicating past findings and extending them to additional personality traits. Because most past research on schadenfreude has relied heavily on the use of reactions to hypothetical scenarios, an attempt was made to demonstrate external validity by also including a reaction to a live event (confederate misfortune). For the scenarios, schadenfreude was positively correlated with the Dark Triad and just world beliefs; negatively correlated with empathy and agreeableness; and uncorrelated with dispositional envy, self-esteem, or the remaining Big Five traits. For the live event, no personality traits were correlated with schadenfreude, suggesting responses to hypothetical situations may not be representative of real-life schadenfreude events.
Restricted Predicates for Hypothetical Datalog
Directory of Open Access Journals (Sweden)
Fernando Sáenz-Pérez
2015-12-01
Full Text Available Hypothetical Datalog is based on an intuitionistic semantics rather than on a classical logic semantics, and embedded implications are allowed in rule bodies. While the usual implication (i.e., the neck of a Horn clause stands for inferring facts, an embedded implication plays the role of assuming its premise for deriving its consequence. A former work introduced both a formal framework and a goal-oriented tabled implementation, allowing negation in rule bodies. While in that work positive assumptions for both facts and rules can occur in the premise, negative assumptions are not allowed. In this work, we cover this subject by introducing a new concept: a restricted predicate, which allows negative assumptions by pruning the usual semantics of a predicate. This new setting has been implemented in the deductive system DES.
Testing QCD with Hypothetical Tau Leptons
Energy Technology Data Exchange (ETDEWEB)
Brodsky, Stanley J.
1998-10-21
We construct new tests of perturbative QCD by considering a hypothetical {tau} lepton of arbitrary mass, which decays hadronically through the electromagnetic current. We can explicitly compute its hadronic width ratio directly as an integral over the e{sup +}e{sup -} annihilation cross section ratio, R{sub e{sup +}e{sup -}}. Furthermore, we can design a set of commensurate scale relations and perturbative QCD tests by varying the weight function away from the form associated with the V-A decay of the physical {tau}. This method allows the wide range of the R{sub e{sup +}e{sup -}} data to be used as a probe of perturbative QCD.
Reducing therapeutic misconception: A randomized intervention trial in hypothetical clinical trials.
Directory of Open Access Journals (Sweden)
Paul P Christopher
Full Text Available Participants in clinical trials frequently fail to appreciate key differences between research and clinical care. This phenomenon, known as therapeutic misconception, undermines informed consent to clinical research, but to date there have been no effective interventions to reduce it and concerns have been expressed that to do so might impede recruitment. We determined whether a scientific reframing intervention reduces therapeutic misconception without significantly reducing willingness to participate in hypothetical clinical trials.This prospective randomized trial was conducted from 2015 to 2016 to test the efficacy of an informed consent intervention based on scientific reframing compared to a traditional informed consent procedure (control in reducing therapeutic misconception among patients considering enrollment in hypothetical clinical trials modeled on real-world studies for one of five disease categories. Patients with diabetes mellitus, hypertension, coronary artery disease, head/neck cancer, breast cancer, and major depression were recruited from medical clinics and a clinical research volunteer database. The primary outcomes were therapeutic misconception, as measured by a validated, ten-item Therapeutic Misconception Scale (range = 10-50, and willingness to participate in the clinical trial.154 participants completed the study (age range, 23-87 years; 92.3% white, 56.5% female; 74 (48.1% had been randomized to receive the experimental intervention. Therapeutic misconception was significantly lower (p = 0.004 in the scientific reframing group (26.4, 95% CI [23.7 to 29.1] compared to the control group (30.9, 95% CI [28.4 to 33.5], and remained so after controlling for education (p = 0.017. Willingness to participate in the hypothetical trial was not significantly different (p = 0.603 between intervention (52.1%, 95% CI [40.2% to 62.4%] and control (56.3%, 95% CI [45.3% to 66.6%] groups.An enhanced educational intervention augmenting
Analyses of hypothetical FCI's in a fast reactor
International Nuclear Information System (INIS)
Padilla, A. Jr.; Martin, F.J.; Niccoli, L.G.
1981-01-01
Parametric analyses using the SIMMER code were performed to evaluate the potential for a severe recriticality from a pressure-driven recompaction caused by an energetic FCI during the transition phase of a hypothetical accident in a fast reactor. For realistic and reasonable estimates for the assumed accident conditions, a severe recriticality was not predicted. The conditions under which a severe recriticality would be obtained or averted were identified. 10 figures, 2 tables
Nonstoichiometric complex of gramicidin D with KI at 0.80 (angstrom) resolution
International Nuclear Information System (INIS)
Olczak, A.; Glowka, M.L.; Szczesio, M.; Bojarsk, J.; Duax, W.L.; Burkhart, B.M.; Wawrzak, Z.
2007-01-01
The crystal structure of a nonstoichiometric complex of gramicidin D (gD) with KI has been determined at 100 K using synchrotron radiation. The final R factor was 0.106 for 83 988 observed reflections (Friedel pairs were not merged) collected to 0.80 (angstrom). The structure consists of four independent pentadecapeptides and numerous solvent molecules and salt ions. The general architecture of the antiparallel double-stranded gramicidin dimers in the crystal (a right-handed antiparallel DSβH R form) closely resembles that of previously published cation complexes of gD. However, a significantly different mixture of gramicidin isomers is found in the crystal of the KI complex, including partial occupancy of phenylalanine at position 11. Only three sites in each of the two crystallographically independent channels are partially occupied by potassium cations instead of the commonly observed seven sites. The sum of the partial occupancies of K + (1.10 per two dimers) is consistent with the sum of the iodide occupancies (1.095 over eight sites), which is also confirmed by the anomalous signal of the iodide. There was a significant asymmetry of the distribution and occupancies of cations in the crystallographically independent gramicidin channels, in contrast to the distribution found in the rubidium chloride complex with gD.
Biodiversity gains from efficient use of private sponsorship for flagship species conservation.
Bennett, Joseph R; Maloney, Richard; Possingham, Hugh P
2015-04-22
To address the global extinction crisis, both efficient use of existing conservation funding and new sources of funding are vital. Private sponsorship of charismatic 'flagship' species conservation represents an important source of new funding, but has been criticized as being inefficient. However, the ancillary benefits of privately sponsored flagship species conservation via actions benefiting other species have not been quantified, nor have the benefits of incorporating such sponsorship into objective prioritization protocols. Here, we use a comprehensive dataset of conservation actions for the 700 most threatened species in New Zealand to examine the potential biodiversity gains from national private flagship species sponsorship programmes. We find that private funding for flagship species can clearly result in additional species and phylogenetic diversity conserved, via conservation actions shared with other species. When private flagship species funding is incorporated into a prioritization protocol to preferentially sponsor shared actions, expected gains can be more than doubled. However, these gains are consistently smaller than expected gains in a hypothetical scenario where private funding could be optimally allocated among all threatened species. We recommend integrating private sponsorship of flagship species into objective prioritization protocols to sponsor efficient actions that maximize biodiversity gains, or wherever possible, encouraging private donations for broader biodiversity goals. © 2015 The Author(s) Published by the Royal Society. All rights reserved.
Trial of risk assessment of a hypothetical nuclear facility
International Nuclear Information System (INIS)
Terao, Norichika; Suzuki, Mitsutoshi
2013-01-01
An equation for risk assessment in physical protection is shown by a probability of an adversary attack during a period time, P A , a probability of system effectiveness, P E , and consequence value, C. In addition, P E is shown as the multiplication of a probability of interruption of the facility, P I , by a probability of neutralization by response force, P N . In this study, it is assumed that an adversary assaults a hypothetical nuclear facility. The new quantification method about P A and P I in risk evaluation formula is devised, and risk assessment is attempted. In case of P A , the possibility of assaults against a nuclear facility is discussed by using terrorism data written in the open source database of terrorism, Global Terrorism Database (GTD), summarized by University of Maryland. In addition, it is discussed about P I by using the way of thinking of a risk assessment tool, EASI, developed by the Sandia National Laboratories (SNL). In the hypothetical nuclear facility, the performance of response force, sensors, and communication is expressed quantitatively by probability distribution based on some assumptions. (author)
What we say and what we do: the relationship between real and hypothetical moral choices.
FeldmanHall, Oriel; Mobbs, Dean; Evans, Davy; Hiscox, Lucy; Navrady, Lauren; Dalgleish, Tim
2012-06-01
Moral ideals are strongly ingrained within society and individuals alike, but actual moral choices are profoundly influenced by tangible rewards and consequences. Across two studies we show that real moral decisions can dramatically contradict moral choices made in hypothetical scenarios (Study 1). However, by systematically enhancing the contextual information available to subjects when addressing a hypothetical moral problem-thereby reducing the opportunity for mental simulation-we were able to incrementally bring subjects' responses in line with their moral behaviour in real situations (Study 2). These results imply that previous work relying mainly on decontextualized hypothetical scenarios may not accurately reflect moral decisions in everyday life. The findings also shed light on contextual factors that can alter how moral decisions are made, such as the salience of a personal gain. Copyright © 2012 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Hunter, R.L.
1983-10-01
Nine release phenomena - normal flow of water, tectonic disturbance of the fracture network, intersection of a new fault with the repository, glaciation, fluvia erosion, thermomechanical disturbances, subsidence, seal failure, and drilling - give rise to 318 preliminary scenarios for the release of waste from a hypothetical high-level-waste repository in basalt. The scenarios have relative probabilities that range over several orders of magnitude. The relative probabilities provide a means of screening the scenarios for the more limited set to be subjected to consequence analysis. Lack of data and of preliminary modeling, however, lead to great uncertainties in the highly conservative probabilities assigned here. As a result, the recommendations in this report are directed at resolution of the major uncertainties in the relative probabilities of the preliminary scenarios. The resolution of some of the uncertainties should help in the selection of the suite of scenarios for final consequence analysis. 38 references, 22 figures, 18 tables
Kreitler, Jason; Schloss, Carrie A; Soong, Oliver; Hannah, Lee; Davis, Frank W
2015-01-01
Balancing society's competing needs of development and conservation requires careful consideration of tradeoffs. Renewable energy development and biodiversity conservation are often considered beneficial environmental goals. The direct footprint and disturbance of renewable energy, however, can displace species' habitat and negatively impact populations and natural communities if sited without ecological consideration. Offsets have emerged as a potentially useful tool to mitigate residual impacts after trying to avoid, minimize, or restore affected sites. Yet the problem of efficiently designing a set of offset sites becomes increasingly complex where many species or many sites are involved. Spatial conservation prioritization tools are designed to handle this problem, but have seen little application to offset siting and analysis. To address this need we designed an offset siting support tool for the Desert Renewable Energy Conservation Plan (DRECP) of California, and present a case study of hypothetical impacts from solar development in the Western Mojave subsection. We compare two offset scenarios designed to mitigate a hypothetical 15,331 ha derived from proposed utility-scale solar energy development (USSED) projects. The first scenario prioritizes offsets based precisely on impacted features, while the second scenario offsets impacts to maximize biodiversity conservation gains in the region. The two methods only agree on 28% of their prioritized sites and differ in meeting species-specific offset goals. Differences between the two scenarios highlight the importance of clearly specifying choices and priorities for offset siting and mitigation in general. Similarly, the effects of background climate and land use change may lessen the durability or effectiveness of offsets if not considered. Our offset siting support tool was designed specifically for the DRECP area, but with minor code modification could work well in other offset analyses, and could provide
Hypothetical conflict situations with friends and peers
Directory of Open Access Journals (Sweden)
Petrović Danijela S.
2012-01-01
Full Text Available This paper deals with age and sex differences in preferred strategies of conflict resolution in friendship and peer relationships. The study was conducted on the sample of 286 adolescents. Conflict resolution strategies have been investigated by the method of hypothetical conflict situations. For the purposes of this research, we have created an instrument consisting of 20 hypothetical situations, with the following subjects of conflict: breaking the agreement, non-compliance with opinion differences, provocations, dishonesty and stubbornness. Conflict resolution strategies we examined were giving in, withdrawal, competition and problem solving. The results have shown that problem solving is the dominant strategy of adolescents in conflict with friends, while in peer conflicts they more often opt for competition. Age differences are reflected in the fact that older adolescents are more likely to choose problem solving than younger, whereas younger adolescents are more likely to choose a retreat (withdrawal strategy than older. Girls are more prone to choosing problem solving than boys, who, on the other hand, tend to withdraw more than girls. Also, gender of the other person in the conflict is proved to be important - in conflict with male peers, adolescents choose competition to a greater extent and withdraw to a minor extent, compared to when they are in conflict with female peers. The results have practical implications as well. In programs for teaching constructive conflict resolution that are designed for younger adolescents there should be more emphasis on empowerment and training for assertive behaviour. In addition, when teaching about constructive conflict resolution strategies, it is important to consider the gender of adolescents as well as the gender of the person with whom they are in conflict.
Consequences of a hypothetical incident for different sectors
Bertinelli, F; Garion, C; Jimenez, J M; Parma, V; Perin, A; Schmidt, R; Tavian, L; Tock, J P; van Weelderen, R
2011-01-01
During the 2009 long shutdown, the LHC machine has been partially consolidated by adding safety relief devices in order to better protect the cryostats against large helium release and consequently to mitigate the risks of collateral damages. After recalling the present relief valve implementation and other mitigations related to the collateral damages, this paper describes the damage process of a hypothetical incident, presents its consequences for the different sectors and for beam energies up to 5 TeV with emphasis on the induced downtime.
Bioinformatics and structural characterization of a hypothetical protein from Streptococcus mutans
DEFF Research Database (Denmark)
Nan, Jie; Brostromer, Erik; Liu, Xiang-Yu
2009-01-01
. From the interlinking structural and bioinformatics studies, we have concluded that SMU.440 could be involved in polyketide-like antibiotic resistance, providing a better understanding of this hypothetical protein. Besides, the combination of multiple methods in this study can be used as a general...
Fuel assembly loads during a hypothetical blowdown event in a PWR
International Nuclear Information System (INIS)
Stabel, J.; Bosanyi, B.; Kim, J.D.
1991-01-01
As a consequence of a hypothetical sudden break of the main coolant pipe of a PWR, RPV-internals and fuel assemblies (FA's) are undergoing horizontal and vertical motions. FA's may impact against each other, against core shroud or against lower core support. The corresponding impact loads must be absorbed by the FA spacer grids and guide thimbles. In this paper FA-loads are calculated with and without consideration of Fluid-Structure-Interaction (FSI) effects for assumed different break sizes of the main coolant pipe. The analysis has been performed for a hypothetical cold leg break of a typical SIEMENS-4 loop plant. For this purpose the codes DAPSY/DAISY (GRS, Germany) were coupled with the structural code KWUSTOSS (SIEMENS). It is shown that the FA loads obtained in calculations with consideration of FSI effects are by a factor of 2-4 lower than those obtained in the corresponding calculations without consideration of FSI. (author)
Dymond, Simon; Molet, Mikael; Davies, Lynette
2017-08-01
Evaluative learning comprises changes in preferences after co-occurrences between conditioned stimuli (CSs) and an unconditioned stimulus (US) of affective value. Co-occurrences may involve relational responding. Two experiments examined the impact of arbitrary relational responding on evaluative preferences for hypothetical money and shock outcomes. In Experiment 1, participants were trained to make arbitrary relational responses by placing CSs of the same size but different colours into boxes and were then instructed that these CSs represented different intensities of hypothetical USs (money or shock). Liking ratings of the CSs were altered in accordance with the underlying bigger/smaller than relations. A reversal of preference was also observed: the CS associated with the smallest hypothetical shock was rated more positively than the CS associated with the smallest amount of hypothetical money. In Experiment 2, procedures from Relational Frame Theory (RFT) established a relational network of more than/less than relations consisting of five CSs (A-B-C-D-E). Overall, evaluative preferences were altered, but not reversed, depending on (a) how stimuli had been related to one another during the learning phase and (b) whether those stimuli referred to money or shocks. The contribution of RFT to evaluative learning research is discussed.
Public Versus Private: Does It Matter for Water Conservation? Insights from California
Kallis, Giorgos; Ray, Isha; Fulton, Julian; McMahon, James E.
2010-01-01
This article asks three connected questions: First, does the public view private and public utilities differently, and if so, does this affect attitudes to conservation? Second, do public and private utilities differ in their approaches to conservation? Finally, do differences in the approaches of the utilities, if any, relate to differences in public attitudes? We survey public attitudes in California toward (hypothetical but plausible) voluntary and mandated water conservation, as well as to price increases, during a recent period of shortage. We do this by interviewing households in three pairs of adjacent public and private utilities. We also survey managers of public and private urban water utilities to see if they differ in their approaches to conservation and to their customers. On the user side we do not find pronounced differences, though a minority of customers in all private companies would be more willing to conserve or pay higher prices under a public operator. No respondent in public utility said the reverse. Negative attitudes toward private operators were most pronounced in the pair marked by a controversial recent privatization and a price hike. Nonetheless, we find that California’s history of recurrent droughts and the visible role of the state in water supply and drought management undermine the distinction between public and private. Private utilities themselves work to underplay the distinction by stressing the collective ownership of the water source and the collective value of conservation. Overall, California’s public utilities appear more proactive and target-oriented in asking their customers to conserve than their private counterparts and the state continues to be important in legitimating and guiding conservation behavior, whether the utility is in public hands or private.
Sensitivity Analysis of Evacuation Speed in Hypothetical NPP Accident by Earthquake
Energy Technology Data Exchange (ETDEWEB)
Kim, Sung-yeop; Lim, Ho-Gon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-10-15
Effective emergency response in emergency situation of nuclear power plant (NPP) can make consequences be different therefore it is regarded important when establishing an emergency response plan and assessing the risk of hypothetical NPP accident. Situation of emergency response can be totally changed when NPP accident caused by earthquake or tsunami is considered due to the failure of roads and buildings by the disaster. In this study evacuation speed has been focused among above various factors and reasonable evacuation speed in earthquake scenario has been investigated. Finally, sensitivity analysis of evacuation speed in hypothetical NPP accident by earthquake has been performed in this study. Evacuation scenario can be entirely different in the situation of seismic hazard and the sensitivity analysis of evacuation speed in hypothetical NPP accident by earthquake has been performed in this study. Various references were investigated and earthquake evacuation model has been developed considering that evacuees may convert their evacuation method from using a vehicle to walking when they face the difficulty of using a vehicle due to intense traffic jam, failure of buildings and roads, and etc. The population dose within 5 km / 30 km have been found to be increased in earthquake situation due to decreased evacuation speed and become 1.5 - 2 times in the severest earthquake evacuation scenario set up in this study. It is not agreed that using same emergency response model which is used for normal evacuation situations when performing level 3 probabilistic safety assessment for earthquake and tsunami event. Investigation of data and sensitivity analysis for constructing differentiated emergency response model in the event of seismic hazard has been carried out in this study.
Sensitivity Analysis of Evacuation Speed in Hypothetical NPP Accident by Earthquake
International Nuclear Information System (INIS)
Kim, Sung-yeop; Lim, Ho-Gon
2016-01-01
Effective emergency response in emergency situation of nuclear power plant (NPP) can make consequences be different therefore it is regarded important when establishing an emergency response plan and assessing the risk of hypothetical NPP accident. Situation of emergency response can be totally changed when NPP accident caused by earthquake or tsunami is considered due to the failure of roads and buildings by the disaster. In this study evacuation speed has been focused among above various factors and reasonable evacuation speed in earthquake scenario has been investigated. Finally, sensitivity analysis of evacuation speed in hypothetical NPP accident by earthquake has been performed in this study. Evacuation scenario can be entirely different in the situation of seismic hazard and the sensitivity analysis of evacuation speed in hypothetical NPP accident by earthquake has been performed in this study. Various references were investigated and earthquake evacuation model has been developed considering that evacuees may convert their evacuation method from using a vehicle to walking when they face the difficulty of using a vehicle due to intense traffic jam, failure of buildings and roads, and etc. The population dose within 5 km / 30 km have been found to be increased in earthquake situation due to decreased evacuation speed and become 1.5 - 2 times in the severest earthquake evacuation scenario set up in this study. It is not agreed that using same emergency response model which is used for normal evacuation situations when performing level 3 probabilistic safety assessment for earthquake and tsunami event. Investigation of data and sensitivity analysis for constructing differentiated emergency response model in the event of seismic hazard has been carried out in this study
International Nuclear Information System (INIS)
Arnold, L.A.; Knowles, J.B.
1983-11-01
The SIMMER code contains models of the many interacting thermo-hydraulic processes that occur during a hypothetical core disruptive accident (HCDA), to provide an overall picture from accident initiation to containment loading. In calculations of roof loadings following the HCDA, errors in computing the overall energy balance were found to be up to ten times the kinetic energy of the sodium slug which creates the loading. On this account, the results were considered to be seriously compromised. This report describes a systematic investigation into the effect, nature and origin of the energy discrepancies. Its main conclusion are that, the errors stem from a systematic rather than a random source, energy errors for individual cells can be two decades larger than the mean value provided by the code, and cellular mass and energy errors are strongly correlated and they can actually increase when the mesh is refined. A likely cause of the conservation errors is identified as the solution of the liquid phase mass and energy equations at effectively different time instants during each timestep. (author)
Matusiewicz, Alexis K; Carter, Anne E; Landes, Reid D; Yi, Richard
2013-11-01
Delay discounting (DD) and probability discounting (PD) refer to the reduction in the subjective value of outcomes as a function of delay and uncertainty, respectively. Elevated measures of discounting are associated with a variety of maladaptive behaviors, and confidence in the validity of these measures is imperative. The present research examined (1) the statistical equivalence of discounting measures when rewards were hypothetical or real, and (2) their 1-week reliability. While previous research has partially explored these issues using the low threshold of nonsignificant difference, the present study fully addressed this issue using the more-compelling threshold of statistical equivalence. DD and PD measures were collected from 28 healthy adults using real and hypothetical $50 rewards during each of two experimental sessions, one week apart. Analyses using area-under-the-curve measures revealed a general pattern of statistical equivalence, indicating equivalence of real/hypothetical conditions as well as 1-week reliability. Exceptions are identified and discussed. Copyright © 2013 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Jie Nan
2009-10-01
Full Text Available As an oral bacterial pathogen, Streptococcus mutans has been known as the aetiologic agent of human dental caries. Among a total of 1960 identified proteins within the genome of this organism, there are about 500 without any known functions. One of these proteins, SMU.440, has very few homologs in the current protein databases and it does not fall into any protein functional families. Phylogenetic studies showed that SMU.440 is related to a particular ecological niche and conserved specifically in some oral pathogens, due to lateral gene transfer. The co-occurrence of a MarR protein within the same operon among these oral pathogens suggests that SMU.440 may be associated with antibiotic resistance. The structure determination of SMU.440 revealed that it shares the same fold and a similar pocket as polyketide cyclases, which indicated that it is very likely to bind some polyketide-like molecules. From the interlinking structural and bioinformatics studies, we have concluded that SMU.440 could be involved in polyketide-like antibiotic resistance, providing a better understanding of this hypothetical protein. Besides, the combination of multiple methods in this study can be used as a general approach for functional studies of a protein with unknown function.
Computer codes developed in FRG to analyse hypothetical meltdown accidents
International Nuclear Information System (INIS)
Hassmann, K.; Hosemann, J.P.; Koerber, H.; Reineke, H.
1978-01-01
It is the purpose of this paper to give the status of all significant computer codes developed in the core melt-down project which is incorporated in the light water reactor safety research program of the Federal Ministry of Research and Technology. For standard pressurized water reactors, results of some computer codes will be presented, describing the course and the duration of the hypothetical core meltdown accident. (author)
Abrams, Barbara; Coyle, Jeremy; Cohen, Alison K; Headen, Irene; Hubbard, Alan; Ritchie, Lorrene; Rehkopf, David H
2017-09-01
To model the hypothetical impact of preventing excessive gestational weight gain on midlife obesity and compare the estimated reduction with the US Healthy People 2020 goal of a 10% reduction of obesity prevalence in adults. We analyzed 3917 women with 1 to 3 pregnancies in the prospective US National Longitudinal Survey of Youth, from 1979 to 2012. We compared the estimated obesity prevalence between 2 scenarios: gestational weight gain as reported and under the scenario of a hypothetical intervention that all women with excessive gestational weight gain instead gained as recommended by the Institute of Medicine (2009). A hypothetical intervention was associated with a significantly reduced estimated prevalence of obesity for first (3.3 percentage points; 95% confidence interval [CI] = 1.0, 5.6) and second (3.0 percentage points; 95% CI = 0.7, 5.2) births, and twice as high in Black as in White mothers, but not significant in Hispanics. The population attributable fraction was 10.7% (95% CI = 3.3%, 18.1%) in first and 9.3% (95% CI = 2.2%, 16.5%) in second births. Development of effective weight-management interventions for childbearing women could lead to meaningful reductions in long-term obesity.
Mark Morrison; Thomas C. Brown
2009-01-01
Stated preference methods such as contingent valuation and choice modeling are subject to various biases that may lead to differences between actual and hypothetical willingness to pay. Cheap talk, follow-up certainty scales, and dissonance minimization are three techniques for reducing this hypothetical bias. Cheap talk and certainty scales have received considerable...
study and analysis of asa river hypothetical dam break using hec-ras
African Journals Online (AJOL)
Impounded reservoirs provide beneficial functions such as flood control, recreation, hydropower and water supply but they also carry potential risks. Spontaneous dam break phenomenon can occur and the resultant flooding may cause substantial loss of life and property damage downstream of the dam. A hypothetical dam ...
Effects of spent fuel types on offsite consequences of hypothetical accidents
International Nuclear Information System (INIS)
Courtney, J. C.; Dwight, C. C.; Lehto, M. A.
2000-01-01
Argonne National Laboratory (ANL) conducts experimental work on the development of waste forms suitable for several types of spent fuel at its facility on the Idaho National Engineering and Environmental Laboratory (INEEL) located 48 km West of Idaho Falls, ID. The objective of this paper is to compare the offsite radiological consequences of hypothetical accidents involving the various types of spent nuclear fuel handled in nonreactor nuclear facilities. The highest offsite total effective dose equivalents (TEDEs) are estimated at a receptor located about 5 km SSE of ANL facilities. Criticality safety considerations limit the amount of enriched uranium and plutonium that could be at risk in any given scenario. Heat generated by decay of fission products and actinides does not limit the masses of spent fuel within any given operation because the minimum time elapsed since fissions occurred in any form is at least five years. At cooling times of this magnitude, fewer than ten radionuclides account for 99% of the projected TEDE at offsite receptors for any credible accident. Elimination of all but the most important nuclides allows rapid assessments of offsite doses with little loss of accuracy. Since the ARF (airborne release fraction), RF (respirable fraction), LPF (leak path fraction) and atmospheric dilution factor (χ/Q) can vary by orders of magnitude, it is not productive to consider nuclides that contribute less than a few percent of the total dose. Therefore, only 134 Cs, 137 Cs- 137m Ba, and the actinides significantly influence the offsite radiological consequences of severe accidents. Even using highly conservative assumptions in estimating radiological consequences, they remain well below current Department of Energy guidelines for highly unlikely accidents
Evaluation of Nuclide Release Scenarios for a Hypothetical LILW Repository
International Nuclear Information System (INIS)
Lee, Youn Myoung; Jeong, Jong Tae
2010-11-01
A program for the safety assessment and performance evaluation of a low- and intermediate-level radioactive waste (LILW) repository system has been developed. Utilizing GoldSim (GoldSim, 2006), the program evaluates nuclide release and transport into the geosphere and biosphere under various disruptive natural and manmade events and scenarios that can occur after a waste package failure. We envisaged and illustrated these events and scenarios as occurring after the closure of a hypothetical LILW repository, and they included the degradation of various manmade barriers, pumping well drilling, and natural disruptions such as the sudden formation of a preferential flow pathway in the far-field area of the repository. Possible enhancement of nuclide transport facilitated by colloids or chelating agents is also dealt with. We used the newly-developed GoldSim template program, which is capable of various nuclide release scenarios and is greatly suited for simulating a potential repository given the geological circumstances in Korea, to create the detailed source term and near-field release scheme, various nuclide transport modes in the far-field geosphere area, and the biosphere transfer. Even though all parameter values applied to the hypothetical repository were assumed, the illustrative results, particularly the probabilistic calculations and sensitivity studies, may be informative under various scenarios
Demonstration of resonant photopumping of Mo VII by Mo XII for a VUV laser near 600 Angstrom
International Nuclear Information System (INIS)
Ilcisin, K.J.; Aumayr, F.; Schwob, J.L.; Suckewer, S.
1993-09-01
We present data of experiments on the resonant photopumping of Mo VII by Mo XII as a method of generating a coherent VUV source near 600 angstrom. The experiment is based on a scheme proposed by Feldman and Reader in which the 4p 6 -- 4p 5 6s transition in Mo VII in resonantly photopumped by the 5s 2 S 1/2 -- 4p 2 P 1/2 transition in Mo XII. Results of the laser produced plasma experiments show the successful enhancement of the population of the Mo VII 4p 5 6s upper lasing level when pumped by an adjacent Mo VII plasma. No enhancement was seen in a control experiment where the Mo VII plasma was pumped by a Zr X plasma. Improvements of the intensity of the Mo XII pump source, achieved using an additional pump laser, lead to the generation of a population inversion for the VUV transition
Ability to Categorize Food Predicts Hypothetical Food Choices in Head Start Preschoolers.
Nicholson, Jody S; Barton, Jennifer M; Simons, Ali L
2018-03-01
To investigate whether preschoolers are able to identify and categorize foods, and whether their ability to classify food as healthy predicts their hypothetical food choice. Structured interviews and body measurements with preschoolers, and teacher reports of classroom performance. Six Head Start centers in a large southeastern region. A total of 235 preschoolers (mean age [SD], 4.73 [0.63] years; 45.4% girls). Teachers implemented a nutrition education intervention across the 2014-2015 school year in which children were taught to identify and categorize food as sometimes (ie, unhealthy) and anytime (ie, healthy). Preschooler responses to a hypothetical snack naming, classifying, and selection scenario. Hierarchical regression analyses to examine predictors of child hypothetical food selection. While controlling for child characteristics and cognitive functioning, preschoolers who were better at categorizing food as healthy or unhealthy were more likely to say they would choose the healthy food. Low-contrast food pairs in which food had to be classified based on multiple dimensions were outside the cognitive abilities of the preschoolers. Nutrition interventions may be more effective in helping children make healthy food choices if developmental limitations in preschoolers' abilities to categorize food is addressed in their curriculum. Classification of food into evaluative categories is challenging for this age group. Categorizing on multiple dimensions is difficult, and dichotomous labeling of food as good or bad is not always accurate in directing children toward making food choices. Future research could evaluate further preschoolers' developmental potential for food categorization and nutrition decision making and consider factors that influence healthy food choices at both snack and mealtime. Copyright © 2017 Society for Nutrition Education and Behavior. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Xia Xiangao
2011-01-01
Using aerosol loading data from 79 Aerosol Robotic Network (AERONET) stations with observations from more than six years, changes in aerosol optical depth (AOD) and Angstrom wavelength exponent (AWE) were studied. A statistical method was developed to determine whether AOD changes were due to increased background AOD values and/or an increased number of high AOD events. AOD decreased significantly at AERONET sites in northeastern North American and in Western Europe, which was accompanied by decreased AWE. Reduction of AOD there was mainly due to a decreased frequency of high AOD events and an increased frequency of background AOD events. In addition, decreased AOD values for high AOD events also accounted for ∼ 16–32% of the AOD reduction. This is indicative of significant meteorological effects on AOD variability. AOD trends in other regions were marginal and most were not significant; however, AOD increased significantly at one site in the Sahel and another in Saudi Arabia, predominantly due to the increased frequency of high AOD events and their average AOD.
Directory of Open Access Journals (Sweden)
Amy eWaldman
2011-11-01
Full Text Available The Optic Neuritis Treatment Trial and subsequent studies have had a tremendous impact on the treatment and prognosis of optic neuritis and multiple sclerosis in adults. The results of these studies have been extrapolated to children; however, pediatric data are sparse. Using the method of prospective preference assessment, the willingness of parents and medical professionals to enroll children in a hypothetical Pediatric Optic Neuritis Treatment Trial was assessed using a mock consent form and questionnaire. A 3-arm trial was proposed: 1 intravenous corticosteroids, 2 high-dose oral corticosteroids, and 3 an oral placebo. The forms were completed by 198 parents and 49 physicians. After reviewing the hypothetical scenario, trial design, risks and benefits, and alternatives to the study, 21% of parents would enroll their children in the trial whereas 98% of medical professionals would enroll their patients. With medical professional recommendation, 43% of parents would enroll their children. The manner in which this hypothetical trial was presented to parents, specifically with respect to the recommendation of their child’s health care team, influenced a parent’s willingness to participate.
Seoul, Keep Your Paddies! Implications for the Conservation of Hylid Species
Directory of Open Access Journals (Sweden)
Borzee, Amael
2015-07-01
Full Text Available Biodiversity is plummeting worldwide, and the major causes of such decline include habitat degradation and climate change. While cities do contribute to the negative impact to the environment, they can also serve as strategic centres for conservation programs. Sites qualifying as biogeographic islands within metropolitan Seoul were studied for the occurrence of two hylid species: the endangered Hyla suweonensis and the abundant H. japonica. This study demonstrates that neither habitat diversity nor surface area, but solely the occurrence of aggregated rice paddies is a requisite for H. suweonensis, hypothetically due to its strict breeding requirements. On the contrary, H. japonica occurrence was not affected by any of these factors, and all types of habitats studied were adequate for this species. The presence of an endangered species within the boundaries of one of the most populated metropolises suggests a strong natural resilience, which should be enhanced with appropriate actions. We emphasize that the management plans therein can, and should, be used as the first step in the conservation of H. suweonensis in metropolitan Seoul.
Kreitler, Jason R.; Stoms, David M.; Davis, Frank W.
2014-01-01
Quantitative methods of spatial conservation prioritization have traditionally been applied to issues in conservation biology and reserve design, though their use in other types of natural resource management is growing. The utility maximization problem is one form of a covering problem where multiple criteria can represent the expected social benefits of conservation action. This approach allows flexibility with a problem formulation that is more general than typical reserve design problems, though the solution methods are very similar. However, few studies have addressed optimization in utility maximization problems for conservation planning, and the effect of solution procedure is largely unquantified. Therefore, this study mapped five criteria describing elements of multifunctional agriculture to determine a hypothetical conservation resource allocation plan for agricultural land conservation in the Central Valley of CA, USA. We compared solution procedures within the utility maximization framework to determine the difference between an open source integer programming approach and a greedy heuristic, and find gains from optimization of up to 12%. We also model land availability for conservation action as a stochastic process and determine the decline in total utility compared to the globally optimal set using both solution algorithms. Our results are comparable to other studies illustrating the benefits of optimization for different conservation planning problems, and highlight the importance of maximizing the effectiveness of limited funding for conservation and natural resource management.
Wang, Zhe
2010-10-01
We report superconducting resistive transition characteristics for array(s) of coupled 4-Angstrom single wall carbon nanotubes embedded in aluminophosphate-five zeolite. The transition was observed to initiate at 15 K with a slow resistance decrease switching to a sharp, order of magnitude drop between 7.5 and 6.0 K with strong (anisotropic) magnetic field dependence. Both the sharp resistance drop and its attendant nonlinear IV characteristics are consistent with the manifestations of a Berezinskii-Kosterlitz-Thouless transition that establishes quasi long range order in the plane transverse to the c-axis of the nanotubes, leading to an inhomogeneous system comprising 3D superconducting regions connected by weak links. Global coherence is established at below 5 K with the appearance of a well-defined supercurrent gap/low resistance region at 2 K. © 2010 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
Ryan G Drum
Full Text Available Grassland bird habitat has declined substantially in the United States. Remaining grasslands are increasingly fragmented, mostly privately owned, and vary greatly in terms of habitat quality and protection status. A coordinated strategic response for grassland bird conservation is difficult, largely due to the scope and complexity of the problem, further compounded by biological, sociological, and economic uncertainties. We describe the results from a collaborative Structured Decision Making (SDM workshop focused on linking social and economic drivers of landscape change to grassland bird population outcomes. We identified and evaluated alternative strategies for grassland bird conservation using a series of rapid prototype models. We modeled change in grassland and agriculture cover in hypothetical landscapes resulting from different landowner decisions in response to alternative socio-economic conservation policy decisions. Resulting changes in land cover at all three stages of the annual cycle (breeding, wintering, and migration were used to estimate changes in grassland bird populations. Our results suggest that successful grassland bird conservation may depend upon linkages with ecosystem services on working agricultural lands and grassland-based marketing campaigns to engage the public. With further development, spatial models that link landowner decisions with biological outcomes can be essential tools for making conservation policy decisions. A coordinated non-traditional partnership will likely be necessary to clearly understand and systematically respond to the many conservation challenges facing grassland birds.
Drum, Ryan G.; Ribic, Christine; Koch, Katie; Lonsdorf, Eric V.; Grant, Edward C.; Ahlering, Marissa; Barnhill, Laurel; Dailey, Thomas; Lor, Socheata; Mueller, Connie; Pavlacky, D.C.; Rideout, Catherine; Sample, David W.
2015-01-01
Grassland bird habitat has declined substantially in the United States. Remaining grasslands are increasingly fragmented, mostly privately owned, and vary greatly in terms of habitat quality and protection status. A coordinated strategic response for grassland bird conservation is difficult, largely due to the scope and complexity of the problem, further compounded by biological, sociological, and economic uncertainties. We describe the results from a collaborative Structured Decision Making (SDM) workshop focused on linking social and economic drivers of landscape change to grassland bird population outcomes. We identified and evaluated alternative strategies for grassland bird conservation using a series of rapid prototype models. We modeled change in grassland and agriculture cover in hypothetical landscapes resulting from different landowner decisions in response to alternative socio-economic conservation policy decisions. Resulting changes in land cover at all three stages of the annual cycle (breeding, wintering, and migration) were used to estimate changes in grassland bird populations. Our results suggest that successful grassland bird conservation may depend upon linkages with ecosystem services on working agricultural lands and grassland-based marketing campaigns to engage the public. With further development, spatial models that link landowner decisions with biological outcomes can be essential tools for making conservation policy decisions. A coordinated non-traditional partnership will likely be necessary to clearly understand and systematically respond to the many conservation challenges facing grassland birds.
Can a Repeated Opt-Out Reminder mitigate hypothetical bias in discrete choice experiments?
DEFF Research Database (Denmark)
Alemu, Mohammed Hussen; Olsen, Søren Bøye
2018-01-01
In this paper, we test whether a Repeated Opt-Out Reminder (ROOR) can mitigate hypothetical bias in stated discrete choice experiments (DCE). The data originate from a field experiment concerning consumer preferences for a novel food product made from cricket flour. Utilising a between...
International Nuclear Information System (INIS)
Wider, H.; Cametti, J.; Clusaz, A.; Devos, J.; VanGoethem, G.; Nguyen, H.; Sola, A.
1985-01-01
One aspect of fast reactor safety analysis consists of calculating the strongly coupled system of physical phenomena which contribute to the reactivity balance in hypothetical whole-core accidents: these phenomena are neutronics, fuel behaviour and heat transfer together with coolant thermohydraulics in single- and two-phase flow. Temperature variations in fuel, coolant and neighbouring structures induce, in fact, thermal reactivity feedbacks which are added up and put in the neutronics calculation to predict the neutron flux and the subsequent heat generation in the reactor. At this point a whole-core analysis code is necessary to examine for any hypothetical transient whether the various feedbacks result effectively in a negative balance, which is the basis condition to ensure stability and safety. The European Accident Code (EAC), developed at the Joint Research Centre of the CEC at Ispra (Italy), fulfills this objective. It is a modular informatics structure (quasi 2-D multichannel approach) aimed at collecting stand-alone computer codes of neutronics, fuel pin mechanics and hydrodynamics, developed both in national laboratories and in the JRC itself. EAC makes these modules interact with each other and produces results for these hypothetical accidents in terms of core damage and total energy release. 10 refs
Hypothetical Case and Scenario Description for International Transportation of Spent Nuclear Fuel.
Energy Technology Data Exchange (ETDEWEB)
Williams, Adam David [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Osborn, Douglas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jones, Katherine A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kalinina, Elena Arkadievna [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Cohn, Brian [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Thomas, Maikael A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Parks, Mancel Jordan [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Parks, Ethan Rutledge [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mohagheghi, Amir H. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-12-01
To support more rigorous analysis on global security issues at Sandia National Laboratories (SNL), there is a need to develop realistic data sets without using "real" data or identifying "real" vulnerabilities, hazards or geopolitically embarrassing shortcomings. In response, an interdisciplinary team led by subject matter experts in SNL's Center for Global Security and Cooperation (CGSC) developed a hypothetical case description. This hypothetical case description assigns various attributes related to international SNF transportation that are representative, illustrative and indicative of "real" characteristics of "real" countries. There is no intent to identify any particular country and any similarity with specific real-world events is purely coincidental. To support the goal of this report to provide a case description (and set of scenarios of concern) for international SNF transportation inclusive of as much "real-world" complexity as possible -- without crossing over into politically sensitive or classified information -- this SAND report provides a subject matter expert-validated (and detailed) description of both technical and political influences on the international transportation of spent nuclear fuel. [PAGE INTENTIONALLY LEFT BLANK
Energy Technology Data Exchange (ETDEWEB)
Huston, E.E.; Grammer, J.C.; Yount, R.G.
1988-12-13
Previous experiments demonstrated that two thiols of skeletal myosin subfragment 1 (SF/sub 1/) could be oxidized to a disulfide bond by treatment with a 2-fold excess of 5,5'-dithiobis (2-nitrobenzoic acid) (DTNB) in the presence of MgADP. The resulting characteristic changes in the ATPase activities of SF/sub 1/ and the fact that MgADP was stably trapped at the active site, suggested that the two thiols cross-linked were SH/sub 1/ (Cys-707) and SH/sub 2/ (Cys-697) from the myosin heavy chain. To verify this suggestion, SF/sub 1/, after DTNB treatment as above, was treated with an excess of N-ethylmaleimide to block all accessible thiols. The single protein disulfide produced by DTNB oxidation was reduced with dithioerythritol and the modified SF/sub 1/ internally cross-linked with equimolar (/sup 14/C)p-phenylenedimaleimide (pPDM) in the presence of MgADP. After extensive trypsinization, the major /sup 14/C-labeled peptide was isolated, characterized, and shown to be Cys-Asn-Gly-Val-Leu-Gly-Ile-Arg-Ile-Cys-Arg, in which the two cysteines were cross-linked by pPDM. This peptide is known to contain SH/sub 2/ and SH/sub 1/ in this order and to come from residues 697-708 in the rabbit skeletal myosin heavy chain. Parallel experiments with (/sup 14/C)pPDM and unmodified SF/sub 1/ similar to those above gave an identical SH/sub 1/, SH/sub 2/ tryptic peptide, verifying earlier labeling results. These combined results demonstrate that SH/sub 1/ and SH/sub 2/ cross-linked by pPDM (12-13 /Angstrom/, S to S) or by oxidation with DTNB (2 /Angstrom/, S to S) can move a minimum of 10 /Angstrom/ under the influence of nucleotide binding. Because these residues are separated by only nine amino acids in the primary sequence, this small section of the heavy chain must possess extraordinary flexibility.
NCBI nr-aa BLAST: CBRC-HSAP-07-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-07-0021 ref|YP_798483.1| hypothetical protein LBL_2137 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801392.1| hypothetical protein LBJ_2143 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79550.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76634.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798483.1 0.026 28% ...
NCBI nr-aa BLAST: CBRC-OCUN-01-1280 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-1280 ref|YP_798310.1| hypothetical protein LBL_1947 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801037.1| hypothetical protein LBJ_1728 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79377.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76279.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798310.1 4.1 31% ...
Analysis of initial events following hypothetical criticality of a transport flask
International Nuclear Information System (INIS)
Barbry, F.; Bonhomme, C.; Brown, M.L.; Hague, P.; Mather, D.J.; Shaw, P.M.
1984-01-01
This report deals with the estimation of possible consequences, eg energy release, temperatures reached etc, of such a hypothetical accident in a particular notional transport package design. This particular study examines the situation if criticality occurs during unloading or refilling of a PWR flask. In the first instance, an idealised model has been chosen in order to develop the calculational techniques; it is not initself a realistic accident representation
Willingness to pay for three hypothetical malaria vaccines in Nigeria.
Udezi, Waka Anthony; Usifoh, Cyril Odianose; Ihimekpen, Omoyeme Oluwatosin
2010-08-01
Unlike some African countries that have reported a approximately 50% reduction in malaria deaths in recent years, Nigeria has shown no evidence of a systematic decline in malaria burden. An important and sustainable reduction in malaria burden cannot be achieved unless an effective and inexpensive malaria vaccine becomes available. The goals of this study were to determine the willingness to pay (WTP) for 3 hypothetical malaria vaccines with different levels of protection (in years), effectiveness, and adverse effects; and to identify factors that influence the price that people are willing to pay in Nigeria. With the aid of a questionnaire, a contingent valuation method using payment cards was used to elicit WTP values for 3 hypothetical malaria vaccines. Payment cards contained both a description of the features of the vaccine being evaluated and price options. The 3 hypothetical vaccines had the following characteristics: vaccine A was 75% effective, protected for 3 years, and was well tolerated; vaccine B was 85% effective, protected for 6 years, and was less well tolerated than vaccine A; and vaccine C was 95% effective and protected for 12 years, but was the least well tolerated. Participants consisted of a convenience sample of individuals who were at the pharmacy waiting area of the state-owned hospitals located in Benin City and Warri, Nigeria. Every third patient or caregiver who was in the pharmacy to fill a prescription was asked to take part in the study as they waited to see the pharmacist. If consent was not granted, the next person in line was approached to be interviewed. Linear multiple regression analysis and nonparametric Kruskal-Wallis, Mann-Whitney, or chi(2) test was applied in inferential analysis, where necessary, to investigate the effects of sociodemographic factors on WTP. Prices on payment cards were expressed in Nigerian naira (NGN 150.00 approximately US $1.00), but study results were expressed in US dollars. A total of 359
International Nuclear Information System (INIS)
Meyer, P.D.
1993-12-01
This report provides an analysis of infiltration and percolation at a hypothetical low-level waste (LLW) disposal facility was carried out. The analysis was intended to illustrate general issues of concern in assessing the performance of LLW disposal facilities. Among the processes considered in the analysis were precipitation, runoff, information, evaporation, transpiration, and redistribution. The hypothetical facility was located in a humid environment characterized by frequent and often intense precipitation events. The facility consisted of a series of concrete vaults topped by a multilayer cover. Cover features included a sloping soil surface to promote runoff, plant growth to minimize erosion and promote transportation, a sloping clay layer, and a sloping capillary barrier. The analysis within the root zone was carried out using a one-dimensional, transient simulation of water flow. Below the root zone, the analysis was primarily two-dimensional and steady-state
NCBI nr-aa BLAST: CBRC-EEUR-01-1367 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-EEUR-01-1367 ref|XP_001566741.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM40257.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001566741.1 1.0 26% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-0258 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-0258 ref|XP_001568170.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM43274.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001568170.1 2.3 27% ...
NCBI nr-aa BLAST: CBRC-MDOM-03-0050 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-03-0050 ref|ZP_04755880.1| hypothetical protein FphipA2_06026 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249544.1| conserved hypothetical protein [Francisella philo...miragia subsp. philomiragia ATCC 25015] gb|EET21269.1| conserved hypothetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] ZP_04755880.1 0.048 28% ...
NCBI nr-aa BLAST: CBRC-DDIS-05-0136 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-05-0136 ref|XP_001569189.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM44328.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001569189.1 1e-26 29% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-2711 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-BTAU-01-2711 ref|XP_001568632.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM43752.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001568632.1 6e-17 29% ...
NCBI nr-aa BLAST: CBRC-PABE-20-0089 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PABE-20-0089 ref|XP_001568148.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM43250.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001568148.1 4e-08 29% ...
NCBI nr-aa BLAST: CBRC-MMUS-01-0068 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUS-01-0068 ref|XP_001568148.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM43250.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001568148.1 4e-14 29% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0977 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0977 ref|XP_001568632.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM43752.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001568632.1 1e-11 28% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-3332 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-3332 ref|XP_001568148.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM43250.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001568148.1 1e-32 27% ...
NCBI nr-aa BLAST: CBRC-CELE-05-0449 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CELE-05-0449 ref|XP_001568148.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM43250.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001568148.1 3e-25 48% ...
NCBI nr-aa BLAST: CBRC-PABE-08-0005 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PABE-08-0005 ref|XP_001568632.1| hypothetical protein, conserved [Leishmania brazil...iensis] emb|CAM43752.1| hypothetical protein, conserved [Leishmania braziliensis] XP_001568632.1 1e-09 30% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0103 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0103 ref|YP_001678281.1| hypothetical protein Fphi_1554 [Francisella philomiragia subsp. philo...miragia ATCC 25017] ref|ZP_04755921.1| hypothetical protein FphipA2_06231 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249586.1| conserved hypothetical protein [Francisella philo...ical membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gb|EET21311.1| conserved hyp...othetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] YP_001678281.1 0.012 24% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0519 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0519 ref|YP_001678281.1| hypothetical protein Fphi_1554 [Francisella philomiragia subsp. philo...miragia ATCC 25017] ref|ZP_04755921.1| hypothetical protein FphipA2_06231 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249586.1| conserved hypothetical protein [Francisella philo...ical membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gb|EET21311.1| conserved hyp...othetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] YP_001678281.1 0.11 25% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-1354 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-1354 ref|YP_001678281.1| hypothetical protein Fphi_1554 [Francisella philomiragia subsp. philo...miragia ATCC 25017] ref|ZP_04755921.1| hypothetical protein FphipA2_06231 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249586.1| conserved hypothetical protein [Francisella philo...ical membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gb|EET21311.1| conserved hyp...othetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] YP_001678281.1 0.062 22% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0280 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0280 ref|YP_001678281.1| hypothetical protein Fphi_1554 [Francisella philomiragia subsp. philo...miragia ATCC 25017] ref|ZP_04755921.1| hypothetical protein FphipA2_06231 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249586.1| conserved hypothetical protein [Francisella philo...ical membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gb|EET21311.1| conserved hyp...othetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] YP_001678281.1 0.028 24% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0528 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0528 ref|YP_001678281.1| hypothetical protein Fphi_1554 [Francisella philomiragia subsp. philo...miragia ATCC 25017] ref|ZP_04755921.1| hypothetical protein FphipA2_06231 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249586.1| conserved hypothetical protein [Francisella philo...ical membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gb|EET21311.1| conserved hyp...othetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] YP_001678281.1 0.039 24% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0560 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0560 ref|YP_001678281.1| hypothetical protein Fphi_1554 [Francisella philomiragia subsp. philo...miragia ATCC 25017] ref|ZP_04755921.1| hypothetical protein FphipA2_06231 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249586.1| conserved hypothetical protein [Francisella philo...ical membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gb|EET21311.1| conserved hyp...othetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] YP_001678281.1 0.14 21% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0973 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0973 ref|YP_001678281.1| hypothetical protein Fphi_1554 [Francisella philomiragia subsp. philo...miragia ATCC 25017] ref|ZP_04755921.1| hypothetical protein FphipA2_06231 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249586.1| conserved hypothetical protein [Francisella philo...ical membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gb|EET21311.1| conserved hyp...othetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] YP_001678281.1 0.041 21% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0552 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0552 ref|YP_001678281.1| hypothetical protein Fphi_1554 [Francisella philomiragia subsp. philo...miragia ATCC 25017] ref|ZP_04755921.1| hypothetical protein FphipA2_06231 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249586.1| conserved hypothetical protein [Francisella philo...ical membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gb|EET21311.1| conserved hyp...othetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] YP_001678281.1 0.022 20% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0021 ref|YP_001678281.1| hypothetical protein Fphi_1554 [Francisella philomiragia subsp. philo...miragia ATCC 25017] ref|ZP_04755921.1| hypothetical protein FphipA2_06231 [Francisella philo...miragia subsp. philomiragia ATCC 25015] ref|ZP_05249586.1| conserved hypothetical protein [Francisella philo...ical membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gb|EET21311.1| conserved hyp...othetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] YP_001678281.1 0.23 23% ...
Interpersonal deviance and consequent social impact in hypothetically schizophrenia-prone men.
Zborowski, M J; Garske, J P
1993-08-01
Interpersonal deviance is central to the theory of and research on schizotypal psychopathology. The present study investigated interpersonal deviance and its corresponding impact among hypothetically schizotypic, or schizophrenia-prone, men, defined by high scores on the Perceptual Aberration-Magical Ideation (Per-Mag) Scale. In a videotaped interview, high-scoring Ss relative to control Ss were rated as more odd (p scale and suggest that interpersonal factors may influence the eventual adjustment of high-scoring individuals.
Peters, Katrin; Dudkina, Natalya V.; Jaensch, Lothar; Braun, Hans-Peter; Boekema, Egbert J.; Jänsch, Lothar
The projection structures of complex I and the I+III2 supercomplex from the C-4 plant Zea mays were determined by electron microscopy and single particle image analysis to a resolution of up to 11 angstrom. Maize complex I has a typical L-shape. Additionally, it has a large hydrophilic, extra-domain
Analysis of hypothetical LMFBR whole-core accidents in the USA
International Nuclear Information System (INIS)
Ferguson, D.R.; Deitrich, L.W.; Brown, N.W.; Waltar, A.E.
1978-01-01
The issue of hypothetical whole-core accidents continues to play a significant role in assessment of the potential risk to the public associated with LMFBR operation in the USA. The paper briefly characterizes the changing nature of this role, with emphasis on the current risk-oriented perspective. It then describes the models and codes used for accident analysis in the USA which have been developed under DOE sponsorship and summarizes some specific applications of the codes to the current generation of fast reactors. An assessment of future trends in this area concludes the paper
NCBI nr-aa BLAST: CBRC-AGAM-03-0017 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-AGAM-03-0017 ref|ZP_01512956.1| conserved hypothetical protein [Burkholderia phytofirm...ans PsJN] gb|EAV02438.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN] ZP_01512956.1 0.070 25% ...
NCBI nr-aa BLAST: CBRC-DSIM-02-0067 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-02-0067 ref|ZP_00538033.1| conserved hypothetical protein [Exiguobacterium sibi...ricum 255-15] gb|EAM88856.1| conserved hypothetical protein [Exiguobacterium sibiricum 255-15] ZP_00538033.1 2.9 36% ...
NCBI nr-aa BLAST: CBRC-DYAK-01-0020 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DYAK-01-0020 ref|ZP_02017389.1| conserved hypothetical protein [Methylobacterium extorque...ns PA1] gb|EDN55077.1| conserved hypothetical protein [Methylobacterium extorquens PA1] ZP_02017389.1 2.0 31% ...
NCBI nr-aa BLAST: CBRC-PCAP-01-1406 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-1406 ref|XP_001213293.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU35917.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001213293.1 0.97 28% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-2770 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2770 ref|XP_001208647.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU38039.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001208647.1 8.7 27% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-1000 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-1000 ref|XP_001215926.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU33292.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001215926.1 0.54 32% ...
NCBI nr-aa BLAST: CBRC-GACU-03-0029 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-03-0029 ref|XP_001216777.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU31329.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001216777.1 3.1 39% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0231 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0231 ref|XP_001209722.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU32420.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001209722.1 0.48 31% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-2657 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-BTAU-01-2657 ref|XP_001214433.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU34324.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001214433.1 0.46 34% ...
NCBI nr-aa BLAST: CBRC-TBEL-01-0313 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TBEL-01-0313 ref|XP_001213187.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU35811.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001213187.1 6.7 43% ...
NCBI nr-aa BLAST: CBRC-OSAT-04-0037 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OSAT-04-0037 ref|XP_001215089.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU33672.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001215089.1 0.019 28% ...
NCBI nr-aa BLAST: CBRC-PTRO-01-0109 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PTRO-01-0109 ref|XP_001218166.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU29735.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001218166.1 0.007 31% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0740 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0740 ref|XP_001217896.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU30411.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001217896.1 0.82 29% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0164 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0164 ref|XP_001209232.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU38624.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001209232.1 1.5 24% ...
NCBI nr-aa BLAST: CBRC-DSIM-01-0068 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DSIM-01-0068 ref|XP_001215680.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU33046.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001215680.1 4.4 30% ...
NCBI nr-aa BLAST: CBRC-CBRE-01-0099 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CBRE-01-0099 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.60 31% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...
Comparison of the hypothetical (57)Co brachytherapy source with the (192)Ir source.
Toossi, Mohammad Taghi Bahreyni; Ghorbani, Mahdi; Rostami, Atefeh; Khosroabadi, Mohsen; Khademi, Sara; Knaup, Courtney
2016-01-01
The (57)Co radioisotope has recently been proposed as a hypothetical brachytherapy source due to its high specific activity, appropriate half-life (272 days) and medium energy photons (114.17 keV on average). In this study, Task Group No. 43 dosimetric parameters were calculated and reported for a hypothetical (57)Co source. A hypothetical (57)Co source was simulated in MCNPX, consisting of an active cylinder with 3.5 mm length and 0.6 mm radius encapsulated in a stainless steel capsule. Three photon energies were utilized (136 keV [10.68%], 122 keV [85.60%], 14 keV [9.16%]) for the (57)Co source. Air kerma strength, dose rate constant, radial dose function, anisotropy function, and isodose curves for the source were calculated and compared to the corresponding data for a (192)Ir source. The results are presented as tables and figures. Air kerma strength per 1 mCi activity for the (57)Co source was 0.46 cGyh(-1) cm 2 mCi(-1). The dose rate constant for the (57)Co source was determined to be 1.215 cGyh(-1)U(-1). The radial dose function for the (57)Co source has an increasing trend due to multiple scattering of low energy photons. The anisotropy function for the (57)Co source at various distances from the source is more isotropic than the (192)Ir source. The (57)Co source has advantages over (192)Ir due to its lower energy photons, longer half-life, higher dose rate constant and more isotropic anisotropic function. However, the (192)Ir source has a higher initial air kerma strength and more uniform radial dose function. These properties make (57)Co a suitable source for use in brachytherapy applications.
Energy Technology Data Exchange (ETDEWEB)
Sohrabi, M.; Ghasemi, M.; Amrollahi, R.; Khamooshi, C.; Parsouzi, Z. [Amirkabir University of Technology, Health Physics and Dosimetry Research Laboratory, Department of Physics, Tehran (Iran, Islamic Republic of)
2013-05-15
Unit-1 of the Bushehr nuclear power plant (BNPP-1) is a VVER-type reactor with 1,000-MWe power constructed near Bushehr city at the coast of the Persian Gulf, Iran. The reactor has been recently operational to near its full power. The radiological impact of nuclear power plant (NPP) accidents is of public concern, and the assessment of radiological consequences of any hypothetical nuclear accident on public exposure is vital. The hypothetical accident scenario considered in this paper is a design-basis accident, that is, a primary coolant leakage to the secondary circuit. This scenario was selected in order to compare and verify the results obtained in the present paper with those reported in the Final Safety Analysis Report (FSAR 2007) of the BNPP-1 and to develop a well-proven methodology that can be used to study other and more severe hypothetical accident scenarios for this reactor. In the present study, the version 2.01 of the PC COSYMA code was applied. In the early phase of the accidental releases, effective doses (from external and internal exposures) as well as individual and collective doses (due to the late phase of accidental releases) were evaluated. The surrounding area of the BNPP-1 within a radius of 80 km was subdivided into seven concentric rings and 16 sectors, and distribution of population and agricultural products was calculated for this grid. The results show that during the first year following the modeled hypothetical accident, the effective doses do not exceed the limit of 5 mSv, for the considered distances from the BNPP-1. The results obtained in this study are in good agreement with those in the FSAR-2007 report. The agreement obtained is in light of many inherent uncertainties and variables existing in the two modeling procedures applied and proves that the methodology applied here can also be used to model other severe hypothetical accident scenarios of the BNPP-1 such as a small and large break in the reactor coolant system as well
Potential radiological exposure rates resulting from hypothetical dome failure at Tank W-10
International Nuclear Information System (INIS)
1994-07-01
The main plant area at Oak Ridge National Laboratory (ORNL) contains 12 buried Gunite tanks that were used for the storage and transfer of liquid radioactive waste. Although the tanks are no longer in use, they are known to contain some residual contaminated sludges and liquids. In the event of an accidental tank dome failure, however unlikely, the liquids, sludges, and radioactive contaminants within the tank walls themselves could create radiation fields and result in above-background exposures to workers nearby. This Technical Memorandum documents a series of calculations to estimate potential radiological exposure rates and total exposures to workers in the event of a hypothetical collapse of a Gunite tank dome. Calculations were performed specifically for tank W-10 because it contains the largest radioactivity inventory (approximately half of the total activity) of all the Gunite tanks. These calculations focus only on external, direct gamma exposures for prescribed, hypothetical exposure scenarios and do not address other possible tank failure modes or routes of exposure. The calculations were performed with established, point-kernel gamma ray modeling codes
Johnson, H D; LaVoie, J C; Eggenburg, E; Mahoney, M A; Pounds, L
2001-10-01
The advantages of using hypothetical situations are one reason they have been widely used to examine adolescents' responses to conflict situations. One frequently used research protocol involves presenting several conflict scenarios to participants during a single session. However, in real-life situations multiple conflicts rarely occur within short periods of time, and the nature of this presentation may be associated with changes in adolescents' reports of conflict behaviors. Trend analyses of emotional, conflict goal, and conflict tactic responses from grade 8, 10, 12, and college students to consecutively presented conflict situations showed that responses were associated with presentation of the hypothetical situations. Findings revealed an increase in reports of assertive conflict behaviors and a decrease in reports of constructive conflict behaviors with successive situation presentation. Results from the current study suggest that researchers must consider trends in responses when examining findings from successive situation presentation methodologies because adolescent reports of conflict behavior may change as situation presentation proceeds. Copyright 2001 The Association for Professionals in Services for Adolescents.
Potential radiological exposure rates resulting from hypothetical dome failure at Tank W-10
Energy Technology Data Exchange (ETDEWEB)
1994-07-01
The main plant area at Oak Ridge National Laboratory (ORNL) contains 12 buried Gunite tanks that were used for the storage and transfer of liquid radioactive waste. Although the tanks are no longer in use, they are known to contain some residual contaminated sludges and liquids. In the event of an accidental tank dome failure, however unlikely, the liquids, sludges, and radioactive contaminants within the tank walls themselves could create radiation fields and result in above-background exposures to workers nearby. This Technical Memorandum documents a series of calculations to estimate potential radiological exposure rates and total exposures to workers in the event of a hypothetical collapse of a Gunite tank dome. Calculations were performed specifically for tank W-10 because it contains the largest radioactivity inventory (approximately half of the total activity) of all the Gunite tanks. These calculations focus only on external, direct gamma exposures for prescribed, hypothetical exposure scenarios and do not address other possible tank failure modes or routes of exposure. The calculations were performed with established, point-kernel gamma ray modeling codes.
NCBI nr-aa BLAST: CBRC-DMEL-02-0082 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0082 ref|ZP_01510105.1| conserved hypothetical protein [Burkholderia phytofirm...ans PsJN] gb|EAV05658.1| conserved hypothetical protein [Burkholderia phytofirmans PsJN] ZP_01510105.1 5e-08 25% ...
NCBI nr-aa BLAST: CBRC-OSAT-04-0001 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OSAT-04-0001 ref|ZP_02021447.1| conserved hypothetical protein [Methylobacterium extorque...ns PA1] gb|EDN51662.1| conserved hypothetical protein [Methylobacterium extorquens PA1] ZP_02021447.1 8e-05 30% ...
NCBI nr-aa BLAST: CBRC-DDIS-03-0039 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-03-0039 ref|XP_001209647.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU32345.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001209647.1 2e-30 37% ...
NCBI nr-aa BLAST: CBRC-DDIS-06-0058 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-06-0058 ref|XP_001216414.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU32055.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001216414.1 4e-75 44% ...
NCBI nr-aa BLAST: CBRC-DDIS-03-0055 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-03-0055 ref|XP_001211162.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU36946.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001211162.1 1e-10 22% ...
NCBI nr-aa BLAST: CBRC-FRUB-02-0883 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-FRUB-02-0883 ref|ZP_01184818.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR75842.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01184818.1 4e-58 59% ...
NCBI nr-aa BLAST: CBRC-OLAT-20-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OLAT-20-0021 ref|ZP_01185507.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR75137.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01185507.1 3e-27 45% ...
NCBI nr-aa BLAST: CBRC-DDIS-02-0008 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DDIS-02-0008 ref|ZP_00515102.1| conserved hypothetical protein [Crocosphaera watson...ii WH 8501] gb|EAM51937.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501] ZP_00515102.1 5e-10 32% ...
Hanford groundwater transport estimates for hypothetical radioactive waste incidents
International Nuclear Information System (INIS)
Arnett, R.C.; Brown, D.J.; Baca, R.G.
1977-06-01
This report presents an analysis of the impact of subsurface contamination resulting from a series of hypothetical leaks or accidents involving Hanford high-level radioactive defense waste. Estimates of the amounts and concentrations of radionuclides reaching the Columbia River through the Hanford unconfined aquifer flow path were obtained by means of predictive models. The results of the study showed that the spatially averaged concentrations of 99 Tc, 3 H, and 106 Ru in the ground water as it discharges into the Columbia River are at all times far below the respective ERDA Manual Chapter 0524 Concentration Guides for uncontrolled areas. Upon entering the Columbia River, additional large dilutions of the water containing trace quantities of contaminants will occur
Nuclear Reactor RA Safety Report, Vol. 16, Maximum hypothetical accident
International Nuclear Information System (INIS)
1986-11-01
Fault tree analysis of the maximum hypothetical accident covers the basic elements: accident initiation, phase development phases - scheme of possible accident flow. Cause of the accident initiation is the break of primary cooling pipe, heavy water system. Loss of primary coolant causes loss of pressure in the primary circuit at the coolant input in the reactor vessel. This initiates safety protection system which should automatically shutdown the reactor. Separate chapters are devoted to: after-heat removal, coolant and moderator loss; accident effects on the reactor core, effects in the reactor building, and release of radioactive wastes [sr
NCBI nr-aa BLAST: CBRC-OCUN-01-1138 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-1138 ref|ZP_01462700.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU66540.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01462700.1 2e-04 25% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...
NCBI nr-aa BLAST: CBRC-AGAM-01-0080 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-AGAM-01-0080 ref|ZP_01467057.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU62171.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01467057.1 4e-06 30% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-2878 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2878 ref|ZP_01460012.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69116.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01460012.1 3.2 36% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-3254 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-3254 ref|ZP_01462094.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU67090.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01462094.1 3e-07 26% ...
NCBI nr-aa BLAST: CBRC-OANA-01-2012 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OANA-01-2012 ref|ZP_01465587.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU63646.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01465587.1 0.73 40% ...
NCBI nr-aa BLAST: CBRC-OCUN-01-0401 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-0401 ref|ZP_01467058.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU62172.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01467058.1 0.003 26% ...
NCBI nr-aa BLAST: CBRC-MDOM-03-0382 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MDOM-03-0382 ref|ZP_01466460.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU62763.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01466460.1 0.010 27% ...
NCBI nr-aa BLAST: CBRC-OCUN-01-1138 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-1138 ref|ZP_01467057.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU62171.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01467057.1 0.001 27% ...
Why do people donate to conservation? Insights from a 'real world' campaign.
Veríssimo, Diogo; Campbell, Hamish A; Tollington, Simon; MacMillan, Douglas C; Smith, Robert J
2018-01-01
Non-governmental organisations (NGOs) play a key role in biodiversity conservation. The majority of these organisations rely on public donations to fund their activities, and therefore fundraising success is a determinant of conservation outcomes. In spite of this integral relationship, the key principals for fundraising success in conservation are still guided by expert opinion and anecdotal evidence, with very few quantitative studies in the literature. Here we assessed the behaviour of monetary donors across twenty-five different species-focused conservation campaigns organised by an NGO conservation and environmental society. The Australian Geographic Society (AGS) carried out fundraising campaigns over a five and half year period using an identical methodology in thirty-four of its country-wide network of outlet shops. AGS owns and operates these shops that sell toys and games related to science and nature. We tested how the following factors influenced monetary donations from members of the public:1) campaign duration, 2) appeal and familiarity of species, 3) species geographic distribution relative to the fundraising location, 4) level of income and education of potential donors, 5) age and gender profile of potential donors. Contrary to past research, we found most of these factors did not significantly influence the amount of donations made to each campaign by members of the public. Larger animals did elicit a significantly higher amount donated per transaction than smaller animals, as did shops located in poorer neighbourhoods. Our study findings contrast with past research that has focused largely on hypothetical donations data collected via surveys, and demonstrates the complexity and case-specific nature of relationships between donor characteristics and spending patterns. The study highlights the value of assessing real-world fundraising campaigns, and illustrates how collaboration between academia and NGOs could be used to better tailor fundraising
BOLD responses in reward regions to hypothetical and imaginary monetary rewards.
Miyapuram Krishna P; Tobler Philippe N; Gregorios-Pippas Lucy; Schultz Wolfram
2012-01-01
Monetary rewards are uniquely human. Because money is easy to quantify and present visually, it is the reward of choice for most fMRI studies, even though it cannot be handed over to participants inside the scanner. A typical fMRI study requires hundreds of trials and thus small amounts of monetary rewards per trial (e.g. 5p) if all trials are to be treated equally. However, small payoffs can have detrimental effects on performance due to their limited buying power. Hypothetical monetary rewa...
U.S. Adult Interest in Less Harmful and Less Addictive Hypothetical Modified Risk Tobacco Products.
O'Brien, Erin Keely; Persoskie, Alexander; Parascandola, Mark; Hoffman, Allison C
2017-09-28
Tobacco companies have a history of making health claims about their new products. Such claims are now regulated by the U.S. Food and Drug Administration. We examined consumer interest in hypothetical modified risk tobacco products (MRTPs) among current, former and never established smokers, and examined whether interest was associated with beliefs about tobacco and cancer. Data were analyzed from the U.S. nationally representative 2015 Health Information National Trends Survey (HINTS-FDA 2015; N = 3,738). Interest in hypothetical MRTPs was assessed by asking participants their likelihood of using tobacco products claiming to be less addictive and less harmful than other products. About half of current smokers and a tenth of both former and never smokers reported they were "somewhat" or "very" likely to try hypothetical MRTPs claiming to be less harmful or less addictive. Female smokers, former smokers with lower smoking harm perceptions, and never smokers who are young adults or without college education expressed more interest in these products. Interest in using these products was positively associated with believing that smoking status is a changeable individual characteristic and that it is possible for tobacco products to be made without some harmful chemicals. We identified several subgroups of current, former, and never smokers who may be particularly affected by the marketing of MRTPs and therefore important to study to inform models of the potential population health impact of authorizing the marketing of MRTPs. Findings about interest in hypothetical MRTPs can inform models of how the marketing of MRTPs could affect population health. Understanding which subgroups are particularly interested in MRTPs can help determine who might be important to study to inform these models. We identified several groups who may warrant specific attention: smokers who are female, former smokers who hold low harm perceptions of smoking, never smokers who are young adults or
Analysis of hypothetical incidents in nuclear power plants with PWR and HTR
International Nuclear Information System (INIS)
Geiser, H.
1977-01-01
Several accident analyses are reviewed with a view to fission product release, and the findings are transferred to German reactor plants with LWR and HTR and compared. First of all, hypothetical accidents are compared for both of these lines; after this, the history of accidents is briefly described, and the fission product release during these accidents is investigated. For both reactor lines, there is a different but sufficiently high potential for safety improvements. (orig.) [de
Comparison of SAS3A and MELT-III predictions for a transient overpower hypothetical accident
International Nuclear Information System (INIS)
Wilburn, N.P.
1976-01-01
A comparison is made of the predictions of the two major codes SAS3A and MELT-III for the hypothetical unprotected transient overpower accident in the FFTF. The predictions of temperatures, fuel restructuring, fuel melting, reactivity feedbacks, and core power are compared
NCBI nr-aa BLAST: CBRC-XTRO-01-3594 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-3594 ref|YP_927377.1| conserved hypothetical formate transporter 1 [Shewanella amazon...ensis SB2B] gb|ABL99707.1| conserved hypothetical formate transporter 1 [Shewanella amazonensis SB2B] YP_927377.1 0.29 29% ...
Thor, Jennifer Cordon; York, Kenneth M.
2016-01-01
The hypothetical case presented in this article challenges students in a legal environment of business course to answer that question by examining key legal concepts in agency and contract law, and to conduct an ethical analysis in a case involving volunteers. Although the events in the following case are hypothetical, the contract that the…
Effects of hypothetical improvised nuclear detonation on the electrical infrastructure
International Nuclear Information System (INIS)
Barrett, Christopher L.; Eubank, Stephen; Evrenosoglu, C. Yaman; Marathe, Achla; Marathe, Madhav V.; Phadke, Arun; Thorp, James; Vullikanti, Anil
2013-01-01
We study the impacts of a hypothetical improvised nuclear detonation (IND) on the electrical infrastructure and its cascading effects on other urban inter-dependent infrastructures of a major metropolitan area in the US. We synthesize open source information, expert knowledge, commercial software and Google Earth data to derive a realistic electrical transmission and distribution network spanning the region. A dynamic analysis of the geo-located grid is carried out to determine the cause of malfunction of components, and their short-term and long-term effect on the stability of the grid. Finally a detailed estimate of the cost of damage to the major components of the infrastructure is provided.
Effects of hypothetical improvised nuclear detonation on the electrical infrastructure
Energy Technology Data Exchange (ETDEWEB)
Barrett, Christopher L.; Eubank, Stephen; Evrenosoglu, C. Yaman; Marathe, Achla; Marathe, Madhav V.; Phadke, Arun; Thorp, James; Vullikanti, Anil [Virginia Tech, Blacksburg, VA (United States). Network Dynamics and Simulation Science Lab.
2013-07-01
We study the impacts of a hypothetical improvised nuclear detonation (IND) on the electrical infrastructure and its cascading effects on other urban inter-dependent infrastructures of a major metropolitan area in the US. We synthesize open source information, expert knowledge, commercial software and Google Earth data to derive a realistic electrical transmission and distribution network spanning the region. A dynamic analysis of the geo-located grid is carried out to determine the cause of malfunction of components, and their short-term and long-term effect on the stability of the grid. Finally a detailed estimate of the cost of damage to the major components of the infrastructure is provided.
An Assessment of the Hypothetical Impact of Drug Abuse on Combat Capability. Volume I.
1979-12-01
25 I .4 Jill 1.6 MICROCOPY RESOLUTION TEST CHART NATIONAt BIURIA OF gMANI£ IWOI) A LEVEL AD SAI-80-113-WA AN ASSESSMENT OF THE HYPOTHETICAL IMPACTo OF...potential loss of unit effectiveness in each of these units. The resulting measure of unit effectiveness provides a powerful analy- tic tool for comparing
Energy Technology Data Exchange (ETDEWEB)
Thoerring, H.; Liland, A.
2010-12-15
This report deals with the environmental consequences in Norway after a hypothetical accident at Sellafield. The investigation is limited to the terrestrial environment, and focus on animals grazing natural pastures, plus wild berries and fungi. Only 137Cs is considered. The predicted consequences are severe, in particular for mutton and goat milk production. (Author)
International Nuclear Information System (INIS)
Thoerring, H.; Liland, A.
2010-12-01
This report deals with the environmental consequences in Norway after a hypothetical accident at Sellafield. The investigation is limited to the terrestrial environment, and focus on animals grazing natural pastures, plus wild berries and fungi. Only 137Cs is considered. The predicted consequences are severe - in particular for mutton and goat milk production. (Author)
BEACON/MOD2A analysis of the Arkansas-1 reactor cavity during a hypothetical hot leg break
International Nuclear Information System (INIS)
Ramsthaler, J.A.
1979-01-01
As part of the evaluation of the new MOD2A version of the BEACON code, the Arkansas-1 reactor cavity was modeled during a hypothetical loss-of-coolant accident. Results of the BEACON analysis were compared with results obtained previously with the COMPARE containment code. Studies were also made investigating some of the BEACON interphasic, timestep control, and wall heat transfer options to assure that these models were working properly and to observe their effects on the results. Descriptions of the Arkansas-1 reactor cavity, initial assumptions during the hypothetical LOCA, and methods of modeling with BEACON are presented. Some of the problems encountered in accurately modeling the penetrations surrounding the hot and cold leg pipes are also discussed
Energy Technology Data Exchange (ETDEWEB)
Zhu, Liang Cong
2009-06-08
Proteins are bio-macromolecules consisting of basic 20 amino acids and have distinct three-dimensional folds. They are essential parts of organisms and participate in every process within cells. Proteins are crucial for human life, and each protein within the body has a specific function, such as antibodies, contractile proteins, enzymes, hormonal proteins, structural proteins, storage proteins and transport proteins. Determining three-dimensional structure of a protein can help researchers discover the remarkable protein folding, binding site, conformation and etc, in order to understand well of protein interaction and aid for possible drug design. The research on protein structure by X-ray protein crystallography carried by Li-Wei Hung's research group in the Physical Bioscience Division at Lawrence Berkeley National Laboratory (LBNL) is focusing on protein crystallography. The research in this lab is in the process of from crystallizing the proteins to determining the three dimensional crystal structures of proteins. Most protein targets are selected from Mycobacterium Tuberculosis. TB (Tuberculosis) is a possible fatal infectious disease. By studying TB target protein can help discover antituberculer drugs, and find treatment for TB. The high-throughput mode of crystallization, crystal harvesting, crystal screening and data collection are applied to the research pipeline (Figure 1). The X-ray diffraction data by protein crystals can be processed and analyzed to result in a three dimensional representation of electron density, producing a detailed model of protein structure. Rv0731c is a conserved hypothetical protein with unknown function from Mycobacterium Tuberculosis. This paper is going to report the crystallization process and brief structure information of Rv0731c.
NCBI nr-aa BLAST: CBRC-TSYR-01-0087 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0087 ref|YP_002824787.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24034.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824787.1 1e-17 20% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-0156 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0156 ref|YP_002824783.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24030.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824783.1 3e-18 20% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1411 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-1411 ref|YP_002824787.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24034.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824787.1 4e-43 18% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-0087 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0087 ref|YP_002824783.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24030.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824783.1 2e-18 19% ...
Directory of Open Access Journals (Sweden)
Liu Kaiyang
2007-05-01
Full Text Available Abstract Background Although more than 100 Chlamydia pneumoniae hypothetical proteins have been predicted to be inclusion membrane proteins, only a few have been experimentally demonstrated to be in the inclusion membrane. Using antibodies raised with fusion proteins, we characterized four such hypothetical proteins encoded by two gene clusters (Cpn0146-147 and Cpn0284-285 in the C. pneumoniae genome. Results Cpn0146 and 0147 were detected in the inclusion membrane while Cpn0284 and 0285 inside inclusion and mainly associated with reticulate bodies although all four proteins contain an N-terminal bi-lobed hydrophobic region, a signature motif assigned to inclusion membrane proteins. These four hypothetical proteins were only detected in cells infected with C. pneumoniae but not other chlamydial species, with Cpn0147 at 6 hours and Cpn0146, 0284 & 0285 at 24 hours after infection. Cpn0146 & 147 but not Cpn0284 and 285 co-localized with a host cell endoplasmic reticulum marker, a property known to be possessed by some chlamydial inclusion membrane proteins, when expressed in the host cell cytosol via transgenes. However, the endoplasmic reticulum localization of the C. pneumoniae inclusion membrane proteins did not result in inhibition of the subsequent C. pneumoniae infection. Conclusion The hypothetical proteins Cpn0146 & 0147 were localized in the C. pneumoniae inclusion membrane while Cpn0284 & 0285 within the inclusion although all four were predicted to be Inc proteins, suggesting the need to experimentally characterize the predicted Inc proteins.
International Nuclear Information System (INIS)
Meier, P.M.; Morell, D.
1976-09-01
The report is an analysis of a hypothetical nuclear energy center (NEC) conducted in support of the recently completed study by the Nuclear Regulatory Commission, mandated by the Congress in the Energy Reorganization Act of 1974. The intent of the analysis of the hypothetical, or ''surrogate'', site was to inject a local and regional perspective into the assessment of technical, environmental, institutional, and socioeconomic issues which could be adequately addressed only by reference to a specific site. The hypothetical NEC site in Ocean County, New Jersey, was chosen to illustrate the problems and impacts of potential energy centers in coastal and near-coastal sites in relatively close proximity to large metropolitan areas. Earlier studies of hypothetical energy centers on the Mississippi River at River Bend, La., and on the Columbia River near Hanford, Washington, were also re-examined for their relevance to this new study effort. Neither Ocean County, nor any of the other surrogate sites, have been considered for actual construction of an NEC, nor does their selection for study purposes imply any judgement of desirability. Indeed, the major finding of the report presented is that Ocean County is a relatively poor location for an energy center, and this may well be true of many coastal locations similar to the Jersey shore. The objective in selecting surrogate sites, then, was not to find the best locations, but to select sites that would illustrate the broadest range of potential public policy and siting issues
Modeling a Hypothetical 170Tm Source for Brachytherapy Applications
International Nuclear Information System (INIS)
Enger, Shirin A.; D'Amours, Michel; Beaulieu, Luc
2011-01-01
Purpose: To perform absorbed dose calculations based on Monte Carlo simulations for a hypothetical 170 Tm source and to investigate the influence of encapsulating material on the energy spectrum of the emitted electrons and photons. Methods: GEANT4 Monte Carlo code version 9.2 patch 2 was used to simulate the decay process of 170 Tm and to calculate the absorbed dose distribution using the GEANT4 Penelope physics models. A hypothetical 170 Tm source based on the Flexisource brachytherapy design with the active core set as a pure thulium cylinder (length 3.5 mm and diameter 0.6 mm) and different cylindrical source encapsulations (length 5 mm and thickness 0.125 mm) constructed of titanium, stainless-steel, gold, or platinum were simulated. The radial dose function for the line source approximation was calculated following the TG-43U1 formalism for the stainless-steel encapsulation. Results: For the titanium and stainless-steel encapsulation, 94% of the total bremsstrahlung is produced inside the core, 4.8 and 5.5% in titanium and stainless-steel capsules, respectively, and less than 1% in water. For the gold capsule, 85% is produced inside the core, 14.2% inside the gold capsule, and a negligible amount ( 170 Tm source is primarily a bremsstrahlung source, with the majority of bremsstrahlung photons being generated in the source core and experiencing little attenuation in the source encapsulation. Electrons are efficiently absorbed by the gold and platinum encapsulations. However, for the stainless-steel capsule (or other lower Z encapsulations) electrons will escape. The dose from these electrons is dominant over the photon dose in the first few millimeter but is not taken into account by current standard treatment planning systems. The total energy spectrum of photons emerging from the source depends on the encapsulation composition and results in mean photon energies well above 100 keV. This is higher than the main gamma-ray energy peak at 84 keV. Based on our
International Nuclear Information System (INIS)
Sienicki, J.J.; Abramson, P.B.
1978-01-01
The main objective of the development of multifield, multicomponent thermohydrodynamic computer codes is the detailed study of hypothetical core disruptive accidents (HCDAs) in liquid-metal fast breeder reactors. The main contributions such codes are expected to make are the inclusion of detailed modeling of the relative motion of liquid and vapor (slip), the inclusion of modeling of nonequilibrium/nonsaturation thermodynamics, and the use of more detailed neutronics methods. Scoping studies of the importance of including these phenomena performed with the parametric two-field, two-component coupled neutronic/thermodynamic/hydrodynamic code FX2-TWOPOOL indicate for the prompt burst portion of an HCDA that: (1) Vapor-liquid slip plays a relatively insignificant role in establishing energetics, implying that analyses that do not model vapor-liquid slip may be adequate. Furthermore, if conditions of saturation are assumed to be maintained, calculations that do not permit vapor-liquid slip appear to be conservative. (2) The modeling of conduction-limited fuel vaporization and condensation causes the energetics to be highly sensitive to variations in the droplet size (i.e., in the parametric values) for the sizes of interest in HCDA analysis. Care must therefore be exercised in the inclusion of this phenomenon in energetics calculations. (3) Insignificant differences are observed between the use of space-time kinetics (quasi-static diffusion theory) and point kinetics, indicating again that point kinetics is normally adequate for analysis of the prompt burst portion of an HCDA. (4) No significant differences were found to result from assuming that delayed neutron precursors remain stationary where they are created rather than assuming that they move together with fuel. (5) There is no need for implicit coupling between the neutronics and the hydrodynamics/thermodynamics routines, even outside the prompt burst portion
Shang, Xiang; Xia, Haiyun; Dou, Xiankang; Shangguan, Mingjia; Li, Manyi; Wang, Chong
2018-07-01
An eye-safe 1 . 5 μm visibility lidar is presented in this work considering in situ particle size distribution, which can be deployed in crowded places like airports. In such a case, the measured extinction coefficient at 1 . 5 μm should be converted to that at 0 . 55 μm for visibility retrieval. Although several models have been established since 1962, the accurate wavelength conversion remains a challenge. An adaptive inversion algorithm for 1 . 5 μm visibility lidar is proposed and demonstrated by using the in situ Angstrom wavelength exponent, which is derived from an aerosol spectrometer. The impact of the particle size distribution of atmospheric aerosols and the Rayleigh backscattering of atmospheric molecules are taken into account. Using the 1 . 5 μm visibility lidar, the visibility with a temporal resolution of 5 min is detected over 48 h in Hefei (31 . 83∘ N, 117 . 25∘ E). The average visibility error between the new method and a visibility sensor (Vaisala, PWD52) is 5.2% with the R-square value of 0.96, while the relative error between another reference visibility lidar at 532 nm and the visibility sensor is 6.7% with the R-square value of 0.91. All results agree with each other well, demonstrating the accuracy and stability of the algorithm.
Directory of Open Access Journals (Sweden)
Leybourne Matthew
2006-12-01
Full Text Available Abstract Background The protein encoded by the SA1388 gene from Staphylococcus aureus was chosen for structure determination to elucidate its domain organization and confirm our earlier remote homology based prediction that it housed a nitrogen regulatory PII protein-like domain. SA1388 was predicted to contain a central PII-like domain and two flanking regions, which together belong to the NIF3-like protein family. Proteins like SA1388 remain a poorly studied group and their structural characterization could guide future investigations aimed at understanding their function. Results The structure of SA1388 has been solved to 2.0Å resolution by single wavelength anomalous dispersion phasing method using selenium anomalous signals. It reveals a canonical NIF3-like fold containing two domains with a PII-like domain inserted in the middle of the polypeptide. The N and C terminal halves of the NIF3-like domains are involved in dimerization, while the PII domain forms trimeric contacts with symmetry related monomers. Overall, the NIF3-like domains of SA1388 are organized as a hexameric toroid similar to its homologs, E. coli ybgI and the hypothetical protein SP1609 from Streptococcus pneumoniae. The openings on either side of the toroid are partially covered by trimeric "lids" formed by the PII domains. The junction of the two NIF3 domains has two zinc ions bound at what appears to be a histidine rich active site. A well-defined electron density corresponding to an endogenously bound ligand of unknown identity is observed in close proximity to the metal site. Conclusion SA1388 is the third member of the NIF3-like family of proteins to be structurally characterized, the other two also being hypothetical proteins of unknown function. The structure of SA1388 confirms our earlier prediction that the inserted domain that separates the two NIF3 domains adopts a PII-like fold and reveals an overall capped toroidal arrangement for the protein hexamer. The
Directory of Open Access Journals (Sweden)
Caroline E Whidden
Full Text Available A large fraction of any bacterial genome consists of hypothetical protein-coding open reading frames (ORFs. While most of these ORFs are present only in one or a few sequenced genomes, a few are conserved, often across large phylogenetic distances. Such conservation provides clues to likely uncharacterized cellular functions that need to be elucidated. Marine cyanobacteria from the Prochlorococcus/marine Synechococcus clade are dominant bacteria in oceanic waters and are significant contributors to global primary production. A Hyper Conserved Protein (PSHCP of unknown function is 100% conserved at the amino acid level in genomes of Prochlorococcus/marine Synechococcus, but lacks homologs outside of this clade. In this study we investigated Prochlorococcus marinus strains MED4 and MIT 9313 and Synechococcus sp. strain WH 8102 for the transcription of the PSHCP gene using RT-Q-PCR, for the presence of the protein product through quantitative immunoblotting, and for the protein's binding partners in a pull down assay. Significant transcription of the gene was detected in all strains. The PSHCP protein content varied between 8±1 fmol and 26±9 fmol per ug total protein, depending on the strain. The 50 S ribosomal protein L2, the Photosystem I protein PsaD and the Ycf48-like protein were found associated with the PSHCP protein in all strains and not appreciably or at all in control experiments. We hypothesize that PSHCP is a protein associated with the ribosome, and is possibly involved in photosystem assembly.
RELAP 5 Simulations of a hypothetical LOCA in Ringhals 2
International Nuclear Information System (INIS)
Caraher, D.
1987-01-01
RELAP5 simulations of a hypothetical LOCA in Ringhals 2 were conducted in order to determine the sensitivity of the calculated peak cladding temperature (PCT) to Appendix K requirements. The PCT was most sensitive to the assumed model decay heat: Changing from the 1979 ANS Standard to 1.2 times the 1973 Standard increased the PCT by 70 to 100K. After decay heat, the two parameters which affected the PCT the most were steam generator heat transfer and heat transfer lockout. The PCT was not sensitive to the assumed pump rotor condition (locked vs coasting); nor was it sensitive to a modest amount (5 to 10%) of steam generator tube plugging. (author)
Modeling the consequences of hypothetical accidents for the Titan II system
International Nuclear Information System (INIS)
Greenly, G.D.; Sullivan, T.J.
1981-11-01
Calculations have been made with the Atmospheric Release Advisory Capability (ARAC) suite of three-dimensional transport and diffusion codes MATHEW/ADPIC to assess the consequences of severe, hypothetical accident scenarios. One set of calculations develops the integrated dose and surface deposition patterns for a non-nuclear, high explosive detonation and dispersal of material. A second set of calculations depicts the time integrated dose and instantaneous concentration patterns for a substantial, continuous leak of the missile fuel oxidizer converted to nitrogen dioxide (NO 2 ). The areas affected and some of the implications for emergency response management are discussed
Espino, Orlando; Byrne, Ruth M J
2013-11-01
A new theory explains how people make hypothetical inferences from a premise consistent with several alternatives to a conclusion consistent with several alternatives. The key proposal is that people rely on a heuristic that identifies compatible possibilities. It is tested in 7 experiments that examine inferences between conditionals and disjunctions. Participants accepted inferences between conditionals and inclusive disjunctions when a compatible possibility was immediately available, in their binary judgments that a conclusion followed or not (Experiment 1a) and ternary judgments that included it was not possible to know (Experiment 1b). The compatibility effect was amplified when compatible possibilities were more readily available, e.g., for 'A only if B' conditionals (Experiment 2). It was eliminated when compatible possibilities were not available, e.g., for 'if and only if A B' bi-conditionals and exclusive disjunctions (Experiment 3). The compatibility heuristic occurs even for inferences based on implicit negation e.g., 'A or B, therefore if C D' (Experiment 4), and between universals 'All A's are B's' and disjunctions (Experiment 5a) and universals and conditionals (Experiment 5b). The implications of the results for alternative theories of the cognitive processes underlying hypothetical deductions are discussed. Copyright © 2013. Published by Elsevier Inc.
OPPORTUNITY COSTS OF REWARD DELAYS AND THE DISCOUNTING OF HYPOTHETICAL MONEY AND CIGARETTES
Johnson, Patrick S.; Herrmann, Evan S.; Johnson, Matthew W.
2015-01-01
Humans are reported to discount delayed rewards at lower rates than nonhumans. However, nonhumans are studied in tasks that restrict reinforcement during delays, whereas humans are typically studied in tasks that do not restrict reinforcement during delays. In nonhuman tasks, the opportunity cost of restricted reinforcement during delays may increase delay discounting rates. The present within-subjects study used online crowdsourcing (Amazon Mechanical Turk, or MTurk) to assess the discounting of hypothetical delayed money (and cigarettes in smokers) under four hypothetical framing conditions differing in the availability of reinforcement during delays. At one extreme, participants were free to leave their computer without returning, and engage in any behavior during reward delays (modeling typical human tasks). At the opposite extreme, participants were required to stay at their computer and engage in little other behavior during reward delays (modeling typical nonhuman tasks). Discounting rates increased as an orderly function of opportunity cost. Results also indicated predominantly hyperbolic discounting, the “magnitude effect,” steeper discounting of cigarettes than money, and positive correlations between discounting rates of these commodities. This is the first study to test the effects of opportunity costs on discounting, and suggests that procedural differences may partially account for observed species differences in discounting. PMID:25388973
Conservation of Charge and Conservation of Current
Eisenberg, Bob
2016-01-01
Conservation of current and conservation of charge are nearly the same thing: when enough is known about charge movement, conservation of current can be derived from conservation of charge, in ideal dielectrics, for example. Conservation of current is enforced implicitly in ideal dielectrics by theories that conserve charge. But charge movement in real materials like semiconductors or ionic solutions is never ideal. We present an apparently universal derivation of conservation of current and ...
International Nuclear Information System (INIS)
Schubert, J.F.; Kern, C.D.; Cooper, R.E.; Watts, J.R.
1978-01-01
The Savannah River Laboratory (SRL) is coordinating an interlaboratory effort to provide, test, and use state-of-the-art methods for calculating the environmental impact to an offsite population from the normal releases of radionuclides during the routine operation of a fuel-reprocessing plant. Results of this effort are the estimated doses to regional, continental, and global populations. Estimates are based upon operation of a hypothetical reprocessing plant at a site in the southeastern United States. The hypothetical plant will reprocess fuel used at a burn rate of 30 megawatts/metric ton and a burnup of 33,000 megawatt days/metric ton. All fuel will have been cooled for at least 365 days. The plant will have a 10 metric ton/day capacity and an assumed 3000 metric ton/year (82 percent online plant operation) output. Lifetime of the plant is assumed to be 40 years
Analyzing ecological restoration strategies for water and soil conservation
Mota da Silva, Jonathan; Silva, Marx Leandro Naves; Guimarães, João Luis Bittencourt; Sousa Júnior, Wilson Cabral; Figueiredo, Ricardo de Oliveira; da Rocha, Humberto Ribeiro
2018-01-01
The choice of areas for nature conservation involves the attempt to maximize the benefits, whether by carrying out an economic activity or by the provision of Ecosystem Services. Studies are needed to improve the understanding of the effect of the extent and position along the watershed of restored areas on soil and water conservation. This study aimed to understand how different restoration strategies might reflect in soil conservation and sediment retention. Using InVEST tool, sediment transport was simulated in a small 12 km2 watershed (Posses River, in Southeast Brazil), where one of first Brazilian Payment for Ecosystem Services (PES) projects is being carried out, comparing different hypothetical restoration strategies. With 25% of restoration, sediment export decreased by 78% for riparian restoration, and 27% for the steepest slopes restoration. On the other hand, the decrease in soil loss was lower for riparian restoration, with a 16% decrease, while the steepest slopes restoration reduced it by 21%. This mismatch between the reduction of sediment export and soil loss was explained by the fact that forest not only reduces soil loss locally but also traps sediment arriving from the upper parts of the watershed. While the first mechanism is important to provide soil stability, decreasing the risk of landslip, and to maintain agricultural productivity, the second can improve water quality and decrease the risk of silting, with positive effects on the water reservoirs at the outlet of the watershed. This suggests that Riparian and the Steepest Slopes restoration strategies are complementary in the sense of preventing sediments from reaching the water bodies as well as protecting them at their origin (with the reduction of erosion), so it will be advisable to consider the two types of restoration. PMID:29425214
Analyzing ecological restoration strategies for water and soil conservation.
Saad, Sandra Isay; Mota da Silva, Jonathan; Silva, Marx Leandro Naves; Guimarães, João Luis Bittencourt; Sousa Júnior, Wilson Cabral; Figueiredo, Ricardo de Oliveira; Rocha, Humberto Ribeiro da
2018-01-01
The choice of areas for nature conservation involves the attempt to maximize the benefits, whether by carrying out an economic activity or by the provision of Ecosystem Services. Studies are needed to improve the understanding of the effect of the extent and position along the watershed of restored areas on soil and water conservation. This study aimed to understand how different restoration strategies might reflect in soil conservation and sediment retention. Using InVEST tool, sediment transport was simulated in a small 12 km2 watershed (Posses River, in Southeast Brazil), where one of first Brazilian Payment for Ecosystem Services (PES) projects is being carried out, comparing different hypothetical restoration strategies. With 25% of restoration, sediment export decreased by 78% for riparian restoration, and 27% for the steepest slopes restoration. On the other hand, the decrease in soil loss was lower for riparian restoration, with a 16% decrease, while the steepest slopes restoration reduced it by 21%. This mismatch between the reduction of sediment export and soil loss was explained by the fact that forest not only reduces soil loss locally but also traps sediment arriving from the upper parts of the watershed. While the first mechanism is important to provide soil stability, decreasing the risk of landslip, and to maintain agricultural productivity, the second can improve water quality and decrease the risk of silting, with positive effects on the water reservoirs at the outlet of the watershed. This suggests that Riparian and the Steepest Slopes restoration strategies are complementary in the sense of preventing sediments from reaching the water bodies as well as protecting them at their origin (with the reduction of erosion), so it will be advisable to consider the two types of restoration.
Analyzing ecological restoration strategies for water and soil conservation.
Directory of Open Access Journals (Sweden)
Sandra Isay Saad
Full Text Available The choice of areas for nature conservation involves the attempt to maximize the benefits, whether by carrying out an economic activity or by the provision of Ecosystem Services. Studies are needed to improve the understanding of the effect of the extent and position along the watershed of restored areas on soil and water conservation. This study aimed to understand how different restoration strategies might reflect in soil conservation and sediment retention. Using InVEST tool, sediment transport was simulated in a small 12 km2 watershed (Posses River, in Southeast Brazil, where one of first Brazilian Payment for Ecosystem Services (PES projects is being carried out, comparing different hypothetical restoration strategies. With 25% of restoration, sediment export decreased by 78% for riparian restoration, and 27% for the steepest slopes restoration. On the other hand, the decrease in soil loss was lower for riparian restoration, with a 16% decrease, while the steepest slopes restoration reduced it by 21%. This mismatch between the reduction of sediment export and soil loss was explained by the fact that forest not only reduces soil loss locally but also traps sediment arriving from the upper parts of the watershed. While the first mechanism is important to provide soil stability, decreasing the risk of landslip, and to maintain agricultural productivity, the second can improve water quality and decrease the risk of silting, with positive effects on the water reservoirs at the outlet of the watershed. This suggests that Riparian and the Steepest Slopes restoration strategies are complementary in the sense of preventing sediments from reaching the water bodies as well as protecting them at their origin (with the reduction of erosion, so it will be advisable to consider the two types of restoration.
Energy Technology Data Exchange (ETDEWEB)
Nalbandyan, A.; Ytre-Eide, M.A.; Thoerring, H.; Liland, A.; Bartnicki, J.; Balonov, M.
2012-06-15
The report describes different hypothetical accident scenarios at the Leningrad nuclear power plant for both RBMK and VVER-1200 reactors. The estimated release is combined with different meteorological scenarios to predict possible fallout of radioactive substances in Norway. For a hypothetical catastrophic accident at an RBMK reactor combined with a meteorological worst case scenario, the consequences in Norway could be considerable. Foodstuffs in many regions would be contaminated above the food intervention levels for radioactive cesium in Norway. (Author)
International Nuclear Information System (INIS)
Nalbandyan, A.; Ytre-Eide, M.A.; Thoerring, H.; Liland, A.; Bartnicki, J.; Balonov, M.
2012-06-01
The report describes different hypothetical accident scenarios at the Leningrad nuclear power plant for both RBMK and VVER-1200 reactors. The estimated release is combined with different meteorological scenarios to predict possible fallout of radioactive substances in Norway. For a hypothetical catastrophic accident at an RBMK reactor combined with a meteorological worst case scenario, the consequences in Norway could be considerable. Foodstuffs in many regions would be contaminated above the food intervention levels for radioactive cesium in Norway. (Author)
Hypothetical model of factors determining performance and sports achievement in team sports
Directory of Open Access Journals (Sweden)
Trninić Marko
2011-01-01
Full Text Available The objective of this paper is formation of a comprehensive hypothetical dynamic interactional process model structured by assumed constructs, i.e. processes or mechanisms that obtain real features and influences on athlete's performance and athletic achievement. Thus there are formed and assumed reciprocal relations between high training and competition - based stress as the input variable, cognitive appraisal and interpretation as the mediator, and mood state as the moderator based on the development of the dynamic systems theory. Also, proposed model uses basic assumptions of the Action-Theory approach and it is in accordance with the contemporary socialcognitive view of team functioning in sports. Within the process model, the output variables are measures of efficacy evident through athlete's individual and team performance and athletic achievement. The situation, the team and athlete attributes, the performance and the athletic achievement are joined variables, and the individual and the collective efficacy are the consequence of their reciprocal interaction. Therefore, there are complex and reciprocal interactive processes in real sports and explorative situations amongst the attributes of athlete and team and the behaviour and situation that determine performance and athletic achievement. This is probably the result of an integrated network of reciprocal multi-causal activity of a set of stated assumed constructs from different theories. Thus the hypothetical model is an effort to describe elaborate correlations and/or interdependencies between internal and external determinants which presumably affect athlete's performance and athletic achievement.
Hypothetical air ingress scenarios in advanced modular high temperature gas cooled reactors
International Nuclear Information System (INIS)
Kroeger, P.G.
1988-01-01
Considering an extremely hypothetical scenario of complete cross duct failure and unlimited air supply into the reactor vessel of a modular high temperature gas cooled ractor, it is found that the potential air inflow remains limited due to the high friction pressure drop through the active core. All incoming air will be oxidized to CO and some local external burning would be temporarily possible in such a scenario. The accident would have to continue with unlimited air supply for hundreds of hours before the core structural integrity would be jeopardized
Risk Management in Smallholder Cattle Farming: A Hypothetical Insurance Approach in Western Kenya
Otieno, David Jakinda; Oluoch-Kosura, Willis; Karugia, Joseph Thuo; Drucker, Adam G.; Rege, Edward
2006-01-01
Smallholder cattle farming is an important livelihood strategy in most developing countries like Kenya. However, tropical diseases in Africa often wipe out these valuable assets. This paper focuses on mitigation of cattle disease risks through a hypothetical insurance scheme. The study is based on data from a survey conducted on a purposive sample of 300 smallholder cattle farmers in Kakamega and Siaya districts of Western Kenya. Descriptive measures and a regression model were used in the an...
Directory of Open Access Journals (Sweden)
Laura Martínez-Carrasco
2015-12-01
Full Text Available Choosing a valid procedure to measure willingness to pay (WTP is crucial for designating optimum price policies or for evaluating the demand for new products. This study compares two methods for obtaining WTP in a food context: a random nth price auction and an open-ended contingent valuation (CV question. Participants were regular salad tomato buyers of Alicante and they were randomly assigned to one of the two treatments. The products about which they would show their WTP were traditional tomato varieties. Both treatments were divided into three stages: in the first stage the only available information was a reference price for the tomatoes. In stages 2 and 3 we revealed the local origin and the organic grown of the tomatoes respectively. Our results show that in the auction the percentage of participants willing to pay the same or more than the reference price was between 20 and 30%. In the CV method this percentage was between 40 and 65%. The mean WTP in the auction, considering the whole of the individuals, was situated between 1.90 and 2.13 €/kg. These same results obtained through the CV were situated between 2.54 and 3.21 €/kg. The results confirmed the findings of previous papers in which the hypothetical bias of CV was clarified because it yields higher values for WTP than the auction, especially when referring to the number of individuals willing to pay more. Additionally, hedonic price models were estimated for the prices obtained by both methods with the result that in all the models, WTP was directly related to the price paid for the latest purchase of tomatoes.
Energy Technology Data Exchange (ETDEWEB)
Martínez-Carrasco, L.; Brugarolas, M.; Martínez-Poveda, A.; Ruiz-Martínez, J.J.
2015-07-01
Choosing a valid procedure to measure willingness to pay (WTP) is crucial for designating optimum price policies or for evaluating the demand for new products. This study compares two methods for obtaining WTP in a food context: a random nth price auction and an open-ended contingent valuation (CV) question. Participants were regular salad tomato buyers of Alicante and they were randomly assigned to one of the two treatments. The products about which they would show their WTP were traditional tomato varieties. Both treatments were divided into three stages: in the first stage the only available information was a reference price for the tomatoes. In stages 2 and 3 we revealed the local origin and the organic grown of the tomatoes respectively. Our results show that in the auction the percentage of participants willing to pay the same or more than the reference price was between 20 and 30%. In the CV method this percentage was between 40 and 65%. The mean WTP in the auction, considering the whole of the individuals, was situated between 1.90 and 2.13 €/kg. These same results obtained through the CV were situated between 2.54 and 3.21 €/kg. The results confirmed the findings of previous papers in which the hypothetical bias of CV was clarified because it yields higher values for WTP than the auction, especially when referring to the number of individuals willing to pay more. Additionally, hedonic price models were estimated for the prices obtained by both methods with the result that in all the models, WTP was directly related to the price paid for the latest purchase of tomatoes. (Author)
Calculated magnetocrystalline anisotropy of existing and hypothetical MCo5 compounds
International Nuclear Information System (INIS)
Opahle, Ingo; Richter, Manuel; Kuz'min, Michael D.; Nitzsche, Ulrike; Koepernik, Klaus; Schramm, Lutz
2005-01-01
The magnetic properties, lattice parameters and formation enthalpies of existing and hypothetical MCo 5 compounds (M=Y, La, Th, Mg, Ca and Sr) are calculated within the framework of density functional theory. In these compounds the magnetocrystalline anisotropy energy is dominated by itinerant Co 3d contributions. Band energy calculations suggest that-within in a rigid band picture-anisotropy energies of comparable size to those of hard magnetic materials containing rare earths could be obtained by hole doping of YCo 5 , e.g. by the substitution of Ca or Mg for Y. This idea is confirmed by the presented total energy calculations. However, the calculated enthalpies of formation suggest that CaCo 5 and MgCo 5 could only be prepared by non-equilibrium methods
Guillaumier, Ashleigh; Bonevski, Billie; Paul, Christine; D'Este, Catherine; Doran, Christopher; Siahpush, Mohammad
2014-03-01
Increases in tobacco taxation can lead to reductions in tobacco consumption and prevalence of use across social groups. However, use of price-minimisation strategies to manage current and future tobacco use and the role of financial stress is less understood. This study aimed to measure the effect of cigarette price increases on price-minimisation strategy endorsement and financial stress among socioeconomically disadvantaged smokers. Community service organisation welfare recipients in NSW, Australia completed a touchscreen survey. Smoking history, financial stress, highest price to quit and responses to hypothetical cigarette price increases were assessed. Participants were 354 smokers (response rate = 79%). Most participants received income from a government pension (95%), earned price rises, significantly more participants endorsed trying to quit in response to the larger increase scenario (P price-minimisation strategies (e.g. switching to cheaper brands/products) were endorsed, but remained constant across hypothetical scenarios; level of financial stress appeared to have little influence. Smokers indicating they would not change their smoking in response to price rises had higher levels of nicotine dependence. Socially disadvantaged smokers endorsed numerous price-minimising strategies to maintain smoking at hypothetically increased costs. Larger cigarette price rises motivated more smokers to consider quitting, while price-resistant smokers appeared to have a more entrenched smoker status. © 2013 Australasian Professional Society on Alcohol and other Drugs.
Vrakking, A.M.; Heide, van der A.; Looman, C.W.; Delden, van J.J.M.; Philipsen, B.D.; Maas, van der P.J.; Wal, van der G.
2005-01-01
OBJECTIVE: To study the willingness of Dutch physicians to use potentially life-shortening or lethal drugs for severely ill children. STUDY DESIGN: We asked 63 pediatricians about their approach to 10 hypothetical cases of children with cancer. The age of the child (15, 11, or 6 years), the child's
Tanaka, Ray; Hayashi, Takafumi; Ike, Makiko; Noto, Yoshiyuki; Goto, Tazuko K
2013-06-01
The aim of this study was to evaluate the usefulness of hypothetical monoenergetic images after dual-energy computed tomography (DECT) for assessment of the bone encircling dental implant bodies. Seventy-two axial images of implantation sites clipped out from image data scanned using DECT in dual-energy mode were used. Subjective assessment on reduction of dark-band-like artifacts (R-DBAs) and diagnosability of adjacent bone condition (D-ABC) in 3 sets of DECT images-a fused image set (DE120) and 2 sets of hypothetical monoenergetic images (ME100, ME190)-was performed and the results were statistically analyzed. With regards to R-DBAs and D-ABC, significant differences among DE120, ME100, and ME190 were observed. The ME100 and ME190 images revealed more artifact reduction and diagnosability than those of DE120. DECT imaging followed by hypothetical monoenergetic image construction can cause R-DBAs and increase D-ABC and may be potentially used for the evaluation of postoperative changes in the bone encircling implant bodies. Copyright © 2013 Elsevier Inc. All rights reserved.
Paul, Lisa A.; Kehn, Andre; Gray, Matt J.; Salapska-Gelleri, Joanna
2014-01-01
Objective: Undergraduate rape disclosure recipients' and nonrecipients' sociodemographic and life experience variables, attitudes towards rape, and responses to a hypothetical rape disclosure were compared to determine differences between them. Participants: One hundred ninety-two undergraduates at 3 universities participated in this online survey…
Conservative performance analysis of a PWR nuclear fuel rod using the FRAPCON code
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Fabio Branco Vaz de; Sabundjian, Gaiane, E-mail: fabio@ipen.br, E-mail: gdjian@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2015-07-01
In this paper, some of the preliminary results of the sensitivity and conservative analysis of a hypothetical pressurized water reactor fuel rod are presented, using the FRAPCON code as a basic and preparation tool for the future transient analysis, which will be carried out by the FRAPTRAN code. Emphasis is given to the evaluation of the cladding behavior, since it is one of the critical containment barriers of the fission products, generated during fuel irradiation. Sensitivity analyses were performed by the variation of the values of some parameters, which were mainly related with thermal cycle conditions, and taking into account an intermediate value between the realistic and conservative conditions for the linear heat generation rate parameter, given in literature. Time lengths were taken from typical nuclear power plant operational cycle, adjusted to the obtention of a chosen burnup. Curves of fuel and cladding temperatures, and also for their mechanical and oxidation behavior, as a function of the reactor operation's time, are presented for each one of the nodes considered, over the nuclear fuel rod. Analyzing the curves, it was possible to observe the influence of the thermal cycle on the fuel rod performance, in this preliminary step for the accident/transient analysis. (author)
Reinforcing value and hypothetical behavioral economic demand for food and their relation to BMI.
Epstein, Leonard H; Paluch, Rocco A; Carr, Katelyn A; Temple, Jennifer L; Bickel, Warren K; MacKillop, James
2018-04-01
Food is a primary reinforcer, and food reinforcement is related to obesity. The reinforcing value of food can be measured by establishing how hard someone will work to get food on progressive-ratio schedules. An alternative way to measure food reinforcement is a hypothetical purchase task which creates behavioral economic demand curves. This paper studies whether reinforcing value and hypothetical behavioral demand approaches are assessing the same or unique aspects of food reinforcement for low (LED) and high (HED) energy density foods using a combination of analytic approaches in females of varying BMI. Results showed absolute reinforcing value for LED and HED foods and relative reinforcing value were related to demand intensity (r's = 0.20-0.30, p's demand elasticity (r's = 0.17-0.22, p's demand task, and the differential role of effort in the two tasks. Examples of how a better understanding of food reinforcement may be useful to prevent or treat obesity are discussed, including engaging in alternative non-food reinforcers as substitutes for food, such as crafts or socializing in a non-food environment, and reducing the value of immediate food reinforcers by episodic future thinking. Copyright © 2018. Published by Elsevier Ltd.
International Nuclear Information System (INIS)
Parsons, A.M.; Olague, N.E.; Gallegos, D.P.
1991-01-01
Under the sponsorship of the US Nuclear Regulatory Commission (NRC), Sandia National Laboratories (SNL) is developing a performance assessment methodology for the analysis of long-term disposal and isolation of high-level nuclear wastes (HLW) in alternative geologic media. As part of this exercise, SNL created a conceptualization of ground-water flow and radionuclide transport in the far field of a hypothetical HLW repository site located in unsaturated, fractured tuff formations. This study provides a foundation for the development of conceptual mathematical, and numerical models to be used in this performance assessment methodology. This conceptualization is site specific in terms of geometry, the regional ground-water flow system, stratigraphy, and structure in that these are based on information from Yucca Mountain located on the Nevada Test Site. However, in terms of processes in unsaturated, fractured, porous media, the model is generic. This report also provides a review and evaluation of previously proposed conceptual models of unsaturated and saturated flow and solute transport. This report provides a qualitative description of a hypothetical HLW repository site in fractured tuff. However, evaluation of the current knowledge of flow and transport at Yucca Mountain does not yield a single conceptual model. Instead, multiple conceptual models are possible given the existing information
Energy Technology Data Exchange (ETDEWEB)
Parsons, A.M.; Olague, N.E.; Gallegos, D.P. [Sandia National Labs., Albuquerque, NM (USA)
1991-01-01
Under the sponsorship of the US Nuclear Regulatory Commission (NRC), Sandia National Laboratories (SNL) is developing a performance assessment methodology for the analysis of long-term disposal and isolation of high-level nuclear wastes (HLW) in alternative geologic media. As part of this exercise, SNL created a conceptualization of ground-water flow and radionuclide transport in the far field of a hypothetical HLW repository site located in unsaturated, fractured tuff formations. This study provides a foundation for the development of conceptual mathematical, and numerical models to be used in this performance assessment methodology. This conceptualization is site specific in terms of geometry, the regional ground-water flow system, stratigraphy, and structure in that these are based on information from Yucca Mountain located on the Nevada Test Site. However, in terms of processes in unsaturated, fractured, porous media, the model is generic. This report also provides a review and evaluation of previously proposed conceptual models of unsaturated and saturated flow and solute transport. This report provides a qualitative description of a hypothetical HLW repository site in fractured tuff. However, evaluation of the current knowledge of flow and transport at Yucca Mountain does not yield a single conceptual model. Instead, multiple conceptual models are possible given the existing information.
Geologic simulation model for a hypothetical site in the Columbia Plateau
International Nuclear Information System (INIS)
Petrie, G.M.; Zellmer, J.T.; Lindberg, J.W.; Foley, M.G.
1981-04-01
This report describes the structure and operation of the Assessment of Effectiveness of Geologic Isolation Systems (AEGIS) Geologic Simulation Model, a computer simulation model of the geology and hydrology of an area of the Columbia Plateau, Washington. The model is used to study the long-term suitability of the Columbia Plateau Basalts for the storage of nuclear waste in a mined repository. It is also a starting point for analyses of such repositories in other geologic settings. The Geologic Simulation Model will aid in formulating design disruptive sequences (i.e. those to be used for more detailed hydrologic, transport, and dose analyses) from the spectrum of hypothetical geological and hydrological developments that could result in transport of radionuclides out of a repository. Quantitative and auditable execution of this task, however, is impossible without computer simulation. The computer simulation model aids the geoscientist by generating the wide spectrum of possible future evolutionary paths of the areal geology and hydrology, identifying those that may affect the repository integrity. This allows the geoscientist to focus on potentially disruptive processes, or series of events. Eleven separate submodels are used in the simulation portion of the model: Climate, Continental Glaciation, Deformation, Geomorphic Events, Hydrology, Magmatic Events, Meteorite Impact, Sea-Level Fluctuations, Shaft-Seal Failure, Sub-Basalt Basement Faulting, and Undetected Features. Because of the modular construction of the model, each submodel can easily be replaced with an updated or modified version as new information or developments in the state of the art become available. The model simulates the geologic and hydrologic systems of a hypothetical repository site and region for a million years following repository decommissioning. The Geologic Simulation Model operates in both single-run and Monte Carlo modes
Emission control strategies for short-chain chloroparaffins in two semi-hypothetical case cities
DEFF Research Database (Denmark)
Eriksson, Eva; Revitt, M.; Lützhøft, Hans-Christian Holten
2012-01-01
The short-chain chloroparaffins (SCCP), (C10-13 chloroalkanes) are identified in the European Water Framework Directive, as priority hazardous substances. Within the ScorePP project, the aim is to develop emission control strategies that can be employed to reduce emissions from urban areas...... into receiving waters. Six different scenarios for mitigating SCCP emissions in two different semi-hypothetical case cities representing eastern inland and northern coastal conditions have been evaluated. The analysis, associated with scenario uncertainty, indicates that the EU legislation, Best Available...
Parker, Elizabeth H.; Hubbard, Julie A.; Ramsden, Sally R.; Relyea, Nicole; Dearing, Karen F.; Smithmyer, Catherine M.; Schimmel, Kelly D.
2001-01-01
Examined correspondence between second-graders' use and knowledge of anger display rules. Found that children's responses were moderately related across two contexts. Following live interactions, compared to hypothetical vignettes, children reported feeling and expressing less anger, intending to hide their anger more, and dissembling their anger…
Architecture of human mTOR complex 1.
Aylett, Christopher H S; Sauer, Evelyn; Imseng, Stefan; Boehringer, Daniel; Hall, Michael N; Ban, Nenad; Maier, Timm
2016-01-01
Target of rapamycin (TOR), a conserved protein kinase and central controller of cell growth, functions in two structurally and functionally distinct complexes: TORC1 and TORC2. Dysregulation of mammalian TOR (mTOR) signaling is implicated in pathologies that include diabetes, cancer, and neurodegeneration. We resolved the architecture of human mTORC1 (mTOR with subunits Raptor and mLST8) bound to FK506 binding protein (FKBP)-rapamycin, by combining cryo-electron microscopy at 5.9 angstrom resolution with crystallographic studies of Chaetomium thermophilum Raptor at 4.3 angstrom resolution. The structure explains how FKBP-rapamycin and architectural elements of mTORC1 limit access to the recessed active site. Consistent with a role in substrate recognition and delivery, the conserved amino-terminal domain of Raptor is juxtaposed to the kinase active site. Copyright © 2016, American Association for the Advancement of Science.
Essink-Bot, Marie-Louise; Stuifbergen, Marja C.; Meerding, Willem-Jan; Looman, Caspar W. N.; Bonsel, Gouke J.
2007-01-01
BACKGROUND: The effects of socio-demographic characteristics of the respondent, including age, on valuation scores of hypothetical health states remain inconclusive. Therefore, we analyzed data from a study designed to discriminate between the effects of respondents' age and time preference on
Esposito, Antonella
2012-01-01
This paper is concerned with how research ethics is evolving along with emerging online research methods and settings. In particular, it focuses on ethics issues implied in a hypothetical virtual ethnography study aiming to gain insights on participants' experience in an emergent context of networked learning, namely a MOOC--Massive Online Open…
Radiological Consequence Analyses Following a Hypothetical Severe Accident in Japan
Energy Technology Data Exchange (ETDEWEB)
Kim, Juyub; Kim, Juyoul [FNC Technology Co., Yongin (Korea, Republic of)
2016-10-15
In order to reflect the lessons learned from the Fukushima Daiichi nuclear power plant accident, a simulator which is named NANAS (Northeast Asia Nuclear Accident Simulator) for overseas nuclear accident has been developed. It is composed of three modules: source-term estimation, atmospheric dispersion prediction and dose assessment. For the source-term estimation module, the representative reactor types were selected as CPR1000, BWR5 and BWR6 for China, Japan and Taiwan, respectively. Considering the design characteristics of each reactor type, the source-term estimation module simulates the transient of design basis accident and severe accident. The atmospheric dispersion prediction module analyzes the transport and dispersion of radioactive materials and prints out the air and ground concentration. Using the concentration result, the dose assessment module calculates effective dose and thyroid dose in the Korean Peninsula region. In this study, a hypothetical severe accident in Japan was simulated to demonstrate the function of NANAS. As a result, the radiological consequence to Korea was estimated from the accident. PC-based nuclear accident simulator, NANAS, has been developed. NANAS contains three modules: source-term estimation, atmospheric dispersion prediction and dose assessment. The source-term estimation module simulates a nuclear accident for the representative reactor types in China, Japan and Taiwan. Since the maximum calculation speed is 16 times than real time, it is possible to estimate the source-term release swiftly in case of the emergency. The atmospheric dispersion prediction module analyzes the transport and dispersion of radioactive materials in wide range including the Northeast Asia. Final results of the dose assessment module are a map projection and time chart of effective dose and thyroid dose. A hypothetical accident in Japan was simulated by NANAS. The radioactive materials were released during the first 24 hours and the source
He, Haiyan; Qin, Yongling; Li, Nan; Chen, Guiguang; Liang, Zhiqun
2015-03-01
In the current study, fermentation broth of Aspergillus oryzae HML366 in sugar cane bagasse was subjected to ultrafiltration and ion exchange chromatography, and two xylanases, XynH1 and XynH2, were purified. Time-of-flight mass spectrometry coupled with SDS-PAGE analysis revealed that XynH1 is identical to the hypothetical A. oryzae RIB40 protein XP_001826985.1, with a molecular weight of 33.671 kDa. Likewise, XynH2 was identified as xylanase XynF1 with a molecular weight of 35.402 kDa. Sequence analysis indicated that XynH1 belongs to glycosyl hydrolases family 10. The specific activity of XynH1 was measured at 476.9 U/mg. Optimal xylanase activity was observed at pH 6.0, and enzyme remained active within pH 4.0-10.0 and at a temperature below 70 °C. Mg(2+), Mn(2+), Ca(2+), and K(+) enhanced the XynH1 xylanase activity to 146, 122, 114, and 108%, respectively. XynH1 hydrolyzed Birchwood xylan and Larchwood xylan effectively. The K m and V max of XynH1 values determined were 1.16 mM and 336 μmol/min/mg with Birchwood xylan as the substrate. A. oryzae HML366 xylanase XynH1 showed superior heat and pH tolerance, therefore may have significant applications in paper and biofuel industries. These studies constitute the first investigation of the xylanase activities of the hypothetical protein XP_001826985.1 form A. oryzae.
Kim, Hee Jin; Prithiviraj, Kalyani; Groathouse, Nathan; Brennan, Patrick J; Spencer, John S
2013-02-01
The cell-mediated immunity (CMI)-based in vitro gamma interferon release assay (IGRA) of Mycobacterium leprae-specific antigens has potential as a promising diagnostic means to detect those individuals in the early stages of M. leprae infection. Diagnosis of leprosy is a major obstacle toward ultimate disease control and has been compromised in the past by the lack of specific markers. Comparative bioinformatic analysis among mycobacterial genomes identified potential M. leprae-specific proteins called "hypothetical unknowns." Due to massive gene decay and the prevalence of pseudogenes, it is unclear whether any of these proteins are expressed or are immunologically relevant. In this study, we performed cDNA-based quantitative real-time PCR to investigate the expression status of 131 putative open reading frames (ORFs) encoding hypothetical unknowns. Twenty-six of the M. leprae-specific antigen candidates showed significant levels of gene expression compared to that of ESAT-6 (ML0049), which is an important T cell antigen of low abundance in M. leprae. Fifteen of 26 selected antigen candidates were expressed and purified in Escherichia coli. The seroreactivity to these proteins of pooled sera from lepromatous leprosy patients and cavitary tuberculosis patients revealed that 9 of 15 recombinant hypothetical unknowns elicited M. leprae-specific immune responses. These nine proteins may be good diagnostic reagents to improve both the sensitivity and specificity of detection of individuals with asymptomatic leprosy.
International Nuclear Information System (INIS)
Soloviov, Vladyslav; Pysmenniy, Yevgen
2015-01-01
This paper describes some general methodological aspects of the assessment of the damage to human life and health caused by a hypothetical nuclear accident at the nuclear power plant (NPP). Probability estimation of death (due to cancer and non-cancer effects of radiation injury), disability and incapacity of individuals were made by taking into account the regulations of Ukraine. According to the assessment, the probability of death due to cancer and non-cancer effects of radiation damage to individuals who received radiation dose of 1 Sv is equal to 0.09. Probability of disability of 1, 2 or 3 group regardless of the radiation dose is 0.009, 0.0054, 0.027, respectively. Probability of temporary disability of the individual who received dose equal to 33 mSv (the level of potential exposure in a hypothetical nuclear accident at the NPP) is equal 0.16. This probability estimation of potential harm to human health and life caused by a hypothetical nuclear accident can be used for NPP in different countries using requirements of regulations in these countries. And also to estimate the amount of insurance payments due to the nuclear damage in the event of a nuclear accident at the NPP or other nuclear industry enterprise. (author)
Designing a Physical Security System for Risk Reduction in a Hypothetical Nuclear Facility
International Nuclear Information System (INIS)
Saleh, A.A.; Abd Elaziz, M.
2017-01-01
Physical security in a nuclear facility means detection, prevention and response to threat, the ft, sabotage, unauthorized access and illegal transfer involving radioactive and nuclear material. This paper proposes a physical security system designing concepts to reduce the risk associated with variant threats to a nuclear facility. This paper presents a study of the unauthorized removal and sabotage in a hypothetical nuclear facility considering deter, delay and response layers. More over, the study involves performing any required upgrading to the security system by investigating the nuclear facility layout and considering all physical security layers design to enhance the weakness for risk reduction
Consequence evaluation of hypothetical reactor pressure vessel support failure
International Nuclear Information System (INIS)
Lu, S.C.; Holman, G.S.; Lambert, H.E.
1991-01-01
This paper describes a consequence evaluation to address safety concerns raised by the radiation embrittlement of the reactor pressure vessel (RPV) supports for the Trojan nuclear power plant. The study comprises a structural evaluation and an effects evaluation and assumes that all four reactor vessel supports have completely lost the load carrying capability. The structural evaluation concludes that the Trojan reactor coolant loop (RCL) piping is capable of transferring loads to the steam generator (SG) supports and the reactor coolant pump (RCP) supports and that the SG supports and the RCP supports have sufficient design margins to accommodate additional loads transferred to them through the RCL piping. The effects evaluation, employing a systems analysis approach, investigates initiating events and the reliability of the engineered safeguard systems as the RPV is subject to movements caused by the RPV support failure. The evaluation identifies a number of areas for further investigation and concludes that a hypothetical failure of the Trojan RPV supports due to radiation embrittlement will not result in consequences of significant safety concerns. (author)
International Nuclear Information System (INIS)
Ytre-Eide, M. A.; Standring, W.J.F.; Amundsen, I.; Sickel, M.; Liland, A.; Saltbones, J.; Bartnicki, J.; Haakenstad, H.; Salbu, B.
2009-03-01
This report focuses on transport and fallout from 'worst-case' scenarios based on a hypothetical accident at the B215 facility for storing Highly Active Liquors (HAL) at Sellafield. The scenarios involve an atmospheric release of between 0.1-10 % of the total HAL inventory; only transport and fallout of 137 Cs is considered in this case study. Simulations resulted in between 0.1-50 times the maximum 137 Cs fallout experienced in the most contaminated areas in Norway after the Chernobyl accident. (Author)
Energy Technology Data Exchange (ETDEWEB)
Mitrakos, D., E-mail: dimitris.mitrakos@eeae.gr; Potiriadis, C.; Housiadas, C.
2016-04-15
Highlights: • Actions may be warranted after a major nuclear accident even at long distances. • Distance may not be the decisive parameter for longer term radiological impact. • Remote impact may vary orders of magnitude depending on the meteorological conditions. • The potential impact can be assessed using computationally inexpensive calculations. - Abstract: After the Fukushima accident important initiatives were taken in European level to enhance the nuclear safety level of the existing and planned nuclear reactors, such as the so-called nuclear “stress-tests” and the amendment of the Nuclear Safety Directive. A recent work of HERCA and WENRA focused on the need for a more consistent and harmonized response in a transboundary context in case of a hypothetical major nuclear accident in Europe. Such an accident, although very improbable, cannot be totally excluded and so, should be considered in emergency preparedness arrangements among the various European countries. In case of a hypothetical severe Fukushima-like accident in Europe, the role of the neighboring countries may be important, since the authorities should be able to provide information and advice to the government and the public, but also can contribute to the overall assessment of the situation be their own means. In this work we assess the radiological significance of a hypothetical major nuclear accident for distances longer than 300 km that are not typically covered by the internationally accepted emergency planning zones. The approach is simple and computationally inexpensive, since it is based on the calculation of only a few release scenarios at dates selected within a whole year on the basis of bounding the deposition levels at long distances in relation to the occurrence of precipitation. From the calculated results it is evident that distance is not the only decisive parameter in estimating the potential radiological significance of a severe nuclear accident. The hypothetical
Energy Technology Data Exchange (ETDEWEB)
Moiseeva, N.; Bau, R.; Swenson, S.D.; Marklund, F.S.; Jr.; Choe, J.-Y.; Liu, Z.-J.; Allaire, M.
2009-05-26
Disintegrins are a family of small (4-14 kDa) proteins that bind to another class of proteins, integrins. Therefore, as integrin inhibitors, they can be exploited as anticancer and antiplatelet agents. Acostatin, an {alpha}{beta} heterodimeric disintegrin, has been isolated from the venom of Southern copperhead (Agkistrodon contortrix contortrix). The three-dimensional structure of acostatin has been determined by macromolecular crystallography using the molecular-replacement method. The asymmetric unit of the acostatin crystals consists of two heterodimers. The structure has been refined to an R{sub work} and R{sub free} of 18.6% and 21.5%, respectively, using all data in the 20-1.7 {angstrom} resolution range. The structure of all subunits is similar and is well ordered into N-terminal and C-terminal clusters with four intramolecular disulfide bonds. The overall fold consists of short {beta}-sheets, each of which is formed by a pair of antiparallel {beta}-strands connected by {beta}-turns and flexible loops of different lengths. Conformational flexibility is found in the RGD loops and in the C-terminal segment. The interaction of two N-terminal clusters via two intermolecular disulfide bridges anchors the {alpha}{beta}chains of the acostatin dimers. The C-terminal clusters of the heterodimer project in opposite directions and form a larger angle between them in comparison with other dimeric disintegrins. Extensive interactions are observed between two heterodimers, revealing an {alpha}{beta}{beta}{alpha} acostatin tetramer. Further experiments are required to identify whether the {alpha}{beta}{beta}{alpha} acostatin complex plays a functional role in vivo.
Integrating conservation costs into sea level rise adaptive conservation prioritization
Directory of Open Access Journals (Sweden)
Mingjian Zhu
2015-07-01
Full Text Available Biodiversity conservation requires strategic investment as resources for conservation are often limited. As sea level rises, it is important and necessary to consider both sea level rise and costs in conservation decision making. In this study, we consider costs of conservation in an integrated modeling process that incorporates a geomorphological model (SLAMM, species habitat models, and conservation prioritization (Zonation to identify conservation priorities in the face of landscape dynamics due to sea level rise in the Matanzas River basin of northeast Florida. Compared to conservation priorities that do not consider land costs in the analysis process, conservation priorities that consider costs in the planning process change significantly. The comparison demonstrates that some areas with high conservation values might be identified as lower priorities when integrating economic costs in the planning process and some areas with low conservation values might be identified as high priorities when considering costs in the planning process. This research could help coastal resources managers make informed decisions about where and how to allocate conservation resources more wisely to facilitate biodiversity adaptation to sea level rise.
NCBI nr-aa BLAST: CBRC-BTAU-01-2645 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-BTAU-01-2645 ref|YP_069190.1| hypothetical protein YPTB0648 [Yersinia pseudotuberculosis... IP 32953] emb|CAH19888.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 32953] YP_069190.1 0.001 29% ...
NCBI nr-aa BLAST: CBRC-LAFR-01-0236 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-LAFR-01-0236 ref|NP_336748.1| hypothetical protein MT2277 [Mycobacterium tuberculosis... CDC1551] gb|AAK46562.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551] NP_336748.1 2.0 34% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-1320 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-1320 ref|YP_001100294.1| hypothetical protein HEAR2027 [Herminiimonas arsenico...xydans] emb|CAL62171.1| conserved hypothetical protein; putative membrane protein [Herminiimonas arsenicoxydans] YP_001100294.1 0.0 93% ...
Conservation businesses and conservation planning in a biological diversity hotspot.
Di Minin, Enrico; Macmillan, Douglas Craig; Goodman, Peter Styan; Escott, Boyd; Slotow, Rob; Moilanen, Atte
2013-08-01
The allocation of land to biological diversity conservation competes with other land uses and the needs of society for development, food, and extraction of natural resources. Trade-offs between biological diversity conservation and alternative land uses are unavoidable, given the realities of limited conservation resources and the competing demands of society. We developed a conservation-planning assessment for the South African province of KwaZulu-Natal, which forms the central component of the Maputaland-Pondoland-Albany biological diversity hotspot. Our objective was to enhance biological diversity protection while promoting sustainable development and providing spatial guidance in the resolution of potential policy conflicts over priority areas for conservation at risk of transformation. The conservation-planning assessment combined spatial-distribution models for 646 conservation features, spatial economic-return models for 28 alternative land uses, and spatial maps for 4 threats. Nature-based tourism businesses were competitive with other land uses and could provide revenues of >US$60 million/year to local stakeholders and simultaneously help meeting conservation goals for almost half the conservation features in the planning region. Accounting for opportunity costs substantially decreased conflicts between biological diversity, agricultural use, commercial forestry, and mining. Accounting for economic benefits arising from conservation and reducing potential policy conflicts with alternative plans for development can provide opportunities for successful strategies that combine conservation and sustainable development and facilitate conservation action. © 2013 Society for Conservation Biology.
Understanding Urban Demand for Wild Meat in Vietnam: Implications for Conservation Actions.
Directory of Open Access Journals (Sweden)
Rachel Shairp
Full Text Available Vietnam is a significant consumer of wildlife, particularly wild meat, in urban restaurant settings. To meet this demand, poaching of wildlife is widespread, threatening regional and international biodiversity. Previous interventions to tackle illegal and potentially unsustainable consumption of wild meat in Vietnam have generally focused on limiting supply. While critical, they have been impeded by a lack of resources, the presence of increasingly organised criminal networks and corruption. Attention is, therefore, turning to the consumer, but a paucity of research investigating consumer demand for wild meat will impede the creation of effective consumer-centred interventions. Here we used a mixed-methods research approach comprising a hypothetical choice modelling survey and qualitative interviews to explore the drivers of wild meat consumption and consumer preferences among residents of Ho Chi Minh City, Vietnam. Our findings indicate that demand for wild meat is heterogeneous and highly context specific. Wild-sourced, rare, and expensive wild meat-types are eaten by those situated towards the top of the societal hierarchy to convey wealth and status and are commonly consumed in lucrative business contexts. Cheaper, legal and farmed substitutes for wild-sourced meats are also consumed, but typically in more casual consumption or social drinking settings. We explore the implications of our results for current conservation interventions in Vietnam that attempt to tackle illegal and potentially unsustainable trade in and consumption of wild meat and detail how our research informs future consumer-centric conservation actions.
Understanding Urban Demand for Wild Meat in Vietnam: Implications for Conservation Actions
Shairp, Rachel; Veríssimo, Diogo; Fraser, Iain; Challender, Daniel; MacMillan, Douglas
2016-01-01
Vietnam is a significant consumer of wildlife, particularly wild meat, in urban restaurant settings. To meet this demand, poaching of wildlife is widespread, threatening regional and international biodiversity. Previous interventions to tackle illegal and potentially unsustainable consumption of wild meat in Vietnam have generally focused on limiting supply. While critical, they have been impeded by a lack of resources, the presence of increasingly organised criminal networks and corruption. Attention is, therefore, turning to the consumer, but a paucity of research investigating consumer demand for wild meat will impede the creation of effective consumer-centred interventions. Here we used a mixed-methods research approach comprising a hypothetical choice modelling survey and qualitative interviews to explore the drivers of wild meat consumption and consumer preferences among residents of Ho Chi Minh City, Vietnam. Our findings indicate that demand for wild meat is heterogeneous and highly context specific. Wild-sourced, rare, and expensive wild meat-types are eaten by those situated towards the top of the societal hierarchy to convey wealth and status and are commonly consumed in lucrative business contexts. Cheaper, legal and farmed substitutes for wild-sourced meats are also consumed, but typically in more casual consumption or social drinking settings. We explore the implications of our results for current conservation interventions in Vietnam that attempt to tackle illegal and potentially unsustainable trade in and consumption of wild meat and detail how our research informs future consumer-centric conservation actions. PMID:26752642
Understanding Urban Demand for Wild Meat in Vietnam: Implications for Conservation Actions.
Shairp, Rachel; Veríssimo, Diogo; Fraser, Iain; Challender, Daniel; MacMillan, Douglas
2016-01-01
Vietnam is a significant consumer of wildlife, particularly wild meat, in urban restaurant settings. To meet this demand, poaching of wildlife is widespread, threatening regional and international biodiversity. Previous interventions to tackle illegal and potentially unsustainable consumption of wild meat in Vietnam have generally focused on limiting supply. While critical, they have been impeded by a lack of resources, the presence of increasingly organised criminal networks and corruption. Attention is, therefore, turning to the consumer, but a paucity of research investigating consumer demand for wild meat will impede the creation of effective consumer-centred interventions. Here we used a mixed-methods research approach comprising a hypothetical choice modelling survey and qualitative interviews to explore the drivers of wild meat consumption and consumer preferences among residents of Ho Chi Minh City, Vietnam. Our findings indicate that demand for wild meat is heterogeneous and highly context specific. Wild-sourced, rare, and expensive wild meat-types are eaten by those situated towards the top of the societal hierarchy to convey wealth and status and are commonly consumed in lucrative business contexts. Cheaper, legal and farmed substitutes for wild-sourced meats are also consumed, but typically in more casual consumption or social drinking settings. We explore the implications of our results for current conservation interventions in Vietnam that attempt to tackle illegal and potentially unsustainable trade in and consumption of wild meat and detail how our research informs future consumer-centric conservation actions.
International Nuclear Information System (INIS)
Sadek, M.A.; Tawfik, F.S.
2002-01-01
The point source contamination mechanism and the deterministic conservative approach have been implemented to demonstrate the hazards of hydrological pollution due to a major hypothetical accident in the second research reactor at Inshas. The radioactive inventory is assumed to be dissolved in 75% of the cooling water (25% are lost) and comes directly into contact with ground water and moved down gradient. Five radioisotopes(I-129, Sr-90, Ru-106, Cs-134 and Cs-137) of the entire inventory are found to be highly durable and represent vulnerability in the environment. Their downstream spread indices; C max : maximum concentration at the focus of the moving ellipse, delta: pollution duration at different distances, A:polluted area at different distances and X min : safety distance from the reactor, were calculated based on analytical solutions of the convection-dispersion partial differential equation for absorbable and decaying species. The largest downstream contamination range was found for Sr-90 and Ru-106 but still no potential. The geochemical and hydrological parameters of the water bearing formations play a great role in buffering and limiting the radiation effects. These reduce the retention time of the radioisotopes several order of magnitudes in the polluted distances. Sensitivity analysis of the computed pollution ranges shows low sensitivity to possible potential for variations activity of nuclide inventory, dispersivity and saturated thickness and high sensitivity for possible variations in groundwater velocity and retention factors
Barta, Michael L.; Thomas, Keisha; Yuan, Hongling; Lovell, Scott; Battaile, Kevin P.; Schramm, Vern L.; Hefty, P. Scott
2014-01-01
The obligate intracellular human pathogen Chlamydia trachomatis is the etiological agent of blinding trachoma and sexually transmitted disease. Genomic sequencing of Chlamydia indicated this medically important bacterium was not exclusively dependent on the host cell for energy. In order for the electron transport chain to function, electron shuttling between membrane-embedded complexes requires lipid-soluble quinones (e.g. menaquionone or ubiquinone). The sources or biosynthetic pathways required to obtain these electron carriers within C. trachomatis are poorly understood. The 1.58Å crystal structure of C. trachomatis hypothetical protein CT263 presented here supports a role in quinone biosynthesis. Although CT263 lacks sequence-based functional annotation, the crystal structure of CT263 displays striking structural similarity to 5′-methylthioadenosine nucleosidase (MTAN) enzymes. Although CT263 lacks the active site-associated dimer interface found in prototypical MTANs, co-crystal structures with product (adenine) or substrate (5′-methylthioadenosine) indicate that the canonical active site residues are conserved. Enzymatic characterization of CT263 indicates that the futalosine pathway intermediate 6-amino-6-deoxyfutalosine (kcat/Km = 1.8 × 103 m−1 s−1), but not the prototypical MTAN substrates (e.g. S-adenosylhomocysteine and 5′-methylthioadenosine), is hydrolyzed. Bioinformatic analyses of the chlamydial proteome also support the futalosine pathway toward the synthesis of menaquinone in Chlamydiaceae. This report provides the first experimental support for quinone synthesis in Chlamydia. Menaquinone synthesis provides another target for agents to combat C. trachomatis infection. PMID:25253688
Shankar, Manoharan; Hossain, Mohammad S; Biswas, Indranil
2017-04-15
Streptococcus mutans , an oral pathogen associated with dental caries, colonizes tooth surfaces as polymicrobial biofilms known as dental plaque. S. mutans expresses several virulence factors that allow the organism to tolerate environmental fluctuations and compete with other microorganisms. We recently identified a small hypothetical protein (90 amino acids) essential for the normal growth of the bacterium. Inactivation of the gene, SMU.2137, encoding this protein caused a significant growth defect and loss of various virulence-associated functions. An S. mutans strain lacking this gene was more sensitive to acid, temperature, osmotic, oxidative, and DNA damage-inducing stresses. In addition, we observed an altered protein profile and defects in biofilm formation, bacteriocin production, and natural competence development, possibly due to the fitness defect associated with SMU.2137 deletion. Transcriptome sequencing revealed that nearly 20% of the S. mutans genes were differentially expressed upon SMU.2137 deletion, thereby suggesting a pleiotropic effect. Therefore, we have renamed this hitherto uncharacterized gene as sprV ( s treptococcal p leiotropic r egulator of v irulence). The transcript levels of several relevant genes in the sprV mutant corroborated the phenotypes observed upon sprV deletion. Owing to its highly conserved nature, inactivation of the sprV ortholog in Streptococcus gordonii also resulted in poor growth and defective UV tolerance and competence development as in the case of S. mutans Our experiments suggest that SprV is functionally distinct from its homologs identified by structure and sequence homology. Nonetheless, our current work is aimed at understanding the importance of SprV in the S. mutans biology. IMPORTANCE Streptococcus mutans employs several virulence factors and stress resistance mechanisms to colonize tooth surfaces and cause dental caries. Bacterial pathogenesis is generally controlled by regulators of fitness that are
NCBI nr-aa BLAST: CBRC-LAFR-01-0796 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-LAFR-01-0796 ref|YP_956143.1| hypothetical protein Mvan_5366 [Mycobacterium vanba...alenii PYR-1] gb|ABM16137.1| conserved hypothetical protein [Mycobacterium vanbaalenii PYR-1] YP_956143.1 0.011 41% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0736 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0736 ref|YP_953764.1| hypothetical protein Mvan_2952 [Mycobacterium vanba...alenii PYR-1] gb|ABM13758.1| conserved hypothetical protein [Mycobacterium vanbaalenii PYR-1] YP_953764.1 0.60 31% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0074 ref|YP_317715.1| hypothetical protein Nwi_1101 [Nitrobacter winogradsky...i Nb-255] gb|ABA04363.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255] YP_317715.1 6.5 24% ...
NCBI nr-aa BLAST: CBRC-EEUR-01-0426 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-EEUR-01-0426 ref|YP_069190.1| hypothetical protein YPTB0648 [Yersinia pseudotuberculosis... IP 32953] emb|CAH19888.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 32953] YP_069190.1 3e-11 31% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-2631 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2631 ref|YP_016140.1| hypothetical protein MMOB4430 [Mycoplasma mobile... 163K] gb|AAT27929.1| conserved hypothetical membrane protein [Mycoplasma mobile 163K] YP_016140.1 0.008 27% ...
NCBI nr-aa BLAST: CBRC-TGUT-17-0005 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TGUT-17-0005 ref|YP_864863.1| hypothetical protein Mmc1_0939 [Magnetococcus sp.... MC-1] gb|ABK43457.1| conserved hypothetical protein [Magnetococcus sp. MC-1] YP_864863.1 0.94 32% ...
NCBI nr-aa BLAST: CBRC-LAFR-01-1699 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-LAFR-01-1699 ref|YP_065279.1| hypothetical protein DP1543 [Desulfotalea psychr...ophila LSv54] emb|CAG36272.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54] YP_065279.1 0.69 29% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-0213 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-0213 ref|YP_065102.1| hypothetical protein DP1366 [Desulfotalea psychr...ophila LSv54] emb|CAG36095.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54] YP_065102.1 6.0 22% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-0335 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-0335 ref|YP_001430589.1| hypothetical protein Rcas_0440 [Roseiflexus c...astenholzii DSM 13941] gb|ABU56571.1| conserved hypothetical protein [Roseiflexus castenholzii DSM 13941] YP_001430589.1 1.6 30% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0933 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0933 ref|YP_001430412.1| hypothetical protein Rcas_0261 [Roseiflexus c...astenholzii DSM 13941] gb|ABU56394.1| conserved hypothetical protein [Roseiflexus castenholzii DSM 13941] YP_001430412.1 4.6 32% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-2676 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-BTAU-01-2676 ref|YP_678738.1| hypothetical protein CHU_2133 [Cytophaga hutchinson...ii ATCC 33406] gb|ABG59396.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406] YP_678738.1 0.11 23% ...
NCBI nr-aa BLAST: CBRC-PMAR-01-0373 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PMAR-01-0373 ref|YP_676710.1| hypothetical protein CHU_0076 [Cytophaga hutchinson...ii ATCC 33406] gb|ABG57370.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406] YP_676710.1 8.8 25% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-1085 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-1085 ref|YP_678347.1| hypothetical protein CHU_1738 [Cytophaga hutchinson...ii ATCC 33406] gb|ABG59005.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406] YP_678347.1 0.90 23% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-2145 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-2145 ref|YP_676712.1| hypothetical protein CHU_0078 [Cytophaga hutchinson...ii ATCC 33406] gb|ABG57372.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406] YP_676712.1 0.16 24% ...
KADIS: a program to analyse the disassembly phase of hypothetical accidents in LMFBRs
International Nuclear Information System (INIS)
Schmuck, P.; Jacobs, G.; Arnecke, G.
1977-11-01
The program KADIS models the disassembly phase during power excursions in LMFBR hypothetical accidents. KADIS is based on point kinetics in the neutronics part and on a 2-dimensional representation of the reactor core in the hydrodynamics part. The core is modeled as an ideal, compressible fluid which is heated up adiabatically during the excursion. KADIS was built up with the help of the VENUS program of Argonne National Laboratory. Several important features were added to the basic VENUS model. Therefore we give first a complete description of the mathematical models used. Secondly we provide the user with the necessary information to handle the input/output of KADIS. (orig.) [de
Theoretical and hypothetical framework for research on political socialization process in the family
Directory of Open Access Journals (Sweden)
Čičkarić Lilijana
2005-01-01
Full Text Available The aim of the article is to sum up theoretical and hypothetical framework for empirical research of political socialization process in the family in Serbian society nowadays. The investigation focuses on two theoretical concepts, political socialization and generation as a sociological paradigm. Two methodological approaches are applied. First is interactive model of political socialization, based on analysis of relations between individual who is socialized, agents of political socialization, dominant political system and peripheral social sub-systems. The second one tests interactive relation of generation, lifecycle and effects of epoch. It is suitable for definition of certain historical periods with active role of political.
MCCI study for Pressurized Heavy Water Reactor under hypothetical accident condition
International Nuclear Information System (INIS)
Verma, Vishnu; Mukhopadhyay, Deb; Chatterjee, B.; Singh, R.K.; Vaze, K.K.
2011-01-01
In case of severe core damage accident in Pressurized Heavy Water Reactor (PHWR), large amount of molten corium is expected to come out into the calandria vault due to failure of calandria vessel. Molten corium at high temperature is sufficient to decompose and ablate concrete. Such attack could fail CV by basement penetration. Since containment is ultimate barrier for activity release. The Molten Core Concrete Interaction (MCCI) of the resulting pool of debris with the concrete has been identified as an important part of the accident sequence. MCCI Analysis has been carried out for PHWR for a hypothetical accident condition where total core material is considered to be relocated in calandria vault. Concrete ablation rate in vertical and radial direction is evaluated for rectangular geometry using MEDICIS module of ASTEC Code. Amount of gases released during MCCI is also evaluated. (author)
Zimmermann, C; Baldo, C; Molino, A
2000-03-01
To examine the effects of framing of outcome and probabilities of cancer occurrence on the treatment preference which breast cancer patients indicate for hypothetical patient scenarios. A modified version of the Decision Board Instrument (Levine et al. 1992) was administered to 35 breast cancer patients with past ACT experience. Patients expressed their choice regarding ACT for six scenarios which were characterized by either negative or positive framing of outcome and by one of the three levels of probability of recurrence (high, medium, low). The framing had no influence on ACT choices over all three probability levels. The majority chose ACT for high and medium risk and one third switched from ACT to No ACT in the low-risk condition. This switch was statistically significant. Hypothetical treatment decisions against ACT occur only when the probability of recurrence is low and the benefit of ACT is small. This finding for patients with past experience of ACT is similar to those reported for other oncological patient groups still in treatment.
NCBI nr-aa BLAST: CBRC-PMAR-01-0605 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PMAR-01-0605 ref|YP_950947.1| hypothetical protein Mvan_0090 [Mycobacterium vanba...alenii PYR-1] gb|ABM10941.1| conserved hypothetical protein [Mycobacterium vanbaalenii PYR-1] YP_950947.1 1e-06 28% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-1927 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-1927 ref|YP_001357187.1| hypothetical protein NIS_1724 [Nitratiruptor ...sp. SB155-2] dbj|BAF70830.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2] YP_001357187.1 2.1 27% ...
NCBI nr-aa BLAST: CBRC-GGAL-35-0388 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-35-0388 ref|YP_184257.1| hypothetical protein TK1844 [Thermococcus kodaka...rensis KOD1] dbj|BAD86033.1| hypothetical membrane protein, conserved [Thermococcus kodakarensis KOD1] YP_184257.1 5.1 30% ...
NCBI nr-aa BLAST: CBRC-PMAR-01-0384 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PMAR-01-0384 ref|YP_439624.1| hypothetical protein BTH_II1428 [Burkholderia thailand...ensis E264] gb|ABC34039.1| conserved hypothetical protein [Burkholderia thailandensis E264] YP_439624.1 2.3 36% ...
NCBI nr-aa BLAST: CBRC-DRER-14-0059 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-14-0059 ref|YP_683352.1| hypothetical protein RD1_3158 [Roseobacter denit...rificans OCh 114] gb|ABG32666.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] YP_683352.1 2.5 41% ...
NCBI nr-aa BLAST: CBRC-DRER-26-0529 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-26-0529 ref|YP_683352.1| hypothetical protein RD1_3158 [Roseobacter denit...rificans OCh 114] gb|ABG32666.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] YP_683352.1 2.5 41% ...
NCBI nr-aa BLAST: CBRC-CJAC-01-0362 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CJAC-01-0362 ref|YP_001431476.1| hypothetical protein Rcas_1362 [Roseiflexus c...astenholzii DSM 13941] gb|ABU57458.1| conserved hypothetical protein [Roseiflexus castenholzii DSM 13941] YP_001431476.1 9e-05 36% ...
Conservation and retrieval of information
International Nuclear Information System (INIS)
Jensen, M.
1993-01-01
High-level waste from nuclear power generation will remain radioactive for thousands of years even though 99% of the radioactivity will have decayed within the first millennium. For a hypothetical group involved in future actions to retrieve or repair a repository, information about its location, design, and content would be necessary. The need of such groups can be used to design the information that should be kept in a waste archive. Two main strategies exist for long-germ information transfer, one which links information thorough successive transfers of archived material and other forms of knowledge in society, and one - such as marking the site with a monument - relying upon a direct link from the present to the distant future. Digital methods are not recommended for long-term storage, but digital processing may be a valuable tool to structure information summaries, and in the creation of better long-lasting records. Advances in archive management should also be pursued to widen the choice of information carriers of high durability. In the Nordic countries, during the first few thousand years, and perhaps up to the next period of glaciation, monuments at a repository site may be used to warn the public of the presence of dangerous waste. But messages from such markers may pose interpretation problems as we have today for messages left by earlier societies such as rune inscriptions. Since the national borders may change in the time scale relevant for nuclear waste, the creation of an international archive for all radioactive wastes would represent an improvement as regards conservation and retrieval of information. (EG)
NCBI nr-aa BLAST: CBRC-MMUR-01-0729 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUR-01-0729 ref|YP_001601963.1| hypothetical protein GDI_1718 [Gluconacetobacter diazo...trophicus PAl 5] ref|YP_002277838.1| hypothetical protein Gdia_3499 [Gluconacetobacter diazotrophic...us PAl 5] emb|CAP55661.1| putative membrane protein [Gluconacetobacter diazotrophicus PAl 5] gb|ACI53223.1| ...conserved hypothetical protein [Gluconacetobacter diazotrophicus PAl 5] YP_001601963.1 0.11 24% ...
Directory of Open Access Journals (Sweden)
Arif Khan
2016-03-01
Full Text Available Typhoid fever is a major cause of illness in most developing countries, including Bangladesh. In quest of new potential drug against Typhoid fever, the current study was designed to elucidate structural and functional details of S. typhi hypothetical protein (HP R_27. HP R_27 has the primary amino acid sequences available only. The structural annotation was determined by ProtParam, SOPMA, and CELLO. The three-dimensional (3D structure of HP R_27 predicted through homology modeling by using Phyre2. The 3D structure then refined and verified by ModRefiner, PROCHECK, ERRAT, QMEAN. The functional annotation was also performed by InterProScan, SMART, Pfam, NCBI-CDD and found Phospholipase D-like and DNA repair activity. Multiple sequence alignment also supported the existence of PLD-like domain and DNA repair protein domain in the selected hypothetical protein sequences. Finally, the cavity of drug binding was also identified to assist further molecular docking study and potent inhibitor identification. This in silico approach can be further utilized in molecular drug design for other clinically significant pathogens.
International Nuclear Information System (INIS)
Denis-Petit, D.; Bonnet, T.; Hannachi, F.; Gobet, F.; Tarisien, M.; Versteegen, M.; Comet, M.; Gosselin, G.; Meot, V.; Morel, P.; Pain, J.Ch.; Gilleron, F.; Frank, A.; Bagnoud, V.; Blazevic, A.; Dorchies, F.; Peyrusse, O.; Cayzac, W.; Roth, M.
2014-01-01
The X-rays emitted by a rubidium plasma source created by the PHELIX laser at an intensity of about 6*10"1"4 W/cm"2 were studied. The lines have been measured using Bragg crystals in the wavelength range between 3.8 and 7.3 Angstroms and identified by means of a numerical method developed to describe highly charged rubidium ions in LTE plasma. The experimental plasma temperature, density and charge state distributions have been estimated using non-LTE codes such as CHIVAS and AVERROES. The LTE plasma temperature and density used in the calculations are those allowing to reproduce the calculated NLTE charge state distribution. In order to optimize the use of computational resources, a criterion is established to select the configurations contributing most to the spectra among all those obtained in detailed level accounting based on the MCDF code. Seventy Rb-X-rays have been identified among which forty-nine are reported for the first time. The capabilities of our method are demonstrated by the good agreement of our identifications with previously published data when available. (authors)
Neutronics simulations on hypothetical power excursion and possible core melt scenarios in CANDU6
International Nuclear Information System (INIS)
Kim, Yonghee
2015-01-01
LOCA (Loss of coolant accident) is an outstanding safety issue in the CANDU reactor system since the coolant void reactivity is strongly positive. To deal with the LOCA, the CANDU systems are equipped with specially designed quickly-acting secondary shutdown system. Nevertheless, the so-called design-extended conditions are requested to be taken into account in the safety analysis for nuclear reactor systems after the Fukushima accident. As a DEC scenario, the worst accident situation in a CANDU reactor system is a unprotected LOCA, which is supposed to lead to a power excursion and possibly a core melt-down. In this work, the hypothetical unprotected LOCA scenario is simulated in view of the power excursion and fuel temperature changes by using a simplified point-kinetics (PK) model accounting for the fuel temperature change. In the PK model, the core reactivity is assumed to be affected by a large break LOCA and the fuel temperature is simulated to account for the Doppler effect. In addition, unlike the conventional PK simulation, we have also considered the Xe-I model to evaluate the impact of Xe during the LOCA. Also, we tried to simulate the fuel and core melt-down scenario in terms of the reactivity through a series of neutronics calculations for hypothetical core conditions. In case of a power excursion and possible fuel melt-down situation, the reactor system behavior is very uncertain. In this work, we tried to understand the impacts of fuel melt and relocation within the pressure vessel on the core reactivity and failure of pressure and calandria tubes. (author)
Analyses of hypothetical nuclear criticality excursions in 10- and 20-MW freezer/sublimer vessels
International Nuclear Information System (INIS)
Haught, C.F.; Jordan, W.C.; Basoglu, B.; Dodds, H.L.; Wilkinson, A.D.
1995-01-01
A theoretical model is used to predict the consequences of a postulated hypothetical nuclear criticality excursion in a freezer/sublimer (F/S). Previous work has shown that an intrusion of water into a F/S may result in a critical configuration. A first attempt is made to model the neutronic and thermal-hydraulic phenomena occurring during a criticality excursion involving both uranium hexafluoride (UF 6 ) and uranyl fluoride (UO 2 F 2 ) solution, which is present in the F/S during upset conditions. The model employs point neutronics coupled with simple thermal hydraulics. Reactivity feedback from changes in the properties of the system are included in the model. The excursion is studied in a 10-MW F/S with an initial load of 3,500 kg of 5% weight enriched UF 6 and in a 20-MW F/S with an initial load of 6,800 kg of 2% weight enriched UF 6 . The magnitude of the fission release determined in this work is 5.93 x 10 18 fissions in the 10-MW F/S and 4.21 x 10 18 fissions in the 20-MW F/S. In order to demonstrate the reliability of the techniques used in this work, a limited validation study was conducted by comparing the fission release and peak fission rate determined by this work with experimental results for a limited number of experiments. The agreement between calculations and experiments in the validation study is considered to be satisfactory. The calculational results for the hypothetical accidents in the two F/S vessels appear reasonable
NCBI nr-aa BLAST: CBRC-TTRU-01-0085 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0085 ref|YP_001648035.1| hypothetical protein BcerKBAB4_5264 [Bacillus weihenstep...hanensis KBAB4] gb|ABY46407.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] YP_001648035.1 0.002 26% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...
NCBI nr-aa BLAST: CBRC-DNOV-01-2770 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-2770 ref|YP_925972.1| hypothetical protein Sama_0090 [Shewanella amazon...ensis SB2B] gb|ABL98302.1| conserved hypothetical protein [Shewanella amazonensis SB2B] YP_925972.1 1.8 34% ...
NCBI nr-aa BLAST: CBRC-DRER-26-0448 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-26-0448 ref|YP_682608.1| hypothetical protein RD1_2346 [Roseobacter denit...rificans OCh 114] gb|ABG31922.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] YP_682608.1 2e-89 38% ...
NCBI nr-aa BLAST: CBRC-PHAM-01-0706 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PHAM-01-0706 ref|YP_001504998.1| hypothetical protein Franean1_0633 [Frankia s...p. EAN1pec] gb|ABW10092.1| conserved hypothetical protein [Frankia sp. EAN1pec] YP_001504998.1 0.63 35% ...
NCBI nr-aa BLAST: CBRC-LAFR-01-1090 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-LAFR-01-1090 ref|YP_001404451.1| hypothetical protein Mboo_1290 [Candidatus Methanoregula boo...nei 6A8] gb|ABS55808.1| conserved hypothetical protein [Candidatus Methanoregula boonei 6A8] YP_001404451.1 0.018 21% ...
Identification of a hypothetical membrane protein interactor of ...
Indian Academy of Sciences (India)
Unknown
characterized earlier through co-precipitation studies us- ing antibodies against this conserved carboxyl-terminal region (Rich and Steitz 1987). Protein P0 is also involved at the eEF2 elongation factor-binding domain, as demon- strated in yeast (Justice et al 1999). The P0 protein, and not P1 and P2 proteins, is essential for ...
International Nuclear Information System (INIS)
Trontl, K.; Bace, M.; Pevec, D.
2002-01-01
The aim of this paper is to evaluate dose rates for a hypothetical accident with transport package containing Iridium-192 source and to design additional shielding necessary for the safe unloading of the container, assuming that during the unloading process the whole contents of a radioactive source is unshielded and that the operation is going to take place at the site where a working area exists in the vicinity of the unloading location. Based on the calculated radiation dose rates, a single arrangement of the additional concrete shields necessary for reduction of the gamma dose rates to the permitted level is proposed. The proposed solution is optimal considering safety on one hand and costs on the other.(author)
Vanderlinde, Elizabeth M.; Magnus, Samantha A.; Tambalo, Dinah D.; Koval, Susan F.; Yost, Christopher K.
2011-01-01
The bacterial cell envelope is of critical importance to the function and survival of the cell; it acts as a barrier against harmful toxins while allowing the flow of nutrients into the cell. It also serves as a point of physical contact between a bacterial cell and its host. Hence, the cell envelope of Rhizobium leguminosarum is critical to cell survival under both free-living and symbiotic conditions. Transposon mutagenesis of R. leguminosarum strain 3841 followed by a screen to isolate mutants with defective cell envelopes led to the identification of a novel conserved operon (RL3499-RL3502) consisting of a putative moxR-like AAA+ ATPase, a hypothetical protein with a domain of unknown function (designated domain of unknown function 58), and two hypothetical transmembrane proteins. Mutation of genes within this operon resulted in increased sensitivity to membrane-disruptive agents such as detergents, hydrophobic antibiotics, and alkaline pH. On minimal media, the mutants retain their rod shape but are roughly 3 times larger than the wild type. On media containing glycine or peptides such as yeast extract, the mutants form large, distorted spheres and are incapable of sustained growth under these culture conditions. Expression of the operon is maximal during the stationary phase of growth and is reduced in a chvG mutant, indicating a role for this sensor kinase in regulation of the operon. Our findings provide the first functional insight into these genes of unknown function, suggesting a possible role in cell envelope development in Rhizobium leguminosarum. Given the broad conservation of these genes among the Alphaproteobacteria, the results of this study may also provide insight into the physiological role of these genes in other Alphaproteobacteria, including the animal pathogen Brucella. PMID:21357485
Astrophysical implications of hypothetical stable TeV-scale black holes
Giddings, Steven B
2008-01-01
We analyze macroscopic effects of TeV-scale black holes, such as could possibly be produced at the LHC, in what is regarded as an extremely hypothetical scenario in which they are stable and, if trapped inside Earth, begin to accrete matter. We examine a wide variety of TeV-scale gravity scenarios, basing the resulting accretion models on first-principles, basic, and well-tested physical laws. These scenarios fall into two classes, depending on whether accretion could have any macroscopic effect on the Earth at times shorter than the Sun's natural lifetime. We argue that cases with such effect at shorter times than the solar lifetime are ruled out, since in these scenarios black holes produced by cosmic rays impinging on much denser white dwarfs and neutron stars would then catalyze their decay on timescales incompatible with their known lifetimes. We also comment on relevant lifetimes for astronomical objects that capture primordial black holes. In short, this study finds no basis for concerns that TeV-scale...
Du, Erhu; Cai, Ximing; Brozović, Nicholas; Minsker, Barbara
2017-05-01
Agricultural water markets are considered effective instruments to mitigate the impacts of water scarcity and to increase crop production. However, previous studies have limited understanding of how farmers' behaviors affect the performance of water markets. This study develops an agent-based model to explicitly incorporate farmers' behaviors, namely irrigation behavior (represented by farmers' sensitivity to soil water deficit λ) and bidding behavior (represented by farmers' rent seeking μ and learning rate β), in a hypothetical water market based on a double auction. The model is applied to the Guadalupe River Basin in Texas to simulate a hypothetical agricultural water market under various hydrological conditions. It is found that the joint impacts of the behavioral parameters on the water market are strong and complex. In particular, among the three behavioral parameters, λ affects the water market potential and its impacts on the performance of the water market are significant under most scenarios. The impacts of μ or β on the performance of the water market depend on the other two parameters. The water market could significantly increase crop production only when the following conditions are satisfied: (1) λ is small and (2) μ is small and/or β is large. The first condition requires efficient irrigation scheduling, and the second requires well-developed water market institutions that provide incentives to bid true valuation of water permits.
Skinnider, Michael A; Dejong, Chris A; Franczak, Brian C; McNicholas, Paul D; Magarvey, Nathan A
2017-08-16
Natural products represent a prominent source of pharmaceutically and industrially important agents. Calculating the chemical similarity of two molecules is a central task in cheminformatics, with applications at multiple stages of the drug discovery pipeline. Quantifying the similarity of natural products is a particularly important problem, as the biological activities of these molecules have been extensively optimized by natural selection. The large and structurally complex scaffolds of natural products distinguish their physical and chemical properties from those of synthetic compounds. However, no analysis of the performance of existing methods for molecular similarity calculation specific to natural products has been reported to date. Here, we present LEMONS, an algorithm for the enumeration of hypothetical modular natural product structures. We leverage this algorithm to conduct a comparative analysis of molecular similarity methods within the unique chemical space occupied by modular natural products using controlled synthetic data, and comprehensively investigate the impact of diverse biosynthetic parameters on similarity search. We additionally investigate a recently described algorithm for natural product retrobiosynthesis and alignment, and find that when rule-based retrobiosynthesis can be applied, this approach outperforms conventional two-dimensional fingerprints, suggesting it may represent a valuable approach for the targeted exploration of natural product chemical space and microbial genome mining. Our open-source algorithm is an extensible method of enumerating hypothetical natural product structures with diverse potential applications in bioinformatics.
International Nuclear Information System (INIS)
Min, Byung-Il; Periáñez, Raúl; Park, Kihyun; Kim, In-Gyu; Suh, Kyung-Suk
2014-01-01
Highlights: • An oceanic dispersion assessment system has been developed. • The developed system is based on a database of tidal harmonic constants. • It used to evaluate pollutant behavior for the hypothetical nuclear accident. • It can predict the pollutant distributions with real-time in the ocean. - Abstract: The eleven nuclear power plants in operation, under construction and a well-planned plant in the east coast of China generally use seawater for reactor cooling. In this study, an oceanic dispersion assessment system based on a database of tidal harmonic constants is developed. This system can calculate the tidal current without a large computational cost, and it is possible to calculate real-time predictions of pollutant dispersions in the ocean. Calculated amplitudes and phases have maximum errors of 10% and 20% with observations, respectively. A number of hypothetical simulations were performed according to varying of the release starting time and duration of pollutant for the six nuclear sites in China. The developed system requires a computational time of one hour for one month of real-time forecasting in Linux OS. Thus, it can use to evaluate rapidly the dispersion characteristics of the pollutants released into the sea from a nuclear accident
77 FR 59712 - Energy Conservation Program: Energy Conservation Standards for Dishwashers
2012-10-01
... amended energy conservation standards, DOE conducted a market survey using all available public... Energy Conservation Program: Energy Conservation Standards for Dishwashers AGENCY: Office of Energy... establish amended energy conservation standards for dishwashers in the Federal Register on May 30, 2012. DOE...
International Nuclear Information System (INIS)
Albendea, M.
2014-01-01
Iberdrola is developing a new application to calculate the inventory of radiological material, then of a hypothetical accident, with the name of inventory. This application allows you to calculate the inventory isotopic, analysers and accurate thermal of all or part of the nucleus of the plant of Cofrentes, even of any single element, based on its history of irradiation and specific periods of decay, since the reactor at any time after the shutdown. (Author)
International Nuclear Information System (INIS)
1992-09-01
The purpose of this volume is to report the results of the comparison of the ALWR plan parameters envelope with values of site characteristics developed for our hypothetical sites that generally represent conditions encountered within the United States. This effort is not intended to identify or address the suitability of any existing site, site area, or region in the United States. Also included in this volume is Appendix F, SERCH Summaries Regarding Siting
Structural transitions in crystals of native aspartate carbamoyltransferase
International Nuclear Information System (INIS)
Gouaux, J.E.; Lipscomb, W.N.
1989-01-01
Screened precession x-ray photographs of crystals of native aspartate carbamoyltransferase ligated with L-aspartate and phosphate reveal the presence of a crystal unit-cell dimension that is intermediate between the T (tense) and R (relaxed) states. Characterizing the intermediate (I) crystal is a c-axis unit-cell dimension of 149 angstrom, halfway between the c-axis length of the T (c = 142 angstrom) and R (c = 156 angstrom) states, in the space group P321. Preservation of the P321 space group indicates that the intermediate crystal form retains a threefold axis of symmetry, and therefore the enzyme has at minimum a threefold axis; however, it is not known whether the molecular twofold axis is conserved. The I crystals are formed by soaking T-state crystals with L-aspartate and phosphate. By raising the concentration of L-aspartate the authors can further transform the I crystals, without fragmentation, to a form that has the same unit-cell dimensions as R-state crystals grown in the presence of N-(phosphonoacetyl)-L-aspartate
International Nuclear Information System (INIS)
Kobayashi, Takuya; Nagai, Haruyasu; Chino, Masamichi; Togawa, Orihiko
2004-01-01
A software system SPEEDI-MP is being developed to resolve the environmental problems by simulating the behavior of pollutants in the atmospheric, oceanic and terrestrial environment. Verification of oceanic dispersion prediction codes on the system was carried out to assess the migration behavior of the released 241 Am from a hypothetically sunken nuclear submarine in the Japan Sea. (author)
Energy Technology Data Exchange (ETDEWEB)
None
1980-01-11
A task was undertaken to develop a method for analyzing industrial user responses to alternative rate designs. The method described considers the fuel switching and conservation responses of industrial users and the impact to a hypothetical utility regarding revenue stability, annual gas demand, and seasonal fluctuations. Twenty-seven hypothetical industrial plant types have been specified. For each combustor in the plant, the fuel consumption by season, initial fuel type, fuel switching costs, conservation costs, and amount of fuel conservable is provided. The decision making takes place at the plant level and is aggregated to determine the impact to the utility. Section 2 discusses the factors affecting an industrial user's response to alternative rate designs. Section 3 describes the methodology, includes an overview of the model and an example industrial user's response to a set of fuel prices. The data describing the 27 hypothetical firms is in an appendix.
How conserved are the conserved 16S-rRNA regions?
Directory of Open Access Journals (Sweden)
Marcel Martinez-Porchas
2017-02-01
Full Text Available The 16S rRNA gene has been used as master key for studying prokaryotic diversity in almost every environment. Despite the claim of several researchers to have the best universal primers, the reality is that no primer has been demonstrated to be truly universal. This suggests that conserved regions of the gene may not be as conserved as expected. The aim of this study was to evaluate the conservation degree of the so-called conserved regions flanking the hypervariable regions of the 16S rRNA gene. Data contained in SILVA database (release 123 were used for the study. Primers reported as matches of each conserved region were assembled to form contigs; sequences sizing 12 nucleotides (12-mers were extracted from these contigs and searched into the entire set of SILVA sequences. Frequency analysis shown that extreme regions, 1 and 10, registered the lowest frequencies. 12-mer frequencies revealed segments of contigs that were not as conserved as expected (≤90%. Fragments corresponding to the primer contigs 3, 4, 5b and 6a were recovered from all sequences in SILVA database. Nucleotide frequency analysis in each consensus demonstrated that only a small fraction of these so-called conserved regions is truly conserved in non-redundant sequences. It could be concluded that conserved regions of the 16S rRNA gene exhibit considerable variation that has to be considered when using this gene as biomarker.
Noteboom, H.P.
1985-01-01
The IUCN/WWF Plants Conservation Programme 1984 — 1985. World Wildlife Fund chose plants to be the subject of their fund-raising campaign in the period 1984 — 1985. The objectives were to: 1. Use information techniques to achieve the conservation objectives of the Plants Programme – to save plants;
International Nuclear Information System (INIS)
Bailly, H.W.
1988-01-01
The paper deals with experiments, computational models and methods used to describe the fission product transport (diffusion and particle failure) in the fuel elements of a pebble-bed high-temperature module reactor (HTGR Module) during hypothetical accidents. The codes which describe the diffusion of fission products in the fuel elements are e.g. GETTER and FRESCO. PANAMA, IA/KWU failure function and the so called GOODIN models describe the particle failure. All these models may be used in the risk analysis. The experimental results obtained at the Nuclear Research Center Julich, Germany are discussed and compared with the model calculations for these experiments
National Audubon Society, New York, NY.
This set of teaching aids consists of seven Audubon Nature Bulletins, providing the teacher and student with informational reading on various topics in conservation. The bulletins have these titles: Plants as Makers of Soil, Water Pollution Control, The Ground Water Table, Conservation--To Keep This Earth Habitable, Our Threatened Air Supply,…
Conservation Triage Falls Short Because Conservation Is Not Like Emergency Medicine
Directory of Open Access Journals (Sweden)
John A. Vucetich
2017-05-01
Full Text Available Conservation triage, as a concept, seems to have been born from analogizing circumstances that characterize conservation with triage, as the concept applies to emergency medicine. Careful consideration—facilitated through the aid of formal argumentation—demonstrates the critical limitations of the analogy. Those limitations reveal how the concept of conservation triage falls short. For example, medical triage presupposes that resources available for an emergency are limited and fixed. By contrast, the resources available for conservation are not fixed. Moreover, the ethics of prioritization in medical triage is characterized by there being universal agreement on the moral value of the patients. However, in conservation there is not universal agreement on the value of various objects of conservation concern. The looming importance of those features of conservation—disputed values and unfixed resources—make conservation triage a largely un-useful concept.
Haynos, Ann F; Roberto, Christina A
2017-03-01
Concerns have been raised that obesity public policy measures may have harmful effects on individuals with eating disorders. However, little research has investigated this topic. We examined the impact of a popular obesity public policy, menu calorie labeling, on hypothetical food choices of women with disordered eating. Seven hundred sixteen adult females completed an online survey in which they were randomly assigned to receive a restaurant menu with or without calorie information listed. Participants selected foods representative of a meal they would choose to consume and answered questions on restaurant ordering and menu labeling. Participants completed the Eating Disorder Examination Questionnaire (Fairburn & Beglin, ) to assess global eating pathology. Diagnoses of anorexia nervosa (AN), bulimia nervosa (BN), and binge-eating disorder (BED) were also derived from this measure. Generalized linear modeling examined the impact of menu label condition, disordered eating, and the menu label by disordered eating interaction on hypothetical food selection and related variables. When disordered eating was examined continuously, menu labeling did not differentially affect food selections of those with elevated disordered eating (p = .45). However, when examined by eating disorder diagnosis, participants with AN or BN ordered significantly fewer (p < .001) and participants with BED ordered significantly more (p = .001) calories in the menu label versus no label condition. Menu labeling may decrease the calories ordered among individuals with AN or BN and increase calories ordered among individuals with BED. © 2017 Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
O'Brien, R.S.; Yu, C.; Zeevaert, T.; Olyslaegers, G.; Amado, V.; Setlow, L.W.; Waggitt, P.W.
2008-01-01
This work was carried out as part of the International Atomic Energy Agency's EMRAS program. One aim of the work was to develop scenarios for testing computer models designed for simulating radionuclide migration in the environment, and to use these scenarios for testing the models and comparing predictions from different models. This paper presents the results of the development and testing of a hypothetical area source of NORM waste/residue using two complex computer models and one screening model. There are significant differences in the methods used to model groundwater flow between the complex models. The hypothetical source was used because of its relative simplicity and because of difficulties encountered in finding comprehensive, well-validated data sets for real sites. The source consisted of a simple repository of uniform thickness, with 1 Bq g -1 of uranium-238 ( 238 U) (in secular equilibrium with its decay products) distributed uniformly throughout the waste. These approximate real situations, such as engineered repositories, waste rock piles, tailings piles and landfills. Specification of the site also included the physical layout, vertical stratigraphic details, soil type for each layer of material, precipitation and runoff details, groundwater flow parameters, and meteorological data. Calculations were carried out with and without a cover layer of clean soil above the waste, for people working and living at different locations relative to the waste. The predictions of the two complex models showed several differences which need more detailed examination. The scenario is available for testing by other modelers. It can also be used as a planning tool for remediation work or for repository design, by changing the scenario parameters and running the models for a range of different inputs. Further development will include applying models to real scenarios and integrating environmental impact assessment methods with the safety assessment tools currently
Structure of recombinant Ves v 2 at 2.0 Angstrom resolution
DEFF Research Database (Denmark)
Skov, Lars K; Seppälä, Ulla; Coen, Jeremy J F
2006-01-01
Wasp venom from Vespula vulgaris contains three major allergens: Ves v 1, Ves v 2 and Ves v 5. Here, the cloning, expression, biochemical characterization and crystal structure determination of the hyaluronidase Ves v 2 from family 56 of the glycoside hydrolases are reported. The allergen...... was expressed in Escherichia coli as an insoluble protein and refolded and purified to obtain full enzymatic activity. Three N-glycosylation sites at Asn79, Asn99 and Asn127 were identified in Ves v 2 from a natural source by enzymatic digestions combined with MALDI-TOF mass spectrometry. The crystal structure...... of recombinant Ves v 2 was determined at 2.0 A resolution and reveals a central (beta/alpha)(7) core that is further stabilized by two disulfide bonds (Cys19-Cys308 and Cys185-Cys197). Based on sequence alignments and structural comparison with the honeybee allergen Api m 2, it is proposed that a conserved...
Setting conservation priorities.
Wilson, Kerrie A; Carwardine, Josie; Possingham, Hugh P
2009-04-01
A generic framework for setting conservation priorities based on the principles of classic decision theory is provided. This framework encapsulates the key elements of any problem, including the objective, the constraints, and knowledge of the system. Within the context of this framework the broad array of approaches for setting conservation priorities are reviewed. While some approaches prioritize assets or locations for conservation investment, it is concluded here that prioritization is incomplete without consideration of the conservation actions required to conserve the assets at particular locations. The challenges associated with prioritizing investments through time in the face of threats (and also spatially and temporally heterogeneous costs) can be aided by proper problem definition. Using the authors' general framework for setting conservation priorities, multiple criteria can be rationally integrated and where, how, and when to invest conservation resources can be scheduled. Trade-offs are unavoidable in priority setting when there are multiple considerations, and budgets are almost always finite. The authors discuss how trade-offs, risks, uncertainty, feedbacks, and learning can be explicitly evaluated within their generic framework for setting conservation priorities. Finally, they suggest ways that current priority-setting approaches may be improved.
International Nuclear Information System (INIS)
Wei, T.; Tobias, M.
1974-03-01
The work of the General Atomic Company (GAC) in preparing those portions of the Final Safety Analysis Report for the Fort St. Vrain Reactor (FSV) having to do with hypothetical nuclear driven accidents has been reviewed and a guide to this literature has been prepared. The sources for this study are the Final Safety Analysis Report itself, the Quarterly and Monthly Progress Reports, Topical Reports, and Technical Specifications. The problems considered and the methods used are outlined. An appendix gives a systematic analysis which was used as a guide in organizing the references. (U.S.)
Simulation and dose analysis of a hypothetical accident in Sanmen nuclear power plant
International Nuclear Information System (INIS)
Zhu, Yangmo; Guo, Jianghua; Nie, Chu; Zhou, Youhua
2014-01-01
Highlights: • Atmospheric dispersion following a hypothetical accident in Sanmen NPP is simulated. • Japan, North Korea and Russia are slightly influenced in this accident. • In Taiwan and South Korea, population on 100% and 35% of the land should be given information about reducing dose. • In mainland China, about 284 thousand people are likely to get cancer. - Abstract: In November 2013, an AP1000 nuclear power plant (NPP) will be put into commercial operation. An atmospheric dispersion of radionuclides during a severe hypothetical accident in Sanmen NPP, Zhejiang province, China, is simulated with a Lagrangian particle dispersion model FLEXPART. The accident assumes that a station blackout (SBO) accident occurred on August 25, 2011, 55% core was damaged and 49 radionuclides were released into the atmosphere. Our simulation indicates that, during this dispersion, the radioactive plume will cover the mainland China, Taiwan, Japan, North Korea, South Korea and Russia. The radiation dose levels in Japan, North Korea and Russia are the lightest, usually less than 1 mSv. The influenced areas in these countries are 9901 km 2 , 31,736 km 2 and 2,97,524 km 2 , respectively; dose levels in Taiwan and South Korea are moderate, no more than 20 mSv. Information about reducing dose should be given to the public. Total influenced areas in these two countries are 3621 km 2 and 42,370 km 2 , which take up 100% of the land in Taiwan and 35% of the land in South Korea; the worst situation happens in mainland China. The total influenced area is 3 × 106 km 2 and 1,40,000 km 2 in this area has a dose level higher than 20 mSv. Measurement must be taken to reduce the dose. More than 284 thousand residents will face the risk of developing cancer. Furthermore, 96% of this population is mainly concentrated in Zhejiang province, where Sanmen NPP locates
Energy Technology Data Exchange (ETDEWEB)
Leppaenen, A.P.; Solatie, D. [Radiation and Nuclear Safety Authority - STUK (Finland); Paatero, J. [Finnish Meteorological Institute (Finland)
2014-07-01
There are plans to open a new nuclear power plant in Northern Finland at Pyhaejoki. The currently planned reactor type is AES 2006 built by Rosenergoatom. The power output of the AES 2006 is 1200 MWe. In a hypothetical reactor accident at Pyhaejoki large amounts of radioactivity would be released to the environment in Northern Europe. With suitable wind conditions the contaminants would contaminate large areas in the Euro-Arctic region in Northern Scandinavia and in Kola Peninsula. Northern parts of Scandinavia belongs to the sub-arctic region where reindeer herding is an important livelihood for the local and for the indigenous Sami people. As a results of the CEEPRA-project ('Collaboration Network on Environmental Radiation Protection and Research') funded by the EU's Kolarctic ENPI CBC program estimated a possible fallout to Finnish Lapland from a hypothetical nuclear power plant accident occurring at the planned site. Lichen-reindeer-man food chain is an important food chain to the people living in Lapland from traditional and from economical point of views. The food chain is known to enrich radioactive contaminants efficiently. In case of nuclear fallout this food chain would be one of the primary sources of {sup 137}Cs into the inhabitants in Northern regions. The food chain has been well-studied where studies began in the 1960's and was intensified after the Chernobyl accident. This study concentrates on the effects caused by the hypothetical accident, occurring at the planned Pyhaejoki power plant, to the lichen-reindeer-man food chain. The transfer of {sup 137}Cs and {sup 134}Cs to the reindeer meat and possible doses to the man will be estimated. Document available in abstract form only. (authors)
Tisdell, Clement A.
2010-01-01
This paper outlines the significance of the concept of conservation value and discusses ways in which it is determined paying attention to views stemming from utilitarian ethics and from deontological ethics. The importance of user costs in relation to economic decisions about the conservation and use of natural resources is emphasised. Particular attention is given to competing views about the importance of conserving natural resources in order to achieve economic sustainability. This then l...
Lozano, José H
2016-02-01
Previous research aimed at testing the situational strength hypothesis suffers from serious limitations regarding the conceptualization of strength. In order to overcome these limitations, the present study attempts to test the situational strength hypothesis based on the operationalization of strength as reinforcement contingencies. One dispositional factor of proven effect on cooperative behavior, social value orientation (SVO), was used as a predictor of behavior in four social dilemmas with varying degree of situational strength. The moderating role of incentive condition (hypothetical vs. real) on the relationship between SVO and behavior was also tested. One hundred undergraduates were presented with the four social dilemmas and the Social Value Orientation Scale. One-half of the sample played the social dilemmas using real incentives, whereas the other half used hypothetical incentives. Results supported the situational strength hypothesis in that no behavioral variability and no effect of SVO on behavior were found in the strongest situation. However, situational strength did not moderate the effect of SVO on behavior in situations where behavior showed variability. No moderating effect was found for incentive condition either. The implications of these results for personality theory and assessment are discussed. © 2014 Wiley Periodicals, Inc.
Energy Technology Data Exchange (ETDEWEB)
Auluck, S. K. H., E-mail: skhauluck@gmail.com, E-mail: skauluck@barc.gov.in [Physics Group, Bhabha Atomic Research Center, Mumbai (India)
2014-09-15
Experimental data compiled over five decades of dense plasma focus research are consistent with the snowplow model of sheath propagation, based on the hypothetical balance between magnetic pressure driving the plasma into neutral gas ahead and “wind pressure” resisting its motion. The resulting sheath velocity, or the numerically proportional “drive parameter,” is known to be approximately constant for devices optimized for neutron production over 8 decades of capacitor bank energy. This paper shows that the validity of the snowplow hypothesis, with some correction, as well as the non-dependence of sheath velocity on device parameters, have their roots in local conservation laws for mass, momentum, and energy coupled with the ionization stability condition. Both upper and lower bounds on sheath velocity are shown to be related to material constants of the working gas and independent of the device geometry and capacitor bank impedance.
International Nuclear Information System (INIS)
Auluck, S. K. H.
2014-01-01
Experimental data compiled over five decades of dense plasma focus research are consistent with the snowplow model of sheath propagation, based on the hypothetical balance between magnetic pressure driving the plasma into neutral gas ahead and “wind pressure” resisting its motion. The resulting sheath velocity, or the numerically proportional “drive parameter,” is known to be approximately constant for devices optimized for neutron production over 8 decades of capacitor bank energy. This paper shows that the validity of the snowplow hypothesis, with some correction, as well as the non-dependence of sheath velocity on device parameters, have their roots in local conservation laws for mass, momentum, and energy coupled with the ionization stability condition. Both upper and lower bounds on sheath velocity are shown to be related to material constants of the working gas and independent of the device geometry and capacitor bank impedance
Study of an hypothetical reactor meltdown accident for a 50 MW sub(th) fast reactor
International Nuclear Information System (INIS)
Azevedo, E.M. de.
1983-01-01
A melhodology for determining the energy released in hypothetical reactor meltdown accidents is presented. A numerical code was developed based upon the Nicholson method for a uniform and homogeneous reactor with spherical geometry. A comparative study with other know programs in the literature which use better approximations for small energy released, shows that the methodology used were compatible with those under comparison. Besides the influence of some parameters on the energy released, such as the initial power level and the prompt neutron lifetime was studied under this metodology and its result exhibitted. The Doppler effect was also analyzed and its influence on the energy released has been emphasized. (Author) [pt
Protein (Cyanobacteria): 495466071 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available conserved hypothetical protein, ribA/ribD-fused Moorea producens MTIYFYDISEKPYGCFSNFSPHGFELDGLWWPTSEHYFQAQK...FAGTSHVEEIRSCKTPAEAASMGRERTRPLRRDWEEIKEDVMGRGLLCKFQTHADIREILLGTGDELIVEDAPQDYYWGCGKDRSGKNRLGEILMEIRAILRES
van Nieuwenhuijzen, M; Bijman, ER; Lamberix, ICW; Wijnroks, L; de Castro, BO; Vermeer, A; Matthys, W
Background Most research on children's social problem-solving skills is based on responses to hypothetical vignettes. Just how these responses relate to actual behaviour in real-life social situations is, however, unclear, particularly for children with mild intellectual disabilities (MID). Method
Daskalakis, S; Mantas, J
2009-01-01
The evaluation of a service-oriented prototype implementation for healthcare interoperability. A prototype framework was developed, aiming to exploit the use of service-oriented architecture (SOA) concepts for achieving healthcare interoperability and to move towards a virtual patient record (VPR) paradigm. The prototype implementation was evaluated for its hypothetical adoption. The evaluation strategy was based on the initial proposition of the DeLone and McLean model of information systems (IS) success [1], as modeled by Iivari [2]. A set of SOA and VPR characteristics were empirically encapsulated within the dimensions of IS success model, combined with measures from previous research works. The data gathered was analyzed using partial least squares (PLS). The results highlighted that system quality is a partial predictor of system use but not of user satisfaction. On the contrary, information quality proved to be a significant predictor of user satisfaction and partially a strong significant predictor of system use. Moreover, system use did not prove to be a significant predictor of individual impact whereas the bi-directional relation between use and user satisfaction did not confirm. Additionally, user satisfaction was found to be a strong significant predictor of individual impact. Finally, individual impact proved to be a strong significant predictor of organizational impact. The empirical study attempted to obtain hypothetical, but still useful beliefs and perceptions regarding the SOA prototype implementation. The deduced observations can form the basis for further investigation regarding the adaptability of SOA implementations with VPR characteristics in the healthcare domain.
International Nuclear Information System (INIS)
Mitake, S.; Suzuki, K.; Ohno, T.; Okada, T.
1982-01-01
A hypothetical rapid depressurization accident of the experimental VHTR has been analyzed, including all phenomena in the accident, from its initiating depressurization of the coolant to consequential radiological hazard. Based on reliability analysis of the engineered safety features, all possible sequences, in which the safety systems are in success or in failure, have been investigated with event tree analysis. The result shows the inherent safety characteristics of the reactor and the effectiveness of the engineered safety features. And through the analysis, it has been indicated that further investigations on some phenomena in the accident, e.g., air ingress by natural circulation flow and fission product transport in the plant, will bring forth more reasonable and sufficient safety of the reactor
Margles, Shawn W; Peterson, Richard B; Ervin, Jamison; Kaplin, Beth A
2010-01-01
Interdisciplinary approaches to conservation research and environmental management continue to garner interest among practitioners, academics, and students. Yet, cases of practitioners and researchers from different disciplines successfully working in concert towards an integrated conservation approach are rare. What is preventing practitioners of multiple disciplines from harmoniously working together? Why are practitioners and academics struggling to apply their graduate training to real world conservation? What is preventing the benefits of cooperation and partnerships between different disciplines addressing conservation from being realized? This special issue "Conservation without Borders: Building Communication and Action across Disciplinary Boundaries for Effective Conservation" asks readers to consider the numerous interpretations and implications of the phrase "Conservation without Borders" and to reflect on how different academic and disciplinary lenses can contribute to a more integrated approach to tackling conservation challenges. The articles that comprise this special issue offer readers insights into the ways in which different disciplines view conservation work and interdisciplinary approaches to environmental problems. Bringing these perspectives and approaches together in one place is a step towards improving communication across disciplines for the purpose of achieving more successful biodiversity conservation.
2013-12-06
... Conservation Program: Energy Conservation Standards for Commercial and Industrial Electric Motors; Proposed... Conservation Program: Energy Conservation Standards for Commercial and Industrial Electric Motors AGENCY... proposes energy conservation standards for a number of different groups of electric motors that DOE has not...
ORF Sequence: cds [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available KGSWTFYIMLLASFRIFFGLGLSLSPMESWTIMNVVHAGVTFIVFHWIKGNPFHTPWVDMMGKGEKQTWWEQIDGSVQNTPSRKFLICVVVFLYLAAVHSTPFERQFFFVHAVNLIAFLVVFVAKLPFMHGVRIFGINR ... cds gnl|CMER >gnl|CMER|CMQ020C hypothetical protein, conserved MQSGHGETRFDVGVEWLRA
Kawatsu, L; Uchimura, K; Izumi, K; Ohkado, A; Kato, S
2018-05-01
Despite a growing burden of foreign-born tuberculosis (TB) patients, Japan does not currently practise pre-entry tuberculosis (TB) screening among foreign-born entrants. To evaluate the impact of a hypothetical pre-entry TB screening programme among new foreign-born entrants into Japan. Using publicly available sources, we estimated 1) the number of prevalent TB cases, defined as bacteriologically or clinically confirmed cases among new foreign-born entrants into Japan in 2015, and 2) the yield from a hypothetical pre-entry TB screening programme under three scenarios: Scenario A, in which screening would be required of all applicants intending to stay for 3 months; Scenario B, screening among applicants for visas for settlement purposes; and Scenario C, screening among student and technical intern visa applicants. The numbers of prevalent TB cases under Scenarios A, B and C were respectively 492, 54 and 248 out of a total of 328 791, 21 554 and 182 879 applicants, respectively 276, 29 and 137 of whom would be detected via the pre-entry screening programme, giving an yield of respectively 83.9, 134.5 and 74.9 per 100 000 screened under each scenario. The yield was the highest under Scenario B; however, the impact was greatest under Scenario A, in that it detected the greatest number of patients and thus contributed the most in reducing the burden of foreign-born TB cases in Japan.
Handels, Ron L. H.; Joore, Manuela A.; Tran-Duy, An; Wimo, Anders; Wolfs, Claire A. G.; Verhey, Frans R. J.; Severens, Johan L.
Introduction: The study aimed to determine the room for improvement of a perfect cerebrospinal fluid (CSF) biomarker and the societal incremental net monetary benefit of CSF in subjects with mild cognitive impairment (MCI) assuming a hypothetical disease-modifying Alzheimer's disease (AD) treatment.
Fixism and conservation science.
Robert, Alexandre; Fontaine, Colin; Veron, Simon; Monnet, Anne-Christine; Legrand, Marine; Clavel, Joanne; Chantepie, Stéphane; Couvet, Denis; Ducarme, Frédéric; Fontaine, Benoît; Jiguet, Frédéric; le Viol, Isabelle; Rolland, Jonathan; Sarrazin, François; Teplitsky, Céline; Mouchet, Maud
2017-08-01
The field of biodiversity conservation has recently been criticized as relying on a fixist view of the living world in which existing species constitute at the same time targets of conservation efforts and static states of reference, which is in apparent disagreement with evolutionary dynamics. We reviewed the prominent role of species as conservation units and the common benchmark approach to conservation that aims to use past biodiversity as a reference to conserve current biodiversity. We found that the species approach is justified by the discrepancy between the time scales of macroevolution and human influence and that biodiversity benchmarks are based on reference processes rather than fixed reference states. Overall, we argue that the ethical and theoretical frameworks underlying conservation research are based on macroevolutionary processes, such as extinction dynamics. Current species, phylogenetic, community, and functional conservation approaches constitute short-term responses to short-term human effects on these reference processes, and these approaches are consistent with evolutionary principles. © 2016 Society for Conservation Biology.
A hypothetical severe reactor accident in Sosnovyj Bor, Russia
International Nuclear Information System (INIS)
Lahtinen, J.; Toivonen, H.; Poellaenen, R.; Nordlund, G.
1993-12-01
Individual doses and short-term radiological consequences from a hypothetical severe accident at the Russian nuclear power plant in Sosnovyj Bor were estimated for two sites in Finland. The sites are Kotka, located 140 km from the plant, and Helsinki, 220 km from the plant. The release was assumed to start immediately after the shutdown of the reactor (a 1000 MW RBMK unit) which had been operating at nominal power level for a long time. An effective release height of 500 m was assumed. The prevailing meteorological conditions during the release were taken to present the situation typical of the area (effective wind speed 9 m/s, neutral dispersion conditions). The release fractions applied in the study were of the same order as in the Chernobyl accident, i.e. 100% for noble gases, 60% for iodines, 40% for cesium and 1-10% for other radiologically important nuclides. The release was assumed to last 24 hours. However, half of the nuclides were released during the first hour. No attention was paid to the actual sequence of events that could lead to such release characteristics and time behaviour. The concentration and dose calculations were performed with a modified version of the computer code OIVA developed in Finnish Centre for Radiation and Nuclear Safety. Inhalation dose and external doses from the release plume and from the deposited activity were calculated for adults only, and no sheltering was considered. (11 refs., 4 figs., 6 tabs.)
Directory of Open Access Journals (Sweden)
Kerrie A Wilson
2016-09-01
Full Text Available Conservation triage seems to be at a stalemate between those who accept triage based on utilitarian rationalization, and those that reject it based on a number of ethical principles. We argue that without considered attention to the ethics of conservation triage we risk further polarization in the field of conservation. We draw lessons from the medical sector, where triage is more intuitive and acceptable, and also from disaster planning, to help navigate the challenges that triage entails for conservation science, practice, and policy. We clarify the consequentialist, deontological, and virtue ethical stances that influence the level of acceptance of triage. We emphasize the ethical dimensions of conservation triage in principle and in practice, particularly in the context of stakeholder diversity, a wide range of possible objectives and actions, broader institutions, and significant uncertainties. A focus on a more diverse set of ethics, more considered choice of triage as a conservation tool, open communication of triage objectives and protocols, greater consideration of risk preferences, and regular review and adaptation of triage protocols is required for conservation triage to become more acceptable among diverse conservation practitioners, institutions, and the general public. Accepting conservation triage as fundamentally an ethical problem would foster more open dialogue and constructive debate about the role of conservation triage in a wider system of care.
Looking for a hypothetical jovian metabolisms to explain a paucity of ammonia
Wong, M. L.
2017-12-01
One startling find from Juno's reconnaissance of Jupiter is a factor-of-two depletion from expected concentrations of NH3 in the 7-bar region of the atmosphere. Here, we investigate hypothetical NH3-consuming metabolisms of putative jovian life. Classically, astrobiologists state life's requirements as: liquid water, sources of CHNOPS, and the availability of free energy. On Jupiter, water clouds condense at a pressure of 7 bars—a region where the temperature is 300 K—providing droplets of liquid water. With its tight gravitational grip on hydrogen, Jupiter has bountiful reductants containing CHNOPS in the form of H2O, CH4, H2S, NH3, and PH3. However, the O-rich oxidants often considered for astrobiological systems on other worlds are largely absent. Instead, hypothetical metabolisms may rely on sulfur species as electron acceptors. Exposed to ultraviolet radiation, H2S will photolyze and react to form polysulfur (Sx, where x ≥ 8). Polysulfur may contribute to the coloration of Jupiter's upper atmosphere, particularly of the Great Red Spot. Polysulfur that rains down to the region of Jupiter's atmosphere where liquid water exists can provide significant redox disequilibrium from which free energy can be liberated. For instance, the reaction 16/3 NH3 + S8 ⟶ 8 H2S + 8/3 N2has a ΔG = -38.8 kJ per mol NH3 at 300 K and 7 bars. This reaction is promising in that: 1) it recycles S8 back to H2S, which can then be lofted to higher altitudes and create more S8; 2) it creates N2, which Juno cannot detect using its microwave radiometer. In order to be a plausible metabolism, we must show: 1) that this reaction is kinetically inhibited, i.e. that abiotic processes cannot easily resolve this disequilibrium; 2) that enough S8 is produced photochemically and is transported to the 7 bar region on short enough timescales to provide the requisite disequilibrium. Finally, copious lightning in the water cloud region—the flash rate has been estimated to be 30 flashes year-1
International Nuclear Information System (INIS)
Funayama, Kyoko; Kajimoto, Mitsuhiro; Nagayoshi, Takuji; Tanaka, Nobuo
1999-01-01
In the Level 2 PSA program at INS/NUPEC, MELCOR1.8.3 is extensively applied to analyze radionuclide behavior of dominant sequences. In addition, the revised source terms provided in the NUREG-1465 report have been also discussed to examine the potential of the radionuclides release to the environment in the conventional siting criteria. In the present study, characteristics of source terms to the environment were examined comparing with results by the Hypothetical Accident (LOCA), NUREG-1465 and MELCOR1.8.3. calculation for a typical BWR with a Mark-II containment in order to assure conservatives of the Hypothetical Accident in Japan. Release fractions of iodine to the environment for the Hypothetical Accident and NUREG-1465, which used engineering models for predicting radionuclide behaviors, were about 10 -4 and 10 -6 of core inventory, respectively, while the best estimate MELCOR1.8.3 code predicted 10 -9 of iodine to the environment. The present study showed that the engineering models in the Hypothetical Accident or NUREG-1465 have large conservatives to estimate source term of iodine to the environment. (author)
Energy Extraction from a Hypothetical MHK Array in a Section of the Mississippi River
Barco, J.; James, S. C.; Roberts, J. D.; Jones, C. A.; Jepsen, R. A.
2010-12-01
The world is facing many challenges meeting the energy demands for the future. Growing populations and developing economies as well as increasing energy expenditures highlight the need for a spectrum of energy sources. Concerns about pollution and climate change have led to increased interest in all forms of renewable energy to stabilize or decrease consumption of fossil fuels. One promising renewable is marine and hydrokinetic (MHK) energy, which has the potential to make important contributions to energy portfolios of the future. However, a primary question remains: How much energy can be extracted from MHK devices in rivers and oceans without significant environmental effects? This study focuses on the potential energy extraction from different hypothetical MHK array configurations in a section of the Mississippi River located near to Scotlandville Bend, Louisiana. Bathymetry data, obtained from Free Flow Power Corporation (FFP) via the US Army Corps bathymetry survey library, were interpolated onto a DELFT3D curvilinear, orthogonal grid of the system using ArcGIS 9.3.1. Boundary conditions are constrained by the upstream and downstream river flow rates and gage heights obtained from USGS website. Acoustic Doppler Current Profiler (ADCP) measurements obtained from FFP are used for pre-array model validation. Energy extraction is simulated using momentum sinks recently coded into SNL-EFDC, which is an augmented version of US EPA’s Environmental Fluid Dynamics Code (EFDC). SNL-EFDC model includes a new module which considers energy removal by MHK devices and commensurate changes to the turbulent kinetic energy and turbulent kinetic energy dissipation rate. As expected, average velocities decrease downstream of each MHK device due to energy extraction and blunt-body form drag from the MHK support structures. Changes in the flow field can alter sediment transport dynamics around and downstream of an MHK array; various hypothetical scenarios are examined. This
ADM pseudotensors, conserved quantities and covariant conservation laws in general relativity
International Nuclear Information System (INIS)
Fatibene, L.; Ferraris, M.; Francaviglia, M.; Lusanna, L.
2012-01-01
The ADM formalism is reviewed and techniques for decomposing generic components of metric, connection and curvature are obtained. These techniques will turn out to be enough to decompose not only Einstein equations but also covariant conservation laws. Then a number of independent sets of hypotheses that are sufficient (though not necessary) to obtain standard ADM quantities (and Hamiltonian) from covariant conservation laws are considered. This determines explicitly the range in which standard techniques are equivalent to covariant conserved quantities. The Schwarzschild metric in different coordinates is then considered, showing how the standard ADM quantities fail dramatically in non-Cartesian coordinates or even worse when asymptotically flatness is not manifest; while, in view of their covariance, covariant conservation laws give the correct result in all cases. - Highlights: ► In the paper ADM conserved quantities for GR are obtained from augmented conservation laws. ► Boundary conditions for this to be possible are considered and compared with the literature. ► Some different forms of Schwarzschild solutions are considered as simple examples of different boundary conditions.
REVIEW: The evolving linkage between conservation science and practice at The Nature Conservancy.
Kareiva, Peter; Groves, Craig; Marvier, Michelle
2014-10-01
The Nature Conservancy (TNC) was founded by ecologists as a United States land trust to purchase parcels of habitat for the purpose of scientific study. It has evolved into a global organization working in 35 countries 'to conserve the lands and waters on which all life depends'. TNC is now the world 's largest conservation non-governmental organization (NGO), an early adopter of advances in ecological theory and a producer of new science as a result of practising conservation.The Nature Conservancy 's initial scientific innovation was the use of distributional data for rare species and ecological communities to systematically target lands for conservation. This innovation later evolved into a more rigorous approach known as 'Conservation by Design' that contained elements of systematic conservation planning, strategic planning and monitoring and evaluation.The next scientific transition at TNC was a move to landscape-scale projects, motivated by ideas from landscape ecology. Because the scale at which land could be set aside in areas untouched by humans fell far short of the spatial scale demanded by conservation, TNC became involved with best management practices for forestry, grazing, agriculture, hydropower and other land uses.A third scientific innovation at TNC came with the pursuit of multiobjective planning that accounts for economic and resource needs in the same plans that seek to protect biodiversity.The Millennium Ecosystem Assessment prompted TNC to become increasingly concerned with ecosystem services and the material risk to people posed by ecosystem deterioration.Finally, because conservation depends heavily upon negotiation, TNC has recently recruited social scientists, economists and communication experts. One aspect still missing, however, is a solid scientific understanding of thresholds that should be averted. Synthesis and applications . Over its 60-plus year history, scientific advances have informed The Nature Conservancy (TNC) 's actions
Community motivations to engage in conservation behavior to conserve the Sumatran orangutan.
Nilsson, Danielle; Gramotnev, Galina; Baxter, Greg; Butler, James R A; Wich, Serge A; McAlpine, Clive A
2016-08-01
Community-based conservation programs in developing countries are often based on the assumption that heteronomous motivation (e.g., extrinsic incentives such as economic rewards and pressure or coercion to act) will incite local communities to adopt conservation behaviors. However, this may not be as effective or sustainable as autonomous motivations (e.g., an intrinsic desire to act due to inherent enjoyment or self-identification with a behavior and through freedom of choice). We analyzed the comparative effectiveness of heteronomous versus autonomous approaches to community-based conservation programs through a case study of Sumatran orangutan (Pongo abelii) conservation in 3 villages in Indonesia. Each village had a different conservation program design. We surveyed people (n = 240) to determine their motivations for and behavior changes relative to orangutan and orangutan habitat (forest) protection. Heteronomous motivations (e.g., income from tourism) led to greater self-reporting of behavior change toward orangutan protection. However, they did not change self-reported behavior toward forest (i.e., orangutan habitat) protection. The most effective approach to creating self-reported behavior change throughout the community was a combination of autonomous and heteronomous motivations. Individuals who were heteronomously motivated to protect the orangutan were more likely to have changed attitudes than to have changed their self-reported behavior. These findings demonstrate that the current paradigm of motivating communities in developing countries to adopt conservation behaviors primarily through monetary incentives and rewards should consider integrating autonomous motivational techniques that promote the intrinsic values of conservation. Such a combination has a greater potential to achieve sustainable and cost-effective conservation outcomes. Our results highlight the importance of using in-depth sociopsychological analyses to inform the design and
ORF Alignment: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available [imported] - ... Ureaplasma urealyticum ... Length = 313 ... Query: 8... NC_002162 gi|13357852 >1esc0 2 302 87 399 2e-29 ... ref|NP_078126.1| hypothetical protein UU292 [Ureap...lasma parvum serovar 3 str. ATCC ... 700970] gb|AAF30701.1| conserved hypothetical ... [Ureap...7 ... KINYLAIGDSITAGFNSELGWEAPGRYDPITNKISGLSFPSFIAQYINKVEPNRLASYEN 146 ... KINYLAIGDSITAGFNSELGWEAPGRYDP...ITNKISGLSFPSFIAQYINKVEPNRLASYEN Sbjct: 1 ... KINYLAIGDSITAGFNSELGWEAPGRYDPITNKISGLSFPSFIAQYINKVEPNRLASYEN 60 ...
ORF Alignment: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002162 gi|13358063 >1t71A 5 267 1 262 2e-78 ... ref|NP_078337.1| hypothetical protein UU500 [Ureap...lasma parvum serovar 3 str. ATCC ... 700970] gb|AAF30912.1| conserved hypothetical ... [Ureap...[imported] - ... Ureaplasma urealyticum ... Length = 262 ... Query: 1 ...ery: 121 GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKLSLVYGTHT 180 ... ... ... GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKLSLVYGTHT Sbjct: 121 GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVD
Paradigms for parasite conservation.
Dougherty, Eric R; Carlson, Colin J; Bueno, Veronica M; Burgio, Kevin R; Cizauskas, Carrie A; Clements, Christopher F; Seidel, Dana P; Harris, Nyeema C
2016-08-01
Parasitic species, which depend directly on host species for their survival, represent a major regulatory force in ecosystems and a significant component of Earth's biodiversity. Yet the negative impacts of parasites observed at the host level have motivated a conservation paradigm of eradication, moving us farther from attainment of taxonomically unbiased conservation goals. Despite a growing body of literature highlighting the importance of parasite-inclusive conservation, most parasite species remain understudied, underfunded, and underappreciated. We argue the protection of parasitic biodiversity requires a paradigm shift in the perception and valuation of their role as consumer species, similar to that of apex predators in the mid-20th century. Beyond recognizing parasites as vital trophic regulators, existing tools available to conservation practitioners should explicitly account for the unique threats facing dependent species. We built upon concepts from epidemiology and economics (e.g., host-density threshold and cost-benefit analysis) to devise novel metrics of margin of error and minimum investment for parasite conservation. We define margin of error as the risk of accidental host extinction from misestimating equilibrium population sizes and predicted oscillations, while minimum investment represents the cost associated with conserving the additional hosts required to maintain viable parasite populations. This framework will aid in the identification of readily conserved parasites that present minimal health risks. To establish parasite conservation, we propose an extension of population viability analysis for host-parasite assemblages to assess extinction risk. In the direst cases, ex situ breeding programs for parasites should be evaluated to maximize success without undermining host protection. Though parasitic species pose a considerable conservation challenge, adaptations to conservation tools will help protect parasite biodiversity in the face of
Conservation: Toward firmer ground
1975-01-01
The following aspects of energy conservation were reviewed in order to place the problems in proper perspective: history and goals, conservation accounting-criteria, and a method to overcome obstacles. The effect of changing prices and available supplies of energy sources and their causes on consumption levels during the last few decades were described. Some examples of attainable conservation goals were listed and justified. A number of specific criteria applicable to conservation accounting were given. Finally, a discussion was presented to relate together the following aspects of energy conservation: widespread impact, involvement of government, industry, politics, moral and ethical aspects, urgency and time element.
Community markets for conservation: Markets to advance conservation mission
Fay, J.
2008-01-01
This presentation describes the function and economics of COMACO (Community Markets for Conservation), discusses the current reality of climate change, and then explores how possible market mechanism approaches to ameliorating climate change may fit into COMACO's work and research. LTRA-2 (An Agricultural Markets Model for Biodiversity Conservation)
International Nuclear Information System (INIS)
Diersch, R.; Weiss, M.; Tso, C.F.; Chung, S.H.; Lee, H.Y.
2004-01-01
CASTORc ircledR KN-12 is a new cask design by GNB for KHNP-NETEC for dry and wet transportation of up to twelve spent PWR fuel assemblies in Korea. It received its transport license from the Korean Competent Authority KINS in July 2002 and is now in use in South Korea. It has been designed to satisfy the regulatory requirements of the 10 CFR 71 and the IAEA ST-1 for Type B(U)F packages. Its structural performance was demonstrated against the load cases and boundary conditions as defined in 10 CFR 71 and NRC's Regulatory Guide 7.8, and further explained in NUREG 1617. This included normal conditions of transport load cases - including Hot Environment, Cold Environment, Increased External Pressure (140MPa), Minimum External Pressure (24.5kPa), Vibration and shock, and 0.3m free drop - and the hypothetical accident conditions load cases - including the 9m Free Drop, Puncture, Thermal Fire Accident, 200m Water Immersion and 1.5 x MNOP Internal Pressure. Structural performance were demonstrated by analysis, including state-of-the-art finite element (FE) simulation, and confirmed by tests using a 1/3-scale model. Test results were also used to verify the numerical tool and the methods used in the analyses. All the structural analyses including validation against drop tests were carried out by Arup, and testing were carried out by KAERI. This paper concentrates on the analysis carried out to demonstrate performance in the hypothetical accident 9m free drop scenarios, and results from a small selection of them
Energy Technology Data Exchange (ETDEWEB)
Diersch, R.; Weiss, M. [Gesellschaft fuer Nuklear-Behaelter mbH (Germany); Tso, C.F. [Arup (United Kingdom); Chung, S.H.; Lee, H.Y. [KHNP-NETEC (Korea)
2004-07-01
CASTORc{sup ircledR} KN-12 is a new cask design by GNB for KHNP-NETEC for dry and wet transportation of up to twelve spent PWR fuel assemblies in Korea. It received its transport license from the Korean Competent Authority KINS in July 2002 and is now in use in South Korea. It has been designed to satisfy the regulatory requirements of the 10 CFR 71 and the IAEA ST-1 for Type B(U)F packages. Its structural performance was demonstrated against the load cases and boundary conditions as defined in 10 CFR 71 and NRC's Regulatory Guide 7.8, and further explained in NUREG 1617. This included normal conditions of transport load cases - including Hot Environment, Cold Environment, Increased External Pressure (140MPa), Minimum External Pressure (24.5kPa), Vibration and shock, and 0.3m free drop - and the hypothetical accident conditions load cases - including the 9m Free Drop, Puncture, Thermal Fire Accident, 200m Water Immersion and 1.5 x MNOP Internal Pressure. Structural performance were demonstrated by analysis, including state-of-the-art finite element (FE) simulation, and confirmed by tests using a 1/3-scale model. Test results were also used to verify the numerical tool and the methods used in the analyses. All the structural analyses including validation against drop tests were carried out by Arup, and testing were carried out by KAERI. This paper concentrates on the analysis carried out to demonstrate performance in the hypothetical accident 9m free drop scenarios, and results from a small selection of them.
International Nuclear Information System (INIS)
French McCay, D.; Whittier, N.; Sankaranarayanan, S.; Jennings, J.; Etkin, D.S.
2002-01-01
The oil spill risks associated with four submerged rock pinnacles near Alcatraz Island in San Francisco Bay are being evaluated by the United States Army Corps of Engineers. Oil spill modeling has been conducted for a hypothetical oil spill to determine biological impacts, damages to natural resources and response costs. The scenarios are hypothetical vessel grounding on the pinnacles. The SIMAP modeling software by the Applied Science Associates was used to model 3 spill sizes (20, 50 and 95 percentile by volume) and 4 types of oil (gasoline, diesel, heavy fuel oil, and crude oil). The frequency distribution of oil fates and impacts was determined by first running each scenario in stochastic mode. The oil fates and biological effects of the spills were the focus of this paper. It was shown that diesel and crude oil spills would have greater impacts in the water column than heavy fuel or gasoline because gasoline is more volatile and less toxic and because heavy oil spills would be small in volume. It was determined that the major impacts and damage to birds would be low due to the high dilution potential of the bay. It was also noted that dispersants would be very effective in reducing impacts on wildlife and the shoreline. These results are being used to evaluate the cost-benefit analysis of removing the rocks versus the risk of an oil spill. The work demonstrates a statistically quantifiable method to estimate potential impacts that could be used in ecological risk assessment and cost-benefit analysis. 15 refs., 13 tabs., 11 figs
Wadian, Taylor W; Sonnentag, Tammy L; Jones, Tucker L; Barnett, Mark A
2018-01-01
A total of 184 adults read descriptions of six hypothetical children with various undesirable characteristics (i.e., being extremely overweight, extremely aggressive, extremely shy, a poor student, a poor athlete, displaying symptoms of attention deficit hyperactivity disorder). Following each description, the participants were asked to rate how much they disagree or agree that the child, the child's parents, and the child's biological condition (i.e., "something wrong inside the child's body or brain") are at fault for the onset and the perpetuation of the undesirable characteristic. In addition, the participants were asked to rate their attitude toward each child using a 100-point "feeling thermometer." Analyses of the participants' various fault attribution ratings revealed that they tended to agree more strongly that a child's parents and his/her biological condition are at fault for the onset and the perpetuation of the child's undesirable characteristic than is the child him/herself. Despite the participants' reluctance to blame a hypothetical child for his/her undesirable characteristic, regression analyses revealed that, in general, the more they blamed the child for the onset of his/her undesirable characteristic, the more negative their attitude was toward the child. However, the participants' ratings of the extent to which the child's parents or biological condition are at fault for the onset and the perpetuation of the child's undesirable characteristic were not found to be associated with their attitude toward any of the children. Similarities and differences between the present findings and those reported in prior studies involving younger individuals are addressed.
2010-03-10
... Diego County Water Authority Natural Communities Conservation Program/Habitat Conservation Plan, San... meetings for the San Diego County Water Authority's (Water Authority/Applicant) draft Natural Communities Conservation Plan (NCCP)/Habitat Conservation Plan (HCP) prepared in application to us for an incidental take...
van Nieuwenhuijzen, M.; Bijman, E. R.; Lamberix, I. C. W.; Wijnroks, L.; de Castro, B. Orobio; Vermeer, A.; Matthys, W.
2005-01-01
Abstract: Background Most research on children's social problem-solving skills is based on responses to hypothetical vignettes. Just how these responses relate to actual behaviour in real-life social situations is, however, unclear, particularly for children with mild intellectual disabilities (MID). Method: In the present study, the spontaneous…
Abrash Walton, Abigail
2010-01-01
This essay considers the arenas of advocacy, politics, and self-reflection in strengthening conservation and resource management initiatives. It frames key questions that reflective conservation practitioners may address in seeking to enhance the results of conservation projects, including equity and more inclusive participation by nonprivileged groups. The essay touches on the importance of understanding conservation work within particular political and historic dynamics, including the need to understand non-Western and/or indigenous or traditional perspectives on conservation. The author makes the case that Western or privileged conservation practitioners are uniquely situated to advocate effectively for change.
Naqvi, Ahmad Abu Turab; Shahbaaz, Mohd; Ahmad, Faizan; Hassan, Md Imtaiyaz
2015-01-01
Syphilis is a globally occurring venereal disease, and its infection is propagated through sexual contact. The causative agent of syphilis, Treponema pallidum ssp. pallidum, a Gram-negative sphirochaete, is an obligate human parasite. Genome of T. pallidum ssp. pallidum SS14 strain (RefSeq NC_010741.1) encodes 1,027 proteins, of which 444 proteins are known as hypothetical proteins (HPs), i.e., proteins of unknown functions. Here, we performed functional annotation of HPs of T. pallidum ssp. pallidum using various database, domain architecture predictors, protein function annotators and clustering tools. We have analyzed the sequences of 444 HPs of T. pallidum ssp. pallidum and subsequently predicted the function of 207 HPs with a high level of confidence. However, functions of 237 HPs are predicted with less accuracy. We found various enzymes, transporters, binding proteins in the annotated group of HPs that may be possible molecular targets, facilitating for the survival of pathogen. Our comprehensive analysis helps to understand the mechanism of pathogenesis to provide many novel potential therapeutic interventions.
Intersubassembly incoherencies and grouping techniques in LMFBR hypothetical overpower accident
International Nuclear Information System (INIS)
Wilburn, N.P.
1977-10-01
A detailed analysis was made of the FTR core using the 100-channel MELT-IIIA code. Results were studied for the transient overpower accident (where 0.5$/sec and 1$/sec ramps) and in which the Damage Parameter and the Failure Potential criteria were used. Using the information obtained from these series of runs, a new method of grouping the subassemblies into channels has been developed. Also, it was demonstrated that a 7-channel representation of the FTR core using this method does an adequate job of representing the behavior during a hypothetical disruptive transient overpower core accident. It has been shown that this new 7-channel grouping method does a better job than an earlier 20-channel grouping. It has also been demonstrated that the incoherency effects between subassemblies as shown during the 76-channel representation of the reactor can be adequately modeled by 7-channels, provided the 7-channels are selected according to the criteria stated in the report. The overall results of power and net reactivity were shown to be only slightly different in the two cases of the 7-channel and the 76-channel runs. Therefore, it can be concluded that any intersubassembly incoherencies can be modeled adequately by a small number of channels, provided the subassemblies making up these channels are selected according to the criteria stated
Wu, Ruidong; Long, Yongcheng; Malanson, George P; Garber, Paul A; Zhang, Shuang; Li, Diqiang; Zhao, Peng; Wang, Longzhu; Duo, Hairui
2014-01-01
By addressing several key features overlooked in previous studies, i.e. human disturbance, integration of ecosystem- and species-level conservation features, and principles of complementarity and representativeness, we present the first national-scale systematic conservation planning for China to determine the optimized spatial priorities for biodiversity conservation. We compiled a spatial database on the distributions of ecosystem- and species-level conservation features, and modeled a human disturbance index (HDI) by aggregating information using several socioeconomic proxies. We ran Marxan with two scenarios (HDI-ignored and HDI-considered) to investigate the effects of human disturbance, and explored the geographic patterns of the optimized spatial conservation priorities. Compared to when HDI was ignored, the HDI-considered scenario resulted in (1) a marked reduction (∼9%) in the total HDI score and a slight increase (∼7%) in the total area of the portfolio of priority units, (2) a significant increase (∼43%) in the total irreplaceable area and (3) more irreplaceable units being identified in almost all environmental zones and highly-disturbed provinces. Thus the inclusion of human disturbance is essential for cost-effective priority-setting. Attention should be targeted to the areas that are characterized as moderately-disturbed, conservation. We delineated 23 primary large-scale priority areas that are significant for conserving China's biodiversity, but those isolated priority units in disturbed regions are in more urgent need of conservation actions so as to prevent immediate and severe biodiversity loss. This study presents a spatially optimized national-scale portfolio of conservation priorities--effectively representing the overall biodiversity of China while minimizing conflicts with economic development. Our results offer critical insights for current conservation and strategic land-use planning in China. The approach is transferable and easy
Vulnerability Analysis of Physical Protection System at Hypothetical Facility
International Nuclear Information System (INIS)
Jung, Won Moog; Lee, Ho Jin; Yu, Dong Han; Min, Gyung Sik
2006-01-01
Since the 9/11 event in the U.S.A, International terror possibilities has been increasing for nuclear facilities including nuclear power plants(NPPs). It is necessary to evaluate the performance of an existing physical protection system(PPS) at nuclear facilities based on such malevolent acts. A PPS is a complex configuration of detection, delay, and response elements. Detection, delay, and response elements are all important to the analysis and evaluation of a PPS and its effectiveness. Methods are available to analyze a PPS and evaluate its effectiveness. Sandia National Laboratory(SNL) in the U.S.A was developed a System Analysis of Vulnerability to Intrusion (SAVI) computer code for evaluating the effectiveness of PPS against outsider threats. This study presents the vulnerability analysis of the PPS at hypothetical facility using SAVI code that the basic input parameters are from PPS of Hanaro Research Reactor at Korea Atomic Energy Research Institution. It is understand that PPS of research reactor and critical assemblies are deficient that that of NPP and nuclear materials of RRCAS are compact to transport For analysis, first, the site-specific Adversary Sequence Diagrams(ASDs) of the PPS is constructed. It helps to understand the functions of the existing PPS composed of physical areas and Protection Elements(PEs). Then, the most vulnerable path of an ASD as a measure of effectiveness is determined. The results in the analysis can used to suggest the possible PPS upgrades to the most vulnerable paths for the system like research reactor
International Nuclear Information System (INIS)
Schwinkendorf, K.N.
1995-01-01
In a damaged light water reactor core (as in the aftermath of a Three-Mile-Island-like core meltdown), water reflood is performed to carry off decay heat. The severely degraded geometry of the fuel debris bed may increase core reactivity with water reflood. Sufficient boron poisoning of the reflood water is therefore very important. One hypothetical accident is the reintroduction of cooling water that is insufficiently borated, resulting in the damaged reactor attaining criticality in this uncontrolled configuration. The goal in simulating this accident is the prediction of the energy release from the resulting transient
The Conserver Society revisited. Un regard neuf sur la societe de conservation
Energy Technology Data Exchange (ETDEWEB)
Schrecker, T
1983-01-01
A discussion paper is presented on the applicability of the ''conserver society'' concept to Canada. Such a concept involves phenomena as increasing energy efficiency throughout society, encouraging energy conservation and use of renewable resources, and promoting life styles not needing a large consumption of goods or energy. Recent encouraging signs of energy conservation trends in Canada are offset by lags in the application of state of the art energy efficiency techniques in construction and manufacturing. Institutional barriers, such as division of conservation costs between building owners and renters, are also mentioned. Some institutional innovations are being implemented to overcome these constraints, however. Renewable energy options considered in this paper are limited to solar thermal energy and biomass. Waste recycling is also considered as an area of considerable potential. Renewable resources in Canada include forests and water, and expenditures to conserve these resources are seen as essential investments for the future, especially in view of the fact that impacts take years to appear. In the economic sphere, a number of developments are outlined, relating to conserver technologies (e.g. those that reduce environmental impacts while recovering materials or energy) and industries. The effect of conserver strategies on employment is also examined. A separate section of this report discusses Quebec, its cultural development and its approach to the conserver society; government actions have been taken with respect to forests, agricultural land, home energy use, recycling, and changing of public attitudes. 50 refs.
Conservation: Toward firmer ground
1975-01-01
The following aspects of energy conservation were discussed: conservation history and goals, conservation modes, conservation accounting-criteria, and a method to overcome obstacles. The conservation modes tested fall into one of the following categories: reduced energy consumption, increased efficiency of energy utilization, or substitution of one or more forms of energy for another which is in shorter supply or in some sense thought to be of more value. The conservation accounting criteria include net energy reduction, economic, and technical criteria. A method to overcome obstacles includes (approaches such as: direct personal impact (life style, income, security, aspiration), an element of crisis, large scale involvement of environmental, safety, and health issues, connections to big government, big business, big politics, involvement of known and speculative science and technology, appeal to moral and ethical standards, the transient nature of opportunities to correct the system.
International Nuclear Information System (INIS)
1979-07-01
Hypothetical accidents in nuclear power plants are events which by definition can have a devastating impact on the surroundings of the plant. Apart from an adequate plant design, the protection of the population in case of an accident is covered by the emergency planning. Of major importance are the measures for the short-term emergency protection. The decision on whether these measures are applied has to be based on appropriate measurements within the plant. The aim and achieved result of this investigation is to specify accident types. They serve as operational decision making criteria to determine the necessary measurements for analysing the accident in the accident situation, and to provide indications for choosing the suitable strategy for the protection measures. (orig.) [de
Alexander-Vaughn, Louise B.; Collazo, Jaime A.; Drew, C. Ashton
2014-01-01
The Eastern North Carolina/Southeastern Virginia Strategic Habitat Conservation Team (ENCSEVA) is a partnership among local federal agencies and programs with a mission to apply Strategic Habitat Conservation to accomplish priority landscape-level conservation within its geographic region. ENCSEVA seeks to further landscape-scale conservation through collaboration with local partners. To accomplish this mission, ENCSEVA is developing a comprehensive Strategic Habitat Conservation Plan (Plan) to provide guidance for its members, partners, and collaborators by establishing mutual conservation goals, objectives, strategies, and metrics to gauge the success of conservation efforts. Identifying common goals allows the ENCSEVA team to develop strategies that leverage joint resources and are more likely to achieve desired impacts across the landscape. The Plan will also provide an approach for ENCSEVA to meet applied research needs (identify knowledge gaps), foster adaptive management principles, identify conservation priorities, prioritize threats (including potential impacts of climate change), and identify the required capacity to implement strategies to create more resilient landscapes. ENCSEVA seeks to support the overarching goals of the South Atlantic Landscape Conservation Cooperative (SALCC) and to provide scientific and technical support for conservation at landscape scales as well as inform the management of natural resources in response to shifts in climate, habitat fragmentation and loss, and other landscape-level challenges (South Atlantic LCC 2012). The ENCSEVA ecoregion encompasses the northern third of the SALCC geography and offers a unique opportunity to apply landscape conservation at multiple scales through the guidance of local conservation and natural resource management efforts and by reporting metrics that reflect the effectiveness of those efforts (Figure 1). The Environmental Decision Analysis Team, housed within the North Carolina Cooperative
International Nuclear Information System (INIS)
Edwards, L.L.
1978-01-01
The CHAMP computer code was employed to simulate a plane-geometry cross section of a Mark I boiling water reactor toroidal pressure suppression system air discharge experiment under hypothetical loss-of-coolant accident conditions. The experiments were performed at the Lawrence Livermore Laboratory on a 1 / 5 -scale model of the Peach Bottom Nuclear Power Plant
Directory of Open Access Journals (Sweden)
Paul Jepson
2011-01-01
Full Text Available As a crisis-oriented discipline, conservation biology needs actions to understand the state of nature and thwart declines in biodiversity. Actors-traditionally individuals, institutions, and collectives-have been central to delivering such goals in practice. However, the definition of actors within the discipline has been narrow and their role in influencing conservation outcomes inadequately conceptualised. In this paper, we examine the question ′What is a conservation actor?′ Who or what creates the capacity to influence conservation values and actions? Drawing from theoretical developments in Actor-Network Theory and collective governance, we argue that the concept of an actor in conservation biology should be broadened to include non-humans, such as species and devices, because they have the agency and ability to influence project goals and outcomes. We illustrate this through four examples: the Asian elephant, International Union for Conservation of Nature red lists, the High Conservation Value approach, and an Integrated Conservation and Development Project. We argue that a broader conceptualisation of actors in conservation biology will produce new forms of understanding that could open up new areas of conservation research, enhance practice and draw attention to spheres of conservation activity that might require stronger oversight and governance.
Groundwater flow modeling for near-field of a hypothetical near-surface disposal facility
International Nuclear Information System (INIS)
Park, H. Y.; Park, J. W.; Jang, G. M.; Kim, C. R.
2000-01-01
For a hypothetical near-surface radioactive disposal facility, the behavior of groundwater flow around the near-field of disposal vault located at the unsaturated zone were analyzed. Three alternative conceptual models proposed as the hydraulic barrier layer design were simulated to assess the hydrologic performance of engineered barriers for the facility. In order to evaluate the seepage possibility of the infiltrated water passed through the final disposal cover after the facility closure, the flow path around and water flux through each disposal vault were compared. The hydrologic parameters variation that accounts for the long-term aging and degradation of the cover and engineered materials was considered in the simulations. The results showed that it is necessary to construct the hydraulic barrier at the upper and sides of the vault, and that, for this case, achieving design hydraulic properties of bentonite/sand mixture barrier in the as-built condition is crucial to limit the seepage into the waste
Control of the selectivity of the aquaporin water channel family by global orientational tuning
DEFF Research Database (Denmark)
Jensen, Morten Østergaard; Tajkhorshid, E.; Nollert, P.
2002-01-01
and orientation of a single file of seven to nine water molecules inside the channel. Two conserved asparagines force a central water molecule to serve strictly as a hydrogen bond donor to its neighboring water molecules. Assisted by the electrostatic potential generated by two half-membrane spanning loops......Aquaporins are transmembrane channels found in cell membranes of all life forms. We examine their apparently paradoxical property, facilitation of efficient permeation of water while excluding protons, which is of critical importance to preserving the electrochemical potential across the cell...... membrane. We have determined the structure of the Escherichia coli aquaglyceroporin GlpF with bound water, in native (2.7 angstroms) and in W48F/F200T mutant (2.1 angstroms) forms, and carried out 12-nanosecond molecular dynamics simulations that define the spatial and temporal probability distribution...
Relative Stabilities of Conserved and Non-Conserved Structures in the OB-Fold Superfamily
Directory of Open Access Journals (Sweden)
Andrei T. Alexandrescu
2009-05-01
Full Text Available The OB-fold is a diverse structure superfamily based on a β-barrel motif that is often supplemented with additional non-conserved secondary structures. Previous deletion mutagenesis and NMR hydrogen exchange studies of three OB-fold proteins showed that the structural stabilities of sites within the conserved β-barrels were larger than sites in non-conserved segments. In this work we examined a database of 80 representative domain structures currently classified as OB-folds, to establish the basis of this effect. Residue-specific values were obtained for the number of Cα-Cα distance contacts, sequence hydrophobicities, crystallographic B-factors, and theoretical B-factors calculated from a Gaussian Network Model. All four parameters point to a larger average flexibility for the non-conserved structures compared to the conserved β-barrels. The theoretical B-factors and contact densities show the highest sensitivity.Our results suggest a model of protein structure evolution in which novel structural features develop at the periphery of conserved motifs. Core residues are more resistant to structural changes during evolution since their substitution would disrupt a larger number of interactions. Similar factors are likely to account for the differences in stability to unfolding between conserved and non-conserved structures.
Econometric modelling of conservation
International Nuclear Information System (INIS)
Parker, J.C.; Seal, D.J.
1990-01-01
The issue of energy conservation in general, and conservation in the natural gas markets in particular, has recently had a much lower profile than in the past, when energy prices were significantly higher and energy costs composed a much larger proportion of industrial operating costs than today. The recent downward trend in energy prices has diverted attention away from this issue. In the face of expected significant real price increases, increasing pressure from environmental groups, and directives on the part of regulator authorities, conservation is once again becoming a topic of consideration in the energy industry. From the point of view of gas demand forecasting, conservation has received too little attention. The intentions of this paper are to establish the need for forecasting conservation in the natural gas utility sector, and to construct a model of industrial demand which incorporates conservation and is appropriate for use as a forecasting tool
International Nuclear Information System (INIS)
Howard, B.J.; Wright, S.M.; Salbu, B.; Skuterud, K.L.; Hove, K.; Loe, R.
2004-01-01
The spatial and temporal variation in radiocaesium and 90 Sr doses to two population groups of the two Northernmost counties of Norway, Troms and Finnmark, following a hypothetical accident at the Kola nuclear power plant (KNPP) have been estimated using a model implemented within a geographical information system. The hypothetical accident assumes a severe loss of coolant accident at the KNPP coincident with meteorological conditions causing significant radionuclide deposition in the two counties. External doses are estimated from ground deposition and the behaviour of the different population groups, and internal doses from predicted food product activity concentrations and dietary consumption data. Doses are predicted for reindeer keepers and other Norwegian inhabitants, taking account of existing 137 Cs and 90 Sr deposition but not including the remedial effect of any countermeasures that might be used. The predicted doses, arising mainly from radiocaesium, confirm the Arctic Monitoring and Assessment Programme assessment that residents of the Arctic are particularly vulnerable to radiocaesium contamination, which could persist for many years. External doses are predicted to be negligible compared to ingestion doses. Ingestion doses for reindeer keepers are predicted to exceed 1 mSv y -1 for several decades primarily due to their high consumption of reindeer meat. Other Norwegians would also be potentially exposed to doses exceeding 1 mSv y -1 for several years, especially if they consume many local products. Whilst reindeer production is the most important exposure pathway, freshwater fish, lamb meat, dairy products, mushrooms and berries are also significant contributors to predicted ingestion doses. Radionuclide fluxes, defined as the total output of radioactivity in food from an area for a unit time, are dominated by reindeer meat. The results show the need for an effective emergency response, with appropriate countermeasures, should an accident of the
Mainstreaming the social sciences in conservation.
Bennett, Nathan J; Roth, Robin; Klain, Sarah C; Chan, Kai M A; Clark, Douglas A; Cullman, Georgina; Epstein, Graham; Nelson, Michael Paul; Stedman, Richard; Teel, Tara L; Thomas, Rebecca E W; Wyborn, Carina; Curran, Deborah; Greenberg, Alison; Sandlos, John; Veríssimo, Diogo
2017-02-01
Despite broad recognition of the value of social sciences and increasingly vocal calls for better engagement with the human element of conservation, the conservation social sciences remain misunderstood and underutilized in practice. The conservation social sciences can provide unique and important contributions to society's understanding of the relationships between humans and nature and to improving conservation practice and outcomes. There are 4 barriers-ideological, institutional, knowledge, and capacity-to meaningful integration of the social sciences into conservation. We provide practical guidance on overcoming these barriers to mainstream the social sciences in conservation science, practice, and policy. Broadly, we recommend fostering knowledge on the scope and contributions of the social sciences to conservation, including social scientists from the inception of interdisciplinary research projects, incorporating social science research and insights during all stages of conservation planning and implementation, building social science capacity at all scales in conservation organizations and agencies, and promoting engagement with the social sciences in and through global conservation policy-influencing organizations. Conservation social scientists, too, need to be willing to engage with natural science knowledge and to communicate insights and recommendations clearly. We urge the conservation community to move beyond superficial engagement with the conservation social sciences. A more inclusive and integrative conservation science-one that includes the natural and social sciences-will enable more ecologically effective and socially just conservation. Better collaboration among social scientists, natural scientists, practitioners, and policy makers will facilitate a renewed and more robust conservation. Mainstreaming the conservation social sciences will facilitate the uptake of the full range of insights and contributions from these fields into
Local Responses to Participatory Conservation in Annapurna Conservation Area, Nepal
Khadka, Damodar; Nepal, Sanjay K.
2010-02-01
Biodiversity conservation has undergone a profound change in philosophy, policies and management approaches over the last forty years. The traditional top-down approach to nature protection has been widely criticized for failing to include critical social elements in management practices, and is being gradually replaced by a slew of participatory strategies under the rubric of bottom-up conservation. The new approach recognizes local communities as key partners in wildlife management and seeks their participation in social development and biodiversity conservation. However, every social context is different in its structure and functions, and in the way social groups respond to calls for participation. In order to gain a better understanding of the approach and the barriers encountered in its implementation, a questionnaire survey of 188 households was employed in the communities of the Upper Mustang extension of Annapurna Conservation Area (ACA) in Nepal. The study provides a comparative analysis of community participation and its barriers between Non-Tourist (NT) and Tourist (TV) villages. The results revealed important differences between the two groups in terms of their participation in community programs, barriers to participation, and perception of benefits from participation. Owing to their distinct spatial, demographic and attitudinal differences, the two village groups have their own sets of needs, values and motivation factors which cannot be generalized and treated as such. The research clearly identifies the need for the conservation agency to be creative in devising strategies and initiatives appropriate to specific social groups so as to optimize their input in participatory conservation.
Parker, Pete; Thapa, Brijesh; Jacob, Aerin
2015-12-01
To alleviate poverty and enhance conservation in resource dependent communities, managers must identify existing livelihood strategies and the associated factors that impede household access to livelihood assets. Researchers increasingly advocate reallocating management power from exclusionary central institutions to a decentralized system of management based on local and inclusive participation. However, it is yet to be shown if decentralizing conservation leads to diversified livelihoods within a protected area. The purpose of this study was to identify and assess factors affecting household livelihood diversification within Nepal's Kanchenjunga Conservation Area Project, the first protected area in Asia to decentralize conservation. We randomly surveyed 25% of Kanchenjunga households to assess household socioeconomic and demographic characteristics and access to livelihood assets. We used a cluster analysis with the ten most common income generating activities (both on- and off-farm) to group the strategies households use to diversify livelihoods, and a multinomial logistic regression to identify predictors of livelihood diversification. We found four distinct groups of household livelihood strategies with a range of diversification that directly corresponded to household income. The predictors of livelihood diversification were more related to pre-existing socioeconomic and demographic factors (e.g., more landholdings and livestock, fewer dependents, receiving remittances) than activities sponsored by decentralizing conservation (e.g., microcredit, training, education, interaction with project staff). Taken together, our findings indicate that without direct policies to target marginalized groups, decentralized conservation in Kanchenjunga will continue to exclude marginalized groups, limiting a household's ability to diversify their livelihood and perpetuating their dependence on natural resources. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
CÉSAR REY
2004-07-01
Full Text Available This investigation had two objectives: a to compare the number of punitive and not punitive socialresponses reported toward three hypothetical situations of interpersonal tension, by a group of 39institutionalized for physical abuse children and girls, with that informed by a group of 34 not abusedchildren and girls inscribed to an educational institution, and b to compare the number of punitive andnot punitive responses that the physically abused children and girls referred in this situations. All thechildren had between eight and twelve age-years, among second and quarter educational degree and lowsocioeconomic levels. The three hypothetical situations of interpersonal tension were presented verballywith the support of six sheets (three for each sex and their responses were gathered in a quantitative waythrough the content analysis. The application of the test U of Mann Whitney didn’t throw significantdifferences among the two groups. Nevertheless, it was found a significant difference at intra-grouplevel, in accordance with the test of Wicolxon.
Hullman, Jessica; Resnick, Paul; Adar, Eytan
2015-01-01
Many visual depictions of probability distributions, such as error bars, are difficult for users to accurately interpret. We present and study an alternative representation, Hypothetical Outcome Plots (HOPs), that animates a finite set of individual draws. In contrast to the statistical background required to interpret many static representations of distributions, HOPs require relatively little background knowledge to interpret. Instead, HOPs enables viewers to infer properties of the distribution using mental processes like counting and integration. We conducted an experiment comparing HOPs to error bars and violin plots. With HOPs, people made much more accurate judgments about plots of two and three quantities. Accuracy was similar with all three representations for most questions about distributions of a single quantity.
Constructing Conservation Impact: Understanding Monitoring and Evaluation in Conservation NGOs
Directory of Open Access Journals (Sweden)
Catherine Benson Wahlén
2014-01-01
Full Text Available A growing number of scholars critically examine large conservation organisations to explore organisational intentions, practices, and outcomes. In parallel, other scholars have problematised audit cultures, suggesting that these seemingly good practices of evaluation and measurement are not neutral and instead have consequences for governance and power. This article combines literature on conservation NGOs, organisational theory, and audit culture to study the inner workings of conservation and to understand the construction of effectiveness and impact. I draw on semi-structured interviews to examine how a large, international conservation organisation, which I term the World Conservation Organisation (WCO; a pseudonym, coordinates monitoring and evaluation (M&E processes among its international, national, and local offices. I find individual staff within WCO make varying assumptions about the M&E policies and place different values on M&E, which results in different institutional logics towards M&E and a broader organisational failure to measure progress and reflect upon outcomes. The findings also show difficulties in translating broad organisational goals into specific project activities, underscoring tensions in implementation and limitations in M&E practice. I also find that organisational and managerial pressure to report success is greater than donor pressure, a finding that expands understandings of NGO-donor dynamics.
"Hypothetical machines": the science fiction dreams of Cold War social science.
Lemov, Rebecca
2010-06-01
The introspectometer was a "hypothetical machine" Robert K. Merton introduced in the course of a 1956 how-to manual describing an actual research technique, the focused interview. This technique, in turn, formed the basis of wartime morale research and consumer behavior studies as well as perhaps the most ubiquitous social science tool, the focus group. This essay explores a new perspective on Cold War social science made possible by comparing two kinds of apparatuses: one real, the other imaginary. Even as Merton explored the nightmare potential of such machines, he suggested that the clear aim of social science was to build them or their functional equivalent: recording machines to access a person's experiential stream of reality, with the ability to turn this stream into real-time data. In this way, the introspectometer marks and symbolizes a broader entry during the Cold War of science-fiction-style aspirations into methodological prescriptions and procedural manuals. This essay considers the growth of the genre of methodological visions and revisions, painstakingly argued and absorbed, but punctuated by sci-fi aims to transform "the human" and build newly penetrating machines. It also considers the place of the nearly real-, and the artificial "near-substitute" as part of an experimental urge that animated these sciences.
Conservation in Context: A Comparison of Conservation Perspectives in a Mexican Protected Area
Directory of Open Access Journals (Sweden)
Martha Bonilla-Moheno
2012-09-01
Full Text Available The conservation of biodiversity in protected areas depends on the interests and agendas of stakeholders involved in the planning and enforcing of management actions. The challenge, therefore, has been to identify and include the perspectives of multiple participants important to local conservation. This paper describes the social context in which local conservation is conducted in a natural protected area in Yucatan, Mexico. In particular, it examines the agreement and expectations among local stakeholders on the main goals the reserve should achieve. Through participatory observation and semi-structured interviews, we analyzed the perceptions on conservation of the five groups relevant to the area management: 1 local people; 2 conservation government agency; 3 scientists; 4 non-governmental organization, and 5 a tourist agency. All actors agreed that the protected area should fulfill two main goals: i to conserve biodiversity and, ii to improve local welfare and development. In general, ecotourism is perceived as the best option for protecting the forest and promoting local development. Traditional agriculture, on the other hand, is perceived as the main conservation threat, but recognized as a crucial component of local wellbeing. We discuss these results in the context of the Yucatan Peninsula.
Adams, Vanessa M.; Game, Edward T.; Bode, Michael
2014-08-01
Growing threats and limited resources have always been the financial realities of biodiversity conservation. As the conservation sector has matured, however, the accountability of conservation investments has become an increasingly debated topic, with two key topics being driven to the forefront of the discourse: understanding how to manage the risks associated with our conservation investments and demonstrating that our investments are making a difference through evidence-based analyses. A better understanding of the uncertainties associated with conservation decisions is a central component of managing risks to investments that is often neglected. This focus issue presents both theoretical and applied approaches to quantifying and managing risks. Furthermore, transparent and replicable approaches to measuring impacts of conservation investments are noticeably absent in many conservation programs globally. This focus issue contains state of the art conservation program impact evaluations that both demonstrate how these methods can be used to measure outcomes as well as directing future investments. This focus issue thus brings together current thinking and case studies that can provide a valuable resource for directing future conservation investments.
International Nuclear Information System (INIS)
Adams, Vanessa M; Game, Edward T; Bode, Michael
2014-01-01
Growing threats and limited resources have always been the financial realities of biodiversity conservation. As the conservation sector has matured, however, the accountability of conservation investments has become an increasingly debated topic, with two key topics being driven to the forefront of the discourse: understanding how to manage the risks associated with our conservation investments and demonstrating that our investments are making a difference through evidence-based analyses. A better understanding of the uncertainties associated with conservation decisions is a central component of managing risks to investments that is often neglected. This focus issue presents both theoretical and applied approaches to quantifying and managing risks. Furthermore, transparent and replicable approaches to measuring impacts of conservation investments are noticeably absent in many conservation programs globally. This focus issue contains state of the art conservation program impact evaluations that both demonstrate how these methods can be used to measure outcomes as well as directing future investments. This focus issue thus brings together current thinking and case studies that can provide a valuable resource for directing future conservation investments. (paper)
Morris, Michael W; Carranza, Erica; Fox, Craig R
2008-11-01
Four studies investigated whether activating a social identity can lead group members to choose options that are labeled in words associated with that identity. When political identities were made salient, Republicans (but not Democrats) became more likely to choose the gamble or investment option labeled "conservative." This shift did not occur in a condition in which the same options were unlabeled. Thus, the mechanism underlying the effect appears to be not activated identity-related values prioritizing low risk, but rather activated identity-related language (the group label "conservative"). Indeed, when political identities were salient, Republicans favored options labeled "conservative" regardless of whether the options were low or high risk. Finally, requiring participants to explain the label "conservative" before making their choice did not diminish the effect, which suggests that it does not merely reflect inattention to content or construct accessibility. We discuss the implications of these results for the literatures on identity, priming, choice, politics, and marketing.
Lessmann, Janeth; Muñoz, Jesús; Bonaccorso, Elisa
2014-01-01
Ecuador has the largest number of species by area worldwide, but also a low representation of species within its protected areas. Here, we applied systematic conservation planning to identify potential areas for conservation in continental Ecuador, with the aim of increasing the representation of terrestrial species diversity in the protected area network. We selected 809 terrestrial species (amphibians, birds, mammals, and plants), for which distributions were estimated via species distribution models (SDMs), using Maxent. For each species we established conservation goals based on conservation priorities, and estimated new potential protected areas using Marxan conservation planning software. For each selected area, we determined their conservation priority and feasibility of establishment, two important aspects in the decision-making processes. We found that according to our conservation goals, the current protected area network contains large conservation gaps. Potential areas for conservation almost double the surface area of currently protected areas. Most of the newly proposed areas are located in the Coast, a region with large conservation gaps and irreversible changes in land use. The most feasible areas for conservation were found in the Amazon and Andes regions, which encompass more undisturbed habitats, and already harbor most of the current reserves. Our study allows defining a viable strategy for preserving Ecuador's biodiversity, by combining SDMs, GIS-based decision-support software, and priority and feasibility assessments of the selected areas. This approach is useful for complementing protected area networks in countries with great biodiversity, insufficient biological information, and limited resources for conservation. PMID:25360277
Conservation and non-conservation in general relativity
International Nuclear Information System (INIS)
Bondi, H.
1990-01-01
The difficulties of conservation laws in general relativity are discussed, with special reference to the non-tangible nature of gravitational energy and its transformation into tangible forms of energy. Inductive transfer of energy is marked out as wholly distinct from wave transfer. Slow (adiabatic) changes are utilized to make clear, in the axi-symmetric case, that the mass of an isolated body is conserved irrespective of any local changes (e.g. of shape) and that in inductive transfer the movement of energy between two bodies can readily be traced by the changes in their masses. (author)
Conservation Laws for Partially Conservative Variable Mass Systems via d'Alembert's Principle
Institute of Scientific and Technical Information of China (English)
AFTAB Ahmed; NASEER Ahmed; QUDRAT Khan
2008-01-01
Conservation laws for partially conservative variable mass dynamical systems under symmetric infinitesimal transformations are determined. A generalization of Lagrange-d'Alembert's principle for a variable mass system in terms of asynchronous virtual variation is presented. The generalized Killing equations are obtained such that their solution yields the transformations and the associated conservation laws. An example illustrative of the theory is furnished at the end as well.
International Nuclear Information System (INIS)
Owen, J.L.; McGinnis, J.T.; Harper, C.M.; Battelle Columbus Labs., OH)
1982-01-01
This paper presents results of an environmental assessment conducted under the direction of the Office of Nuclear Waste Isolation as part of the National Waste Terminal Storage program. The study defined a range of potential environmental effects of constructing, operating, decommissioning, and long-term isolation of a nuclear waste repository. The analytical methodology used to determine potential environmental effects required definition of a hypothetical environmental setting and repository. Potentially applicable regulatory requirements were identified and were used as guidelines to evaluate permitting feasibility. The environmental effects of repository development were analyzed for the two major time periods of concern: short term (the period of construction, operation, and decommissioning) and long term (the isolation period after decommissioning). As a result of this analysis, major environmental uncertainties and issues were identified. 11 references, 5 figures
Studies of hypothetical and fundamental decay properties of positronium
International Nuclear Information System (INIS)
Wahl, W.
1985-05-01
For the solution of the CP problem in the standard theory of the strong interaction the existence of a neutral pseudoscalar boson was postulated which couples to quarks and leptons. If the mass of this so-called axion is smaller than two electron masses for orthopositronium 'o-Ps' the decay into one photon and axion is expected in concurrence to the standard decay into three photons. The detection of a monoenergetic photon would be an indication for this decay channel because the axion would only very weakly interact with matter. In the spectrum no lineshape of a monoenergetic photon is observed. From this results in dependence on the mass of a hypothetical particle and with a confidence limit of 90% for the branching ratio of o-Ps an upper limit which is in the range between 320 keV and 950 keV less than 10 -7 . Applied to the axion model an upper limit for the mass of the standard axion of 250 keV results. For the study of the fundamental decay properties of positronium the lifetime of o-Ps and the 3γ energy distribution of the decay quanta were measured. Furthermore the rare 4γ decay of para-positronium 'p-Ps' was searched for. The measured lifetime of o-Ps τ=141.2±1.2ns agrees well with the theoretical value. Calculations on the 3γ energy distribution are confirmed. For the 4γ decay of p-Ps predicted by QED with a branching ratio of ≅ 1.5x10 -6 an upper limit of 2x10 -5 results. (orig./HSI) [de
International Nuclear Information System (INIS)
Goldhaber, M.
1988-01-01
For quite a while it has been realized that some discrete quantum numbers are conserved in some interactions but not in others. The most conspicuous cases are parity P, charge conjugation C, and the product CP which are conserved in strong and electromagnetic interactions but not in weak interactions. The question arises whether for some of the other conserved quantities, which are conserved in strong, electromagnetic and weak interactions, there is an interaction intermediate in strength between weak and gravitational which violates these quantum numbers, e.g., baryon number B and lepton number L. The possibility exists that these conservation laws, if they are broken at all, are only broken by the gravitational force which would make the mass of an intermediate boson which induces the break-down equal to the Planck mass. (orig.)
International Nuclear Information System (INIS)
Gjoerup, H.L.; Hedemann Jensen, P.; Jensen, N.O.; Pejtersen, V.; Lundtang Petersen, E.; Petersen, T.; Thykier-Nielsen, S.; Heikel Vinther, F.
1978-04-01
This report contains a critical review of Jan Beyea's report: A study of some of the consequences of hypothetical reactor accidents at Barsebaeck (Princeton University, January 1978). Unreasonable assumptions concerning dry deposition, plume rise, meteorological considerations, dose-response relationship and probability distributions were found in the report. It is found that the conclusions of the Beyea report are the result of a mathematical exercise rather than the results of a realistic risk evaluation for Barsebaeck. (author)
Austin, Jane E.; Slattery, Stuart; Clark, Robert G.
2014-01-01
There are 30 threatened or endangered species of waterfowl worldwide, and several sub-populations are also threatened. Some of these species occur in North America, and others there are also of conservation concern due to declining population trends and their importance to hunters. Here we review conservation initiatives being undertaken for several of these latter species, along with conservation measures in place in Europe, to seek common themes and approaches that could be useful in developing broad conservation guidelines. While focal species may vary in their life histories, population threats and geopolitical context, most conservation efforts have used a systematic approach to understand factors limiting populations and o identify possible management or policy actions. This approach generally includes a priori identification of plausible hypotheses about population declines or status, incorporation of hypotheses into conceptual or quantitative planning models, and the use of some form of structured decision making and adaptive management to develop and implement conservation actions in the face of many uncertainties. A climate of collaboration among jurisdictions sharing these birds is important to the success of a conservation or management programme. The structured conservation approach exemplified herein provides an opportunity to involve stakeholders at all planning stages, allows for all views to be examined and incorporated into model structures, and yields a format for improved communication, cooperation and learning, which may ultimately be one of the greatest benefits of this strategy.
Evaluating local benefits from conservation in Nepal's Annapurna Conservation Area.
Spiteri, Arian; Nepal, Sanjay K
2008-09-01
Protected areas are integral to the global effort to conserve biodiversity, and, over the past two decades, protected area managers have begun to recognize that conservation objectives are next to impossible to achieve without considering the needs and concerns of local communities. Incentive-based programs (IBPs) have become a favored approach to protected area management, geared at fostering local stewardship by delivering benefits tied to conservation to local people. Effective IBPs require benefits to accrue to and be recognized by those experiencing the greatest consequences as a result of the protected area, and those likely to continue extractive activities if their livelihood needs are compromised. This research examines dispersal of IBP benefits, as perceived by local residents in Nepal's Annapurna Conservation Area. Results reported here are based on questionnaire interviews with 188 households conducted between September and December 2004. Results indicate that local residents primarily identify benefits from social development activities, provisions for resource extraction, and economic opportunities. Overall, benefits have been dispersed equally to households in villages on and off the main tourist route, and regardless of a household's participation in tourism. However, benefits are not effectively targeted to poorer residents, those highly dependent on natural resources, and those experiencing the most crop damage and livestock loss from protected wildlife. This article provides several suggestions for improving the delivery of conservation incentives.
Barnett, Mark A; Sonnentag, Tammy L; Wadian, Taylor W; Jones, Tucker L; Langley, Courtney A
2015-01-01
The present study, involving sixth- to eighth-grade students, is an extension of a prior investigation (Barnett, Livengood, Sonnentag, Barlett, & Witham, 2010) that examined children's perceptions of hypothetical peers with various undesirable characteristics. Results indicate that children's perceptions of hypothetical peers with an undesirable characteristic are influenced by the peers' desire to change, the source of effort to change, and the peers' success or failure in changing the characteristic. The children anticipated responding more favorably to peers who were successful in overcoming an undesirable characteristic than peers who were unsuccessful. Regardless of the peers' outcome, the children anticipated responding more favorably to peers who tried to change than peers who relied on the effort of adult authorities to motivate change. The children perceived successful peers as experiencing more positive affect than their unsuccessful counterparts, especially if the success was presented as a fulfillment of the peers' desire to change their undesirable characteristic. Finally, the children's ratings reflected the belief that, among peers who failed to change their undesirable characteristic, lacking the desire to change increases the relative likelihood that the characteristic will be permanent.
International Nuclear Information System (INIS)
Hsu, I-Chow J.; Speight, Joycelyn; Hai, Jenny; Vigneault, Eric; Phillips, Theodore; Pouliot, Jean
2002-01-01
Purpose: To evaluate the dose distribution within the clinical target volume between two gynecologic brachytherapy systems - the tandem and ovoids and the Syed-Neblett gynecologic template - using a hypothetical computer model. Methods and Materials: Source positions of an intracavitary system (tandem and ovoids) and an interstitial system (GYN template) were digitized into the Nucletron Brachytherapy Planning System. The GYN template is composed of a 13-catheter implant (12 catheters plus a tandem) based on the Syed-Neblett gynecologic template. For the tandem and ovoids, the dwell times of all sources were evenly weighted to produce a pear-shaped isodose distribution. For the GYN template, the dwell times were determined using volume optimization. The prescribed dose was then normalized to point A in the intracavitary system and to a selected isodose line in the interstitial system. The treated volume in the two systems was kept approximately the same, and a cumulative dose-volume histogram of the treated volume was then generated with the Nucletron Brachytherapy Planning System to use for comparison. To evaluate the dose to a hypothetical target, in this case the cervix, a 2-cm-long, 3-cm-diameter cylinder centered along the tandem was digitized as the clinical target volume. The location of this hypothetical cervix was based on the optimal application of the brachytherapy system. A visual comparison of clinical target coverage by the treated volume on three different orthogonal planes through the treated volume was performed. The percentage dose-volume histograms of the target were generated for comparison. Multiple midline points were also placed at 5-mm intervals away from the tandem in the plane of the cervix to simulate the location of potential bladder and rectal dose points. Doses to these normal structures were calculated for comparison. Results: Although both systems covered the hypothetical cervix adequately, the interstitial system had a better
Madagascar Conservation & Development
African Journals Online (AJOL)
Madagascar Conservation & Development welcomes the results of original research, field surveys, advances in field and laboratory techniques, book reviews, and informal status reports from research, conservation, development and management programs and in-field projects in Madagascar. In addition, notes on changes ...
Prairie Conservation in Canada: The Prairie Conservation Action Plan Experience
Dean Nernberg; David Ingstrup
2005-01-01
In Canada, grassland conservation has been mobilized and directed through the development of Prairie Conservation Action Plans and Action Plan Committees in the three prairie provinces of Alberta (45 partner agencies and organizations), Saskatchewan (26 partners), and Manitoba (26 partners). In Alberta, 43 percent of the native prairie remains; in Saskatchewan and...
Conserving what, where and how? Cost-efficient measures to conserve biodiversity in Denmark
DEFF Research Database (Denmark)
Petersen, Anders Højgård; Strange, Niels; Anthon, Signe
2016-01-01
Biodiversity conservation efforts in Europe have traditionally focused on farmland and open nature areas such as grasslands, heathlands and meadows, while little attention has been devoted to conservation actions in forest. Using detailed information on the geographical distribution of about 900...... terrestrial species in Denmark we apply systematic conservation planning techniques to identify how to protect biodiversity at the lowest cost to society. The results suggest that conservation actions in forest should be given a higher priority. Thus, three to four times the number of forest species...... are protected per million € compared with species living in open land natural areas. Furthermore, a gap analysis finds the current designation of Natura 2000 and other protected areas is skewed toward open land natural areas, and insufficient to meet the conservation targets on forest species....
Exploring hypothetical learning progressions for the chemistry of nitrogen and nuclear processes
Henry, Deborah McKern
Chemistry is a bridge that connects a number of scientific disciplines. High school students should be able to determine whether scientific information is accurate, how chemistry applies to daily life, and the mechanism by which systems operate (NRC, 2012). This research focuses on describing hypothetical learning progressions for student understanding of the chemical reactions of nitrogen and nuclear processes and examines whether there is consistency in scientific reasoning between these two distinct conceptual areas. The constant comparative method was used to analyze the written products of students including homework, formative and summative tests, laboratory notebooks, reflective journals, written presentations, and discussion board contributions via Edmodo (an online program). The ten participants were 15 and 16 year old students enrolled in a general high school chemistry course. Instruction took place over a ten week period. The learning progression levels ranged from 0 to 4 and were described as missing, novice, intermediate, proficient, and expert. The results were compared to the standards set by the NRC with a lower anchor (expectations for grade 8) and upper anchor (expectations for grade 12). The results indicate that, on average, students were able to reach an intermediate level of understanding for these concepts.
Skibins, Jeffrey C; Powell, Robert B
2013-01-01
Zoos in the 21st century are striving to make effective contributions to conservation. Although zoos are extremely popular and host over 600 million visitors worldwide, one challenge zoos face is how to effectively engage visitors and raise awareness and action for conservation. To this end, zoos commonly rely on charismatic megafauna, which have been shown to elicit a connection with zoo visitors. However, little is known about how to measure a connection to a species or how this connection may influence conservation behaviors. This study had two sequential objectives. The first was to develop a scale to measure visitors' connection to a species (Conservation Caring). The second was to investigate the relationship of Conservation Caring to pro-conservation behaviors, following a zoo experience. Pre- (n = 411) and post-visit (n = 452) responses were collected from three sites in order to assess the reliability and validity of a scale to measure Conservation Caring. Structural equation modeling was used to explore the relationship between Conservation Caring and pro-conservation behaviors. Conservation Caring was deemed a valid and reliable scale and was a strong predictor of species oriented behaviors (β = 0.62), for example, "adopting" an animal, but a weak predictor for biodiversity oriented behaviors (β = 0.07), for example, supporting sustainability policies. Results support the role zoos can play in fostering a connection to wildlife and stimulating pro-conservation behaviors. Additionally, visitors connected to a wide array of animals. On the basis of these results, zoos may recruit a wider assemblage of species as potential flagships. © 2013 Wiley Periodicals, Inc.
Simulation of Groundwater Mounding Beneath Hypothetical Stormwater Infiltration Basins
Carleton, Glen B.
2010-01-01
Groundwater mounding occurs beneath stormwater management structures designed to infiltrate stormwater runoff. Concentrating recharge in a small area can cause groundwater mounding that affects the basements of nearby homes and other structures. Methods for quantitatively predicting the height and extent of groundwater mounding beneath and near stormwater Finite-difference groundwater-flow simulations of infiltration from hypothetical stormwater infiltration structures (which are typically constructed as basins or dry wells) were done for 10-acre and 1-acre developments. Aquifer and stormwater-runoff characteristics in the model were changed to determine which factors are most likely to have the greatest effect on simulating the maximum height and maximum extent of groundwater mounding. Aquifer characteristics that were changed include soil permeability, aquifer thickness, and specific yield. Stormwater-runoff variables that were changed include magnitude of design storm, percentage of impervious area, infiltration-structure depth (maximum depth of standing water), and infiltration-basin shape. Values used for all variables are representative of typical physical conditions and stormwater management designs in New Jersey but do not include all possible values. Results are considered to be a representative, but not all-inclusive, subset of likely results. Maximum heights of simulated groundwater mounds beneath stormwater infiltration structures are the most sensitive to (show the greatest change with changes to) soil permeability. The maximum height of the groundwater mound is higher when values of soil permeability, aquifer thickness, or specific yield are decreased or when basin depth is increased or the basin shape is square (and values of other variables are held constant). Changing soil permeability, aquifer thickness, specific yield, infiltration-structure depth, or infiltration-structure shape does not change the volume of water infiltrated, it changes the
2010-03-04
... Diego County Water Authority Natural Communities Conservation Program/Habitat Conservation Plan, San... the NCCP/HCP's conservation strategy. Covered Activities would include developing new water... permit application, and notice of public meetings. SUMMARY: The San Diego County Water Authority (Water...
Conservation Laws for Partially Conservative Variable Mass Systems via d'Alembert's Principle
International Nuclear Information System (INIS)
Ahmed, Aftab; Ahmed, Naseer; Khan, Qudrat
2008-01-01
Conservation laws for partially conservative variable mass dynamical systems under symmetric infinitesimal transformations are determined. A generalization of Lagrange-d'Alembert's principle for a variable mass system in terms of asynchronous virtual variation is presented. The generalized Killing equations are obtained such that their solution yields the transformations and the associated conservation laws. An example illustrative of the theory is furnished at the end as well. (the physics of elementary particles and fields)
Harding, Hilary G.; Zinzow, Heidi M.; Burns, Erin E.; Jackson, Joan L.
2010-01-01
Previous research suggests that similarity to a victim may influence attributions of responsibility in hypothetical child sexual abuse scenarios. One aspect of similarity receiving mixed support in the literature is respondent child sexual abuse history. Using a sample of 1,345 college women, the present study examined child sexual abuse history,…
International Nuclear Information System (INIS)
Iniotakis, N.; Decken, C.B. von der
1982-01-01
In case of a hypothetical core heat up accident of an HTR the structural graphite of the reactor causes under certain circumstances a very important retardation of the release of fission products into the containment building of the plant. A model is presented which describes the transport phenomena in the graphite structure extensively taking into account specially the macro-structure of the graphite. It is shown by parameter variations under which conditions one can expect a large retardation effect and quantitative values of this retardation, which can be very important, are given. (author)
Structural properties of hypothetical CeBa2Cu3O7 compound from LSDA+DMFT calculations
Directory of Open Access Journals (Sweden)
Łuszczek Maciej
2016-09-01
Full Text Available The hypothetical stoichiometric CeBa2Cu3O7 (Ce123 compound, which has not been synthesized as a single phase yet, was studied by the density functional theory (DFT. We utilized a method which merges the local spin density approximation (LSDA with the dynamical mean-field theory (DMFT to account for the electronic correlations. The LSDA+DMFT calculations were performed in the high-temperature range. The particular emphasis was put on the pressure-induced changes in the electronic band structure related to strongly correlated 4f states. The computational results indicate the occurrence of a large negative volumetric thermal expansion coefficient near T = 500 K and a trace of a low-volume isostructural metastable state at high temperatures.
Directory of Open Access Journals (Sweden)
Jessica Hullman
Full Text Available Many visual depictions of probability distributions, such as error bars, are difficult for users to accurately interpret. We present and study an alternative representation, Hypothetical Outcome Plots (HOPs, that animates a finite set of individual draws. In contrast to the statistical background required to interpret many static representations of distributions, HOPs require relatively little background knowledge to interpret. Instead, HOPs enables viewers to infer properties of the distribution using mental processes like counting and integration. We conducted an experiment comparing HOPs to error bars and violin plots. With HOPs, people made much more accurate judgments about plots of two and three quantities. Accuracy was similar with all three representations for most questions about distributions of a single quantity.
Tourism-conservation enterprises for community livelihoods and biodiversity conservation in Kenya
Nthiga, R.W.; Duim, van der V.R.; Visseren-Hamakers, I.J.; Lamers, M.A.J.
2015-01-01
Tourism-conservation enterprises (TCEs), such as eco-lodges, are a relatively new strategy of the African Wildlife Foundation for enhancing community livelihoods and wildlife conservation in wildlife-rich areas outside state-protected areas in sub-Saharan Africa. This article investigates the extent
2010-04-16
... Program: Energy Conservation Standards for Residential Water Heaters, Direct Heating Equipment, and Pool... heating equipment and pool heaters. Table I.1--Amended Energy Conservation Standards for Residential Water... for national energy and water conservation; and 7. Other factors the Secretary of Energy (Secretary...
Crowdfunding biodiversity conservation.
Gallo-Cajiao, E; Archibald, C; Friedman, R; Steven, R; Fuller, R A; Game, E T; Morrison, T H; Ritchie, E G
2018-05-26
Raising funds is critical for conserving biodiversity and hence so too is scrutinizing emerging financial mechanisms that might help achieve this goal. In this context, anecdotal evidence indicates crowdfunding is being used to support a variety of activities needed for biodiversity conservation, yet its magnitude and allocation remain largely unknown. We conducted a global analysis to help address this knowledge gap, based on empirical data from conservation-focused projects extracted from crowdfunding platforms. For each project, we determined the funds raised, date, country of implementation, proponent characteristics, activity type, biodiversity realm, and target taxa. We identified 72 relevant platforms and 577 conservation-focused projects that have raised US$4 790 634 since 2009. Whilst proponents were based in 38 countries, projects were delivered across 80 countries, indicating a potential mechanism of resource mobilization. Proponents were from non-governmental organizations (35%), universities (30%), or were freelancers (26%). Most projects were for research (40%), persuasion (31%), and on-ground actions (21%). Projects have focused primarily on species (57.7%) and terrestrial ecosystems (20.3%), and less on marine (8.8%) and freshwater ecosystems (3.6%). Projects have focused on 208 species, including a disproportionate number of threatened bird and mammal species. Crowdfunding for biodiversity conservation has now become a global phenomenon and presents signals for potential expansion, despite possible pitfalls. Opportunities arise from its spatial amplifying effect, steady increase over time, inclusion of Cinderella species, adoption by multiple actors, and funding of a range of activities beyond research. Our study paves the way for further research on key questions, such as campaign success rates, effectiveness, and drivers of adoption. Even though the capital input of crowdfunding so far has been modest compared to other conservation finance
Geographies of Conservation I: De-extinction and Precision Conservation
Adams, William Mark
2016-01-01
Extinction has long been a central concern in biodiversity conservation. Today, de-extinction offers interesting possibilities of restoring charismatic species and ecosystem function, but also risks and costs. Most de-extinction depends on genetic engineering and synthetic biology. These technologies are also proposed for use in ‘gene tweaking’ in wild species to enhance their chance of survival. Within conservation, the resulting debates pit an optimistic world of high-tech ‘precision con...
2013-08-20
... merging the metal halide lamp fixture and the high-intensity discharge (HID) lamp rulemakings. This NOPR... Conservation Program: Energy Conservation Standards for Metal Halide Lamp Fixtures; Proposed Rule #0;#0;Federal...: Energy Conservation Standards for Metal Halide Lamp Fixtures AGENCY: Office of Energy Efficiency and...
McCormick, Stephen; Romero, L. Michael
2017-01-01
Endocrinologists can make significant contributions to conservation biology by helping to understand the mechanisms by which organisms cope with changing environments. Field endocrine techniques have advanced rapidly in recent years and can provide substantial information on the growth, stress, and reproductive status of individual animals, thereby providing insight into current and future responses of populations to changes in the environment. Environmental stressors and reproductive status can be detected nonlethally by measuring a number of endocrine-related endpoints, including steroids in plasma, living and nonliving tissue, urine, and feces. Information on the environmental or endocrine requirements of individual species for normal growth, development, and reproduction will provide critical information for species and ecosystem conservation. For many taxa, basic information on endocrinology is lacking, and advances in conservation endocrinology will require approaches that are both “basic” and “applied” and include integration of laboratory and field approaches.
Three-dimensional Structure of a Viral Genome-delivery Portal Vertex
Energy Technology Data Exchange (ETDEWEB)
A Olia; P Prevelige Jr.; J Johnson; G Cingolani
2011-12-31
DNA viruses such as bacteriophages and herpesviruses deliver their genome into and out of the capsid through large proteinaceous assemblies, known as portal proteins. Here, we report two snapshots of the dodecameric portal protein of bacteriophage P22. The 3.25-{angstrom}-resolution structure of the portal-protein core bound to 12 copies of gene product 4 (gp4) reveals a {approx}1.1-MDa assembly formed by 24 proteins. Unexpectedly, a lower-resolution structure of the full-length portal protein unveils the unique topology of the C-terminal domain, which forms a {approx}200-{angstrom}-long {alpha}-helical barrel. This domain inserts deeply into the virion and is highly conserved in the Podoviridae family. We propose that the barrel domain facilitates genome spooling onto the interior surface of the capsid during genome packaging and, in analogy to a rifle barrel, increases the accuracy of genome ejection into the host cell.
Hydrology and Conservation Ecology
Narayanan, M.
2006-12-01
Responses to change in the behavior of ecological systems are largely governed by interactions at different levels. Research is essential and is to be necessarily designed to gain insights into various interactions at the community level. Sustainable resource management is only possible if conservation of biodiversity can be accomplished by properly using the knowledge discovered. It is well known that the United States Department of Agriculture provides technical information, resources, and data necessary to assist the researchers in addressing their conservation needs. Conservation aims to protect, preserve and conserve the earth's natural resources. These include, but not limited to the conservation of soil, water, minerals, air, plants and all living beings. The United States Department of Agriculture also encourages farmers and ranchers to voluntarily address threats to soil and water. Protection of wetlands and wildlife habitat has been on the radar screen of conservation experts for a very long time. The main objective has always been to help farmers and landowners conform and comply with federal and state environmental laws. During the implementation phase, farmers should be encouraged to make beneficial, cost-effective changes to methods of irrigation systems. In some cases, the hydrologic regime of the project area can be thought of as principally an issue of river flow regimes for floodplain forests. In this presentation, the author tries to focus on the impact of hydrology and conservation ecology on global warming. He also discusses the impact of hydrology and conservation ecology global air concerns such as greenhouse gas concentrations in the atmosphere. References: Chow, V. T, D. R. Maidment, and L. W. Mays. 1988. Applied Hydrology. McGraw-Hill, Inc. U.S. Soil Conservation Service. Technical Release 55: Urban Hydrology for Small Watersheds. USDA (U.S. Department of Agriculture). June 1986. Lehner, B. and P. Döll (2004). Development and validation
Resource Conservation Glossary.
Soil Conservation Society of America, Ankeny, IA.
This glossary is a composite of terms selected from 13 technologies, and is the expanded revision of the original 1952 edition of "The Soil and Water Conservation Glossary." The terms were selected from these areas: agronomy, biology, conservation, ecology, economics, engineering, forestry, geology, hydrology, range, recreation, soils, and…
Richardson, Brianna; Price, Sheri; Campbell-Yeo, Marsha
2018-05-18
Using a queer phenomenological approach, the objective of this philosophical analysis is to explore the transgender experience in highly gendered clinical areas, such as the birth unit, and make recommendations on how to provide perinatal care that is inclusive of gender diversity within these areas. This paper aims to describes a hypothetical clinical experience to provide insight on the institutional barriers that currently exist and to provide nurses and midwives with pragmatic strategies to enhance gender-diverse care in general and gendered clinical areas. Currently, general healthcare providers are not sufficiently educated on how to care for and meet the needs of people who identify as lesbian, gay, bisexual, trans, queer, queer or questioning and other communities (LGBTQ+). This vulnerable population continually faces stigma, discrimination, and marginalization, which act as barriers to accessing healthcare services. Although transgender people often have difficulty accessing healthcare in general settings, they experience an even greater challenge within traditionally gendered clinical care areas. Queer Phenomenology was used to guide a critical philosophical analysis of hypothetical case reflecting a clinical scenario regarding a transgender man's experience in labour and birth. Healthcare professionals often provide insufficient care to transgender persons, inadvertently leading to further marginalization of this vulnerable population. Special consideration to provide gender-diverse care throughout the perinatal period is needed. Structures and supports are essential to enhance the care from providers in attending to the unique needs of transgender individuals and reduce oppressive effects from heteronormative environments. Nurses and midwives are leading exemplars of providing person-centered care and are capable of advocating for equitable care amongst all populations to influence systemic change. Strategies for implementing changes that address LGBTQ
Directory of Open Access Journals (Sweden)
Sudha Chandelia
2016-03-01
Full Text Available Background: Concerns over inappropriate use of cough and cold medication (CCM in children have been raised. In addition to being ineffective, these are now considered toxic for young children. Despite this fact studies from some regions have shown high use of these medications by physicians. However data on pediatricians and from India are negligible. Aim: To study the burden and patterns of cough and cold medications use by pediatricians for hypothetical cases. Methods: In this cross-sectional study; 172 pediatricians of various hospitals of Delhi and Haryana were enrolled from February 15 to March 15, 2012. They were contacted personally by authors and asked to write their prescriptions for two hypothetical case scenarios [having cough and cold] of two different age groups; (1 less than 2 years and (2 2–5 years. We made two categories as recommendations exist for children less than 2 years while recommendations for the second category are underway. Results were summarized as percentages, counts and; presented in tables and figures. Chi square test was used to establish association between categorical variables of subgroups. Results: Response rate was 93%. The most used CCM was antihistaminics (82% and systemic sympathomimetics (48%. The use of CCM was significantly less in teaching hospitals as compared to non-teaching (77% vs. 95%; p-value – 0.025. However there was no statistical difference in the practice of post graduates and more senior pediatricians (p value-0.895. No difference in CCM use in two age groups {(82% (less than 2 years vs. 85% (2–5 years; p-value – 0.531} was observed. Conclusion: Overall use of CCM is still high irrespective of patient age, pediatrician’s seniority or hospital setting. Efforts should be made to create awareness among the pediatricians regarding cautious use of these medications.
2010-04-05
... Conservation Program: Energy Conservation Standards for Small Electric Motors; Correction AGENCY: Office of... standards for small electric motors, which was published on March 9, 2010. In that final rule, the U.S... titled ``Energy Conservation Standards for Small Electric Motors.'' 75 FR 10874. Since the publication of...
Maixenchs, Maria; Anselmo, Rui; Zielinski-Gutiérrez, Emily; Odhiambo, Frank O.; Akello, Clarah; Zaidi, S. Shujaat H.; Soofi, Sajid Bashir; Bhutta, Zulfiqar A.; Diarra, Kounandji; Djitèye, Mahamane; Dembélé, Roukiatou; Sow, Samba; Minsoko, Pamela Cathérine Angoissa; Agnandji, Selidji Todagbe; Ismail, Mamudo R.; Carrilho, Carla; Ordi, Jaume; Menéndez, Clara; Bassat, Quique
2016-01-01
Background The minimally invasive autopsy (MIA) is being investigated as an alternative to complete diagnostic autopsies for cause of death (CoD) investigation. Before potential implementation of the MIA in settings where post-mortem procedures are unusual, a thorough assessment of its feasibility and acceptability is essential. Methods and Findings We conducted a socio-behavioural study at the community level to understand local attitudes and perceptions related to death and the hypothetical feasibility and acceptability of conducting MIAs in six distinct settings in Gabon, Kenya, Mali, Mozambique, and Pakistan. A total of 504 interviews (135 key informants, 175 health providers [including formal health professionals and traditional or informal health providers], and 194 relatives of deceased people) were conducted. The constructs “willingness to know the CoD” and “hypothetical acceptability of MIAs” were quantified and analysed using the framework analysis approach to compare the occurrence of themes related to acceptability across participants. Overall, 75% (379/504) of the participants would be willing to know the CoD of a relative. The overall hypothetical acceptability of MIA on a relative was 73% (366/504). The idea of the MIA was acceptable because of its perceived simplicity and rapidity and particularly for not “mutilating” the body. Further, MIAs were believed to help prevent infectious diseases, address hereditary diseases, clarify the CoD, and avoid witchcraft accusations and conflicts within families. The main concerns regarding the procedure included the potential breach of confidentiality on the CoD, the misperception of organ removal, and the incompatibility with some religious beliefs. Formal health professionals were concerned about possible contradictions between the MIA findings and the clinical pre-mortem diagnoses. Acceptability of the MIA was equally high among Christian and Islamic communities. However, in the two predominantly
Deligne, Natalia I.; Fitzgerald, Rebecca H.; Blake, Daniel M.; Davies, Alistair J.; Hayes, Josh L.; Stewart, Carol; Wilson, Grant; Wilson, Thomas M.; Castelino, Renella; Kennedy, Ben M.; Muspratt, Scott; Woods, Richard
2017-04-01
What happens when a city has a volcanic eruption within its boundaries? To explore the consequences of this rare but potentially catastrophic combination, we develop a detailed multi-hazard scenario of an Auckland Volcanic Field (AVF) eruption; the AVF underlies New Zealand's largest city, Auckland. We start with an existing AVF unrest scenario sequence and develop it through a month-long hypothetical eruption based on geologic investigations of the AVF and historic similar eruptions from around the world. We devise a credible eruption sequence and include all volcanic hazards that could occur in an AVF eruption. In consultation with Civil Defence and Emergency Management staff, we create a series of evacuation maps for before, during, and after the hypothetical eruption sequence. Our result is a versatile scenario with many possible applications, developed further in companion papers that explore eruption consequences on transportation and water networks. However, here we illustrate one application: evaluating the consequences of an eruption on electricity service provision. In a collaborative approach between scientists and electricity service providers, we evaluate the impact of the hypothetical eruption to electricity generation, transmission, and distribution infrastructure. We then evaluate how the impacted network functions, accounting for network adaptations (e.g., diverting power away from evacuated areas), site access, and restoration factors. We present a series of regional maps showing areas with full service, rolling outages, and no power as a result of the eruption. This illustrative example demonstrates how a detailed scenario can be used to further understand the ramifications of urban volcanism on local and regional populations, and highlights the importance of looking beyond damage to explore the consequences of volcanism.
Silva, K.; Lawawirojwong, S.; Promping, J.
2017-06-01
Consequence assessment of a hypothetical severe accident is one of the important elements of the risk assessment of a nuclear power plant. It is widely known that the meteorological conditions can significantly influence the outcomes of such assessment, since it determines the results of the calculation of the radionuclide environmental transport. This study aims to assess the impacts of the meteorological conditions to the results of the consequence assessment. The consequence assessment code, OSCAAR, of Japan Atomic Energy Agency (JAEA) is used for the assessment. The results of the consequence assessment using Thai meteorological data are compared with those using Japanese meteorological data. The Thai case has following characteristics. Low wind speed made the radionuclides concentrate at the center comparing to the Japanese case. The squalls induced the peaks in the ground concentration distribution. The evacuated land is larger than the Japanese case though the relocated land is smaller, which is attributed to the concentration of the radionuclides near the release point.
International Nuclear Information System (INIS)
Hastowo, H.; Nabbi, R.; Prayoto; Ismuntoyo, R.P.H.
2004-01-01
Investigation on ATWS and hypothetical accidents for the Indonesian Multipurpose Reactor RSG-GAS have been undertaken by computer simulation technique. Two computer codes, namely RELAP5 and PARET-ANL, were used as the main tools. The RELAP5 was utilized to perform system analysis while the PARET-ANL code was used to perform the reactor core analysis in more detail. Two different models have been applied as a basis of the simulation: Typical Working Core model (IWC-model) consisting of four regions with different radial power factors; and the hot-channel model consisting of two regions with different radial power factors. Both RELAP5 ad PARET-ANL results showed that in the occurrence of ATWS, failure on fuel element or fuel plate was limited to the region with the most highest power factor. The results also indicated that no high pressure development occurs in that region, so that mechanical damage on the fuel element or other core components due to pressure shock did not happen.(author)
Energy Technology Data Exchange (ETDEWEB)
Johannesen, Anne Borge; Skonhoft, Anders [Department of Economics, Norwegian University of Science and Technology, N-7491 Trondheim, Dragvoll (Norway)
2005-10-15
Integrated conservation and development projects (ICDPs) have frequently been established in Africa to improve wildlife conservation and the welfare of local communities. However, their effectiveness has been hampered by conflicts and illegal harvesting. This paper focuses on the strategic interaction between the manager of a protected area and a group of local people. The park manager benefits from wildlife through tourism and hunting. The local people benefit through hunting, but also bear the wildlife damage. ICDPs relying on money transfers to the local people from the park manager may or may not promote wildlife conservation. In addition, the welfare of the local people are ambiguous. (author) [Wildlife; Conservation; Conflicts; Local welfare].
Japan's energy conservation policy
International Nuclear Information System (INIS)
Yoda, Kenichi
1990-01-01
This article reviews developments in Japanese energy conservation since the 1970s. The industrial sector has achieved the greatest success, due to industrial restructuring as well as improvements in energy efficiency. In the residential/commercial sector, the efficiency of appliances has been much improved. Although improvements have been made in the fuel efficiency of passenger cars, energy consumption in the transportation sector has risen slightly owing to increased transport of passengers and freight. The overall responsibility for energy conservation policy rests with the Ministry of International Trade and Industry. MITI is also responsible for implementing specific conservation policies in regard to the industrial and commercial sectors. In the residential sector, MITI works with the Ministry of Construction and in the transportation sector with the Ministry of Transport. To realize the goals of energy conservation policy through general research, dissemination of public information and other activities, MITI works with the Energy Conservation Center (ECC). (author). 2 figs, 3 tabs
Point-of-views representation for hypothetical reasoning: application to decision-aid
International Nuclear Information System (INIS)
Diaz, Antoine
1992-01-01
Most of the knowledge based Decision Support Systems must deal with two difficulties in problem solving representation: reasoning with incomplete knowledge and managing contradictory reasoning. We propose a method which answers the question of reasoning revision when a contradiction occurs, while preserving the functionalities of the De Kleer's ATMS System for simulating hypothetical reasoning. As a matter of fact, these functionalities are particularly suitable for decision aiding problems. In order to formalize the ATMS, we use a resolution method called Cat-resolution (Cayrol and Tayrac). This method allows the computation of ATMS functions relating to a set of propositional clauses by saturating this set. Owing to this choice, we can use the same principles as ATMS on the saturation trace. Each clause in the saturated set can be linked to the sets of initial clauses justifying its derivation by Cat-resolution. The reasoning inconsistency is now managed. First the user can identify the source of the inconsistency thanks to the empty clause explanation. Then he can try to restore the reasoning consistency by relaxing at least one of the initial clauses justifying the empty clause. The computation of 'partial' ATMS, representing a point of view in the decision-making problem, is more effective owing to the justifications of the derived clauses. (author) [fr
Credibility and advocacy in conservation science
Horton, Cristi C.; Peterson, Tarla Rai; Banerjee, Paulami
2015-01-01
Abstract Conservation policy sits at the nexus of natural science and politics. On the one hand, conservation scientists strive to maintain scientific credibility by emphasizing that their research findings are the result of disinterested observations of reality. On the other hand, conservation scientists are committed to conservation even if they do not advocate a particular policy. The professional conservation literature offers guidance on negotiating the relationship between scientific objectivity and political advocacy without damaging conservation science's credibility. The value of this guidance, however, may be restricted by limited recognition of credibility's multidimensionality and emergent nature: it emerges through perceptions of expertise, goodwill, and trustworthiness. We used content analysis of the literature to determine how credibility is framed in conservation science as it relates to apparent contradictions between science and advocacy. Credibility typically was framed as a static entity lacking dimensionality. Authors identified expertise or trustworthiness as important, but rarely mentioned goodwill. They usually did not identify expertise, goodwill, or trustworthiness as dimensions of credibility or recognize interactions among these 3 dimensions of credibility. This oversimplification may limit the ability of conservation scientists to contribute to biodiversity conservation. Accounting for the emergent quality and multidimensionality of credibility should enable conservation scientists to advance biodiversity conservation more effectively. PMID:26041036
Framing conservation on private lands: conserving oak in Oregon's Willamette Valley
A. Paige Fischer; John C. Bliss
2009-01-01
Conserving threatened habitats on private lands requires policies that advance the interests of landowners and natural resource professionals alike. Through qualitative analysis of individual and focus-group interviews, we compared how family forest owners and natural resource professionals frame conservation of threatened habitat: the oak woodlands and savanna in...
Scheeren, Anke M.; Begeer, Sander; Banerjee, Robin; Terwogt, Mark Meerum; Koot, Hans M.
2010-01-01
The self-presentation skills of children and adolescents with high-functioning autistic spectrum disorder (HFASD) and typically developing (TD) controls were compared, in response to both hypothetical and real life situations. In both situations, 26 HFASD and 26 TD participants were prompted to describe themselves twice, first in a baseline…
International Nuclear Information System (INIS)
Lunguya, J. M.
2013-06-01
This work presents the environmental impact analysis of some selected radionuclides released from the Ghana Research Reactor- 1 (GHARR-1) after a hypothetical postulated accidents scenario. The source term was identified and generated from an inventory of radioisotopes released during the accident. Atmospheric transport model was then applied to calculate the total effective dose and how it would be distributed to different organs of the human body as a function of distance downwind. All accident scenarios were selected from GHARR-1 Safety Analysis Report. After the source term was identified the MCNPX code was used to perform the core burnup/depletion analysis. The assumption was made that the activities were released to the atmosphere under a horse design basis accident scenario. The gaussian dose calculation method was applied, coded in Hotspot, a Healthy Physics computer code. This served as the computational tool to perform the atmospheric dispersion modeling and was used to calculate radionuclide concentration at downwind location. Based upon predominant meteorological conditions at the site, the adopted strategy was to use site-specific meteorological data and dispersion modeling to analyze the hypothetical release to the environment of radionuclides and evaluate to what extent such a release may have radiological effects on the public. Final data were processed and presented as Total Effective Dose Equivalent as a function of time and distance of deposition. The results indicate that all the values of Effective dose obtained are far below the regulatory limits, making the use of the reactor safe, even in the case of worst accident scenario where all the fission products were released into the atmosphere. (au)
Evangeli, Michael; Kafaar, Zuhayr; Kagee, Ashraf; Swartz, Leslie; Bullemor-Day, Philippa
2013-01-01
It is vital that enough participants are willing to participate in clinical trials to test HIV vaccines adequately. It is, therefore, necessary to explore what affects peoples' willingness to participate (WTP) in such trials. Studies have only examined individual factors associated with WTP and not the effect of messages about trial participation on potential participants (e.g., whether losses or gains are emphasized, or whether the outcome is certain or uncertain). This study explores whether the effects of message framing on WTP in a hypothetical HIV vaccine trial are consistent with Prospect Theory. This theory suggests that people are fundamentally risk averse and that (1) under conditions of low risk and high certainty, gain-framed messages will be influential (2) under conditions of high risk and low certainty, loss-framed messages will be influential. This cross-sectional study recruited 283 HIV-negative students from a South African university who were given a questionnaire that contained matched certain gain-framed, certain loss-framed, uncertain gain-framed, and uncertain loss-framed statements based on common barriers and facilitators of WTP. Participants were asked to rate how likely each statement was to result in their participation in a hypothetical preventative HIV vaccine trial. Consistent with Prospect Theory predictions, for certain outcomes, gain-framed messages were more likely to result in WTP than loss-framed messages. Inconsistent with predictions, loss-framed message were not more likely to be related to WTP for uncertain outcomes than gain-framed messages. Older students were less likely to express their WTP across the different message frames. Recruitment for HIV vaccine trials should pay attention to how messages about the trial are presented to potential participants.
Energy conservation. A goal for Albertans
Energy Technology Data Exchange (ETDEWEB)
Zwicky, L
1988-01-01
In late 1985, the Public Advisory Committees to the Environmental Council of Alberta began working toward a draft conservation strategy for Alberta. A prospectus was published and meetings and workshops held, the goal being a conservation strategy in place by 1992. This report is one of a series of discussion papers on relevant sectors such as agriculture, fish and wildlife, tourism, and various specific energy sources. This report focuses on energy use in general in the province, including the role of energy conservation in a conservation strategy, the potential for energy conservation, barriers, actions to encourage conservation, the impacts of conserving energy, and the next steps to take. 3 figs., 1 tab.
An exactly conservative particle method for one dimensional scalar conservation laws
International Nuclear Information System (INIS)
Farjoun, Yossi; Seibold, Benjamin
2009-01-01
A particle scheme for scalar conservation laws in one space dimension is presented. Particles representing the solution are moved according to their characteristic velocities. Particle interaction is resolved locally, satisfying exact conservation of area. Shocks stay sharp and propagate at correct speeds, while rarefaction waves are created where appropriate. The method is variation diminishing, entropy decreasing, exactly conservative, and has no numerical dissipation away from shocks. Solutions, including the location of shocks, are approximated with second order accuracy. Source terms can be included. The method is compared to CLAWPACK in various examples, and found to yield a comparable or better accuracy for similar resolutions.
Madagascar Conservation & Development: Editorial Policies
African Journals Online (AJOL)
... of the Madagascar Conservation & Development community. Finally, Madagascar Conservation & Development serves as a conduit for debate and discussion and welcomes contributions on any aspect of the legal or scientific status of any species living in Madagascar, or on conservation and development philosophy.
Smith, Martha
2010-01-01
Take plant lessons outdoors with this engaging and inquiry-based activity in which third-grade students learn how to apply soil conservation methods to growing plants. They also collect data and draw conclusions about the effectiveness of their method of soil conservation. An added benefit to this activity is that the third-grade students played…
Optimal conservation of migratory species.
Directory of Open Access Journals (Sweden)
Tara G Martin
Full Text Available BACKGROUND: Migratory animals comprise a significant portion of biodiversity worldwide with annual investment for their conservation exceeding several billion dollars. Designing effective conservation plans presents enormous challenges. Migratory species are influenced by multiple events across land and sea-regions that are often separated by thousands of kilometres and span international borders. To date, conservation strategies for migratory species fail to take into account how migratory animals are spatially connected between different periods of the annual cycle (i.e. migratory connectivity bringing into question the utility and efficiency of current conservation efforts. METHODOLOGY/PRINCIPAL FINDINGS: Here, we report the first framework for determining an optimal conservation strategy for a migratory species. Employing a decision theoretic approach using dynamic optimization, we address the problem of how to allocate resources for habitat conservation for a Neotropical-Nearctic migratory bird, the American redstart Setophaga ruticilla, whose winter habitat is under threat. Our first conservation strategy used the acquisition of winter habitat based on land cost, relative bird density, and the rate of habitat loss to maximize the abundance of birds on the wintering grounds. Our second strategy maximized bird abundance across the entire range of the species by adding the constraint of maintaining a minimum percentage of birds within each breeding region in North America using information on migratory connectivity as estimated from stable-hydrogen isotopes in feathers. We show that failure to take into account migratory connectivity may doom some regional populations to extinction, whereas including information on migratory connectivity results in the protection of the species across its entire range. CONCLUSIONS/SIGNIFICANCE: We demonstrate that conservation strategies for migratory animals depend critically upon two factors: knowledge of
DEFF Research Database (Denmark)
Lechner, Alex Mark; Brown, Greg; Raymond, Christopher Mark
2015-01-01
aspects of conservation planning. Objectives We present an approach for characterizing the potential effects of public conservation orientation and projected future development land use scenarios on landscape connectivity. Methods Using public participation GIS techniques (mail-based surveys linked...... to a mapping component), we classified spatially explicit conservation values and preferences into a conservation orientation index consisting of positive, negative, or neutral scores. Connectivity was then modeled using a least-cost path and graph-network approach for a range of conservation orientation...... and development scenarios in the Lower Hunter region, Australia. Scenarios were modelled through either adding vegetation (positive orientation) or removing vegetation (negative orientation, development). Results Scenarios that included positive conservation orientation link the isolated eastern and western...
Space, time and conservation laws
International Nuclear Information System (INIS)
Aronov, R.A.; Ugarov, V.A.
1978-01-01
The Neter theorem establishing correspondence between conservation laws and symmetry properties (space and time in particular) is considered. The theorem is based on one of the possible ways of finding equations of motion for a physical system. From a certain expression (action functional) equations of motion for a system can be obtained which do not contain new physical assertions in principal in comparison with the Newtonian laws. Neter suggested a way of deriving conservation laws by transforming space and time coordinates. Neter theorem consequences raise a number of problems: 1). Are conservation laws (energy, momentum) consequences of space and time symmetry properties. 2). Is it possible to obtain conservation laws in theory neglecting equations of motion. 3). What is of the primary importance: equations of motion, conservation laws or properties of space and time symmetry. It is shown that direct Neter theorem does not testify to stipulation of conservation laws by properties of space and time symmetry and symmetry properties of other non-space -time properties of material systems in objective reality. It says nothing of whether there is any subordination between symmetry properties and conservation laws
Ogorevc, Marko; Murovec, Nika; Fernandez, Natacha Bolanos; Rupel, Valentina Prevolnik
2017-03-28
The purpose of this article is to explore whether any differences exist between the general population and patient based preferences towards EQ-5D-5L defined hypothetical health states. The article discusses the role of adaptation and self-interest in valuing health states and it also contributes rigorous empirical evidence to the scientific debate on the differences between the patient and general population preferences towards hypothetical health states. Patient preferences were elicited in 2015 with the EQ-5D-5L questionnaire using time trade-off and discrete choice experiment design and compared to the Spanish general population preferences, which were elicited using identical methods. Patients were chosen on a voluntary basis according to their willingness to participate in the survey. They were recruited from patient organisations and a hospital in Madrid, Spain. 282 metastatic breast cancer patients and 333 rheumatoid arthritis patients were included in the sample. The analysis revealed differences in preferences between the general population and patient groups. Based on the results of our analysis, it is suggested that the differences in preferences stem from patients being more able to accurately imagine "non-tangible" dimensions of health states (anxiety or depression, and pain or discomfort) than the general population with less experience in various health states. However, this does not mean that general public values should not be reflected in utilities derived for coverage decision making. Copyright © 2017 Elsevier B.V. All rights reserved.
Wijk, van J.J.; Lamers, M.A.J.; Duim, van der V.R.
2015-01-01
This chapter examines the organizational form of tourism conservation enterprises, which has been developed and promoted by the African Wildlife Foundation (AWF) since the late 1990s. By deploying commercial tourism as a mechanism to attain conservation and livelihood goals, tourism conservation
International Nuclear Information System (INIS)
Dacheux, N.; Clavier, N.; Wallez, G.; Quarton, M.
2007-01-01
Three new crystal structures, isotypic with β-Zr 2 O(PO 4 ) 2 , have been resolved by the Rietveld method. All crystallize with an orthorhombic cell (S.G.: Cmca) with a = 7.1393(2) Angstroms, b = 9.2641(2) Angstroms, c 12.5262(4) Angstroms, V = 828.46(4) (Angstroms) 3 and Z = 8 for Th(OH)PO 4 ; a = 7.0100(2) Angstroms, b = 9.1200(2) Angstroms, c = 12.3665(3) Angstroms, V 790.60(4) (Angstroms) 3 and Z = 8 for U(OH)PO 4 ; a 7.1691(3) Angstroms, b 9.2388(4) Angstroms, c = 12.8204(7) Angstroms, V 849.15(7) (Angstroms) 3 and Z = 4 for Th 2 O(PO 4 ) 2 . By heating, the M(OH)PO 4 (M Th, U) compounds condense topotactically into M 2 O(PO 4 ) 2 , with a change of the environment of the tetravalent cation that lowers from 8 to 7 oxygen atoms. The lower stability of Th 2 O(PO 4 ) 2 compared to that of U 2 O(PO 4 ) 2 seems to result from this unusual environment for tetravalent thorium. (authors)
International Nuclear Information System (INIS)
Bartnicki, Jerzy; Amundsen, Ingar; Brown, Justin; Hosseini, Ali; Hov, Øystein; Haakenstad, Hilde; Klein, Heiko; Lind, Ole Christian; Salbu, Brit; Szacinski Wendel, Cato C.; Ytre-Eide, Martin Album
2016-01-01
The Russian nuclear submarine K-27 suffered a loss of coolant accident in 1968 and with nuclear fuel in both reactors it was scuttled in 1981 in the outer part of Stepovogo Bay located on the eastern coast of Novaya Zemlya. The inventory of spent nuclear fuel on board the submarine is of concern because it represents a potential source of radioactive contamination of the Kara Sea and a criticality accident with potential for long-range atmospheric transport of radioactive particles cannot be ruled out. To address these concerns and to provide a better basis for evaluating possible radiological impacts of potential releases in case a salvage operation is initiated, we assessed the atmospheric transport of radionuclides and deposition in Norway from a hypothetical criticality accident on board the K-27. To achieve this, a long term (33 years) meteorological database has been prepared and used for selection of the worst case meteorological scenarios for each of three selected locations of the potential accident. Next, the dispersion model SNAP was run with the source term for the worst-case accident scenario and selected meteorological scenarios. The results showed predictions to be very sensitive to the estimation of the source term for the worst-case accident and especially to the sizes and densities of released radioactive particles. The results indicated that a large area of Norway could be affected, but that the deposition in Northern Norway would be considerably higher than in other areas of the country. The simulations showed that deposition from the worst-case scenario of a hypothetical K-27 accident would be at least two orders of magnitude lower than the deposition observed in Norway following the Chernobyl accident. - Highlights: • Long-term meteorological database has been developed for atmospheric dispersion. • Using this database, the worst case meteorological scenarios have been selected. • Mainly northern parts of Norwegian territory will be
Readings in Wildlife and Fish Conservation, High School Conservation Curriculum Project.
Ensminger, Jack
This publication is a tentative edition of readings on Wildlife and Fish Conservation in Louisiana, and as such it forms part of one of the four units of study designed for an experimental high school course, the "High School Conservation Curriculum Project." The other three units are concerned with Forest Conervation, Soil and Water…
A True Proteus: A history of energy conservation in German science and culture, 1847-1914
Wegener, F. D. A.
2009-11-01
This thesis follows the career of the law of energy conservation in German science and culture between 1847 and 1914. There is an interesting contrast between the initial reception of Hermann Helmholtz’ 1847 treatise ‘Über die Erhaltung der Kraft’, which was rejected by the editor of the Annalen der Physik, and its later status as a classic of science. ‘Energy’ was the shared concept of the disciplines. It was used by physiologists, physicists, psychologists, sociologists and philosophers. Moreover, the law of energy conservation also made a huge cultural impact. The period around 1900 has justly been called an energetic era. Why did the law of energy conservation become such a universal success? The obvious way to explain this success would be to say: because it is true, and subsequently comment upon its great scientific value. This thesis adopts a different perspective. It adopts Wittgenstein’s definition of meaning as use in language. Consequently, the meaning of the law is only referred to in relation to the way in which it was put to use in communicative practice. From this perspective it is immediately evident that the understanding of the law of energy conservation was subject to considerable change. Helmholtz initially conceptualized the law in terms of atoms and forces; Gustav Kirchhoff and Ernst Mach, rejected atoms and forces as hypothetical entities and they preferred to use the more mundane concept of work instead; Wilhelm Ostwald, finally, thought of energy as an immaterial substance. This thesis meticulously follows the changes in use and understanding to which the law was subject as it penetrated German science and culture. Communication and interests, rather than natural essences, are the central explanatory concepts of the thesis. From 1847 onwards Helmholtz and Du Bois-Reymond actively sought to spread the law of energy conservation among their colleagues and the general public. They told their fellow physiologists, for example, that
Methods of equipment conservation of a carboelectric
International Nuclear Information System (INIS)
Hurtado Higuera, Julio Cesar
2001-01-01
Several conservation methods are mentioned like they are those of conservation in dry, in humid, conservation of bombs of water conservation, of turbines, of generators, of transformers, of electric motors and conservation of coal piles
Handbook on energy conservation
International Nuclear Information System (INIS)
1989-12-01
This book shows energy situation in recent years, which includes reserves of energy resource in the world, crude oil production records in OPEC and non OPEC, supply and demand of energy in important developed countries, prospect of supply and demand of energy and current situation of energy conservation in developed countries. It also deals with energy situation in Korea reporting natural resources status, energy conservation policy, measurement for alternative energy, energy management of Korea, investment in equipment and public education for energy conservation.
43 CFR 427.1 - Water conservation.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Water conservation. 427.1 Section 427.1... INTERIOR WATER CONSERVATION RULES AND REGULATIONS § 427.1 Water conservation. (a) In general. The Secretary shall encourage the full consideration and incorporation of prudent and responsible water conservation...
DEFF Research Database (Denmark)
Boklund, Anette; Goldbach, Stine G.; Uttenthal, Åse
2008-01-01
of CSFV between the hypothetical wild-boar population and the domestic population. Furthermore, the economic impact is assessed taking the perspective of the Danish national budget and the Danish pig industry. We used InterSpreadPlus to model the differential classical swine fever (CSF) risk due to wild......Denmark has no free-range wild-boar population. However, Danish wildlife organizations have suggested that wild boar should be reintroduced into the wild to broaden national biodiversity. Danish pig farmers fear that this would lead to a higher risk of introduction of classical swine fever virus...
DEFF Research Database (Denmark)
Budeanu, Adriana
2017-01-01
Tourism is promoted by policy makers and international organizations as a tool for advancing conservation agendas, while contributing to poverty alleviation and human development, under the banner of ecotourism or sustainable tourism. However, the indiscriminating use of complex and ambiguous...... concepts such as “poverty” and “sustainability” hide important nuances with regards to the variety of processes and subsequent effects that are triggered when tourism and conservation are being adjoined. Experiences with tourism developments show that destinations that are weak economically find it harder...... to draw benefits from tourism developments or to decline participation in tourism with only little or no losses of sources of income and wealth. If tourism should fulfil sustainability goals related to conservation, poverty, and human development, it needs consistent governmental intervention...
Resource conservation management
International Nuclear Information System (INIS)
Miller, W.
1999-01-01
Resource conservation management is a management program similar to financial management in that its success requires commitment by all levels of the organization to the process as well as an accounting procedure and auditing of critical components. Resource conservation management provides a framework for all elements of efficient building operations and maintenance. The savings connected with the program are principally connected with changes in the way buildings are operated and maintained. Given the reduction in rebates for the installation of energy-efficient equipment, this approach has considerable promise. This paper discusses the evolution of the resource conservation management service and the savings associated with a two-year pilot effort with seven school districts, as well as the critical components of a successful program
Leadership: a new frontier in conservation science.
Manolis, Jim C; Chan, Kai M; Finkelstein, Myra E; Stephens, Scott; Nelson, Cara R; Grant, Jacqualine B; Dombeck, Michael P
2009-08-01
Leadership is a critical tool for expanding the influence of conservation science, but recent advances in leadership concepts and practice remain underutilized by conservation scientists. Furthermore, an explicit conceptual foundation and definition of leadership in conservation science are not available in the literature. Here we drew on our diverse leadership experiences, our reading of leadership literature, and discussions with selected conservation science leaders to define conservation-science leadership, summarize an exploratory set of leadership principles that are applicable to conservation science, and recommend actions to expand leadership capacity among conservation scientists and practitioners. We define 2 types of conservation-science leadership: shaping conservation science through path-breaking research, and advancing the integration of conservation science into policy, management, and society at large. We focused on the second, integrative type of leadership because we believe it presents the greatest opportunity for improving conservation effectiveness. We identified 8 leadership principles derived mainly from the "adaptive leadership" literature: recognize the social dimension of the problem; cycle frequently through action and reflection; get and maintain attention; combine strengths of multiple leaders; extend your reach through networks of relationships; strategically time your effort; nurture productive conflict; and cultivate diversity. Conservation scientists and practitioners should strive to develop themselves as leaders, and the Society for Conservation Biology, conservation organizations, and academia should support this effort through professional development, mentoring, teaching, and research.
Symmetry mappings concomitant to particle-number-conservation-baryon-number conservation
International Nuclear Information System (INIS)
Davis, W.R.
1977-01-01
Four theorem serve to demonstrate that matter fields in space-time admit certain timelike symmetry mappings concomitant to the familiar notion of particle number conservation, which can be more fundamentally accounted for by a type of projective invariance principle. These particular symmetry mappings include a family of symmetry properties that may be admitted by Riemannian space-times. In their strongest form, the results obtained provide some insight relating to the conservation of baryon number
Electric energy utilization and conservation
International Nuclear Information System (INIS)
Tripathy, S.C.
1991-01-01
Various aspects of electric energy utilization and conservation are discussed. First chapter reviews thermodynamic aspects of energy conservation. Subsequent chapters describe possibilities and methods of energy conservation in thermal power plants, airconditioning and ventilation systems, electric lighting systems, electric heating systems in industries, and railway electrification. Chapter 8 describes various modes of energy storage and compares their economies. The next chapter discusses various facets of energy economics and the last chapter discusses the practical aspects of energy conservation in different industries and power utilities. (M.G.B.). 100 refs
7 CFR 633.9 - Conservation plan.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Conservation plan. 633.9 Section 633.9 Agriculture... AGRICULTURE LONG TERM CONTRACTING WATER BANK PROGRAM § 633.9 Conservation plan. (a) The program participant... conservation plan for the acreage designated under an agreement. (b) The conservation plan is the basis for the...
Making conservation work for everyone
Energy Technology Data Exchange (ETDEWEB)
Wiersma, J. [Veridian Corp., Ajax, ON (Canada)
2004-07-01
This presentation discussed the economic value of conservation, the optimal deployment of energy conservation. A sample load profile was presented to demonstrate how much electricity the average residential customer uses on a summer day. The average customer does not have the tools to understand the financial consequences of conservation for different types of equipment at different times of the day. Smart metering technology could help in this regard. Accurate unsubsidized prices are also considered to be the best incentive to conserve because customers will reduce electricity use when the prices are high. It was also suggested that standards for new appliances should be increased effectively to their economic value. The enablers to energy conservation include solid consumer education programs, real time metering in places where it is cost effective, real time pricing in places where it is practical, and power rates that reflect real costs. Barriers to energy conservation include the residual economic advantage that may be insufficient to justify investment; support from local distribution companies and transmission companies if the lost revenue adjustment mechanism (LRAM) is not sufficient to recover lost revenue and if LDCs are not sufficiently involved in the design of the electricity conservation program. 7 figs.
Conservation Education: A Position Statement.
Soil Conservation Society of America, Ankeny, IA.
The Soil Conservation Society of America's (SCSA) aim is to advance the science and art of good land and water use. Conservation education has a significant role in achieving the wise use of these resources. In this report, perspectives are offered on: (1) the requirements for effective conservation education programs; (2) rationale for…
An assessment of the effect of reactor size on hypothetical ore disruptive accidents
International Nuclear Information System (INIS)
Buttery, N.E.; Board, S.J.
1978-01-01
There is a general tendency towards larger plant sizes, in the interests primarily of economies of scale. In this paper the effect of core size on hypothetical core disruptive accidents (HCDA) is considered, and it is shown that the energy yield increases rapidly with size, primarily due to a tendency towards coherence of voiding in reactors with a large positive void coefficient. Small cores compare favourably in this respect with alternative large designs with low void coefficient cores, because the reduced mass more than compensates for the reduced doppler constant, and they also have a potential advantage in later stages of HCDA (transition phase and after). If energetic HCDA cannot be shown to be unrealistic and if containment of these events is provided as part of the general safety philosophy, then the costs (which may increase disproportionately with yield) of engineering an adequately reliable system needs to be accounted for. Containment costs are only one of many factors which need to be taken into account in optimising the design and so the energy release from a HCDA must take its proper place in the optimisation according to the safety principles and safety case agreed for LMFBRS. (author)
Conservation genetics of Iberian raptors
Directory of Open Access Journals (Sweden)
Martinez–Cruz, B.
2011-12-01
Full Text Available In this paper I provide an overview of conservation genetics and describe the management actions in the wild that can benefit from conservation genetic studies. I describe the genetic factors of risk for the survival of wild species, the consequences of loss of genetic diversity, inbreeding and outbreeding depression, and the use of genetic tools to delimitate units of conservation. Then I introduce the most common applications of conservation genetics in the management of wild populations. In a second part of the paper I review the conservation genetic studies carried on the Iberian raptors. I introduce several studies on the Spanish imperial eagle, the bearded vulture, the black vulture and the red kite that were carried out using autosomal microsatellite markers and mitochondrial DNA (mtDNA sequencing. I describe studies on the lesser kestrel and Egyptian vulture that additionally applied major histocompatibility complex (MHC markers, with the purpose of incorporating the study of non–neutral variation. For every species I explain how these studies can be and/or are applied in the strategy of conservation in the wild.
International Nuclear Information System (INIS)
Wuschke, D.M.; Whitaker, S.H.; Goodwin, B.W.; Rasmussen, L.R.
1995-06-01
This report describes an assessment of the long-term radiological risk to an individual of the critical group that would result from a meteorite impact on a hypothetical reference disposal vault for used fuel, located 500 m below the Earth's surface. The purpose of the assessment was to determine if this radiological risk could exceed or approach the AECB risk criterion. (author). 47 refs., 5 tabs., 6 figs
Energy Technology Data Exchange (ETDEWEB)
Balakrishna, A.M.; Saxena, A.; Mok, H. Y.-K.; Swaminathan, K.
2009-11-01
The type IVb pilus of the enteropathogenic bacteria Salmonella typhi is a major adhesion factor during the entry of this pathogen into gastrointestinal epithelial cells. Its target of adhesion is a stretch of 10 residues from the first extracellular domain of cystic fibrosis transmembrane conductance regulator (CFTR). The crystal structure of the N-terminal 25 amino acid deleted S. typhi native PilS protein ({Delta}PilS), which makes the pilus, was determined at 1.9 {angstrom} resolution by the multiwavelength anomalous dispersion method. Also, the structure of the complex of {Delta}PilS and a target CFTR peptide, determined at 1.8 {angstrom}, confirms that residues 113-117 (NKEER) of CFTR are involved in binding with the pilin protein and gives us insight on the amino acids that are essential for binding. Furthermore, we have also explored the role of a conserved disulfide bridge in pilus formation. The subunit structure and assembly architecture are crucial for understanding pilus functions and designing suitable therapeutics against typhoid.
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.1278 >orf19.1278; Contig19-10104; complement(13162...4..>132028); ; conserved hypothetical protein; truncated protein IQNNKCSGCNLKLDFPVIHFKCKHSFHQKCLSTNLIATSTESS
NCBI nr-aa BLAST: CBRC-TSYR-01-0757 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0757 ref|YP_069190.1| hypothetical protein YPTB0648 [Yersinia pseudotuberculosis... IP 32953] ref|YP_001722278.1| type VI secretion system Vgr family protein [Yersinia pseudotuberculosis... YPIII] ref|YP_001871112.1| type VI secretion system Vgr family protein [Yersinia pseudotuberculosis PB...1/+] emb|CAH19888.1| conserved hypothetical protein [Yersinia pseudotuberculosis ...IP 32953] gb|ACA69825.1| type VI secretion system Vgr family protein [Yersinia pseudotuberculosis YPIII] gb|
Otto, Clint R.; O'Dell, Samuel; Bryant, R. B.; Euliss, Ned H. Jr.; Bush, Rachel; Smart, Matthew
2017-01-01
Concern over declining pollinators has led to multiple conservation initiatives for improving forage for bees in agroecosystems. Using data available through the Pollinator Library (npwrc.usgs.gov/pollinator/), we summarize plant–pollinator interaction data collected from 2012–2015 on lands managed by the U.S. Fish and Wildlife Service and private lands enrolled in U.S. Department of Agriculture conservation programs in eastern North Dakota (ND). Furthermore, we demonstrate how plant–pollinator interaction data from the Pollinator Library and seed cost information can be used to evaluate hypothetical seeding mixes for pollinator habitat enhancements. We summarize records of 314 wild bee and 849 honey bee (Apis mellifera L.) interactions detected on 63 different plant species. The wild bee observations consisted of 46 species, 15 genera, and 5 families. Over 54% of all wild bee observations were represented by three genera―Bombus, Lassioglossum, and Melissodes. The most commonly visited forbs by wild bees were Monarda fistulosa, Sonchus arvensis, and Zizia aurea. The most commonly visited forbs by A. mellifera were Cirsium arvense, Melilotus officinalis, and Medicago sativa. Among all interactions, 13% of A. mellifera and 77% of wild bee observations were made on plants native to ND. Our seed mix evaluation shows that mixes may often need to be tailored to meet the unique needs of wild bees and managed honey bees in agricultural landscapes. Our evaluation also demonstrates the importance of incorporating both biologic and economic information when attempting to design cost-effective seeding mixes for supporting pollinators in a critically important part of the United States.
International Nuclear Information System (INIS)
Suzuki, K.; Tashiro, M.; Sasanuma, K.; Nagashima, K.
1976-01-01
This study shows the effect of constraints around FSI zone on FSI phenomena and deformations of reactor structures. SUGAR-PISCES code system has been developed to evaluate the phenomena of FSI and the response of reactor structure. SUGAR calculates the phenomena of FSI. PISCES, developed by Physics International Company in U.S.A., calculates the dynamic response of reactor structure in two-dimensional, time-dependent finite-difference Lagrangian model. The results show that the peak pressure and energy by FSI and the deformation of reactor structures are about twice in case of FSI zone surrounding by blanket than by coolant. The FSI phenomena highly depend on the reactor structure and the realistic configuration around core must be considered for analyzing hypothetical core disruptive accident. This work was supported by a grant from Power Reactor and Nuclear Fuel Development Corporation. (auth.)
International Nuclear Information System (INIS)
Yamano, Norihiro; Maruyama, Yu; Kudo, Tamotsu; Moriyama, Kiyofumi; Ito, Hideo; Komori, Keiichi; Sonobe, Hisao; Sugimoto, Jun
1998-06-01
In the ALPHA (Assessment of Loads and Performance of Containment in Hypothetical Accident) program, several tests have been performed to quantitatively evaluate loads to and performance of a containment vessel during a severe accident of a light water reactor. The ALPHA program focuses on investigating leak behavior through the containment vessel, fuel-coolant interaction, molten core-concrete interaction and FP aerosol behavior, which are generally recognized as significant phenomena considered to occur in the containment. In designing the experimental facility, it was considered to simulate appropriately the phenomena mentioned above, and to cover experimental conditions not covered by previous works involving high pressure and temperature. Experiments from the viewpoint of accident management were also included in the scope. The present report describes design specifications, dimensions, instrumentation of the ALPHA facility based on the specific test objectives and procedures. (author)
Rob Baldwin; Ryan Scherzinger; Don Lipscomb; Miranda Mockrin; Susan Stein
2014-01-01
Recent advances in planning and ecological software make it possible to conduct highly technical analyses to prioritize conservation investments and inform local land use planning. We review these tools, termed conservation planning tools, and assess the knowledge of a key set of potential users: the land use planning community. We grouped several conservation software...
Is international conservation aid enough?
Law, Elizabeth A.
2016-02-01
Bare et al (2015 Environ. Res. Lett. 10 125010) ask an important question: is international conservation enough? Since the 1990’s international conservation donors have spent over 3.4 billion on biodiversity conservation related projects in sub-Saharan Africa. Both donors and recipients have a right to know if this is effective. Surprisingly, this question is rarely asked. It is a difficult question—involving many rival social, environmental, and economic explanations. Bare, Kauffman and Miller uncover some interesting associations, supporting existing hypotheses and proposing their own: that conservation aid alone is insufficient to mitigate drivers of deforestation (and in some cases may even exacerbate forest loss). This controversial result warrants further investigation—but what is needed now is nuance and robustness in further analyses, to have more confidence in the critique and it’s implications for international conservation aid.
Case study of building of conservation coalitions to conserve ecological interactions.
Chen, Gao; Luo, Shihong; Mei, Nianshu; Shen, Dingfang; Sun, Weibang
2015-12-01
We engaged experts in various fields of study (pollination ecology, chemical ecology, and ethnobotany), invited community participation, and provided environmental education in an effort to conserve an endangered birthwort (Aristolochia delavayi) and a vulnerable pipevine swallowtail (Byasa daemonius). Scientists studied the uptake and sequestration of the secondary metabolites aristolochic acids from A. delavayi leaves by different stages of pipevine swallowtail as a defense mechanism; low fruit set of the myophilous A. delavayi due to pollinator limitation; and the emission of chemical signals that attract parasitic wasps by the prepupae of B. daemonius. The results of these studies were part of an education program delivered by personnel of non-governmental organizations. The program was devised to deliver information to the public about the health risks of consuming A. delavayi individuals (aristolochic-acid-associated cancers) and to establish a bridge between the public and scientific research. Following delivery of the program, the behavior of residents changed considerably. Community residents were involved in management activities, including participation in a program to promote understanding of ecological interactions between A. delavayi and B. daemonius; designing an in situ conservation site; monitoring A. delavayi and B. daemonius individuals; and promoting the natural fruit set of A. delavayi by scattering animal excrement to attract fly pollinators. The integration of scientific information and community participation appears to have resulted in an increase in abundance of threatened A. delavayi and B. daemonius populations. We believe the involvement of local people in conservation is necessary for successful species conservation. © 2015 Society for Conservation Biology.
International Nuclear Information System (INIS)
Basoglu, B.; Brewer, R.W.; Haught, C.F.; Hollenbach, D.F.; Wilkinson, A.D.; Dodds, H.L.; Pasqua, P.F.
1994-01-01
This paper describes the development of a computer model for predicting the excursion characteristics of a postulated, hypothetical, critically accident involving a homogeneous mixture of low-enriched UO 2 powder and water contained in a cylindrical blender. The model uses point neutronics coupled with simple lumped-parameter thermal-hydraulic feedback. The temperature of the system is calculated using a simple time-dependent energy balance where two extreme conditions for the thermal behavior of the system are considered, which bound the real life situation. Using these extremes, three different models are developed. To evaluate the models, the authors compared the results with the results of the POWDER code, which was developed by the Commissariat a l'Energie Atomique/United Kingdom Atomic Energy Authority (CEA/UKAEA) for damp powder systems. The agreement in these comparisons is satisfactory. Results of the excursion studies in this work show that approximately 10 19 fissions occur as a result of accidental water ingress into powder blenders containing 5,000 kg of low-enriched (5%) UO 2 powder
The Presence of Real Food Usurps Hypothetical Health Value Judgment in Overweight People123
Ziauddeen, Hisham; Davies, Kirsty M.; Jebb, Susan A.; Marteau, Theresa M.
2016-01-01
Abstract To develop more ecologically valid models of the neurobiology of obesity, it is critical to determine how the neural processes involved in food-related decision-making translate into real-world eating behaviors. We examined the relationship between goal-directed valuations of food images in the MRI scanner and food consumption at a subsequent ad libitum buffet meal. We observed that 23 lean and 40 overweight human participants showed similar patterns of value-based neural responses to health and taste attributes of foods. In both groups, these value-based responses in the ventromedial PFC were predictive of subsequent consumption at the buffet. However, overweight participants consumed a greater proportion of unhealthy foods. This was not predicted by in-scanner choices or neural response. Moreover, in overweight participants alone, impulsivity scores predicted greater consumption of unhealthy foods. Overall, our findings suggest that, while the hypothetical valuation of the health of foods is predictive of eating behavior in both lean and overweight people, it is only the real-world food choices that clearly distinguish them. PMID:27280152
The Work of the Civilian Conservation Corps: Pioneering Conservation in Louisiana
James P. Barnett; Anna C. Burns
2016-01-01
The Civilian Conservation Corps (CCC) was a public work relief program that operated from 1933 to 1942 in the United States for unemployed, unmarried men from relief families, ages 18-25. A part of the New Deal of U.S. President Franklin D. Roosevelt, it provided unskilled manual labor jobs related to the conservation and development of natural resources on the Nationâ...
Water Conservation Resource List.
NJEA Review, 1981
1981-01-01
Alarmed by the growing water shortage, the New Jersey State Office of Dissemination has prepared this annotated list of free or inexpensive instructional materials for teaching about water conservation, K-l2. A tipsheet for home water conservation is appended. (Editor/SJL)
Pellis, A.; Lamers, M.A.J.; Duim, van der V.R.
2015-01-01
Tourism plays an increasingly important role in the way non-governmental organisations govern landscapes, especially in decentralised conservation contexts in developing countries. In this paper, we examine the role of three key conservation organisations (the African Wildlife Foundation, the
International Nuclear Information System (INIS)
Kadyshevich, E.A.; Ostrovskii, V.E.
2007-01-01
A DNA replication, mitosis, and binary fission hydrate hypothesis (MRH hypothesis) allowing non-trivial explanations for the physicochemical mechanisms of some intracellular processes is proposed. The hypothesis has a thermodynamic basis and is initiated by original experimental calorimetric and kinetic studies of the behavior of functional organic polymer and monomer substances in highly concentrated aqueous solutions. Experimental data demonstrating the occurrence of a short-range ordering in concentrated aqueous solutions of such substances are included. Hypothetical simple non-enzymatic unified mechanisms for the natural processes of DNA local unwinding preceding the start of duplication, DNA replication, formation and disappearance of the protein bonds between sister chromatids in the centromere region of eukaryotic DNA and in the centromere-like region of prokaryotic DNA, moving of daughter chromosomes apart to the opposite sides of cells in late anaphase, and formation of the nuclear envelopes in telophase and intracellular membranes between the newly formed nuclei in cytokinesis are formulated. The nature of a number of other intracellular phenomena is discussed
Willis, Craig K R
2015-10-01
Conservation physiology aims to apply an understanding of physiological mechanisms to management of imperiled species, populations, or ecosystems. One challenge for physiologists hoping to apply their expertise to conservation is connecting the mechanisms we study, often in the laboratory, with the vital rates of populations in the wild. There is growing appreciation that infectious pathogens can threaten populations and species, and represent an important issue for conservation. Conservation physiology has much to offer in terms of addressing the threat posed to some host species by infectious pathogens. At the same time, the well-developed theoretical framework of disease ecology could provide a model to help advance the application of physiology to a range of other conservation issues. Here, I use white-nose syndrome (WNS) in hibernating North American bats as an example of a conservation problem for which integrative physiological research has been a critical part of research and management. The response to WNS highlights the importance of a well-developed theoretical framework for the application of conservation physiology to a particular threat. I review what is known about physiological mechanisms associated with mortality from WNS and emphasize the value of combining a strong theoretical background with integrative physiological studies in order to connect physiological mechanisms with population processes and thereby maximize the potential benefits of conservation physiology. © The Author 2015. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.