
Sample records for anglerfishes teleostei lophiiformes

  1. Evolutionary history of anglerfishes (Teleostei: Lophiiformes: a mitogenomic perspective

    Directory of Open Access Journals (Sweden)

    Shimazaki Mitsuomi


    Full Text Available Abstract Background The teleost order Lophiiformes, commonly known as the anglerfishes, contains a diverse array of marine fishes, ranging from benthic shallow-water dwellers to highly modified deep-sea midwater species. They comprise 321 living species placed in 68 genera, 18 families and 5 suborders, but approximately half of the species diversity is occupied by deep-sea ceratioids distributed among 11 families. The evolutionary origins of such remarkable habitat and species diversity, however, remain elusive because of the lack of fresh material for a majority of the deep-sea ceratioids and incompleteness of the fossil record across all of the Lophiiformes. To obtain a comprehensive picture of the phylogeny and evolutionary history of the anglerfishes, we assembled whole mitochondrial genome (mitogenome sequences from 39 lophiiforms (33 newly determined during this study representing all five suborders and 17 of the 18 families. Sequences of 77 higher teleosts including the 39 lophiiform sequences were unambiguously aligned and subjected to phylogenetic analysis and divergence time estimation. Results Partitioned maximum likelihood analysis confidently recovered monophyly for all of the higher taxa (including the order itself with the exception of the Thaumatichthyidae (Lasiognathus was deeply nested within the Oneirodidae. The mitogenomic trees strongly support the most basal and an apical position of the Lophioidei and a clade comprising Chaunacoidei + Ceratioidei, respectively, although alternative phylogenetic positions of the remaining two suborders (Antennarioidei and Ogcocephaloidei with respect to the above two lineages are statistically indistinguishable. While morphology-based intra-subordinal relationships for relatively shallow, benthic dwellers (Lophioidei, Antennarioidei, Ogcocephaloidei, Chaunacoidei are either congruent with or statistically indistinguishable from the present mitogenomic tree, those of the principally deep

  2. Deep-water chaunacid and lophiid anglerfishes (Pisces: Lophiiformes) off the south-eastern United States (United States)

    Caruso, John H.; Ross, Steve W.; Sulak, K.J.; Sedberry, G.R.


    Recent research cruises to deep (80-910 m) reef habitats off the south-eastern U.S. and in the northern Gulf of Mexico have provided new information on the diagnostic characteristics, behaviours, colour patterns in life, bottom associations, distributions and maximum sizes of species of the anglerfish genera Chaunax, Lophiodes and Sladenia. Chaunax stigmaeus occurred much further south than previously known (Blake Plateau off South Carolina), and all C. stigmaeus observed were found associated with dense beds of dead coral (Lophelia pertusa) rubble or on broken hard bottom. In contrast, Chaunax suttkusi was found on soft bottoms. Chaunax stigmaeus and C. suttkusi appear to be sympatric over a major portion of their ranges. Because knowledge of pigmentation in live or freshly caught Chaunax is critical to distinguish some members of the genus, changes in the colouration of C. suttkusi were noted and documented photographically immediately after death and after fixation. The yellow spots found on some, but not all specimens, temporarily disappeared completely after death, but they reappeared after fixation, slowly disappearing thereafter along with other carotenoid pigments. Lophiodes beroe and Lophiodes monodi were collected for the first time off the Atlantic coast of the U.S., being previously known only from the Gulf of Mexico, Caribbean Sea and the northern coast of South America. For both species (L. beroe and L. monodi), the collections included the two largest known representatives of the species (400 and 325 mm standard length, respectively). Lophiodes beroe commonly occurred on L. pertusa rubble, and seemed to prefer this habitat. Occupying such a habitat that is deep and difficult to sample probably explains how this common species escaped detection. Only a single L. monodi was collected or observed, so this species appears to be uncommon in this geographic area or at least so on coral rubble habitat. Detailed aspects of the colour patterns of both species

  3. Deep-water chaunacid and lophiid anglerfishes (Pisces: Lophiiformes) off the Southeastern United States (United States)

    Caruso, John H.; Ross, Steve W.; Sulak, Kenneth J.; Sedberry, George R.


    Recent research cruises to deep (80–910 m) reef habitats off the south-eastern U.S. and in the northern Gulf of Mexico have provided new information on the diagnostic characteristics, behaviours, colour patterns in life, bottom associations, distributions and maximum sizes of species of the anglerfish genera Chaunax, Lophiodes and Sladenia. Chaunax stigmaeus occurred much further south than previously known (Blake Plateau off South Carolina), and all C. stigmaeusobserved were found associated with dense beds of dead coral (Lophelia pertusa) rubble or on broken hard bottom. In contrast, Chaunax suttkusi was found on soft bottoms. Chaunax stigmaeusand C. suttkusi appear to be sympatric over a major portion of their ranges. Because knowledge of pigmentation in live or freshly caught Chaunax is critical to distinguish some members of the genus, changes in the colouration of C. suttkusi were noted and documented photographically immediately after death and after fixation. The yellow spots found on some, but not all specimens, temporarily disappeared completely after death, but they reappeared after fixation, slowly disappearing thereafter along with other carotenoid pigments. Lophiodes beroe andLophiodes monodi were collected for the first time off the Atlantic coast of the U.S., being previously known only from the Gulf of Mexico, Caribbean Sea and the northern coast of South America. For both species (L. beroe and L. monodi), the collections included the two largest known representatives of the species (400 and 325 mm standard length, respectively). Lophiodes beroecommonly occurred on L. pertusa rubble, and seemed to prefer this habitat. Occupying such a habitat that is deep and difficult to sample probably explains how this common species escaped detection. Only a single L. monodi was collected or observed, so this species appears to be uncommon in this geographic area or at least so on coral rubble habitat. Detailed aspects of the colour

  4. Variação geográfica de caracteres quantitativos em Ogcocephalus vespertilio (Linnaeus (Teleostei, Lophiiformes, Ogcocephalidae Geographic variation of morphometric characters in Ogcocephalus vespertilio (Linnaeus (Teleostei, Lophiiformes, Ogcocephalidae

    Directory of Open Access Journals (Sweden)

    Mauro José Cavalcanti


    Full Text Available Patterns of geographic variation in 10 morphometric characters were analyzed in a sample of 91 specimens of the batfish, Ogcocephalus vespertilio (L., from the NE and SE Brazilian coast, using multivariate statistics and randomization tests. The specimens were ordinated by principal components analysis in two groups corresponding to the regions north and south of the 23ºC isotherm, and size variation was found to account for 70.3%, whereas shape differences accounted for 23.6% of the total variation in morphometric characters. The two groups were different at the 1% significance level by multivariate analysis of variance based on the Wilk's criterion, tested by a randomization procedure. Width of illicial cavity and distance from anus to anal fin were the characters most contributing to the differentiation of the population samples.

  5. The first record of a frogfish, Fowlerichthys scriptissimus (Antennariidae, Lophiiformes, from Korea

    Directory of Open Access Journals (Sweden)

    Song-Hun Han


    Full Text Available Abstract This is the first report of Fowlerichthys scriptissimus (Lophiiformes, Antennariidae from Korea. A single specimen (291.0 mm SL was collected off the coast of Jejudo Island by gill net on 28 March 2012 and identified with morphological and molecular approaches. The specimen is characterized by having all five pelvic fin rays bifurcate and possessing 20 vertebrae, 13 pectoral-fin rays, and a basidorsal ocellus on the side of the body. This species is distinguishable from other Korean taxa by the number of pectoral fin rays, the bifurcate form of the pelvic rays, and the vertebral count. We add this species to the Korean fish fauna and suggest new Korean names, “Byeol-ssin-beng-i-sok” and “Byeol-ssin-beng-i” for the genus and species, respectively.

  6. A synthesis of the early life history of the anglerfish, Lophius piscatorius (Linnaeus, 1758) in northern British waters

    DEFF Research Database (Denmark)

    Hislop, J.R.G.; Gallego, A.; Heath, M.R.


    and an examination of the geographical distribution of pelagic and demersal anglerfish. Otolith incremental analysis indicates that the pelagic phase is relatively long(ca. 120 days) and growth during the first year of life is rapid. A particle tracking model predicts that pelagic post larvae of known age caught...

  7. A new species of the Genus Microbrotula (Teleostei: Bythitidae) from Cenderawasih Bay, New Guinea, Indonesia

    DEFF Research Database (Denmark)

    Schwarzhans, Werner; Nielsen, Jørgen


    Following the recent revision of Microbrotula (Schwarzhans Nielsen, 2011), an additional nine specimens of the viviparous genus Microbrotula (Teleostei: Bythitidae), all caught in the Cenderawasih Bay, Irian Jaya, New Guinea, Indonesia, were made available to us. These specimens represent a new...

  8. A new genus and species of Bythitidae (Teleostei: Ophidiiformes) from northwestern Australia

    DEFF Research Database (Denmark)

    Nielsen, Jørgen; Schwarzhans, Werner


    A new genus and species of bathyal bythitid fish (Teleostei: Ophidiiformes) is described based on a single specimen caught at a depth of 392 m in the Timor Sea off the coast of northwestern Australia. Timorichthys disjunctus gen. nov., sp. nov. differs from all other bythitid genera by the position...

  9. Feeding habits of the Oligocene bristlemouth fish Scopeloides glarisianus (Teleostei: Stomiiformes: Gonostomatidae)

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Prokofiev, A. M.; Krzemiński, W.


    Roč. 45, č. 4 (2012), s. 377-386 ISSN 0016-6995 Institutional research plan: CEZ:AV0Z30130516 Keywords : Teleostei * Gonostomatidae * functional morphology * feeding habits * cannibalism * palaeoecology * Palaeogene Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.052, year: 2012

  10. Miocene bristlemouths (Teleostei: Stomiiformes: Gonostomatidae) from the Makrilia Formation, Ierapetra, Crete

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Carnevale, G.


    Roč. 16, č. 3 (2017), s. 266-277 ISSN 1631-0683 Institutional support: RVO:67985831 Keywords : Teleostei * Gonostomatidae * Crete * Neogene * Tortonian * Cyclothone gaudanti sp. nov. Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 1.376, year: 2016

  11. Sahyadria, a new genus of barbs (Teleostei: Cyprinidae from Western Ghats of India

    Directory of Open Access Journals (Sweden)

    R. Raghavan


    Full Text Available Redline Torpedo Barbs (Teleostei: Cyprinidae, comprising of two species, Puntius denisonii and P. chalakkudiensis, and six evolutionarily distinct lineages are endemic to the streams of the Western Ghats freshwater ecoregion in peninsular India. Based on molecular and osteological evidence, we demonstrate that these barbs comprise a distinct genus, for which we propose the name Sahyadria.

  12. An Oligocene toadfish (Teleostei, Percomorpha) from Moravia, Czech Republic: The earliest skeletal record for the order Batrachoidiformes

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Carnevale, G.


    Roč. 92, č. 1 (2017), s. 123-131 ISSN 1214-1119 R&D Projects: GA ČR(CZ) GA16-21523S Institutional support: RVO:67985831 Keywords : Teleostei * Batrachoidiformes * Oligocene * Menilitic Formation * Paratethys Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 1.175, year: 2016

  13. Revision of the genus 'Microbrotula' (Teleostei: Bythitidae), with description of two new species and a related new genus

    DEFF Research Database (Denmark)

    Schwarzhans, Werner; Nielsen, Jørgen


    Following recent systematic revisions of Anderson (2005, 2007), seven species of the viviparous genus Microbrotula (Teleostei: Bythitidae) have been described, all from the Indo-west Pacific Ocean. Six of these species are here recognised as valid: M. bentleyi, M. greenfieldi, M. punicea, M. quee...

  14. Relationship between ecomorphology and trophic segregation in four closely related sympatric fish species (Teleostei, Sciaenidae). (United States)

    Blasina, Gabriela; Molina, Juan; Lopez Cazorla, Andrea; Díaz de Astarloa, Juan

    This study explores the relationship between ecomorphology and trophic segregation in four closely related sympatric fish species (Teleostei, Sciaenidae) that are known to differ in their trophic habits. Only adult specimens were analyzed: 103 Cynoscion guatucupa, 77 Pogonias cromis, 61 Micropogonias furnieri, and 48 Menticirrhus americanus. The four species presented divergent ecomorphological traits related to swimming agility, prey spotting and capture, and the potential size of prey they were able to swallow. Results suggest that these sciaenid species can partition the food resources, even though they completely overlap in space. Differences in their ecomorphological traits appear to correlate closely with the diet and consequently could explain the trophic differentiation observed. Arguably, these ecomorphological differences play a significant role in the coexistence of the adults of these sympatric fish species. Copyright © 2016 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  15. Next generation sequencing yields the complete mitochondrial genome of the largescale mullet, Liza macrolepis (Teleostei: Mugilidae). (United States)

    Shen, Kang-Ning; Tsai, Shiou-Yi; Chen, Ching-Hung; Hsiao, Chung-Der; Durand, Jean-Dominique


    In this study, the complete mitogenome sequence of largescale mullet (Teleostei: Mugilidae) has been sequenced by the next-generation sequencing method. The assembled mitogenome, consisting of 16,832 bp, had the typical vertebrate mitochondrial gene arrangement, including 13 protein-coding genes, 22 transfer RNAs, two ribosomal RNAs genes, and a non-coding control region of D-loop. D-loop which has a length of 1094 bp is located between tRNA-Pro and tRNA-Phe. The overall base composition of largescale mullet is 27.8% for A, 30.1% for C, 16.2% for G, and 25.9% for T. The complete mitogenome may provide essential and important DNA molecular data for further phylogenetic and evolutionary analysis for Mugilidae.

  16. Next generation sequencing yields the complete mitochondrial genome of the Hornlip mullet Plicomugil labiosus (Teleostei: Mugilidae). (United States)

    Shen, Kang-Ning; Chen, Ching-Hung; Hsiao, Chung-Der


    In this study, the complete mitogenome sequence of hornlip mullet Plicomugil labiosus (Teleostei: Mugilidae) has been sequenced by next-generation sequencing method. The assembled mitogenome, consisting of 16,829 bp, had the typical vertebrate mitochondrial gene arrangement, including 13 protein coding genes, 22 transfer RNAs, 2 ribosomal RNAs genes and a non-coding control region of D-loop. D-loop contains 1057 bp length is located between tRNA-Pro and tRNA-Phe. The overall base composition of P. labiosus is 28.0% for A, 29.3% for C, 15.5% for G and 27.2% for T. The complete mitogenome may provide essential and important DNA molecular data for further population, phylogenetic and evolutionary analysis for Mugilidae.


    Directory of Open Access Journals (Sweden)



    Full Text Available The origin of the largest modern vertebrate group, the Teleostei, saw major refinements in the last decades, thanks to newly discovered and stratigraphically closely spaced Triassic Lagerstätten. Here we report the oldest Pholidophoriformes (stem teleosts that were collected during a large scale yet detailed excavation of Upper Ladinian (Middle Triassic marine deposits in Xingyi City, Guizhou Province, China. Taxonomic comparisons support the erection of a new pholidophorid genus, Malingichthys gen. nov., with two species. The new genus shows a partially fused skull roof, a preopercular bone with a hockey-stick shape and, for the first time in Pholidophoridae, supraneural elements. Most Triassic marine vertebrate clades (fishes and reptiles, Malingichthys included first emerged in the South China Block, with Late Ladinian most showing an important faunal transformation that was strengthened by our last findings. The material here described is about 2 million years older than the previous records for pholidophorids. 

  18. Clave ilustrada de los peces chilenos de la familia Serranidae (Teleostei: Perciformes

    Directory of Open Access Journals (Sweden)

    Germán Pequeño


    Full Text Available Se presenta una clave para reconocer especies de la familia Serranidae de Chile, que se agrupan en las subfamilias Epinephelinae, Serraninae y Anthiinae. Se proporcionan antecedentes básicos referidos a la taxonomía del grupo, para mayor facilidad del reconocimiento. En cada caso específico, se indica la distribución geográfica e ilustraciones reducidas de las 13 especies de la familia Serranidae que en la actualidad son consideradas en la ictiofauna de Chile.Illustrated key for the Chilean fishes of the family Serranidae (Teleostei: Perciformes. A taxonomic key for identification of fish species of the family Serranidae of Chile, grouped in the subfamilies Epinephelinae, Serraninae and Anthiinae is presented. Basic data about the taxonomic of the group to facilitate the identification is given. In each specific case, the geographical distribution is showed. Reduced illustrations for the currently 13 serranid species considered in the Chilean ichthyofauna are included. Rev. Biol. Trop. 59 (1: 247-253. Epub 2011 March 01.

  19. Hyphessobrycon ocasoensis sp. n. (Teleostei, Characidae una nueva especie para el Alto Cauca, Colombia

    Directory of Open Access Journals (Sweden)

    García-Alzate, C. A.


    Full Text Available Hyphessobrycon ocasoensis n. sp. (Teleostei, Characidae a new species from the Alto Cauca, Colombia Hyphessobrycon ocasoensis n. sp. (Characiformes, Characidae from heterorhabdus group (Gery, 1977 is described from the upper Cauca River in Colombia. The new species is distinguished from all other known species by the following combination of characters: three unbranched and eight branched fins in the dorsal fin; short maxillary bone with one or no teeth; four small foramens in the maxillary bone, and five in the premaxillary; 5-17 scales with pores in the lateral line, six between the lateral line and anal-fin origin, six between the lateral line and pelvic-fin origin, and nine predorsals; depth of the caudal peduncle has a mean of 16.7% in standard length; interorbital width 50.6% in head; a dark spot on caudal peduncle and a dark lateral band that extends vertically from the dorsal–fin origin to the tips of the middle caudal fin rays. Physical and chemical data of their habitat are included.

  20. Phylogenetic Relationships of Pseudorasbora, Pseudopungtungia, and Pungtungia (Teleostei; Cypriniformes; Gobioninae Inferred from Multiple Nuclear Gene Sequences

    Directory of Open Access Journals (Sweden)

    Keun-Yong Kim


    Full Text Available Gobionine species belonging to the genera Pseudorasbora, Pseudopungtungia, and Pungtungia (Teleostei; Cypriniformes; Cyprinidae have been heavily studied because of problems on taxonomy, threats of extinction, invasion, and human health. Nucleotide sequences of three nuclear genes, that is, recombination activating protein gene 1 (rag1, recombination activating gene 2 (rag2, and early growth response 1 gene (egr1, from Pseudorasbora, Pseudopungtungia, and Pungtungia species residing in China, Japan, and Korea, were analyzed to elucidate their intergeneric and interspecific phylogenetic relationships. In the phylogenetic tree inferred from their multiple gene sequences, Pseudorasbora, Pseudopungtungia and Pungtungia species ramified into three phylogenetically distinct clades; the “tenuicorpa” clade composed of Pseudopungtungia tenuicorpa, the “parva” clade composed of all Pseudorasbora species/subspecies, and the “herzi” clade composed of Pseudopungtungia nigra, and Pungtungia herzi. The genus Pseudorasbora was recovered as monophyletic, while the genus Pseudopungtungia was recovered as polyphyletic. Our phylogenetic result implies the unstable taxonomic status of the genus Pseudopungtungia.

  1. Next generation sequencing yields the complete mitochondrial genome of the flathead mullet, Mugil cephalus cryptic species NWP2 (Teleostei: Mugilidae). (United States)

    Shen, Kang-Ning; Yen, Ta-Chi; Chen, Ching-Hung; Li, Huei-Ying; Chen, Pei-Lung; Hsiao, Chung-Der


    In this study, the complete mitogenome sequence of Northwestern Pacific 2 (NWP2) cryptic species of flathead mullet, Mugil cephalus (Teleostei: Mugilidae) has been amplified by long-range PCR and sequenced by next-generation sequencing method. The assembled mitogenome, consisting of 16,686 bp, had the typical vertebrate mitochondrial gene arrangement, including 13 protein-coding genes, 22 transfer RNAs, 2 ribosomal RNAs genes and a non-coding control region of D-loop. D-loop was 909 bp length and was located between tRNA-Pro and tRNA-Phe. The overall base composition of NWP2 M. cephalus was 28.4% for A, 29.8% for C, 26.5% for T and 15.3% for G. The complete mitogenome may provide essential and important DNA molecular data for further phylogenetic and evolutionary analysis for flathead mullet species complex.

  2. Cytogenetic characterization of the strongly electric Amazonian eel, Electrophorus electricus (Teleostei, Gymnotiformes, from the Brazilian rivers Amazon and Araguaia

    Directory of Open Access Journals (Sweden)

    Soraia B.A. Fonteles


    Full Text Available A karyotype analysis of the electric eel, Electrophorus electricus (Teleostei, Gymnotiformes, a strongly electric fish from northern South America, is presented. Two female specimens were analyzed, one from the Amazon River and one from the Araguaia River. The specimens had a chromosomal number of 2n = 52 (42M-SM + 10A. C-bands were present in a centromeric and pericentromeric position on part of the chromosomes; some interstitial C-bands were also present. Heteromorphic nucleolus organizer regions (NORs were detected in two chromosome pairs of the specimen from the Amazon River. The chromosome number and karyotype characteristics are similar to those of other Gymnotidae species. The genera Electrophorus and Gymnotus are positioned as the basal lineages in the Gymnotiformes phylogeny.

  3. Bipteria formosa (Kovaleva et Gaevskaya, 1979) comb. n. (Myxozoa: Myxosporea) in whiting Merlangius merlangus (Teleostei: Gadidae) from Denmark

    DEFF Research Database (Denmark)

    Karlbakk, Egil; Køie, Marianne


    A total of 22 specimens of whiting Merlangius merlangus (L.) (Teleostei, Gadidae) from the northern Øresund, Denmark were examined for Myxosporea. Zschokkella hildae Auerbach, 1910 (Myxidiidae), Gadimyxa sp. (Parvicapsulidae) and a species of Bipteria occurred in the renal tubules of 9%, 18% and 68...... Wakabayashi, 2000 and the Sphaerosporidae....


    African Journals Online (AJOL)

    these fISh (Love 1970), but the effects of maintaining fISh in laboratory aquaria on their haematology per se have not yet been investigated and laboratory data are usually thought to apply to wild fish as well. Newly caught, exhausted fish cannot be used for the determination of certain physiological parameters (Love 1970) ...


    African Journals Online (AJOL)

    There was no indication of sex-reversal, the steenbras remaining permanently ...... However, with ages greater than six exact determination ...... chances of inbreeding by self-fertilization and the possible crosses and lowering of the effective.

  6. Teleostei: Sparidae

    African Journals Online (AJOL)

    ponent of the fish community to receive attention. In order to assess the importance of the availability of various benthic ... Particular attention has also been paid to resource ..... has permitted an analysis of how selective R. sorbo is for prey.


    African Journals Online (AJOL)

    The breeding cycle of male Liza dumerili was studied in the Swartkops Estuary using a visual index, a gonosomatic index and a histological index. Histological studies were superior to any other means of establishing the breeding cycle in detail. Male fISh were in the inactive or non-breeding state during the winter months.


    African Journals Online (AJOL)

    Active. spermatocytogenesis, meiosis and spermiogenesis All testis lobules filled with cysts of primary and secondary spermato- cytes and spermatids. Sperm content of testis and main sperm duct varying from few sperm present to packed with sperm. Stage 6: Late spermiogenesis. More than 90% of testis filled with sperm.

  9. Teleostei, Apogonidae

    African Journals Online (AJOL)


    Jan 13, 1992 ... It remains to be seen if lhis social system is usual in this species. how olher aspects of ... Crewe 1990b), also has a queen caste, but it is not known how similar the .... several localities in the Western Indian Ocean. The counts.

  10. Teleostei: Sparidae

    African Journals Online (AJOL)


    May 2, 1991 ... P. grande is primarily herbivorous, feeding selectively on rhodophytes found on ... (1981) also states that P. grande attains sexual maturity between 40-45 cm ...... 31 these fish. For these reasons it is important that attention be.


    African Journals Online (AJOL)

    The different spermatogenic cells were measured under oil immersion (1 000 X). Both bright field and ... which runs along the entire length of the testes, as in Eucalia inconstans (Ruby & McMillan. 1970). The left ..... The vertebrate body. Ed. 4.


    African Journals Online (AJOL)

    richness and abundance of clinids in a group of intertidal rock pools near Muizenberg ... were made of the species, number and age classes of all fish present and their positions and activities. ... dependent variable due to variation in an independent variable (Sokal & Rohlf 1969). Log-. R ep ... Only two other fish species,.

  13. Two new species of Monogenea (Platyhelminthes: Cercomeridea parasitic on Chaetodipterus faber (Teleostei: Ephippidae from the Brazilian coastal zone

    Directory of Open Access Journals (Sweden)

    A. D. Cezar


    Full Text Available Metazoan parasites were extracted for 110 Chaetodipterus faber (Broussonet, 1782 (Teleostei: Ephippidae specimens from the coastal zone of the State of Rio de Janeiro, Brazil (nearly 21-23° S, 41-45° W. Two new species of monogeneans belonging to genera Sprostoniella and Parancylodiscoides are described and illustrated. The new species of Sprostoniella, differ from S. multitestis, the only known species of the genus, by: 1. the arrangement of septa (with 17 septa, two of them bifid and two incomplet in the new species; 17 septa, two of them trifid in S. multitestis. 2. the new species showed two central loculi, while S. multitestis only one, and 3. the first pair of anchors of the new species is small and poorly developed, while in S. multitestis is well developed and strong. The new species of Parancylodiscoides differs from P. chaetodipteri, the only known species of the genus, by: 1. the testis shape (bilobated in the new species, not bilobated in P. chaetodipteri, and 2. by the presence of accessory prostatic reservoir at the copulatory organ base (absent in P. chaetodipteri.Se extrajeron metazoos parásitos de 110 Chaetodipterus faber (Broussonet, 1782 (Teleostei: Ephippidae del litoral del Estado de Rio de Janeiro, Brasil (aprox. 21-23° S, 41-45° W. Se describe e ilustra dos nuevas especies de monogéneos de los géneros Sprostoniella y Parancylodiscoides. La nueva especie de Sprostoniella difiere de S. multitestis, la otra especie del género, por 1. la disposición de los septos (con 17 septos, dos de ellos bífidos y dos incompletos en la nueva especie; 17 septos, dos de ellos trífidos en S. multitestis, 2. la nueva especie muestra dos lóculos centrales, mientras S. multitestis sólo uno, y 3. el primer par de ganchos en la nueva especie es pequeño y poco desarrollado, mientras que en S. multitestis es robusto y bien desarrollado. La nueva especie de Parancylodiscoides difiere de P. chaetodipteri, la otra especie del género, por

  14. [Ontogenetic Mechanisms of Explosive Morphological Divergence in the Lake Tana (Ethiopia) Species Flock of Large African Barbs (Labeobarbus; Cyprinidae; Teleostei)]. (United States)

    Shkila, F N; Lazebny, O E; Kapitanova, D V; Abdissa, Belay; Borisov, V B; Smirnov, S V


    Species flock of Lake Tana (Ethiopia) large African barbs (Labeobarbus; Cyprinidae; Teleostei) was studied as a model system for investigating ontogenetic mechanisms of the explosive morphological divergence often accompanying sympatric speciation in bony fishes. Comparative morphological analysis carried out with the use ofgeometric morphometric techniques revealed quantitative differences in the head shapes of species under study. Comparative analysis of skull development revealed significant interspecies differences in the temporal characteristics of craniogenesis in these species. These two lines of evidence suggest that heterochronies in craniogenesis underlie divergence in the head shapes of adult Tana barbs. This prediction was verified via experimental changes of temporal characteristics of craniogenesis in L. intermedius, a putative ancestor for the Lake Tana species flock. For this aim, timing and rate of skull development were changed by artificial manipulation of thyroid hormone levels. In sum, it was shown that it is heterochronies that underlie an explosive morphological divergence of the Lake Tana barbs species flock. Our findings together with those reported in the literature suggest variability in the activity of the hypothalamic-pituitary-thyroid axis to contribute to these heterochronies.

  15. Heterochrony in fringeheads (Neoclinus) and amplification of an extraordinary aggressive display in the Sarcastic Fringehead (Teleostei: Blenniiformes). (United States)

    Hongjamrassilp, Watcharapong; Summers, Adam P; Hastings, Philip A


    The Sarcastic Fringehead (Neoclinus blanchardi, Teleostei) exhibits an extreme version of a common aggressive display, the "gaping display," in which an open mouth is presented toward an opponent. Males of this species have extremely long jaws that extend posteriorly well past the posterior margin of the head and are flared laterally during the gaping display. In this study, we explored morphological traits related to this extraordinary display in this and related species of blennies. Morphological modifications include enlargement of the buccopalatal membrane, elongation of the maxilla via an uncalcified posterior extension, and evolution of a novel hinge between the anterior maxilla and lacrimal bones permitting lateral movement of the upper jaw. Geometric morphometry using the truss network system, thin-plate spline, and PCA of three closely related species of Neoclinus indicate that the elongate maxilla of N. blanchardi most likely evolved via acceleration (faster growth compared to outgroups) and hypermorphosis (continued growth to a larger body size), both forms of peramorphic heterochrony. Coloration and fluorescence of the buccopalatal membrane may also serve to amplify the extraordinary gaping display of the Sarcastic Fringehead. © 2018 Wiley Periodicals, Inc.

  16. Mortality of Juvenile So-iuy Mullet, Liza Haematocheilus (Teleostei, Mugilidae, in the Sea of Azov Associated With Metacercaria (Digenea

    Directory of Open Access Journals (Sweden)

    Sarabeev V.


    Full Text Available Mortality of Juvenile So-iuy Mullet, Liza haematocheilus (Teleostei, Mugilidae, in the Sea of Azov Associated with Metacercariae (Digenea. Sarabeev, V. - Age-dependent patterns, including yearly variations of digenean metacercariae infestations of the introduced species, Liza haematocheilus (Temminck & Schlegel, 1845, were studied. We evaluated the impacts of three metacercaria species, Timoniella imbutiforme (Molin, 1859 Brooks, 1980, Diplostomum spp. and Ascocotyle (Phagicola longa Ransom, 1920, on juvenile fish in age from one month to 2+ years old from the Molochny Estuary and neighboring waters of the Sea of Azov by applying Croft on’s negative binomial truncation technique, epidemiologic and aggregation indices. Parasite surveys executed in 1997-2014 revealed significant yearly differences in the infection dynamics of studied metacercariae in juvenile fish of L. haematocheilus. Metacercariae were absent or fish harboured several times less parasites in 2005-2013 than in 1997-1999. T. imbutiforme infection exhibits a convex that was observed in a decline of the parasite load aft er an initial increase. The infection load of Diplostomum spp. increased asymptotically with the fish age reaching maximum value in two years old juveniles. Both the abundance and the prevalence of A. (P. longa were low in juveniles of two month and two years old but relatively high and more or less constant during the rest of the juvenile period. Results of the present study suggest that metacercariae, especially, T. imbutiforme, are associated with mortality of juvenile Liza haematocheilus.

  17. From sneaker to parental male: change of reproductive traits in the black goby, Gobius niger (Teleostei, Gobiidae). (United States)

    Immler, Simone; Mazzoldi, Carlotta; Rasotto, Maria Berica


    This study focuses on the consequences of the switch of tactic from parasitic to parental male in the black goby, Gobius niger (Teleostei: Gobiidae), a species showing two alternative male mating tactics. Older and larger males defend nests, court, and perform parental care on eggs, while younger and smaller ones behave as parasites, sneaking into nests while spawning occurs. Males adopting different tactics are known to present differences in primary and secondary sex traits. The social context of sneaker males was manipulated to induce a tactic switch. Sneakers were kept under two different experimental treatments with or without a female, and under exclusion of male-male competition. Males changed tactics, courting females, spawning, and performing parental care. All males showed substantial changes in primary sexual traits, such as a reduction in gonadal development and an increase in the investment in accessory structures. The experimental groups differed in the functionality of gonads and accessory organs and in the development of the secondary sex traits. These results demonstrate that the moment of switching is not genetically fixed in the black goby. Sneaker males are able to quickly reallocate energy in primary and secondary sex traits, in accordance with the adopted tactic. Several aspects of this flexible reproductive pattern resemble the socially controlled sex change found in sequential hermaphrodites. Copyright 2004 Wiley-Liss, Inc.

  18. Dactylogyrid monogeneans parasitising Cyphocharax voga (Hensel) (Teleostei: Curimatidae) from the Pampas region, Argentina: new and previously described species. (United States)

    Rossin, María Alejandra; Timi, Juan Tomás


    Most studies on dactylogyrid monogeneans in Argentina have been carried out during 1980s and 1990s. Many of these species have been later synonymised and other remain under a confusing taxonomic status, particularly those parasitising Cyphocharax voga (Hensel) (Teleostei: Curimatidae). In order to clarify the identity of dactylogyrids, new material was collected from fishes in Lake Chascomús, Buenos Aires Province, Argentina. A total of four species was found in the gills of C. voga. Two known species, Curvianchoratus singularis (Suriano, 1980) Suriano, 1986 and Palombitrema triangulum (Suriano, 1981) Suriano, 1997, are redescribed and their generic and specific status discussed, and two new species are described. Urocleidoides surianoae n. sp. can be distinguished from its congeners by having an anterior medial projection in the ventral bar and a laminar ligament connecting the base of the male copulatory organ and accessory piece. Annulotrematoides bonaerensis n. sp. differs from its congeners principally by having a ventral bar with an anterior medial projection. The diversity of dactylogyrids harboured by C. voga indicates the need of further studies in the Pampas region, which will provide interesting and valuable sources of evidence for future zoogeographical and evolutionary research on dactylogyrids in the Neotropics.

  19. Atividade de amilase em quimo de três espécies tropicais de peixes teleostei de água doce Amylase activity in the chyme of three teleostei freshwater fish

    Directory of Open Access Journals (Sweden)

    José Teixeira de Seixas Filho


    Full Text Available O objetivo deste trabalho foi determinar a atividade de amilase no quimo presente nos intestinos médio e posterior, ou reto, em três espécies tropicais de peixes Teleostei de água doce: piracanjuba, Brycon orbignyanus (Valenciennes, 1849, piau, Leporinus friderici (Bloch, 1794, onívoros, e surubim, Pseudoplatystoma coruscans (Agassiz, 1829, preferencialmente carnívoro, visando fornecer referência à nutrição para o ajuste da alimentação artificial. As atividades de amilase foram determinadas usando-se kit BIOCLIN com metodologia modificada por CARAWAY (1959. Os resultados monstraram atividade específica média (2106,33 UA/mg para amilase do piracanjuba e foram 91,74% menor em comparação ao piau (25.488,14 UA/mg, ambos de hábito alimentar onívoro, enquanto a atividade específica da amilase para o piracanjuba foi 89,06% menor em relação ao surubim (19.246,80 UA/mg, carnívoro, o qual apresentou atividade específica da amilase 24,49% menor em relação à do piau. Os dados sugerem que a grande diferença da atividade específica de amilase entre o piau e o piracanjuba possui ligação com sua morfometria e o complexo arranjo das pregas da mucosa dos intestinos médio e posterior. Além disso, a atividade de amilase do surubim indica possibilidade de uso de ração contendo carboidratos, porém estudos adicionais são necessários para a avaliação do comportamento dessas espécies na alimentação artificial.The objective of this work was to determine the amylase activity in the chyme present in the medium and posterior intestines or in the rectum of three tropical freshwater Teleostei species: piracanjuba, Brycon orbignyanus (Valenciennes, 1849, piau, Leporinus friderici (Bloch, 1974, omnivorous, and surubim, Pseudoplatystoma coruscans (Agassiz, 1829, preferably carnivorous, aiming to provide nutritional reference data for the adjustment of the artificial feeding systems. The amylase activity was determined by the use of

  20. Phylogeny and biogeography of highly diverged freshwater fish species (Leuciscinae, Cyprinidae, Teleostei) inferred from mitochondrial genome analysis. (United States)

    Imoto, Junichi M; Saitoh, Kenji; Sasaki, Takeshi; Yonezawa, Takahiro; Adachi, Jun; Kartavtsev, Yuri P; Miya, Masaki; Nishida, Mutsumi; Hanzawa, Naoto


    The distribution of freshwater taxa is a good biogeographic model to study pattern and process of vicariance and dispersal. The subfamily Leuciscinae (Cyprinidae, Teleostei) consists of many species distributed widely in Eurasia and North America. Leuciscinae have been divided into two phyletic groups, leuciscin and phoxinin. The phylogenetic relationships between major clades within the subfamily are poorly understood, largely because of the overwhelming diversity of the group. The origin of the Far Eastern phoxinin is an interesting question regarding the evolutionary history of Leuciscinae. Here we present phylogenetic analysis of 31 species of Leuciscinae and outgroups based on complete mitochondrial genome sequences to clarify the phylogenetic relationships and to infer the evolutionary history of the subfamily. Phylogenetic analysis suggests that the Far Eastern phoxinin species comprised the monophyletic clades Tribolodon, Pseudaspius, Oreoleuciscus and Far Eastern Phoxinus. The Far Eastern phoxinin clade was independent of other Leuciscinae lineages and was closer to North American phoxinins than European leuciscins. All of our analysis also suggested that leuciscins and phoxinins each constituted monophyletic groups. Divergence time estimation suggested that Leuciscinae species diverged from outgroups such as Tincinae to be 83.3 million years ago (Mya) in the Late Cretaceous and leuciscin and phoxinin shared a common ancestor 70.7 Mya. Radiation of Leuciscinae lineages occurred during the Late Cretaceous to Paleocene. This period also witnessed the radiation of tetrapods. Reconstruction of ancestral areas indicates Leuciscinae species originated within Europe. Leuciscin species evolved in Europe and the ancestor of phoxinin was distributed in North America. The Far Eastern phoxinins would have dispersed from North America to Far East across the Beringia land bridge. The present study suggests important roles for the continental rearrangements during the

  1. Non-invasive ancient DNA protocol for fluid-preserved specimens and phylogenetic systematics of the genus Orestias (Teleostei: Cyprinodontidae). (United States)

    Garrigos, Yareli Esquer; Hugueny, Bernard; Koerner, Kellie; Ibañez, Carla; Bonillo, Celine; Pruvost, Patrice; Causse, Romain; Cruaud, Corinne; Gaubert, Philippe


    Specimens stored in museum collections represent a crucial source of morphological and genetic information, notably for taxonomically problematic groups and extinct taxa. Although fluid-preserved specimens of groups such as teleosts may constitute an almost infinite source of DNA, few ancient DNA protocols have been applied to such material. In this study, we describe a non-invasive Guanidine-based (GuSCN) ancient DNA extraction protocol adapted to fluid-preserved specimens that we use to re-assess the systematics of the genus Orestias (Cyprinodontidae: Teleostei). The latter regroups pupfishes endemic to the inter-Andean basin that have been considered as a 'species flock', and for which the morphology-based taxonomic delimitations have been hotly debated. We extracted DNA from the type specimens of Orestias kept at the Muséum National d'Histoire Naturelle of Paris, France, including the extinct species O. cuvieri. We then built the first molecular (control region [CR] and rhodopsin [RH]) phylogeny including historical and recently collected representatives of all the Orestias complexes as recognized by Parenti (1984a): agassizii, cuvieri, gilsoni and mulleri. Our ancient DNA extraction protocol was validated after PCR amplification through an approach based on fragment-by-fragment chimera detection. After optimization, we were able to amplify Titicaca. We could not recover the reciprocal monophyly of any of the 15 species or morphotypes that were considered in our analyses, possibly due to incomplete lineage sorting and/or hybridization events. As a consequence, our results starkly question the delineation of a series of diagnostic characters listed in the literature for Orestias. Although not included in our phylogenetic analysis, the syntype of O. jussiei could not be assigned to the agassizii complex as newly defined. The CR sequence of the extinct O. cuvieri was recovered within the cuvieri clade (same haplotype as one representative of O. pentlandii), so

  2. Evolution of microhabitat association and morphology in a diverse group of cryptobenthic coral reef fishes (Teleostei: Gobiidae: Eviota)

    KAUST Repository

    Tornabene, Luke; Ahmadia, Gabby N.; Berumen, Michael L.; Smith, David J.; Jompa, Jamaluddì n; Pezold, Frank L.


    Gobies (Teleostei: Gobiidae) are an extremely diverse and widely distributed group and are the second most species rich family of vertebrates. Ecological drivers are key to the evolutionary success of the Gobiidae. However, ecological and phylogenetic data are lacking for many diverse genera of gobies. Our study investigated the evolution of microhabitat association across the phylogeny of 18 species of dwarfgobies (genus Eviota), an abundant and diverse group of coral reef fishes. In addition, we also explore the evolution of pectoral fin-ray branching and sensory head pores to determine the relationship between morphological evolution and microhabitat shifts. Our results demonstrate that Eviota species switched multiple times from a facultative hard-coral association to inhabiting rubble or mixed sand/rubble habitat. We found no obvious relationship between microhabitat shifts and changes in pectoral fin-ray branching or reduction in sensory pores, with the latter character being highly homoplasious throughout the genus. The relative flexibility in coral-association in Eviota combined with the ability to move into non-coral habitats suggests a genetic capacity for ecological release in contrast to the strict obligate coral-dwelling relationship commonly observed in closely related coral gobies, thus promoting co-existence through fine scale niche partitioning. The variation in microhabitat association may facilitate opportunistic ecological speciation, and species persistence in the face of environmental change. This increased speciation opportunity, in concert with a high resilience to extinction, may explain the exceptionally high diversity seen in Eviota compared to related genera in the family. © 2012 Elsevier Inc.

  3. Next-generation sequencing yields the complete mitochondrial genome of the flathead mullet, Mugil cephalus cryptic species in East Australia (Teleostei: Mugilidae). (United States)

    Shen, Kang-Ning; Chen, Ching-Hung; Hsiao, Chung-Der; Durand, Jean-Dominique


    In this study, the complete mitogenome sequence of a cryptic species from East Australia (Mugil sp. H) belonging to the worldwide Mugil cephalus species complex (Teleostei: Mugilidae) has been sequenced by next-generation sequencing method. The assembled mitogenome, consisting of 16,845 bp, had the typical vertebrate mitochondrial gene arrangement, including 13 protein-coding genes, 22 transfer RNAs, 2 ribosomal RNAs genes and a non-coding control region of D-loop. D-loop consists of 1067 bp length, and is located between tRNA-Pro and tRNA-Phe. The overall base composition of East Australia M. cephalus is 28.4% for A, 29.3% for C, 15.4% for G and 26.9% for T. The complete mitogenome may provide essential and important DNA molecular data for further phylogenetic and evolutionary analysis for flathead mullet species complex.

  4. Two new species of Hypostomus Lacépède (Teleostei: Loricariidae from the upper rio Paraná basin, Central Brazil

    Directory of Open Access Journals (Sweden)

    Cláudio H. Zawadzki

    Full Text Available Two new species of Hypostomus Lacépède (Teleostei: Loricariidae from the rio Paranaíba and rio Grande basins, both in the upper rio Paraná basin, central Brazil, are described herein. One of them is distinguished from all congeners, except H. albopunctatus, by having the pectoral-fin spine length equal to or smaller than the pelvic-fin spine. From H. albopunctatus, it is distinguished by having round dark spots (vs. pale on body and fins. The second species is distinguished from all congeners, except H. multidens and H. ternetzi, by having more than 115 teeth (vs. less than 109 per ramus on dentary and premaxilla. It is distinguished most readily from H. ternetzi by having teeth with two symmetrical (vs. asymmetrical cusps. It is distinguished from H. multidens by having round dark spots (vs. pale over body and fins.

  5. Anatomia Funcional e Morfometria do Intestino no Teleostei (Pisces de Água Doce Surubim (Pseudoplatystoma coruscans - Agassiz, 1829

    Directory of Open Access Journals (Sweden)

    Seixas Filho José Teixeira de


    Full Text Available Os objetivos do presente trabalho foram estudar a anatomia funcional e a morfometria comparativas nos intestinos médio e no reto, do peixe Teleostei, surubim, Pseudoplatystoma coruscans (Agassiz, 1829 (Siluriformes, Siluroidei, Pimelodidae, de hábito alimentar carnívoro, em duas classes de tamanho, visando fornecer referência à nutrição para o ajuste de diferentes sistemas de alimentação artificial para essa espécie nativa. Por meio destes estudos concluiu-se que o intestino do surubim, sob o ponto de vista morfológico, deve ser denominado, de intestino médio e reto, devido a presença da valva ileorretal e da invaginação valvar intestinal entre esses segmentos. Em relação ao padrão de enrolamento do intestino, apesar do plano geral do intestino médio e do reto ter sido mantido, as alças do intestino médio apresentaram arranjo indefinido, não tendo sido determinado um arranjo-padrão para a espécie. O arranjo intestinal é compatível ao da maioria de peixes carnívoros, ou predominantemente carnívoro, uma vez que seu intestino é quase retilíneo; contudo, as circunvoluções das alças finais do intestino médio talvez possam ser vistas como adaptações a um possível regime onívoro, preferencialmente carnívoro. As pregas intestinais encontram-se mais complexas e desenvolvidas no intestino dos exemplares da segunda classe de tamanho. Procurando estabelecer relações entre o arranjo das pregas das mucosas e a velocidade de transporte do alimento no intestino médio da espécie estudada, sugere-se que o padrão longitudinal, com numerosas anastomoses retardam o avanço do alimento em sentido aboral, o que possibilita maior período digestivo e, conseqüentemente, maior aproveitamento dos nutrientes, pela exposição do material alimentar à mucosa intestinal por período maior, além de contribuir para a preparação do bolo fecal. As pregas da mucosa próxima ao ânus têm direção longitudinal, sugerindo auxílio na

  6. Crecimiento y mortalidad del pez Haemulon aurolineatum (Teleostei: Haemulidae en el suroeste de la isla de Margarita, Venezuela

    Directory of Open Access Journals (Sweden)

    Edwis Bravo


    Full Text Available Se determinó el crecimiento y la mortalidad natural del pez cují (Haemulon aurolineatum del suroeste de la Isla de Margarita (julio 2005 -junio 2006, para lo cual se analizó una muestra constituida por 2 541 ejemplares recolectados de la pesca artesanal de Boca del Río. La relación talla-peso entre machos y hembras no mostró diferencias significativas en las pendientes "b" (p>0.05; ts=-1.69 ni en los interceptos "a" (p>0.05; ts=-1.01, por lo que se estableció una relación común para ambos sexos: P=0.038*LT2.87. A partir de los datos de distribución de frecuencia de tallas se estimó la longitud asintótica ( aplicando la rutina de Powell-Wetherall, y el coeficiente de crecimiento (k a través de la rutina ELEFAN I (Gayanilo et al. 1996. Posteriormente se empleó el análisis de la progresión modal, previa descomposición de la frecuencia de longitudes de acuerdo al método de Bhattacharya (1967, y se optimizaron las estimaciones de y k según el procedimiento de Gulland y Holt (1959. Los parámetros de crecimiento estimados (L8=24.2 cm y k=0.48 año-1 mostraron un crecimiento moderadamente rápido. Los datos de frecuencias de longitudes fueron ajustados al modelo de von Bertalanffy (1960, indicando una tendencia de tipo exponencial: crecimiento acelerado hasta los 2 años de edad, que luego se hizo lento hasta que el pez alcanzó la longitud máxima. La tasa de mortalidad natural fue alta (M=1.15 año-1, probablemente por alta depredación.Growth and mortality of the fish Haemulon aurolineatum (Teleostei: Haemulidae from Southwest of Margarita Island, Venezuela. We analyzed the growth and natural mortality of the fish known locally as cují (H. aurolineatum in the southwest of Margarita Island, July 2005 to June 2006. A sample of 1 378 males and 1 143 females from artisanal fishing vessels of Boca del Río was analyzed. The common relation for both sexes was expressed by the equation P=0.038*L2.87. The asymptotic length ( was

  7. Crecimiento y mortalidad natural del pez Haemulon aurolineatum (Teleostei: Haemulidae del suroeste de la isla de Margarita, Venezuela

    Directory of Open Access Journals (Sweden)

    Edwis Bravo


    Full Text Available Se determinó el crecimiento y la mortalidad natural del cují (Haemulon aurolineatum del suroeste de la isla de Margarita, entre julio 2005 hasta junio 2006, para lo cual se analizó una muestra de 2 541 ejemplares colectados de la pesca artesanal de Boca del Río. La relación talla-peso entre machos y hembras no mostró diferencias significativas en las pendientes "b" (p>0.05, ts = -1.69 ni en los interceptos "a" (p>0.05, ts = -1.01, por lo que se estableció una relación común para ambos sexos, expresada mediante el modelo P = 0.038*LT2.87. A partir de los datos de distribución de frecuencia de tallas se estimó la longitud asintótica (L∞ con la rutina de Powell-Wetherall, y el coeficiente de crecimiento (k con la rutina ELEFAN I (Gayanilo et al.1996. Se empleó el análisis de la progresión modal, previa descomposición de la frecuencia de longitudes de acuerdo al método de Bhattacharya (1967, y se optimizaron las estimaciones de L∞ y k según Gulland y Holt (1959. Los parámetros de crecimiento estimados (L∞ = 24.2 cm y k = 0.48 año-1 mostraron un crecimiento moderadamente rápido. Los datos de frecuencias de longitudes fueron ajustados al modelo de von Bertalanffy (1960, mostrando una tendencia de tipo exponencial, donde se observó un crecimiento acelerado hasta los 2 años de edad, que luego se hizo lento a medida que el pez alcanzó la longitud máxima. La tasa de mortalidad natural fue alta (M = 1.15 año-1, probablemente causada por alta depredación.Growth and natural mortality of the fish Haemulon aurolineatum (Teleostei: Haemulidae in the Southwest of Margarita Island, Venezuela. We analyzed the growth and natural mortality of the cují (Haemulon aurolineatum in the southwest of Margarita Island, from July 2005 through June 2006. A sample of 1 378 males and 1 143 females collected from Boca del Río artisanal fishing vessels was analyzed. The common relation for both sexes was expressed by the equation P=0.038*L2

  8. Feeding of holoshesthes Heterodon eigenmann (Teleostei, Cheirodontinae of the cajuru reservoir (Minas Gerais, Brazil, in relation to the vegetal biomass on its depletion zone

    Directory of Open Access Journals (Sweden)

    Márcio Camilo Carvalho Alvim


    Full Text Available Stomach contents of Holoshesthes heterodon Eigenmann, 1915 (Teleostei, Cheirodontinae, collected in the depletion zone of Cajuru reservoir when it was at its maximum water level in two stations with different vegetal densities, were studied in order to investigate the influence of the flooded vegetal biomass on the food quantity and quality ingested by fish. Eighteen individuals from each station were examined. The standard length was l.53±0.05 cm and l.52±0.05 cm, respectively at the lower biomass (8.19 kg diy weight/ha and higher biomass (38.10 kg diy weight/ha sampling stations. The stomach repletion Index (SRI was applied for the quantitative analysis. The alimentary index (IAi was used for the quali-quantitative analysis, with the volume of the items obtained through the points method. SRI did not show values significatively different between the two stations, p>0.05, by applying the Mann-Whitney test. In both situations, Cladocera was the most important item. There were no correlation between the flooded vegetal biomass in the depletion zone and the intake of food by H. heterodon. However, as there were no empty stomachs, possibly even the lower vegetal biomass was enough to provide abundant feeding resources.

  9. Simultaneous analysis of five molecular markers provides a well-supported phylogenetic hypothesis for the living bony-tongue fishes (Osteoglossomorpha: Teleostei). (United States)

    Lavoué, Sébastien; Sullivan, John P


    Fishes of the Superorder Osteoglossomorpha (the "bonytongues") constitute a morphologically heterogeneous group of basal teleosts, including highly derived subgroups such as African electric fishes, the African butterfly fish, and Old World knifefishes. Lack of consensus among hypotheses of osteoglossomorph relationships advanced during the past 30 years may be due in part to the difficulty of identifying shared derived characters among the morphologically differentiated extant families of this group. In this study, we present a novel phylogenetic hypothesis for this group, based on the analysis of more than 4000 characters from five molecular markers (the mitochondrial cytochrome b, 12S and 16S rRNA genes, and the nuclear genes RAG2 and MLL). Our taxonomic sampling includes one representative of each extant non-mormyrid osteoglossomorph genus, one representative for the monophyletic family Mormyridae, and four outgroup taxa within the basal Teleostei. Maximum parsimony analysis of combined and equally weighted characters from the five molecular markers and Bayesian analysis provide a single, well-supported, hypothesis of osteoglossomorph interrelationships and show the group to be monophyletic. The tree topology is the following: (Hiodon alosoides, (Pantodon buchholzi, (((Osteoglossum bicirrhosum, Scleropages sp.), (Arapaima gigas, Heterotis niloticus)), ((Gymnarchus niloticus, Ivindomyrus opdenboschi), ((Notopterus notopterus, Chitala ornata), (Xenomystus nigri, Papyrocranus afer)))))). We compare our results with previously published phylogenetic hypotheses based on morpho-anatomical data. Additionally, we explore the consequences of the long terminal branch length for the taxon Pantodon buchholzi in our phylogenetic reconstruction and we use the obtained phylogenetic tree to reconstruct the evolutionary history of electroreception in the Notopteroidei.

  10. (Teleostei: Characiformes) an

    Indian Academy of Sciences (India)

    2Departamento de Morfologia, Instituto de Biociências, Universidade Estadual Paulista, ... Keywords. molecular markers; fish conservation; aquaculture; polymorphic DNA. .... species complex in the upper rio Tibagi Basin (Paraná, Brazil).

  11. Gyrodactylus salinae n. sp. (Platyhelminthes: Monogenea infecting the south European toothcarp Aphanius fasciatus (Valenciennes (Teleostei, Cyprinodontidae from a hypersaline environment in Italy

    Directory of Open Access Journals (Sweden)

    Huyse Tine


    Full Text Available Abstract Background Historically, non-native species of Gambusia (Poeciliidae have been used to control larval stages of the Asian tiger mosquito, Stegomyia albopicta Reinert, Harbach et Kitching, 2004 throughout Italy. The potential utility of indigenous populations of Aphanius fasciatus (Valenciennes (Teleostei: Cyprinodontidae as an appropriate alternative biological control is currently being explored. A sub-sample of ten fish collected from Cervia Saline, Italy (salinity 65 ppt; 30°C to assess their reproductive capability in captivity, harboured a moderate infection of Gyrodactylus von Nordmann, 1832 (Platyhelminthes, Monogenea. A subsequent morphological and molecular study identified this as being a new species. Results Gyrodactylus salinae n. sp. is described from the skin, fins and gills of A. fasciatus. Light and scanning electron microscopical (SEM examination of the opisthaptoral armature and their comparison with all other recorded species suggested morphological similarities to Gyrodactylus rugiensoides Huyse et Volckaert, 2002 from Pomatoschistus minutus (Pallas. Features of the ventral bar, however, permit its discrimination from G. rugiensoides. Sequencing of the nuclear ribosomal DNA internal transcribed spacers 1 and 2 and the 5.8S rRNA gene and a comparison with all species listed in GenBank confirmed they are unique and represent a new species (most similar to Gyrodactylus anguillae Ergens, 1960, 8.3% pair-wise distance based on 5.8S+ITS2. This represents the first species of Gyrodactylus to be described from Aphanius and, to date, has the longest ITS1 (774 bp sequenced from any Gyrodactylus. Additional sampling of Cervia Saline throughout the year, found G. salinae n. sp. to persist in conditions ranging from 35 ppt and 5°C in December to 65 ppt and 30°C in July, while in captivity a low level of infection was present, even in freshwater conditions (0 ppt. Conclusions The ability of G. salinae n. sp. to tolerate a wide

  12. An update on the fish composition (Teleostei of the coastal lagoons of the Restinga de Jurubatiba National Park and the Imboassica Lagoon, northern Rio de Janeiro State

    Directory of Open Access Journals (Sweden)

    Fabio Di Dario

    Full Text Available AIM: We present an update on the composition of the fish species of the Restinga de Jurubatiba National Park and the Imboassica Lagoon, in the northern portion of Rio de Janeiro State, based on collecting efforts of almost two decades, historical museum records, and a review of the literature. METHODS: Specimens were collected using a variety of techniques, mostly between 1994 and 2012, and were fixed with the use of a 10% solution of formalin and subsequently stored in 70% alcohol solution. All specimens examined are deposited in the fish collections of the Núcleo em Ecologia e Desenvolvimento Socioambiental de Macaé, Universidade Federal do Rio de Janeiro (NPM, and Museu Nacional, Universidade Federal do Rio de Janeiro (MNRJ. Continental (freshwater fishes and some marine or estuarine species frequently collected were regarded as Resident, whereas marine species collected only sporadically were regarded as Occasional. Possible associations between the orientation of the lagoons and the composition of Resident fishes were explored through a Correspondence Analysis (CA. RESULTS: A total of 100 species, belonging to 19 orders and 41 families of the Teleostei were recorded. When both Resident and Occasional species are considered, families Carangidae and Engraulidae, with nine and eight species respectively, are the most representative. When only Resident species are considered, the Gerreidae and Gobiidae, both with seven species, are the most representative families. The Imboassica Lagoon, with 76 species, has the highest species richness among lagoons included in this study. A total of 81 species were recorded in the Restinga de Jurubatiba National Park, a number two times higher than reported on previous studies. An identification key, including 57 Resident species, is also presented. CONCLUSIONS: Parallel lagoons were characterized by a small group of continental species presumably of marine ancestry (Secondary Division, while marine species

  13. La pesca de sardina, Sardinella aurita (Teleostei: Clupeidae asociada con la variabilidad ambiental del ecosistema de surgencia costera de Nueva Esparta, Venezuela

    Directory of Open Access Journals (Sweden)

    Leo W González


    Full Text Available Se comparó la pesca de sardina (Sardinella aurita con algunos parámetros climáticos y meteorológicos del ecosistema de surgencia costera de El Morro, Nueva Esparta, Venezuela. Para el período 1996-2000, se aplicaron los modelos de regresión lineal simple y múltiple a los datos de captura en función de la velocidad del viento, temperatura superficial del mar, temperatura del aire y pluviosidad. Hubo una correlación positiva de la captura con la velocidad del viento, y una negativa con temperatura superficial del mar, temperatura del aire y pluviosidad. El modelo de regresión múltiple con intercepto mostró un ajuste bajo, por tal razón se aplicó un modelo de regresión sin intercepto, el cual mejoró significativamente el ajuste. También se aplicó el método de selección de variables "hacia adelante", encontrándose que las variables independientes viento y temperatura del aire guardan relación significativa con la captura de sardina a tiempo real (pAssociation of sardine fishery, Sardinella aurita (Teleostei: Clupeidae and environmental variability of the coastal upwelling ecosystem of Nueva Esparta, Venezuela. The present research is an analysis of Spanish sardine fishing (Sardinella aurita associated with some climatic and meteorologic parameters of the ecosystem from El Morro Nueva Esparta, Venezuela. The catch and environmental data from the area were taken in the period 1996-2000. Catch data as a function of wind speed, sea surface temperature, air temperature and rain were analyzed by means of simple lineal regression and multiple models. We found a positive correlation of catch with wind speed, and a negative correlation with sea surface temperature, air temperature, and rain. The multiple regression model with intercept had a poor fit, therefore, we made a model without intercept, which improve greatly the fit. A selection of the variables using the forward procedure verified that the independent variables "wind speed


    Directory of Open Access Journals (Sweden)

    Renato Ribeiro Nogueira Ferraz


    Full Text Available The demand and consumption of fish and their derivatives has increased considerably in recent years. However, fish are ideal hosts of numerous parasites, highlighting the need to develop new research methodologies for its detection. The aim of present study was to compare the efficacy of Ascocotyle metacercariae (Trematoda: Digenea extraction from visceral tissues of Mugil liza Valenciennes, 1836 (Teleostei: Mugilidae by two methods: homogenization by blender or mixer. Twentysix samples of M. liza were collected, being 16 liver samples and 10 samples of muscle tissue. Approximately 5g of each sample were processed by blender and mixer techniques homogenization for metacercariae extraction. In liver samples, up to 46 metacercariae were found in samples homogenized in blender. The lowest amount found was 2 metacercariae for blender and mixer techniques. In samples of muscle tissue, 4 metacercariae were observed in the mixer extraction. The lowest amount was found to be 2 parasites to blender and mixer. The mean metacercariae found and extracted from muscle tissue were 0.2 (+0.357 and 1.2 (+0.963 for blender and mixer, respectively. The averages of metacercariae found and extracted from fish liver, in blender and mixer, were 24 (+15.145 and 18 (+8.246, respectively. The homogenization techniques for blender and mixer were effective for the extraction of metacercariae of mullet fish tissues, suggesting that they may be directly applicable in the field of study, especially due to the ease of testing.

  15. Determinação do sistema endócrino difuso nos intestinos de três Teleostei (Pisces de água doce com hábitos alimentares diferentes

    Directory of Open Access Journals (Sweden)

    Seixas Filho José Teixeira de


    Full Text Available O objetivo do presente trabalho foi o de verificar a presença de células endócrinas nos intestinos médio e posterior, ou reto, e nos cecos pilóricos de três espécies tropicais de peixes Teleostei de água doce com hábitos alimentares diferentes: piracanjuba, (Brycon orbignyanus e piau (Leporinus friderici, onívoro; e surubim (Pseudoplatystoma coruscans, carnívoro. Para tanto, foram utilizados sete exemplares da piracanjuba, com médias de peso e comprimento-padrão de 410,16 ± 66,33 g e 27,42 ± 1,17 cm, respectivamente, 13 exemplares de piau com médias de 77,71 ± 24,31 g e 14,84 ± 1,56 cm de peso e comprimento-padrão, respectivamente; e cinco exemplares do surubim com médias de peso e comprimento-padrão de 309,91 ± 94,23 g e 32,70 ± 1,79 cm, respectivamente. Pode-se constatar a presença de células endócrinas do "tipo aberto" nos segmentos referentes aos intestinos médio e posterior das espécies onívoras e do "tipo fechado" no intestino médio e no reto da espécie carnívora. As células argirófilas foram observadas entre as células absortivas do epitélio intestinal. Os resultados permitem concluir que a presença de células endócrinas nas espécies estudadas pode indicar que estas atuam no mecanismo de controle da absorção dos nutrientes do alimento.

  16. Ligophorus spp. (Monogenoidea: Dactylogyridae) parasitizing mullets (Teleostei: Mugiliformes: Mugilidae) occurring in the fresh and brackish waters of the Shatt Al-Arab River and Estuary in southern Iraq, with the description of Ligophorus sagmarius sp. n. from the greenback mullet Chelon subviridis (Valenciennes). (United States)

    Kritsky, Delane C; Khamees, Najim R; Ali, Atheer H


    The gills of three of five species of mullets (Teleostei: Mugiliformes: Mugilidae) collected from the brackish and fresh waters of southern Iraq were infected with species of Ligophorus (Monogenoidea: Dactylogyridae) as follows: greenback mullet Chelon subviridis (Valenciennes) infected with Ligophorus lebedevi Dmitrieva, Gerasev, Gibson, Pronkina and Galli, 2012, Ligophorus bantingensis Soo and Lim, 2012, Ligophorus sagmarius n. sp., and Ligophorus fluviatilis (Bychowsky, 1949) Dmitrieva, Gerasev, Gibson, Pronkina, and Galli, 2012; Klunzinger’s mullet Liza klunzingeri (Day) with L. bantingensis, L. fluviatilis, and an apparently undescribed species of Ligophorus; and abu mullet Liza abu (Heckel) with L. bantingensis and L. fluviatilis. The keeled mullet Liza carinata (Valenciennes) and Speigler’s mullet Valamugil speigleri (Bleeker) were uninfected. L. sagmarius n. sp. is described, and L. lebedevi and L. bantingensis are redescribed. Available specimens of L. fluviatilis and the undescribed species of Ligophorus from Klunzinger’s mullet were insufficient for description.

  17. A new sandperch, Parapercis maritzi (Teleostei: Pinguipedidae ...

    African Journals Online (AJOL)


    Jan 15, 1992 ... froze others for otolith extraction at the Port Elizabeth. Museum. Specimens used for the latter were deposited at the. J.L.B. Smith Institute of Ichthyology, where 10 examples of an unknown Parapercis were noticed. Another, completely faded, specimen of the same species has been known at the.

  18. Biologia do jundiá Rhamdia quelen (Teleostei, Pimelodidae Biology of Rhamdia quelen (Teleostei, Pemelodidae

    Directory of Open Access Journals (Sweden)

    Levy de Carvalho Gomes


    Full Text Available O jundiá, Rhamdia quelen, é encontrado desde o centro da Argentina até o sul do México, e seu cultivo está aumentando no sul do Brasil. Portanto, o objetivo desta revisão é apresentar os dados existentes até o momento sobre a biologia dessa espécie. R. quelen pode atingir 50cm de comprimento e 3kg de peso, possui hábito noturno e habita locais calmos e profundos dos rios. Os alevinos suportam água do mar a 10%o, até 9,0g/l de sal comum e pH na faixa de 4,0 a 8,5, com melhor crescimento das larvas na faixa de pH de 8,0 a 8,5. É uma espécie euritérmica. Esse peixe é omnívoro, com tendência piscívora. A maturidade sexual é atingida no primeiro ano de vida. É uma espécie ovulípara e, na natureza, os cardumes desovam em locais com água limpa, calma e de fundo pedregoso. Não apresenta cuidado parental. Possui dois picos reprodutivos por ano (um no verão e outro na primavera e desova múltipla. A indução da desova apresentou bons resultados com gonadotrofina coriônica humana (HCG ou extrato hipofisário. O desenvolvimento embrionário de R. quelen é rápido e se dá entre 3 a 5 dias. O melhor alimento artificial para larvas de R. quelen é baseado em lecitina de soja, fígado bovino e levedura. Várias bactérias patogênicas e trematódeos digenéticos já foram identificados em R. quelen. Para um melhor aproveitamento dessa espécie na piscicultura, são necessários mais estudos relacionados ao efeito de parâmetros físicoquímicos da água, alimentação artificial e crescimento em cativeiro.The jundiá, Rhamdia quelen, occurs from Southern Mexico to Central Argentina, and the husbandry of this species is spreading in Southern Brazil. Consequently, the aim of this review is to present the available data of the biology of this species. R. quelen can reach 50cm of length and 3kg of weight, presents a nocturnal habit and lives in placid and deep waters of the rivers. Fingerlings support 10‰ seawater, up to 9g/l table salt and 4.0 - 8.5 pH range, with best growth at 8.0 - 8.5 pH range. It is an eurytermal species. This fish is omnivorous, but prefers fish. The sexual maturity is reached in the first year of life, and it is ovuliparous and in the natural environment the schools spawn in clean and calm waters with rocky bottom. There is no parental care. This species shows two reproductive peaks/year (spring and summer and multiple spawning. The induced spawning had good results with human chorionic gonadotrofin (HCG or pituitary extract. The embriological development of R. quelen is fast, and the larval development occurs in three to five days. The best feeding ration to the larvae of R. quelen is based on soybean lecithin, cattle liver and yeast. Several pathogenic bacteria and digenetic trematoda were identified in R. quelen. To improve the use of this species in fish culture, additional studies about physico-chemical parameters of the water, feeding rations and growth in captivity are essential.

  19. Does Serranochromis altus (Teleostei: Cichlidae) exist in the ...

    African Journals Online (AJOL)

    Genetic and interspecific divergence in allometry between S. altus and S. angusticeps were non-significant. It was initially thought that these fishes represented different life stages of S. angusticeps. However, we found fish of different sizes, yet with similar ages, representing both species. More accurate age/size and other ...

  20. (female) (Teleostei: Cichlidae) in floating cages, cement tanks and ...

    African Journals Online (AJOL)

    , on the growth rate, feeding efficiency and mortality rates of hybrid tilapia — Tilapia zillii (male) x T. guineensis (female) — was evaluated for 233 days. Fish of average weight 12.59g were stocked at a density of 20 fish m–³ and were fed a 30% ...

  1. Spawning marks in spined loaches (Cobitis taenia; Cobitidae; Teleostei)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg


    Roč. 57, 1-2 (2008), s. 168-171 ISSN 0139-7893. [International Conference Loaches of the genus Cobitis and related genera. Šibenik, 24.09.2006-29.09.2006] R&D Projects: GA ČR GA206/05/2556; GA AV ČR IAA600450508 Institutional research plan: CEZ:AV0Z50450515 Keywords : freshwater fish * reproduction * autecology Subject RIV: EG - Zoology Impact factor: 0.522, year: 2008

  2. Influence of cladogenesis on feeding structures in drums (Teleostei: Sciaenidae). (United States)

    Deary, Alison L; Hilton, Eric J


    Drums (family Sciaenidae) are common in tropical to temperate coastal and estuarine habitats worldwide and present a broad spectrum of morphological diversity. The anatomical variation in this family is particularly evident in their feeding apparatus, which may reflect the partitioning of adult foraging habitats. Adult and early life history stage sciaenids may display ecomorphological patterns in oral and pharyngeal jaw elements but because sciaenids are hierarchically related, the morphological variation of the feeding apparatus cannot be analyzed as independent data. Morphological patterns have been identified in three sciaenid genera from the Chesapeake Bay but it is not known if these patterns are present in other genera of the family and if such patterns are constrained by phylogenetic history. In this study, phylogenetic comparative methods were applied to two sets of oral jaw data obtained from growth series of 11 species of cleared and double-stained Chesapeake Bay sciaenids and alcohol-preserved museum specimens representing 65 of the 66 recognized genera to determine the magnitude of phylogenetic dependence present in the structure of the oral jaws using a recent molecular phylogeny of the family. Pagel's lambda, a measure of phylogenetic signal, was low for pelagic sciaenids in premaxilla, lower jaw, and ascending process lengths, indicating influence of selective forces on the condition of these traits. Conversely, for benthic sciaenids, phylogenetic signal was high for lower jaw and ascending process lengths, indicating significant phylogenetic constraint for their condition in these taxa. Pagel's lambda was intermediate for premaxilla length in benthic sciaenids, suggesting that the length of the premaxilla is influenced by a mix of selective forces and phylogenetic constraint. Although the ecomorphological patterns identified in the oral jaws of scaienids are not entirely free of phylogenetic dependence, selective forces related to foraging are likely driving the evolution of these structures. Copyright © 2016 Elsevier GmbH. All rights reserved.

  3. Little Divergence Among Mitochondrial Lineages of Prochilodus (Teleostei, Characiformes

    Directory of Open Access Journals (Sweden)

    Bruno F. Melo


    Full Text Available Evidence that migration prevents population structure among Neotropical characiform fishes has been reported recently but the effects upon species diversification remain unclear. Migratory species of Prochilodus have complex species boundaries and intrincate taxonomy representing a good model to address such questions. Here, we analyzed 147 specimens through barcode sequences covering all species of Prochilodus across a broad geographic area of South America. Species delimitation and population genetic methods revealed very little genetic divergence among mitochondrial lineages suggesting that extensive gene flow resulted likely from the highly migratory behavior, natural hybridization or recent radiation prevent accumulation of genetic disparity among lineages. Our results clearly delimit eight genetic lineages in which four of them contain a single species and four contain more than one morphologically problematic taxon including a trans-Andean species pair and species of the P. nigricans group. Information about biogeographic distribution of haplotypes presented here might contribute to further research on the population genetics and taxonomy of Prochilodus.

  4. Description of Andinoacara stalsbergi sp. n. (Teleostei: Cichlidae:

    Czech Academy of Sciences Publication Activity Database

    Musilová, Zuzana; Schindler, I.; Staeck, W.


    Roč. 59, č. 2 (2009), s. 131-141 ISSN 1864-5755 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50450515 Keywords : systematic * ichtiology * Cichlidae Subject RIV: EH - Ecology, Behaviour

  5. New gadiform fishes (Teleostei, Gadiformes) from the Miocene of Algeria (United States)

    Carnevale, Giorgio


    As part of the completion of studies on the Miocene fishes of the Chelif Basin (north-western Algeria), this paper represents a contribution to the knowledge of the Messinian gadiform diversity of this western Mediterranean, semi-enclosed, Neogene basin. A new genus and species of the family Macrouridae is erected ( Razelainia paradoxa n. gen. et sp.), two specimens are tentatively referred to already existing taxa ( Gadiculus cf. jonas; Merluccius cf. merluccius), and a species formerly assigned to the gadid genus Brosme is transferred to the genus Gaidropsarus ( Gaidropsarus murdjadjensis). The macrourid Razelainia paradoxa n. gen. et sp. is characterized by an unusual combination of: plesiomorphic gadiform features, such as low vertebral number (presumed), well-developed caudal-fin rays, presence of a single continuous dorsal fin originating just posterior to the neurocranium, anal-fin rays slightly longer than dorsal-fin rays; and derived, typically macrourid features, such as the presence of spinoid scales and the anterior anal-fin pterygiophores extending forward over the abdominal wall. A paleoecological analysis reveals that the Messinian gadiform assemblage of the Chelif Basin had a subtropical/warm temperate affinity, with a marked north-eastern Atlantic-Mediterranean biogeographic character.

  6. Molecular cytogenetic of the Amoy croaker, Argyrosomus amoyensis (Teleostei, Sciaenidae) (United States)

    Liao, Mengxiang; Zheng, Jiao; Wang, Zhiyong; Wang, Yilei; Zhang, Jing; Cai, Mingyi


    The family Sciaenidae is remarkable for its species richness and economic importance. However, the cytogenetic data available in this fish group are still limited, especially those obtained using fluorescence in situ hybridization (FISH). In the present study, the chromosome characteristics of a sciaenid species, Argyrosomus amoyensis, were examined with several cytogenetic methods, including dual-FISH with 18S and 5S rDNA probes, and a self-genomic in situ hybridization procedure (Self-GISH). The karyotype of A. amoyensis comprised 2n=48 acrocentric chromosomes. A single pair of nucleolar organizer regions (NORs) was located at the proximal position of chromosome 1, which was positive for silver nitrate impregnation (AgNO3) staining and denaturation-propidium iodide (DPI) staining but negative for Giemsa staining and 4',6-diamidino-2-phenylindole (DAPI) staining, and was confirmed by FISH with 18S rDNA probes. The 5S rDNA sites were located at the centromeric region of chromosome 3. Telomeric FISH signals were detected at all chromosome ends with different intensities, but internal telomeric sequences (ITSs) were not found. Self-GISH resulted in strong signals distributed at the centromeric regions of all chromosomes. C-banding revealed not only centromeric heterochromatin, but also heterochromatin that located on NORs, in interstitial and distal telomeric regions of specific chromosomes. These results suggest that the karyotype of Amoy croaker was relatively conserved and primitive. By comparison with the reported cytogenetic data of other sciaenids, it can be deduced that although the karyotypic macrostructure and chromosomal localization of 18S rDNA are conserved, the distribution of 5S rDNA varies dynamically among sciaenid species. Thus, the 5S rDNA sites may have different evolutionary dynamics in relation to other chromosomal regions, and have the potential to be effective cytotaxonomic markers in Sciaenidae.


    African Journals Online (AJOL)

    497. JUDB, R. A. 1967. Freshwater fishes of southern Africa. Cape Town: Balkema. KOUMANS, F. P. 1931. A preliminary revision of the genera of the gobioidfishes with united ventral fins. N. V. Lisse. (Netherlands) 1-174: Drukkerij, Imperator. R.

  8. The biology of Barnard's dentex, Dentex barnardi (Teleostei: Sparidae)

    African Journals Online (AJOL)

    The life-history characteristics of the species render it susceptible even to low levels of fishing pressure. Owing to the paucity of information on the fisheries for D. barnardi, and the current fisheries management situation in Angola, conventional management tools are not considered appropriate. The establishment of marine ...

  9. Cryopreservation of spermatozoa of black marlin, Makaira indica (Teleostei: Istiophoridae). (United States)

    van der Straten, K M; Leung, L K-P; Rossini, R; Johnston, S D


    As a first step towards the development of a method for the cryopreservation of black marlin spermatozoa, this study investigated the effect of dimethylsulfoxide (DMSO) concentration and pellet size on post-thaw spermatozoal motility. Spermatozoa were recovered from the spermatic duct of testes retrieved post-mortem from four adult black marlin caught in the Coral Sea spawning grounds of Australia. Undiluted spermatozoa were stored on ice for 4 to 10 hours during transport to shore, then evaluated for motility after activation in seawater (1:10 v:v). Spermatozoa were prepared for cryopreservation in pellets by extension (1:3 v:v) in a defined fish Ringer's solution to give two final DMSO concentrations of 2.5% or 5.0%. Diluted spermatozoa were frozen directly on a dry ice block in pellet sizes of either 0.25 ml or 0.50 ml. Frozen pellets were thawed in a water bath at 40 degrees C for 60 seconds and assessed for post-thaw motility following activation in seawater. Spermatozoa recovered within 50 minutes of death and chilled on ice for 4 to 10 hours showed a mean (+/- SEM) motility immediately following activation of 91.6 +/- 7.9%. 50% of the spermatozoa remained motile for approximately 4 to 5 minutes. Following cryopreservation, mean motility declined significantly across all cryoprotectant and pellet size combinations (P < 0.001) but spermatozoa frozen in 2.5% DMSO showed higher motility than those frozen in 5.0% DMSO (P = 0.014). Pellet size had no effect on post-thaw motility (P = 0.179).

  10. Evolution of the locomotory system in eels (Teleostei: Elopomorpha). (United States)

    Pfaff, Cathrin; Zorzin, Roberto; Kriwet, Jürgen


    Living anguilliform eels represent a distinct clade of elongated teleostean fishes inhabiting a wide range of habitats. Locomotion of these fishes is highly influenced by the elongated body shape, the anatomy of the vertebral column, and the corresponding soft tissues represented by the musculotendinous system. Up to now, the evolution of axial elongation in eels has been inferred from living taxa only, whereas the reconstruction of evolutionary patterns and functional ecology in extinct eels still is scarce. Rare but excellently preserved fossil eels from the Late Cretaceous and Cenozoic were investigated here to gain a better understanding of locomotory system evolution in anguilliforms and, consequently, their habitat occupations in deep time. The number of vertebrae in correlation with the body length separates extinct and extant anguilliforms. Even if the phylogenetic signal cannot entirely be excluded, the analyses performed here reveal a continuous shortening of the vertebral column with a simultaneous increase in vertebral numbers in conjunction with short lateral tendons throughout the order. These anatomical changes contradict previous hypotheses based on extant eels solely. The body curvatures of extant anguilliforms are highly flexible and can be clearly distinguished from extinct species. Anatomical changes of the vertebral column and musculotendinous system through time and between extinct and extant anguilliforms correlate with changes of the body plan and swimming performance and reveal significant shifts in habitat adaptation and thus behaviour. Evolutionary changes in the skeletal system of eels established here also imply that environmental shifts were triggered by abiotic rather than biotic factors (e.g., K/P boundary mass extinction event).

  11. A morphological study on species of African Mormyrus (Teleostei ...

    African Journals Online (AJOL)

    Kwando system and Cunene River, Namibia, showed some differentiation regarded as infrasubspecific, similar to that of the M. rume samples from the Bandama River compared to those of the Comoé River, both in Côte d'Ivoire. The EODs ...

  12. Finestructure of the retina in Garra rufa (cypriniae, Teleostei)

    International Nuclear Information System (INIS)

    Al-Adhami, A. M.; Mir, S.


    The light - and dark-adapted retina of the freshwater, bottom-dweller tele ost, Ga rra rufa (Heck el, 1843) was studied under light and electron microscopes. The fish is a fist record in having both falcifrom process and vit real blood circulation and the hyaloid artery from which it developers. A number of acute vision areas represented by increased density of ganglion cell soma ta are evident. The dark-adapted retina is characterized by notably large photoreceptor terminals (rod spherules and cone placidas). A rod spherules has single synaptic ribbon, whereas a cone pedicle has three to four. The inner nuclear layer is composed of the so meta of horizontal, bipolar and amsacrine cells in addition to nuclei of Muller cells. The outer nuclear layer, on the other hand, is composed of two-three rows of rod nuclei and one row of cone nuclei. The photoreceptor cells include rods and single and double cones. The rod outer segments have deep and/or shallow incisor. Cone ellipsoid may have ellipsosomes. These are shown to develop from one of the apical mitochondria of the ellipsoid- Retinomotor movement involves both the photoreceptor cells and the pigment epithelium. (authors). 11 refs., 14 figs

  13. Careproctus kidoi, a new Arctic species of snailfish (Teleostei

    DEFF Research Database (Denmark)

    Knudsen, Steen Wilhelm; Møller, Peter Rask


    Careproctus kidoi sp. nov. is described from the Baffin Bay between Greenland and Canada, in the northern most part of the western North Atlantic. During a series of bottom trawl surveys conducted in 1988-2004, 22 specimens of an undescribed species of Careproctus were caught at depths between 95...... brown, stomach dusky to dark brown, peritoneum black. It is generally found in deeper waters than the sympatric C. reinhardti....

  14. Two new species of Schistura from Myanmar (Teleostei: Nemacheilidae)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula


    Roč. 24, č. 1 (2013), s. 21-30 ISSN 0936-9902 R&D Projects: GA ČR GA206/08/0637 Institutional research plan: CEZ:AV0Z50450515 Keywords : loach * basin * drainage Subject RIV: EG - Zoology Impact factor: 2.275, year: 2013

  15. Growth and mortality of larval Myctophum affine (Myctophidae, Teleostei). (United States)

    Namiki, C; Katsuragawa, M; Zani-Teixeira, M L


    The growth and mortality rates of Myctophum affine larvae were analysed based on samples collected during the austral summer and winter of 2002 from south-eastern Brazilian waters. The larvae ranged in size from 2·75 to 14·00 mm standard length (L(S)). Daily increment counts from 82 sagittal otoliths showed that the age of M. affine ranged from 2 to 28 days. Three models were applied to estimate the growth rate: linear regression, exponential model and Laird-Gompertz model. The exponential model best fitted the data, and L(0) values from exponential and Laird-Gompertz models were close to the smallest larva reported in the literature (c. 2·5 mm L(S)). The average growth rate (0·33 mm day(-1)) was intermediate among lanternfishes. The mortality rate (12%) during the larval period was below average compared with other marine fish species but similar to some epipelagic fishes that occur in the area. © 2015 The Fisheries Society of the British Isles.

  16. Five newly recorded Cyprinid fish (Teleostei: Cypriniformes) in Myanmar (United States)

    Qin, Tao; Chen, Zhi-Ying; Xu, Lu-Lu; Zaw, Paing; Kyaw, Yunn Mi Mi; Maung, Kyaw Win; Chen, Xiao-Yong


    Freshwater fish from the Putao and Myitkyina areas were collected in three ichthyofaunal surveys of the Mali Hka River and tributaries in and around Khakaborazi National Park and Hponkanrazi Wildlife Sanctuary, Kachin State, from 2014-2016. Tor yingjiangensis Chen et Yang 2004, Tor qiaojiensis Wu et al. 1977, Garra qiaojiensis Wu et al. 1977, Garra bispinosa Zhang 2005, and Schizothorax oligolepis Huang 1985, originally described from the upper Irrawaddy (Ayeyarwaddy) River in China, are first reported herein as new records to Myanmar. Counts, measurements, descriptions, photographs, and distributions of the specimens of the five newly recorded species are provided. PMID:29181904

  17. Mitochondrial diversity and phylogeography of Acrossocheilus paradoxus (Teleostei: Cyprinidae). (United States)

    Ju, Yu-Min; Hsu, Kui-Ching; Yang, Jin-Quan; Wu, Jui-Hsien; Li, Shan; Wang, Wei-Kuang; Ding, Fang; Li, Jun; Lin, Hung-Du


    Mitochondrial DNA cytochrome b sequences (1141 bp) in 229 specimens of Acrossocheilus paradoxus from 26 populations were identified as four lineages. The pairwise genetic distances among these four lineages ranged from 1.57 to 2.37% (mean= 2.00%). Statistical dispersal-vicariance analysis suggests that the ancestral populations were distributed over mainland China and Northern and Western Taiwan. Approximate Bayesian computation approaches show that the three lineages in Taiwan originated from the lineage in mainland China through three colonization routes during two glaciations. The results indicated that during the glaciation and inter-glacial periods, the Taiwan Strait was exposed and sank, which contributed to the dispersion and differentiation of populations. Furthermore, the populations of A. paradoxus colonized Taiwan through a land bridge to the north of the Formosa Bank, and the Miaoli Plateau in Taiwan was an important barrier that limited gene exchange between populations on both the sides.

  18. A new species of Poecilia from Honduras (Teleostei: Poeciliidae)

    NARCIS (Netherlands)

    Poeser, F.N.


    A new species of Poecilia from the Atlantic slopes of Honduras is described and assigned to the subgenus Mollienesia. Poecilia hondurensis, new species, differs from all congeners in the combination of having tricuspid teeth on the inner of both jaws and lacking a prominent spine or hook on the

  19. Mahseers genera Tor and Neolissochilus (Teleostei: Cyprinidae) from southern Vietnam. (United States)

    Hoàng, Huy Đức; Phạm, Hùng Mạnh; Durand, Jean-Dominique; Trần, Ngân Trọng; Phan, Phúc Đình


    Two new species and two new basin records of mahseers in the genera Tor and Neolissochilus are described from the upper Krong No and middle Đồng Nai drainages of the Langbiang Plateau in southern Vietnam. These new species and new records are known from streams and rivers in montane mixed pine and evergreen forests between 140 and 1112 m. Their populations are isolated in the Sre Pok River of the Mekong basin, the middle of the Đồng Nai basin, and the An Lão River. Both new species are differentiated from their congeners by a combination of the following characters: 23-24 lateral scales, 9-10 predorsal scales, 2/7 or 1/8 pelvic-fin rays, mouth position, median lobe of lower lip, rostral hood, colour in life and by divergent mitochondrial DNA. Tor mekongensis sp. nov. is differentiated from Tor dongnaiensis sp. nov. by the number of transverse scale rows (3/1/2 vs. 4/1/2), number of pelvic-fin rays (2/7 vs. 1/8), a blunt rostral hood vs. pointed, caudal-fin lobes that are equal vs. unequal, and by mitochondrial DNA (0.7% sequence divergence). Molecular evidence identifies both species as members of the genus Tor and distinct from all congeners sampled (uncorrected sequence divergences >1.9% for all Tor species for which homologous COI sequences are available). Tor sinensis is recorded in the Krong No and the Sre Pok rivers, further south of its known distribution. Polymorphism is described in Neolissochilus stracheyi with a Tor-like morph and a Neolissochilus-like morph.

  20. Anaemia in the freshwater catfish Clarias albopunctatus (Teleostei ...

    African Journals Online (AJOL)

    Haematological changes were studied in freshwater catfish Clarias albopunctatus exposed for 20 days to 25%, 50% and 100% concentrations of brewery wastewater prepared by dilution using tap water. Haemoglobin, haematocrit and erythrocyte counts in fish exposed to wastewater were significantly lower than in a ...

  1. Philopatry and dispersal of juvenile leervis Lichia amia (Teleostei ...

    African Journals Online (AJOL)

    Understanding and characterising movement and area-use patterns of fishes within estuaries, as well as understanding the degree of connectivity between estuaries and the marine environment, can provide important insights into a species' ecology, which is fundamental for effective management and conservation.

  2. Nuclear DNA content in Galaxias maculatus (Teleostei: Osmeriformes: Galaxiidae Contenido de ADN nuclear en Galaxias maculatus (Teleostei: Osmeriformes: Galaxiidae

    Directory of Open Access Journals (Sweden)

    Pedro Jara-Seguel


    Full Text Available The nuclear DNA content (2C value was determined in the commercial fish Galaxias maculatus (Galaxiidae was determined by microdensitometry of erythrocyte nuclei after Feulgen staining; rainbow trout erythrocytes with a known 2C value were used as a standard. The 2C value of G. maculatus was 2.21 ± 0.12 pg and its C value was equivalent to 1.105 pg (1,082.9 Mbp. This C value is within the range recorded for other osmeriform species (0.62-3.2 pg. The average sperm head diameter of G. maculatus is lower than the average sperm head diameter of rainbow trout (used as a standard, which coincides with the differences observed in the nuclear DNA content of both species. This information increases the genome data available for G. maculatus and might be useful in future programs dealing with its genetic manipulation.El contenido de ADN nuclear (valor 2C fue determinado en el pez comercial Galaxias maculatus (Galaxiidae usando microdensitometría de núcleos de eritrocitos sometidos a tinción de Feulgen, utilizando como estándar eritrocitos de trucha arco iris con un valor 2C conocido. El valor 2C de G. maculatus fue 2,21 ± 0,12 pg y su valor C es equivalente a 1,105 pg (1.082,9 pMb. Este valor C está dentro del rango registrado para otras especies de osmeriformes (0,62-3,2 pg. El diámetro promedio de la cabeza del espermatozoide de G. maculatus es menor al promedio descrito para la trucha arco iris utilizado como estándar, lo que coincide con las diferencias observadas en el contenido de ADN nuclear entre ambas especies. Estos datos contribuyen a ampliar los antecedentes genómicos disponibles para G. maculatus y podrían ser útiles en futuros programas tendientes a su manipulación genética.

  3. Multiple invasions into freshwater by pufferfishes (teleostei: tetraodontidae: a mitogenomic perspective.

    Directory of Open Access Journals (Sweden)

    Yusuke Yamanoue

    Full Text Available Pufferfishes of the Family Tetraodontidae are the most speciose group in the Order Tetraodontiformes and mainly inhabit coastal waters along continents. Although no members of other tetraodontiform families have fully discarded their marine lives, approximately 30 tetraodontid species spend their entire lives in freshwaters in disjunct tropical regions of South America, Central Africa, and Southeast Asia. To investigate the interrelationships of tetraodontid pufferfishes and thereby elucidate the evolutionary origins of their freshwater habitats, we performed phylogenetic analysis based on whole mitochondrial genome sequences from 50 tetraodontid species and closely related species (including 31 newly determined sequences. The resulting phylogenies reveal that the family is composed of four major lineages and that freshwater species from the different continents are independently nested in two of the four lineages. A monophyletic origin of the use of freshwater habitats was statistically rejected, and ancestral habitat reconstruction on the resulting tree demonstrates that tetraodontids independently entered freshwater habitats in different continents at least three times. Relaxed molecular-clock Bayesian divergence time estimation suggests that the timing of these invasions differs between continents, occurring at 0-10 million years ago (MA in South America, 17-38 MA in Central Africa, and 48-78 MA in Southeast Asia. These timings are congruent with geological events that could facilitate adaptation to freshwater habitats in each continent.

  4. Two new species of Protomyctophum (Pisces, Teleostei, Myctophidae) from the Southern Ocean

    NARCIS (Netherlands)

    Prokofiev, Artém M.


    Two new species of the genus Protomyctophum from the Southern Ocean are described. P. mcginnisi n. sp. (from off the Southern Shetland Islands) is most closely related to P. bolini (Fraser-Brunner, 1949), from which it differs in photophore arrangement, in metallic shine of the photophores, and in

  5. Feeding ecology of Lutjanus analis (Teleostei: Lutjanidae from Abrolhos Bank, Eastern Brazil

    Directory of Open Access Journals (Sweden)

    Matheus Oliveira Freitas

    Full Text Available Diet and feeding ecology of the mutton snapper Lutjanus analis were investigated in the Abrolhos Bank, Eastern Brazil, the largest and richest coral reefs in the South Atlantic, where about 270 species of reef and shore fishes occur. To evaluate seasonal and ontogenetic shifts in the diet, specimens of L. analis were obtained through a fish monitoring program in four cities in southern Bahia State, from June 2005 to March 2007. Stomachs from 85 mutton snappers that ranged in size from 18.1 to 74.0 cm TL were examined. Prey were identified to the lowest possible taxon and assessed by the frequency of occurrence and volumetric methods. Variations in volume prey consumption were evaluated using non-metric multi-dimensional scaling ordination, analysis of similarity, and similarity percentage methods. Significant differences in diet composition among size classes were registered, whereas non significant differences between seasons were observed. Considering size-classes, food items consumption showed important variations: juveniles (50.1 cm TL consumed basically fish, mostly Anguiliformes. Lutjanus analis is an important generalist reef predator, with a broad array of food resources and ontogenetic changes in the diet. This snapper species plays an important role on the trophic ecology of the Abrolhos Bank coral reefs.

  6. Spawning migrations of the endemic Labeobarbus (Cyprinidae, Teleostei) species of Lake Tana, Ethiopia, status and threats

    NARCIS (Netherlands)

    Anteneh, W.; Getahun, A.; Dejen, E.; Sibbing, F.A.; Nagelkerke, L.A.J.; de Graaf, M.; Wudneh, T.; Vijverberg, J.; Palstra, A.P.


    The reproductive biology of the only known intact species flock of large cyprinids, the 16 Labeobarbus species of Lake Tana (Ethiopia), has been extensively studied for the past two decades. Seven species of Labeobarbus are known to migrate >50 km upstream into tributary rivers for spawning during

  7. Spawning migrations of the endemic Labeobarbus (Cyprinidae, Teleostei) species of Lake Tana, Ethiopia: status and threats

    NARCIS (Netherlands)

    Anteneh, W.; Getahun, A.; Dejen, E.; Sibbing, F.A.; Nagelkerke, L.A.J.; Graaf, de M.; Wudneh, T.; Vijverberg, J.; Palstra, A.P.


    The reproductive biology of the only known intact species flock of large cyprinids, the 16 Labeobarbus species of Lake Tana (Ethiopia), has been extensively studied for the past two decades. Seven species of Labeobarbus are known to migrate >50 km upstream into tributary rivers for spawning

  8. Environmental pollution affects molecular and biochemical responses during gonadal maturation of Astyanax fasciatus (Teleostei: Characiformes: Characidae). (United States)

    Tolussi, Carlos E; Gomes, Aline D Olio; Kumar, Anupama; Ribeiro, Cristiele S; Nostro, Fabiana L Lo; Bain, Peter A; de Souza, Gabriela B; Cuña, Rodrigo Da; Honji, Renato M; Moreira, Renata G


    Endocrine disrupting compounds (EDCs) have the potential to alter fish reproduction at various levels of organization. The aim of this study was to assess the impact of a natural environment with heavily anthropogenic influence on the physiological processes involved in reproduction in the freshwater fish lambari (Astyanax fasciatus) using different biomarkers. Adult males and females were collected in different seasons from two distinct sites in the same watershed: Ponte Nova Reservoir (PN) considered a pristine or small anthropogenic influence reference point; and Billings Reservoir (Bil), subjected to a large anthropogenic impact. Biological indices, such as hepatosomatic index and gonadosomatic index (GSI), gonadal histomorphology, fecundity, and biomarkers such as plasma levels of estradiol (E2) as well as hepatic gene expression of its alfa nuclear receptor (ERα), were analyzed. Hepatic vitellogenin (VTG) gene expression was evaluated in both sexes, as an indicator of xenoestrogen exposure. Females collected at PN presented a typical annual variation reflected in GSI, whereas for those sampled at Bil the index did not change through the seasons. The higher concentration of E2 in males collected at Bil during spring/2013, together with the detection of VTG gene expression, suggest the presence of EDCs in the water. These EDCs may have also influenced fecundity of females from Bil, which was higher during winter and spring/2013. Gene expression of ERα and ovarian morphology did not differ between fish from both sites. Water conditions from Bil reservoir impacted by anthropic activity clearly interfered mainly with biomarkers of biological effect such as plasma E2 levels and absolute and relative fecundity, but also altered biomarkers of exposure as VTG gene expression. These facts support the notion that waterborne EDCs are capable of causing estrogenic activity in A. fasciatus. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. Molecular phylogeny and larval morphological diversity of the lanternfish genus Hygophum (Teleostei: Myctophidae). (United States)

    Yamaguchi, M; Miya, M; Okiyama, M; Nishida, M


    Larvae of the deep-sea lanternfish genus Hygophum (Myctophidae) exhibit a remarkable morphological diversity that is quite unexpected, considering their homogeneous adult morphology. In an attempt to elucidate the evolutionary patterns of such larval morphological diversity, nucleotide sequences of a portion of the mitochondrially encoded 16S ribosomal RNA gene were determined for seven Hygophum species and three outgroup taxa. Secondary structure-based alignment resulted in a character matrix consisting of 1172 bp of unambiguously aligned sequences, which were subjected to phylogenetic analyses using maximum-parsimony, maximum-likelihood, and neighbor-joining methods. The resultant tree topologies from the three methods were congruent, with most nodes, including that of the genus Hygophum, being strongly supported by various tree statistics. The most parsimonious reconstruction of the three previously recognized, distinct larval morphs onto the molecular phylogeny revealed that one of the morphs had originated as the common ancestor of the genus, the other two having diversified separately in two subsequent major clades. The patterns of such diversification are discussed in terms of the unusual larval eye morphology and geographic distribution. Copyright 2000 Academic Press.

  10. Stone loaches of Choman River system, Kurdistan, Iran (Teleostei: Cypriniformes: Nemacheilidae). (United States)

    Kamangar, Barzan Bahrami; Prokofiev, Artem M; Ghaderi, Edris; Nalbant, Theodore T


    For the first time, we present data on species composition and distributions of nemacheilid loaches in the Choman River basin of Kurdistan province, Iran. Two genera and four species are recorded from the area, of which three species are new for science: Oxynoemacheilus kurdistanicus, O. zagrosensis, O. chomanicus spp. nov., and Turcinoemacheilus kosswigi Băn. et Nalb. Detailed and illustrated morphological descriptions and univariate and multivariate analysis of morphometric and meristic features are for each of these species. Forty morphometric and eleven meristic characters were used in multivariate analysis to select characters that could discriminate between the four loach species. Discriminant Function Analysis revealed that sixteen morphometric measures and five meristic characters have the most variability between the loach species. The dendrograms based on cluster analysis of Mahalanobis distances of morphometrics and a combination of both characters confirmed two distinct groups: Oxynoemacheilus spp. and T. kosswigi. Within Oxynoemacheilus, O. zagrosensis and O. chomanicus are more similar to one other rather to either is to O. kurdistanicus.

  11. Eidinemacheilus proudlovei, a new subterranean loach from Iraqi Kurdistan (Teleostei; Nemacheilidae). (United States)

    Freyhof, Jörg; Abdullah, Younis Sabir; Ararat, Korsh; Ibrahim, Hamad; Geiger, Matthias F


    Eidinemacheilus proudlovei, new species, is described from subterranean waters in the Little Zab River drainage in Iraqi Kurdistan. After the discovery of E. smithi in 1976, E. proudlovei is the second troglomorphic nemacheilid loach found in the Middle East and the second species placed in Eidinemacheilus. Eidinemacheilus proudlovei is distinguished from E. smithi by having 8+8 or 8+7 branched caudal-fin rays, no adipose keel on the caudal peduncle, enlarged jaws and a fully developed head canal system. It furthers differs substantially in its DNA barcode (>8% K2P distance) from all other nemacheilid loaches in the Middle East, Europe and Western India.

  12. Two new species of Oxynoemacheilus from the Tigris drainage in Iraqi Kurdistan (Teleostei: Nemacheilidae). (United States)

    Freyhof, Jörg; Abdullah, Younis Sabir


    Two new species of Oxynoemacheilus are described from the Sirvan River drainage in Iraqi Kurdistan. Oxynoemacheilus gyndes, new species, is distinguished by having a very short lateral line, reaching behind the pectoral-fin base, no scales except on the posteriormost part of the caudal peduncle, a slightly emarginate caudal fin and no suborbital groove in males. Oxynoemacheilus hanae, new species, is distinguished by having a midlateral row of elongated blotches, isolated patches of dark-brown spots or blotches on lower flank, a deeply emarginate caudal fin and a suborbital groove in males.

  13. Oxynoemacheilus zarzianus, a new loach from the Lesser Zab River drainage in Iraqi Kurdistan (Teleostei: Nemacheilidae). (United States)

    Freyhof, Jörg; Geiger, Matthias


    Oxynoemacheilus zarzianus, new species, is described from the Lesser Zab River drainage, a tributary of the lower Tigris. It is distinguished from other Oxynoemacheilus species in the Tigris drainage by having a slightly emarginate caudal fin, no suborbital groove in males, a complete lateral line, the posterior process of the bony air-bladder capsule directed posteriorly, the flank and posterior part of back covered by scales, short barbels and a deep caudal peduncle. It is the fourth Oxynoemacheilus species known from the Lesser Zab drainage, where such loaches seem to be highly isolated in headwaters. Oxynoemacheilus species diversity in the Euphrates and Tigris drainage is exceptional high. Today 22 species are known from the entire Euphrates and Tigris drainage and 15 from the Tigris drainage alone.

  14. Isolation and Characterization of the Etheostoma tallapoosae (Teleostei: Percidae CENP-A Gene

    Directory of Open Access Journals (Sweden)

    Leos G. Kral


    Full Text Available Both centromeric alpha-satellite sequences as well as centromeric protein A (CENP-A are highly variable in eukaryotes. CENP-A, a histone H3 variant, is thought to act as the epigenetic “mark” for assembly of centromeric proteins. While most of the histone fold domain (HFD of the CENP-A is fairly well conserved, a portion of this HFD as well as the N-terminal tail show adaptive variation in both plants and animals. Such variation may establish reproductive barriers that may lead to speciation. The family Percidae contains over 200 species most of which are within the subfamily Etheostomatinae. This subfamily represents a species rich radiation of freshwater fishes in North America and these species exhibit both allopatric and sympatric distributions. In order to study the evolution of CENP-A in percid fish species, we have isolated and characterized the CENP-A gene from Etheostoma tallapoosae by PCR based gene walking. As a result of this study we have demonstrated that the Tallapoosa darter CENP-A gene HFD sequences can be isolated from genomic DNA by nested PCR in a manner that does not lead to the amplification of the highly sequence related histone H3 gene. We also demonstrated that PCR based walking can be subsequently used to isolate the rest of the CENP-A gene and adjacent gene sequences. These adjacent gene sequences provide us with a primer binding sites for PCR isolation of the CENP-A gene from other percid species of fishes. An initial comparison of three percid species shows that the N-terminal tail of the percid CENP-A gene shows adaptive evolution.

  15. Biogeography of the Mesoamerican Cichlidae (Teleostei: Heroini): Colonization through the GAARlandia land bridge and early diversification


    Rica, Olrich; Piálek, Lubomír.; Zardoya, Rafael; Doadrio, Ignacio; Zrzavý, Jan


    Aim: We present a molecular phylogenetic and biogeographical analysis of the Mesoamerican cichlid fishes (Cichlidae: Cichlasomatinae: Heroini), a dominant part of the freshwater biodiversity of the region. Based on these analyses we investigate the spatial and temporal origins and diversification of the group. Location: Mesoamerica. Methods: Model-based phylogenetic methods (MrBayes) using seven molecular markers with a virtually complete species-level taxon sampling, together with the Bayesi...

  16. Phylogenetic relationships of the algae scraping cyprinid genus Capoeta (Teleostei: Cyprinidae)

    Czech Academy of Sciences Publication Activity Database

    Levin, B. A.; Freyhof, J.; Lajbner, Zdeněk; Perea, S.; Abdoli, A.; Gaffaroglu, M.; Özulog, M.; Rubeyan, H.R.; Salnikov, V.B.; Doadrio, I.


    Roč. 62, č. 1 (2012), s. 542-549 ISSN 1055-7903 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50450515 Keywords : Cyprinidae * Phylogeny * Polyploid barbini Subject RIV: EH - Ecology, Behaviour Impact factor: 4.066, year: 2012

  17. Squalius namak, a new chub from Lake Namak basin in Iran (Teleostei: Cyprinidae). (United States)

    Khaefi, Roozbehan; Esmaeili, Hamid Reza; Sayyadzadeh, Golnaz; Geiger, Matthias F; Freyhof, Jörg


    Squalius namak, new species, from the endorheic Lake Namak and Kavir basins in Iran, is distinguished from the species of the genus Squalius in the Persian Gulf and the southern Caspian Sea basins by having a wide and thick symphysial knob on the lower jaw, a convex posterior anal-fin margin, a bold, dark-grey or brown, roundish or crescent-shaped blotch at the posterior tip of each flank scale and orange caudal-, anal- and pelvic-fin rays in life. Squalius namak is also characterized by four fixed, diagnostic nucleotide substitutions in the mtDNA COI barcode region.

  18. Observations on the reproductive and larval biology of Blennius pavo (Pisces: Teleostei) (United States)

    Westernhagen, H.


    Social behaviour and spawning of adult Blennius pavo kept in the laboratory are described. Eggs are deposited in batches on the walls of artificial spawning places (PVC pipes). One male guards and tends the eggs of different females in one spawning place. Larval hatching occurs in groups according to oviposition. Minimum incubation temperature is around 14 15°C. Larval survival in 1-1 rearing jars is not related to larval total length but to density of larval stock. An experimental population of laboratory reared juvenile and adolescent B. pavo displays a male to female ratio of 1:1.4. Factors possibly influencing the sex ratio of this littoral fish are discussed in view of the situation in its natural environment.

  19. Sexual ornaments, body morphology, and swimming performance in naturally hybridizing swordtails (teleostei: xiphophorus.

    Directory of Open Access Journals (Sweden)

    James B Johnson

    Full Text Available Determining the costs of sexual ornaments is complicated by the fact that ornaments are often integrated with other, non-sexual traits, making it difficult to dissect the effect of ornaments independent of other aspects of the phenotype. Hybridization can produce reduced phenotypic integration, allowing one to evaluate performance across a broad range of multivariate trait values. Here we assess the relationship between morphology and performance in the swordtails Xiphophorus malinche and X. birchmanni, two naturally-hybridizing fish species that differ extensively in non-sexual as well as sexual traits. We took advantage of novel trait variation in hybrids to determine if sexual ornaments incur a cost in terms of locomotor ability. For both fast-start and endurance swimming, hybrids performed at least as well as the two parental species. The sexually-dimorphic sword did not impair swimming performance per se. Rather, the sword negatively affected performance only when paired with a sub-optimal body shape. Studies seeking to quantify the costs of ornaments should consider that covariance with non-sexual traits may create the spurious appearance of costs.

  20. Revision of the Astyanax orthodus species-group (Teleostei: Characidae with descriptions of three new species

    Directory of Open Access Journals (Sweden)

    Raquel I. Riuz-C


    Full Text Available The Astyanax orthodus species-group includes nine species: Astyanax boliviensis sp. nov., A. bopiensis nom. nov., A. embera sp. nov., A. gandhiae sp. nov., A. moorii comb. nov., A. orthodus, A. superbus, A. villwocki and A. yariguies comb. nov. The group is diagnosed by the presence of a series of pinnate-shaped marks (chevrons located along the lateral midline, which extends from the humeral region to the caudal peduncle. Astyanax bopiensis nom. nov. is proposed as a substitute name for Astyanacinus multidens, which, along with Astyanax yariguies comb. nov., we reassign to Astyanax.We also propose the synonymy of Astyanacinus with Astyanax. The members of the A. orthodus species-group are distributed in northwestern South America, occurring in the Patia River drainage (A. embera sp. nov. of the Pacific coast of Colombia, the Atrato River Basin (A. orthodus, the Magdalena River Basin (A. yariguies comb. nov. of Caribbean Colombia, streams of the southern flank of the Andes of the Orinoco Basin in Venezuela (A. superbus, in the upper Amazon River Basin of Colombia, Ecuador and Peru (A. villwocki, A. gandhiae sp. nov., from the upper Paraguay River (A. moorii comb. nov., the Madidi and Mamore Rivers, Bolivia (A. boliviensis sp. nov. and A. bopiensis nom. nov.. All species currently included in Astyanacinus are reassigned to the Astyanax orthodus species-group.

  1. Cytogenetic and morphological diversity in populations of Astyanax fasciatus (Teleostei, Characidae from Brazilian northeastern river basins

    Directory of Open Access Journals (Sweden)

    Aline Souza Medrado


    Full Text Available In the present work, morphometric and cytogenetic analyses were carried out in populations of the fish Astyanax fasciatus (Characidae from Contas and Recôncavo Sul River basins (State of Bahia, Brazil, providing new data on the genetic structure of this species along the region. Based on morphologic measurements, we observed that populations from the same hydrographic basin were more similar to each other (Contas and Preto do Costa Rivers, and remarkably divergent from Recôncavo Sul (Mineiro Stream, as indicated by clustering analysis. Cytogenetic data revealed a same diploid number for all populations (2n = 48, but distinct karyotype formulae (8M+24SM+12ST+4A, FN = 92 in Contas River, 8M+24SM+10ST+6A, FN = 90 in Preto do Costa River, and 8M+18SM+16ST+6A, FN = 90 in Mineiro Stream. Ag-NORs were identified at telomeres on a subtelocentric chromosome pair, although multiple ribosomal sites have been detected in some specimens from Contas River. These results show that A. fasciatus populations from northeastern river basins are well differentiated and present peculiar cytogenetic features when compared to populations from other regions. Therefore, the apparent chromosomal plasticity of this species, likely to represent a complex of cryptic forms, is corroborated. Finally, we demonstrated that morphological features can be successfully used to support other sources of genetic information.

  2. Phylogeny and historical biogeography of trans-Andean cichlid fishes (Teleostei: Cichlidae)

    Czech Academy of Sciences Publication Activity Database

    Musilová, Zuzana; Říčan, O.; Říčanová, Š.; Janšta, P.; Gahura, O.; Novák, J.


    Roč. 65, č. 3 (2015), s. 333-350 ISSN 1864-5755 R&D Projects: GA MŠk LC06073 Institutional support: RVO:67985904 Keywords : Andean uplift * Andinoacara * Mesoheros Subject RIV: EG - Zoology Impact factor: 0.722, year: 2015

  3. Schistura kampucheensis, a new species of loach from Cambodia (Teleostei: Nemacheilidae)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Petrtýl, M.; Chaloupková, P.; Borin, C.


    Roč. 26, č. 4 (2016), s. 353-362 ISSN 0936-9902 R&D Projects: GA ČR GA206/08/0637 Institutional support: RVO:67985904 Keywords : Schistura kampucheensis * loach Subject RIV: EG - Zoology Impact factor: 0.953, year: 2016

  4. Characteristics of infection of Diplectanum sp. (Monogenea: Monopisthocolytea: Diplectanidae in Cynoscion analis Jenyns (Pisces: teleostei: Scianidae

    Directory of Open Access Journals (Sweden)

    José Iannacone


    Full Text Available 120 Cynoscion analis Jenyns were collected from Chorrillos fishmarket, Lima, Perú, between January and February 2000 and necropsied to study ectoparasite monogenean Diplectanum sp. from branchial filaments. This parasite was considered a core specie, because it parasites 2/3 hosts examined. Of the fishes collected 80 were female and 40 male. Females and males showed a standard length between 16,4-27,0 cm (mean = 21,08 ± 2,24 and 16,5-26,3 cm (mean = 20,47 ± 2,06, respectively. The prevalence of infection of Diplectanurn was 72,5%, mean intensity and abundance were 3,16 ± 2,84 and 2,29 ± 2,80 respectively. This monogenean showed an overclispersal spatial distribution (2,55 at level of fish hosts. We observed a correlation between mean intensity of infestation and standard length of C. analis. Males (4,14 ± 3,75 showed a higher mean intensity than females (2,67 ± 2,14. A high prevalence, intensity and abundance of Diplectanum to 11 gill was found. However, we did not find neither preference when we separated each gill in three parts (fore, middle and hind respectively. Finally, we compared our results of population assemblages of other ectoparasite monogeneans in marine fishes. Diplectanurn sp. is a new record to C. analis and to Peru.

  5. The morphology and sculpture of ossicles in the Cottidae (Teleostei of the Baltic Sea

    Directory of Open Access Journals (Sweden)

    Heli Špilev


    Full Text Available Small to very small ossified structures (ossicles such as cephalic horns, dermal tubercles, fin-ray rods, lateral-line canal segments, branchial tooth plates and gill-raker tubercles of three species of the teleostean fish family Cottidae inhabiting the Baltic Sea are described and for the first time illustrated with SEM images, with emphasis on their microscopic external features. The morphology and sculpture of these small ossicles notably differ in the three genera, but differences can also occur between males and females, as documented here in Myoxocephalus scorpius (Linnaeus. The detailed features of such ossicles are potentially useful for taxonomic identification in sea-floor sediments or gut contents, in a manner similar to their use in many modern and fossil fishes, and may also prove useful as phylogenetically important characters at generic and familial levels.

  6. Distribution, feeding and ecomorphology of four species of Auchenipteridae (Teleostei: Siluriformes in Eastern Amazonia, Brazil

    Directory of Open Access Journals (Sweden)

    Tiago M. S. Freitas

    Full Text Available ABSTRACT Fish exhibit morphological, physiological and behavioral specializations which enable them to display different ways to explore the environments and resources. Thus, the aim of this study was to verify how four Auchenipteridae species differ in the distribution, feeding habits and morphological traits: Auchenipterichthys longimanus (Günther, 1864, Auchenipterus nuchalis (Spix & Agassiz, 1829, Tatia intermedia (Steindachner, 1877 and Trachelyopterus galeatus (Linnaeus, 1766. This study was conducted in rivers and bays of the Anapú Basin, Pará State (Brazil, where these species are abundant. Specimens were collected using gillnets, and after caught the stomachs were removed for the contents analyzes. Eighteen morphometric measurements from ten adult specimens of each species were taken, combined into fifteen ecomorphological attributes. The species distribution showed that A. longimanus was restricted to rivers, while the others were exclusively caught in the bays. All four species had their diet composed of allochthonous insects, but A. longimanus also exhibited a great frugivorous habit. The most important ecomorphological attributes were relative to the consumption of larger food items (for A. longimanus and T. galeatus and to the longer swimming capacity (for A. longimanus and T. intermedia. These morphological differences and the trophic diversity presented in this study highlighted some important information about how ecomorphological similar species behave and share resources, which may play a significant role on the coexistence of these species in the Anapú Basin.

  7. Microhabitat Association of Cryptobenthic Reef Fishes (Teleostei: Gobiidae) in the Central Red Sea

    KAUST Repository

    Troyer, Emily


    that have close associations with the substrate. These fishes can be behaviorally cryptic, by seeking refuge within the reef matrix, or visually cryptic, using cryptic coloration to match the surrounding habitat. These factors make visual surveys inadequate

  8. Microhabitat Association of Cryptobenthic Reef Fishes (Teleostei: Gobiidae) in the Central Red Sea

    KAUST Repository

    Troyer, Emily


    Knowledge of biodiversity within an ecosystem is essential when trying to understand the function and importance of that ecosystem. A challenge when assessing biodiversity of reef habitats is cryptobenthic fishes, which encompass many groups that have close associations with the substrate. These fishes can be behaviorally cryptic, by seeking refuge within the reef matrix, or visually cryptic, using cryptic coloration to match the surrounding habitat. These factors make visual surveys inadequate for sampling these fishes. One such group of cryptobenthic fishes are the gobies, family Gobiidae, which currently represent over 1600 species, although new species are continually being discovered. Gobies are often small (less than 5 cm), and many species will be associated with a very specific microhabitat type. Due to the understudied nature of the Red Sea, little is known about habitat preferences of gobies within the region. In order to determine the differences in goby community structure within the central Red Sea, fishes were sampled at one reef using 1 m² enclosed rotenone stations from three distinct microhabitats: hard coral, rubble, and sand. Following collection, specimens were photographed and sequenced using COI, to aid in species identification. 232 individuals were collected representing 31 species of goby. Rubble microhabitats were found to host the majority of collected gobies (69%), followed by hard coral (20.6%), then sand (9.9%). Goby assemblages in the three microhabitats were significantly different from each other, and evidence of habitat-specialists was found. These results provide essential baseline information about the ecology of understudied cryptobenthic fishes that can be used in future large-scale studies in the Red Sea region.


    NARCIS (Netherlands)



    Criteria for female mate choice were investigated in a natural population of a Mediterranean blenny, Aidablennius sphynx. Removable test tubes in concrete blocks were offered as nests. Each tube was guarded by a male and females laid eggs in the tubes. Nests with larger broods received significantly

  10. Morphology-diet relationships in four killifishes (Teleostei, Cyprinodontidae, Orestias) from Lake Titicaca. (United States)

    Maldonado, E; Hubert, N; Sagnes, P; De Mérona, B


    This study explores the relationship between morphology and diet in four Andean killifishes (Orestias) from Lake Titicaca that are known to differ in habitat use. Species that fed preferentially on amphipods (Orestias albus) or molluscs (Orestias luteus) separated in multivariate space from other species that feed on cladocera and algae (Orestias agassii and Orestias jussiei). Generally, specimens feeding on cladocera were characterized by a short, blunt nose with a small mouth; whereas, specimens feeding on amphipods exhibited a long snout with a large mouth. Specimens including molluscs in their diet tended to have a larger posterior part of the head and the larger opercles than others; while the occurrence of substratum in gut content was generally related to a short but deep head. The present analysis suggests that the littoral O. jussiei has an intermediate phenotype and diet between the pelagic (O. agassii) and benthic (O. albus and O. luteus) species. Results suggest that resource partitioning was occurring and that several morphological traits relate to characteristics of the diet, and it is inferred that the benthic, the pelagic and the littoral zones in the lake host different prey communities constituting distinct adaptive landscapes.

  11. Population characteristics, space use and habitat associations of the seahorse Hippocampus reidi (Teleostei: Syngnathidae

    Directory of Open Access Journals (Sweden)

    Ierecê Lucena Rosa

    Full Text Available This paper provides a case study of a threatened seahorse species, Hippocampus reidi, highlighting the importance of using ecological information to assist conservation and management initiatives. Underwater visual sighting data (50 x 2m transect gathered along the NE, SE and S portions of the Brazilian coast revealed an unequal distribution across localities, perhaps related to harvesting pressure, and a mean density of 0.026 ind.m-2. Our findings suggest some restricted spatial use by H. reidi, which was consistent with its estimated home range, and with re-sighting of specimens. Reproduction was recorded year-round, however productive peaks may exist. Components of habitat structure mostly used as anchoring points were mangrove plants, macroalgae, cnidarians, seagrass, sponges, and bryozoans. Conservation recommendations include: further characterization and mapping of habitats; assessment of availability and condition of microhabitats in selected areas, and studies on dispersal routes during initial life stages.

  12. Development of free neuromasts in Engraulis ringens and Strangomera bentincki (Teleostei, Clupeiformes early larvae

    Directory of Open Access Journals (Sweden)

    Alejandra Llanos-Rivera


    Full Text Available Neuromast morphology and distribution are characterized during early ontogeny of anchoveta (Engraulis ringens and common sardine (Strangomera bentincki. Although both species share morphological features, they show several differences during their early ontogeny, such as size at hatching and yolk absorption. Larvae were obtained from incubation of planktonic eggs (at 12°C, collected during the spawning season 2001 (August-September at Coliumo Bay. The neuromasts were observed from hatching to 25 days, and the pattern of neuromast appearance, in newly hatched larva, until yolk absorption, was determined using Janus Green staining and scanning electronic microscope. Results showed a similar pattern of neuromast development in both species. At hatching, two pairs of neuromasts were observed in the cephalic area and 8-9 in the rest of the body, which increased to 19 pairs and to 30-39 pairs at a larval size of 11 mm, respectively. On the average, 12 hair cells per neuromast were counted, with little variation among neuromasts. The polarity of these hair cells was closest to multiple polarity. Neuromast positioning for both species, anchoveta and common sardine larvae, are similar to those of Engraulis mordax and Clupea harengus, respectively. The similar development pattern of these species seems to be related to similar functional constraints and close taxonomic affinity.

  13. Steroid sex hormone dynamics during estradiol-17β induced gonadal differentiation in Paralichthys olivaceus (Teleostei) (United States)

    Sun, Peng; You, Feng; Liu, Mengxia; Wu, Zhihao; Wen, Aiyun; Li, Jun; Xu, Yongli; Zhang, Peijun


    Steroid sex hormones, such as estradiol-17β (E2) and testosterone (T), are important regulators of sex change in fish. In this study, we examined the effects of E2 treatment on the dynamics of E2 and T during gonadal differentiation in the olive flounder Paralichthys olivaceus using histology and radioimmunoassay (RIA). Flounder larvae were divided into five groups (G0-G4), and fed with 0 (control), 0.2, 2, 20 and 100 mg E2/kg feed from 35 to 110 day post hatching (dph). Fish growth in the G1 and G2 groups was not significantly different from that of the control group ( P>0.05), while fish in the G3 and G4 groups were less active and showed growth depression and high mortality. The gonads of fish in the G3 and G4 groups were smaller and surrounded by hyperplastic connective tissue. The frequency of females in the G0-G4 groups was 54.5%, 75.0%, 100%, 100% and 93.3%, respectively. The RIA analyses of E2 and T showed that T levels decreased during gonadal differentiation, and increased slightly at the onset of ovarian differentiation, while E2 levels increased gradually and peaked at the onset of ovarian differentiation in the control group. In the E2-treated groups, T levels decreased before the onset of ovarian differentiation. E2 levels were high on the 48 dph, but declined to a lower level on the 54 dph, and then increased gradually during gonadal differentiation. And a sharp increase of E2 levels were observed in all E2-treated groups at the onset of ovarian differentiation. The data suggest that T and E2 play important roles during gonadal differentiation, and an E2 dose of 2 mg/kg feed could induce sex reversal in P. olivaceus.

  14. Peroxisomes in intestinal and gallbladder epithelial cells of the stickleback, Gasterosteus aculeatus L. (Teleostei)

    NARCIS (Netherlands)

    Ruiter, A.J.H. de; Veenhuis, M.; Wendelaar Bonga, S.E.


    The occurrence of microbodies in the epithelial cells of the intestine and gallbladder of the stickleback, Gasterosteus aculeatus L., is described. In the intestine the organelles are predominantly located in the apical and perinuclear zone of the cells and may contain small crystalline cores. In

  15. Molecular phylogeny and biogeography of the Neotropical cichlid fish tribe Cichlasomatini (Teleostei: Cichlidae: Cichlasomatinae)

    Czech Academy of Sciences Publication Activity Database

    Musilová, Zuzana; Říčan, Oldřich; Janko, Karel; Novák, J.


    Roč. 46, - (2008), s. 659-672 ISSN 1055-7903 R&D Projects: GA MŠk LC06073 Grant - others:GA UK(CZ) 182/2004/B-BIO; GA UK(CZ) 139407 Institutional research plan: CEZ:AV0Z50450515 Keywords : molecular phylogeny * Cichlids * south America Subject RIV: EG - Zoology Impact factor: 3.871, year: 2008

  16. New species of Freitascapillaria (Nematoda: Capillariidae) from the intestine of Cottus caeruleomentum (Teleostei: Cottidae) in Maryland

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Muzzall, P.


    Roč. 95, č. 4 (2009), s. 987-990 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Freitascapillaria * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009

  17. Monophyly of Heterandriini (Teleostei: Poeciliidae revisited: a critical review of the data

    Directory of Open Access Journals (Sweden)

    Alfy Morales-Cazan

    Full Text Available The systematics and taxonomy of poeciliid fishes (guppies and allies remain poorly understood despite the relative importance of these species as model systems in the biological sciences. This study focuses on testing the monophyly of the nominal poeciliine tribe Heterandriini and the genus Heterandria, through examination of the morphological characters on which the current classification is based. These characters include aspects of body shape (morphometrics, scale and fin-ray counts (meristics, pigmentation, the cephalic laterosensory system, and osteological features of the neurocranium, oral jaws and suspensorium, branchial basket, pectoral girdle, and the gonopodium and its supports. A Maximum Parsimony analysis was conducted of 150 characters coded for 56 poeciliid and outgroup species, including 22 of 45 heterandriin species (from the accounted in Parenti & Rauchenberger, 1989, or seven of nine heterandriin species (from the accounted in Lucinda & Reis, 2005. Multistate characters were analyzed as both unordered and ordered, and iterative a posteriori weighting was used to improve tree resolution. Tree topologies obtained from these analyses support the monophyly of the Middle American species of "Heterandria," which based on available phylogenetic information, are herein reassigned to the genus Pseudoxiphophorus. None of the characters used in previous studies to characterize the nominal taxon Heterandriini are found to be unambiguously diagnostic. Some of these characters are shared with species in other poeciliid tribes, and others are reversed within the Heterandriini. These results support the hypothesis that Pseudoxiphophorus is monophyletic, and that this clade is not the closest relative of H. formosa (the type species from southeastern North America. Available morphological data are not sufficient to assess the phylogenetic relationships of H. formosa with respect to other members of the Heterandriini. The results further suggest that most tribe-level taxa of the Poeciliinae are not monophyletic, and that further work remains to resolve the evolutionary relationships of this group.

  18. Breeding behavior and reproductive life history of the Neosho Madtom, Noturus placidus (Teleostei: Ictaluridae) (United States)

    Bulger, Angela G.; Wilkinson, Christopher D.; Edds, David R.; Wildhaber, Mark L.


    The Neosho madtom, Noturus placidus, is a small catfish listed by the U. S. Fish and Wildlife Service as threatened. Little is known of its breeding biology and behavior because high turbidity and flow during its spawning season prevent direct observation in the field, and captive propagation has met with limited success. We held Neosho madtoms in laboratory aquaria in 1996 and 1998 to study sexual dimorphism during breeding season, courtship and nesting behavior, egg and clutch size, and embryological and larval development. We also attempted to induce spawning. Courtship behaviors were recorded on videotape, including “carousel” and “tail curl” displays in which the fish spun in circles, head to tail, then quivered, with the male's tail wrapped around the female's head. Three clutches were observed, all in nest cavities that had been excavated by the fish under a structure; one clutch (1996) consisted of approximately 60 eggs, with a mean chorion diameter of 3.1 mm, and two (1998) consisted of approximately 30 eggs, with mean diameter of 3.7 mm. In all situations, eggs hatched after eight or nine days, and yolk-sacs were fully depleted seven days later. One spawn (1998) occurred after two days of injection with synthetic hormone. Male parental care of eggs and larvae was observed in 1996. Larvae remained in the nest until yolk-sacs were absorbed, after which they dispersed throughout the tank. Dissection of two females that laid clutches in this study revealed previtellogenic eggs in the lumen of ovaries, with a mean chorion diameter of 0.9 mm. Swollen lips of males, distended abdomen of females, and differences in head shape, premaxillary tooth patch coloring, and genital papillae of breeding males and females were documented during spawning periods.

  19. The reproduction of Blennius pavo (Teleostei, Blenniidae). I. Ovarial cycle, environmental factors and feeding (United States)

    Patzner, Robert A.


    Blennius (Salaria) pavo is a very common coastal fish in the Mediterranean Sea. The development of the ovary was studied over a period of one year; seven stages of oogenesis are described. Ripe eggs are carried during the spawning season from Juni to August. The ovary shows a resting period of more than half a year (September to March). Environmental factors of the study area such as surface water temperature and daylength are described as well as the condition factors of male and female fish. Observations on food and behaviour during the winter months are also included.

  20. Karyotype variability in neotropical catfishes of the family Pimelodidae (Teleostei: Siluriformes

    Directory of Open Access Journals (Sweden)

    Américo Moraes Neto

    Full Text Available Karyotypic data are presented for four species of fish belonging to the Pimelodidae family. These species show a conserved diploid number, 2n = 56 chromosomes, with different karyotypic formulae. The analyzed species showed little amount of heterochromatin located preferentially in the centromeric and telomeric regions of some chromosomes. The nucleolus organizer regions activity (Ag-NORs and the chromosomal location of ribosomal genes by fluorescent in situ hybridization (FISH, with 18S and 5S probes, showing only one chromosome pair marked bearer of ribosomal genes, the only exception was Pimelodus britskii that presented multiple NORs and syntenic location of the 18S and 5S probes. Non-Robertsonian events, as pericentric inversion and NORs duplication are requested to explain the karyotype diversification in Pseudoplatystoma from the rio Paraguay (MS, Pimelodus from the rio Iguaçu (PR, Sorubim from the rio Paraguay (MS and Steindachneridion from the rio Paraíba do Sul (SP. The obtained data for the karyotype macrostructure of these species corroborates a conserved pattern observed in Pimelodidae. On the other hand, interspecific variations detected by molecular cytogenetics markers made possible cytotaxonomic inferences and differentiation of the species here analyzed.

  1. Reproductive biology of a population of Gymnotus aff.carapo (Teleostei: Gymnotidae from southern Brazil

    Directory of Open Access Journals (Sweden)

    Diego de Paula Cognato

    Full Text Available The reproductive period and its relation with somatic and abiotic factors, the relative and absolute fecundity, spawning type, length of first maturation and sex ratio is describe for Gymnotus aff.carapo from a small lake at Itapuã State Park, Rio Grande do Sul, Brazil. Gymnotus aff. carapo presents a relatively long reproductive cycle extending from November/2003 to March/2004. Decreases in water conductivity and increases in dissolved oxygen are correlated with increased gonadal development in males. In females, seasonal increases in temperature and photoperiod and decreases in dissolved oxygen are correlated with increased gonadal development. The mean absolute fecundity was 915.3 oocytes, and mean relative fecundity 0.20 oocytes/mg body weight. Egg size distributions indicate multiple spawning. The size of first maturation was 141 mm in females and 146 mm in males. The sex ratio was 1:1, with a male bias only in smaller size classes.

  2. Molecular Phylogeny and Biogeography of the Amphidromous Fish Genus Dormitator Gill 1861 (Teleostei: Eleotridae) (United States)

    Galván-Quesada, Sesángari; Doadrio, Ignacio; Alda, Fernando; Perdices, Anabel; Reina, Ruth Gisela; García Varela, Martín; Hernández, Natividad; Campos Mendoza, Antonio; Bermingham, Eldredge; Domínguez-Domínguez, Omar


    Species of the genus Dormitator, also known as sleepers, are representatives of the amphidromous freshwater fish fauna that inhabit the tropical and subtropical coastal environments of the Americas and Western Africa. Because of the distribution of this genus, it could be hypothesized that the evolutionary patterns in this genus, including a pair of geminate species across the Central American Isthmus, could be explained by vicariance following the break-up of Gondwana. However, the evolutionary history of this group has not been evaluated. We constructed a time-scaled molecular phylogeny of Dormitator using mitochondrial (Cytochrome b) and nuclear (Rhodopsin and β-actin) DNA sequence data to infer and date the cladogenetic events that drove the diversification of the genus and to relate them to the biogeographical history of Central America. Two divergent lineages of Dormitator were recovered: one that included all of the Pacific samples and another that included all of the eastern and western Atlantic samples. In contrast to the Pacific lineage, which showed no phylogeographic structure, the Atlantic lineage was geographically structured into four clades: Cameroon, Gulf of Mexico, West Cuba and Caribbean, showing evidence of potential cryptic species. The separation of the Pacific and Atlantic lineages was estimated to have occurred ~1 million years ago (Mya), whereas the four Atlantic clades showed mean times of divergence between 0.2 and 0.4 Mya. The splitting times of Dormitator between ocean basins are similar to those estimated for other geminate species pairs with shoreline estuarine preferences, which may indicate that the common evolutionary histories of the different clades are the result of isolation events associated with the closure of the Central American Isthmus and the subsequent climatic and oceanographic changes. PMID:27074006

  3. A new species of Bryconops (Teleostei: Characidae from the rio Madeira basin, Northern Brazil

    Directory of Open Access Journals (Sweden)

    Juliana M. Wingert

    Full Text Available A new species of Bryconops is described from a tributary to the rio Madeira in the Amazon basin, State of Rondônia, Brazil. Bryconops piracolina belongs to the subgenus Bryconops by having no teeth or rarely one tooth in the maxilla, and a naked area on cheek between the second and third infraorbitals. The new species is distinguished from all species of this subgenus by the presence of a large black blotch on dorsal-fin base. Furthermore, it is distinguished from all congeners, except B. inpai, by possessing the adipose fin entirely black. It differs from B. inpai by the lack of humeral spots. It further differs from all species of the subgenus Bryconops, except B. caudomaculatus, by having the last scales of the longitudinal series of scales that bears the lateral line series not pored beyond the end of the hypural plate, and differs from B. caudomaculatus by the smaller number of pored lateral line scales (31-36, mean 34.6, vs. 37-43, mean = 40.6, respectively.

  4. Revision of the jawfish genus Lonchopisthus with description of a new Atlantic species (Teleostei: Opistognathidae) (United States)

    Smith-Vaniz, William F.; Walsh, Stephen J.


    Synonymies, diagnoses, descriptions, illustrations, an identification key, and meristic frequency tables are provided for all species of Lonchopisthus. Most of the skeletal anatomy of L. higmani is also illustrated. A new jawfish, Lonchopisthus ancistrus n. sp., is described from the Gulf of Mexico and off Honduras based on 21 specimens 41–89 mm SL. The new species differs from other congeners by the following combination of characters: the posterior end of the maxilla strongly hooked; the membrane connecting the maxilla and premaxilla and the inner membrane covering the posterior part of the dentary pale; segmented dorsal-fin rays 11–13, with unbranched rays 2–5; longitudinal body-scale rows 33–39; and very long pelvic fins, 39.4–75.3% SL. Lonchopisthus lemur (and its synonym L. meadi) shares most characters with L. ancistrus, but differs in having shorter pelvic fins, 19.2–29.9% SL; fewer longitudinal body-scale rows, 26–33; and 5 infraorbitals (vs. 4). Both are relatively deep-water species, occurring from 100 m to at least 375 m (vs. 3–139 m in the other species). Lonchopisthus micrognathus is unique in having no branched caudal-fin rays at any size and the middle caudal-fin rays with free tips that may be used to maintain tactile contact with the substrate while hovering over its burrow. The western Atlantic Lonchopisthus higmani and eastern Pacific L. sinuscalifornicus are sister species that differ from the other Atlantic species in having the posterior end of the maxilla with a notch instead of a strong hook, the opercle with a large dark blotch, and one supraneural (vs. no supraneural).

  5. A new pachyrhizodontid fish (Actinopterygii, Teleostei from the Muhi Quarry (Albian-Cenomanian, Hidalgo, Mexico

    Directory of Open Access Journals (Sweden)

    G. Arratia


    Full Text Available A new genus and species – Motlayoichthys sergioi (ZooBank registration:, – from the Cretaceous (Albian-Cenomanian of the Muhi Quarry, Hidalgo, central Mexico is assigned to the family Pachyrhizodontidae based on the presence of the inner premaxillary tooth and a few other cranial characters. Its unique suite of characters, that includes several autapomorphies supports its assignment as a new genus and species, such as the presence of a triangular head with three sides of similar lengths and with its deepest part at the level of the supraoccipital region; the lower jaw projecting anterior to the premaxilla; the ornamentation of cranial bones – especially those of the cheek region – consisting of fine longitudinal crests densely covering the bony surfaces; one or a few deep grooves on the mandibular teeth, which in addition bear acrodin tips ornamented with fine parallel striae; and the position of the dorsal fin, near the posterior margin of the cranium. Motlayoichthys n. gen., together with Michin, Pachyrhizodus, Rhacolepis, and Notelops, is part of the early radiation of pachyrhizodontoids during Albian times.

  6. Reproductive cycles of Mugil cephalus, Liza ramada and Liza aurata (Teleostei: Mugilidae). (United States)

    Bartulović, V; Dulčić, J; Matić-Skoko, S; Glamuzina, B


    The reproductive cycles of three mullet species from the Eastern Adriatic coast were described using several biological parameters (gonado-somatic index, oocyte diameter and sex ratio) to improve knowledge about their reproduction. © 2011 The Authors. Journal of Fish Biology © 2011 The Fisheries Society of the British Isles.

  7. Helminth species richness of introduced and native grey mullets (Teleostei: Mugilidae). (United States)

    Sarabeev, Volodimir


    Quantitative complex analyses of parasite communities of invaders across different native and introduced populations are largely lacking. The present study provides a comparative analysis of species richness of helminth parasites in native and invasive populations of grey mullets. The local species richness differed between regions and host species, but did not differ when compared with invasive and native hosts. The size of parasite assemblages of endohelminths was higher in the Mediterranean and Azov-Black Seas, while monogeneans were the most diverse in the Sea of Japan. The helminth diversity was apparently higher in the introduced population of Liza haematocheilus than that in their native habitat, but this trend could not be confirmed when the size of geographic range and sampling efforts were controlled for. The parasite species richness at the infracommunity level of the invasive host population is significantly lower compared with that of the native host populations that lends support to the enemy release hypothesis. A distribution pattern of the infracommunity richness of acquired parasites by the invasive host can be characterized as aggregated and it is random in native host populations. Heterogeneity in the host susceptibility and vulnerability to acquired helminth species was assumed to be a reason of the aggregation of species numbers in the population of the invasive host. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  8. Genus-level taxonomic changes implied by the mitochondrial phylogeny of grey mullets (Teleostei: Mugilidae). (United States)

    Durand, Jean-Dominique; Chen, Wei-Jen; Shen, Kang-Ning; Fu, Cuizhang; Borsa, Philippe


    A comprehensive mitochondrial phylogeny of the family Mugilidae (Durand et al., Mol. Phylogenet. Evol. 64 (2012) 73-92) demonstrated the polyphyly or paraphyly of a proportion of the 20 genera in the family. Based on these results, here we propose a revised classification with 25 genera, including 15 genera currently recognized as valid (Agonostomus, Aldrichetta, Cestraeus, Chaenomugil, Chelon, Crenimugil, Ellochelon, Joturus, Mugil, Myxus, Neomyxus, Oedalechilus, Rhinomugil, Sicamugil and Trachystoma), 7 resurrected genera [Dajaus (for Agonostomus monticola), Gracilimugil (for Liza argentea), Minimugil (for Sicamugil cascasia), Osteomugil (for several species currently under Moolgarda and Valamugil, including M. cunnesius, M. engeli, M. perusii, and V. robustus), Planiliza (for Indo-Pacific Chelon spp., Indo-Pacific Liza spp., and Paramugil parmatus), Plicomugil (for Oedalechilus labiosus), and Squalomugil (for Rhinomugil nasutus)] and 3 new genera: Neochelon gen. nov. (for Liza falcipinnis), Parachelon gen. nov. (for L. grandisquamis) and Pseudomyxus gen. nov. (for Myxus capensis). Genus Chelon was shown to include exclusively Chelon spp. and Liza spp. from the Atlantic and the Mediterranean, and Liza spp. species endemic to eastern southern Africa. Genus Crenimugil should now include C. crenilabis, Moolgarda seheli and V. buchanani. Genus names Liza, Moolgarda, Paramugil, Valamugil and Xenomugil should be abandoned because they are no longer valid. Further genetic evidence is required to confirm or infirm the validity of the genus Paracrenimugil Senou 1988. The mitochondrial phylogeny of the 25 genera from the present revision is the following: [(Sicamugil, (Minimugil, Rhinomugil)); Trachystoma; ((Myxus, Neomyxus), (Cestraeus, Chaenomugil, (Agonostomus, Dajaus, Joturus), Mugil)); (Aldrichetta, Gracilimugil); Neochelon gen. nov.; (Pseudomyxus gen. nov., (Chelon, Oedalechilus, Planiliza, Parachelon gen. nov.)); ((Squalomugil, (Ellochelon, Plicomugil)), (Crenimugil, Osteomugil))]. Agonostomus monticola and several species with large distribution ranges (including Moolgarda seheli, Mugil cephalus and M. curema) consist of separate lineages whose geographic distribution suggests they are cryptic species, thus warranting further taxonomic work in the Mugilidae at the infra-generic level. Copyright © 2012 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  9. A checklist of macroparasites of Liza haematocheila (Temminck & Schlegel) (Teleostei: Mugilidae). (United States)

    Kostadinova, Aneta


    The mugilid fish Liza haematocheila (syn. Mugil soiuy), native to the Western North Pacific, provides opportunities to examine the changes of its parasite fauna after its translocation to the Sea of Azov and subsequent establishment in the Black Sea. However, the information on macroparasites of this host in both ranges of its current distribution comes from isolated studies published in difficult-to-access literature sources. Data from 53 publications, predominantly in Chinese, Russian and Ukrainian, were compiled from an extensive search of the literature and the Host-Parasite Database maintained up to 2005 at the Natural History Museum, London. The complete checklist of the metazoan parasites of L. haematocheila throughout its distributional range comprises summarised information for 69 nominal species of helminth and ectoparasitic crustacean parasites, from 45 genera and 27 families (370 host-parasite records in total) and includes the name of the parasite species, the area/locality of the host capture, and the author and date of the published record. The taxonomy is updated and the validity of the records and synonymies are critically evaluated. A comparison of the parasite faunas based on the records in the native and introduced/invasive range of L. haematocheila suggests that a large number of parasite species was 'lost' in the new distributional range whereas an even greater number was 'gained'. Although the present checklist provides information that will facilitate future studies, the interesting question of macroparasite faunal diversity in L. haematocheila in its natural and introduced/invasive ranges cannot be dealt with the current data because of unreliability associated with the large number of non-documented and questionable records. This stresses the importance of data quality analysis in using host-parasite database and checklist data.

  10. Preliminary observations on the feeding habits of the Mediterranean needlefish Tylosurus acus imperialis (Teleostei: Belonidae

    Directory of Open Access Journals (Sweden)

    Manel Châari


    Full Text Available Objective: To present the first information on the feeding habits of the Mediterranean needlefish Tylosurus acus imperialis (T. a. imperialis of Tunisia and to examine the diet variation in relation to the fish size, maturity and sex. Methods: Gut contents of 92 specimens of T. a. imperialis, collected mainly from May 2004 to July 2006 off the Gulf of Gabès, Southeastern Tunisian coast, were analyzed. Results: The results showed that 55.4% of them had empty guts and 44.6% contained food in their guts. The emptiness index did not vary significantly according to size classes or sexes of T. a. imperialis. Basic food consisted of teleosts (Mugilidae, Gobidae and Belonidae (62.6% followed by crustaceans (37.3%, mostly decapods Sycionia carinata (5.4%. A decrease in the feeding rate at the peak of the spawning season was observed for both sexes. A diet variation among juvenile and adult specimens of T. a. imperialis was found. Conclusions: This study enhances our knowledge on the biology of the Mediterranean needlefish T. a. imperialis. This fish is an active predator and an opportunistic feeder but the feeding rate declines at the peak of the spawning season.

  11. A revision of the species of Saturnius Manter, 1969 (Digenea: Hemiuridae), parasites of mullets (Teleostei: Mugilidae). (United States)

    Blasco-Costa, Isabel; Montero, Francisco E; Gibson, David I; Balbuena, Juan Antonio; Raga, Juan Antonio; Shvetsova, Ludmila S; Kostadinova, Aneta


    The genus Saturnius Manter, 1969 is defined, its species re-examined and a key to the species presented. S. overstreeti n. sp. is described from Mugil soiuy Basilewsky and M. cephalus L. from the Russian coast of the Sea of Japan and distinguished from the morphologically related S. papernai Overstreet, 1977 and S. maurepasi Overstreet, 1977. S. segmentatus Manter, 1969 is redescribed on the basis of the type- and newly collected material from M. cephalus on the Russian coast of the Sea of Japan. The morphometric variation of S. papernai is studied based on newly collected material from Liza aurata (Risso) in the Ebro Delta and off Santa Pola, Spain. The comparisons reveal lower ranges of most metrical features than previously known. A principal component analysis, carried out after adding the new data to those of Blasco-Costa et al. (2006), confirms the species identification. Other valid species recognised are S. mugilis (Yamaguti, 1970), S. maurepasi, S. belizensis Fischthal, 1977, S. dimitrovi Blasco-Costa et al., 2006 and S. minutus Blasco-Costa et al., 2006. Forms considered species inquirendae are S. valamugilis Rekharani & Madhavi, 1984, Bunocotyle constrictus Domnich & Sarabeev, 1999 [=S. papernai of Domnich & Sarabeev (2000a, b, c, d)], B. mugilis Yamaguti, 1970 of Solonchenko (1976) and S. mugilis of Dmitrieva & Gaevskaya (2001). Host and locality information is given in detail for all species. Lisa ramado (Risso) and Chelon labrosus (Cuvier) are new host records for S. papernai (sensu stricto) and S. dimitrovi. L. aurata is a new host record for S. dimitrovi and S. minutus, and L. saliens (Risso) is a new host record for S. minutus.

  12. Microsatellite variation and genetic structuring in Mugil liza (Teleostei: Mugilidae) populations from Argentina and Brazil (United States)

    Mai, Ana C. G.; Miño, Carolina I.; Marins, Luis F. F.; Monteiro-Neto, Cassiano; Miranda, Laura; Schwingel, Paulo R.; Lemos, Valéria M.; Gonzalez-Castro, Mariano; Castello, Jorge P.; Vieira, João P.


    The mullet Mugil liza is distributed along the Atlantic coast of South America, from Argentina to Venezuela, and it is heavily exploited in Brazil. We assessed patterns of distribution of neutral nuclear genetic variation in 250 samples from the Brazilian states of Rio de Janeiro, São Paulo, Santa Catarina and Rio Grande do Sul (latitudinal range of 23-31°S) and from Buenos Aires Province in Argentina (36°S). Nine microsatellite loci revealed 131 total alleles, 3-23 alleles per locus, He: 0.69 and Ho: 0.67. Significant genetic differentiation was observed between Rio de Janeiro samples (23°S) and those from all other locations, as indicated by FST, hierarchical analyses of genetic structure, Bayesian cluster analyses and assignment tests. The presence of two different demographic clusters better explains the allelic diversity observed in mullets from the southernmost portion of the Atlantic coast of Brazil and from Argentina. This may be taken into account when designing fisheries management plans involving Brazilian, Uruguayan and Argentinean M. liza populations.

  13. A checklist of macroparasites of Liza haematocheila (Temminck & Schlegel (Teleostei: Mugilidae

    Directory of Open Access Journals (Sweden)

    Kostadinova Aneta


    Full Text Available Abstract Background The mugilid fish Liza haematocheila (syn. Mugil soiuy, native to the Western North Pacific, provides opportunities to examine the changes of its parasite fauna after its translocation to the Sea of Azov and subsequent establishment in the Black Sea. However, the information on macroparasites of this host in both ranges of its current distribution comes from isolated studies published in difficult-to-access literature sources. Materials and methods Data from 53 publications, predominantly in Chinese, Russian and Ukrainian, were compiled from an extensive search of the literature and the Host-Parasite Database maintained up to 2005 at the Natural History Museum, London. Results The complete checklist of the metazoan parasites of L. haematocheila throughout its distributional range comprises summarised information for 69 nominal species of helminth and ectoparasitic crustacean parasites, from 45 genera and 27 families (370 host-parasite records in total and includes the name of the parasite species, the area/locality of the host capture, and the author and date of the published record. The taxonomy is updated and the validity of the records and synonymies are critically evaluated. A comparison of the parasite faunas based on the records in the native and introduced/invasive range of L. haematocheila suggests that a large number of parasite species was 'lost' in the new distributional range whereas an even greater number was 'gained'. Conclusion Although the present checklist provides information that will facilitate future studies, the interesting question of macroparasite faunal diversity in L. haematocheila in its natural and introduced/invasive ranges cannot be dealt with the current data because of unreliability associated with the large number of non-documented and questionable records. This stresses the importance of data quality analysis in using host-parasite database and checklist data.

  14. Multilocus resolution of Mugilidae phylogeny (Teleostei: Mugiliformes): Implications for the family's taxonomy. (United States)

    Xia, Rong; Durand, Jean-Dominique; Fu, Cuizhang


    The interrelationships among mugilids (Mugiliformes: Mugilidae) remain highly debated. Using a mitochondrial gene-based phylogeny as criterion, a revised classification with 25 genera in the Mugilidae has recently been proposed. However, phylogenetic relationships of major mitochondrial lineages remain unresolved and to gain a general acceptance the classification requires confirmation based on multilocus evidence and diagnostic morphological characters. Here, we construct a species-tree using twelve nuclear and three mitochondrial loci and infer the evolution of 71 morphological characters. Our multilocus phylogeny does not agree with previous morphology-based hypotheses for the relationships within Mugilidae, confirms the revised classification with 25 genera and further resolves their phylogenetic relationships. Using the well-resolved multilocus phylogeny as the criterion, we reclassify Mugilidae genera into three new subfamilies (Myxinae, Rhinomugilinae, and Cheloninae) and one new, recombined, subfamily (Mugilinae). The Rhinomugilinae subfamily is further divided into four tribes. The revised classification of Mugilidae is supported by morpho-anatomical synapomorphies or a combination of characters. These characters are used to erect a key to the subfamilies and genera. Copyright © 2015 Elsevier Inc. All rights reserved.

  15. The complete mitochondrial genome of the redeye mullet Liza haematocheila (Teleostei, Mugilidae). (United States)

    Chen, Jianhua; Li, Yinglei; Chen, Haigang; Yan, Binlun; Meng, Xueping


    The complete mitochondrial sequence of the redeye mullet Liza haematocheila has been determined. The circle genome is 16,822 bp in size, and consists of 13 protein-coding genes, 2 rRNA genes, 22 tRNA genes and a control region. The gene order and composition of L. haematocheila was similar to that of most other teleosts. The base composition of H-strand is 26.42% (A), 26.38% (T), 16.72% (G) and 30.47% (C), with an AT content of 52.8%. All genes are encoded on the heavy strand with the exception of ND6 and eight tRNA genes. The mitochondrial genome of L. haematocheila presented will be in favor of resolving phylogenetic relationships within the family Scatophagidae and the Mugiliformes.

  16. Migration and reproductive biology of Mugil liza (Teleostei: Mugilidae) in south Brazil. (United States)

    Lemos, V M; Varela, A S; Schwingel, P R; Muelbert, J H; Vieira, J P


    The mullet Mugil liza occurs along the Atlantic coast of South America from Venezuela to Argentina, but 95% of the commercial catch is collected from south Brazil between São Paulo and Argentina. Mugil liza is a single spawner with oocyte development occurring synchronously in two groups. Spawning happens in marine areas and occurs after migration. The reproductive migration occurs from Argentina (38° S) to the southern Brazilian states (24-26° S) from April to July, with peak spawning in June between northern Santa Catarina and Paraná. The presence of hyaline oocytes was associated with high salinity and sea surface temperatures of 19-21° C, and followed the seasonal northward displacement of these oceanographic conditions. The average size at first maturity (Lm ) for both sexes was 408·3 mm total length, LT . Males (Lm  = 400·1) matured earlier than females (Lm  = 421·9 mm). Fecundity ranged from 818,992 to 2,869,767 oocytes (mean = 1,624,551) in fish that were between 426 and 660 mm LT . © 2014 The Fisheries Society of the British Isles.

  17. Shaken not stirred: A molecular contribution to the systematics of genus Mugil (Teleostei, Mugilidae). (United States)

    Heras, Sandra; Maltagliati, Ferruccio; Fernández, Maria Victoria; Roldán, María Inés


    With this work we addressed some molecular systematic issues within the Mugil cephalus species complex. Particular attention was paid to the debated situations of: (i) Mugil liza, occurring in partial sympatry with Mugil cephalus in the northwestern Atlantic, and (ii) Mugil platanus, considered by some authors a synonymy of the former species and distributed in the southwestern Atlantic. We sequenced 79 individuals of a 465-bp portion of the mitochondrial control region (CR) from 8 western Atlantic and 2 Mediterranean localities. In addition, all CR sequences available from GenBank for the studied taxa were added to our dataset, for a total of 323 individuals. Overall, 229 haplotypes corresponding to 8 divergent monophyletic lineages were detected. Results of phylogenetic analyses were consistent with the occurrence of past speciation events producing the observed lineages. Of these lineages, 7 correspond to cryptic species and one is constituted by M. liza and M. platanus. As a matter of fact, these 2 taxa constitute a single lineage within the M. cephalus species complex. However, individuals of M. liza/M. platanus lineage analyzed by means of the 18 mitochondrial markers available in GenBank exhibited a degree of genetic diversity consistent with highly divergent populations. Of the 8 lineages detected, the Mediterraean one (type locality) corresponds to M. cephalus; the lineage M. liza/M. platanus should be named M. liza, under the priority principle, and the left 6 lineages need formal description. © 2015 International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and John Wiley & Sons Australia, Ltd.

  18. Reproductive biology of the mullet Mugil liza (Teleostei: Mugilidae in a tropical Brazilian bay

    Directory of Open Access Journals (Sweden)

    Rafael J. Albieri


    Full Text Available The reproductive biology of Mugil liza Valenciennes, 1836 is described as a contribution to an elaborate management programm. A total of 243 specimens (89 males and 154 females were collected in the Sepetiba Bay in south-eastern Brazil from July/2006 to June/2007. The gonadosomatic index (I G and the sequential development of the ovaries observed through histological studies suggested that the spawning season ranged from May to August. The population reached total sexual maturity (L T100 at 550 and 570 mm total length (L T for males and females, respectively. Females attained a larger size than males, and the sex ratio was female-biased for fish larger than 500 mm L T. The hepatosomatic index (I H was significantly related to the I G, indicating that vitellogenesis mobilizes hepatic energy during reproduction. Mean fecundity was 3,080,000 oocytes. The presence of only two phases of oocyte development in ripe ovaries - a reserve stock and a clutch of post-vitellogenic oocytes - indicated that ovarian development is group synchronic and this species is characterized as a total spawner. The results suggest that establishing a closed fishing season from May to August and establishing a minimum size for capture of 350 mm L T would enhance stock conservation and production for future harvest seasons.

  19. The ultrastructure of the mullet Mugil curema Valenciennes (Teleostei, Mugilidae spermatozoa

    Directory of Open Access Journals (Sweden)

    Daura Regina Eiras-Stofella


    Full Text Available The structure of the spermatozoon of Mugil curema Valenciennes, 1836 was studied using scanning and transmission electron microscopy. The spermatic head is rounded and formed by the nucleus containing granular chromatin, firmly packed resulting in a mass extremely electron dense. The acrossome is absent. The midpiece is characterized by the presence of two centrioles, a plasmatic canal, very few vesicles, and several mitochondria (9-10 with aproximately 0.50µm in diameter. The head and the midpiece are aproximately 1.56µm in diameter. The flagellum conforms to the 9 + 0 flagellar pattern near the transition region in its midpiece and is 9 + 2 from there on up to the distal region of the axoneme. The electron density in the A tubules 1, 2, 5 and 6 shows the asymetry of this spermatozoa. Its spermatic cell differs ultrastructuraly from those of other Mugilidae species mainly because it has the highest number of mitochondria.

  20. A new species of Saturnius Manter, 1969 (Digenea: Hemiuridae) from Mediterranean mullet (Teleostei: Mugilidae). (United States)

    Marzoug, Douniazed; Rima, Mohamed; Boutiba, Zitouni; Georgieva, Simona; Kostadinova, Aneta; Pérez-del-Olmo, Ana


    A new hemiurid digenean, Saturnius gibsoni n. sp., is described from the stomach lining of Mugil cephalus L. off Oran, Mediterranean coast of Algeria. Characteristic morphological features of the new species include small size of the body which is comprised of six pseudosegments, small ventral sucker, weakly developed mound-shaped flange at the level of the ventral sucker, and eggs being large in relation to the size of the body. Saturnius gibsoni n. sp. resembles S. minutus Blasco-Costa, Pankov, Gibson, Balbuena, Raga, Sarabeev & Kostadinova, 2006 and two unidentified Saturnius spp. in the small size of the body and most metrical features. However, in spite of the presence of five transverse septa resulting in six pseudosegments and the range overlap of some metrical features, the ventral sucker in S. minutus is much larger, the ventral sucker muscular flange is more prominent, the last pseudosegment is narrower in relation to body width and more rounded, and the eggs are smaller (mean 21 × 10 vs 25 × 12 μm). Furthermore, the partial sequences of the 28S rRNA gene region (domains D1-D3; 1,195 nt) obtained from two isolates of S. gibsoni n. sp. differed by 11 nt (0.9%) from that of S. minutus. Both unidentified forms of Saturnius are clearly distinguishable from S. gibsoni n. sp. by the presence of six stout, transverse muscular septa, forming seven pseudosegments (vs five septa forming six pseudosegments). Bayesian inference analysis of partial 28S rDNA sequences based on a total of 15 species from the families Hemiuridae and Lecithasteridae depicted the Bunocotylinae Dollfus, 1950 as a strongly supported basal clade, with Bunocotyle progenetica (Markowski, 1936) as the closest sister taxon to Saturnius spp.

  1. Barcoding snakeheads (Teleostei, Channidae) revisited: Discovering greater species diversity and resolving perpetuated taxonomic confusions (United States)

    Conte-Grand, Cecilia; Britz, Ralf; Dahanukar, Neelesh; Raghavan, Rajeev; Pethiyagoda, Rohan; Tan, Heok Hui; Hadiaty, Renny K.; Yaakob, Norsham S.


    Snakehead fishes of the family Channidae are predatory freshwater teleosts from Africa and Asia comprising 38 valid species. Snakeheads are important food fishes (aquaculture, live food trade) and have been introduced widely with several species becoming highly invasive. A channid barcode library was recently assembled by Serrao and co-workers to better detect and identify potential and established invasive snakehead species outside their native range. Comparing our own recent phylogenetic results of this taxonomically confusing group with those previously reported revealed several inconsistencies that prompted us to expand and improve on previous studies. By generating 343 novel snakehead coxI sequences and combining them with an additional 434 coxI sequences from GenBank we highlight several problems with previous efforts towards the assembly of a snakehead reference barcode library. We found that 16.3% of the channid coxI sequences deposited in GenBank are based on misidentifications. With the inclusion of our own data we were, however, able to solve these cases of perpetuated taxonomic confusion. Different species delimitation approaches we employed (BIN, GMYC, and PTP) were congruent in suggesting a potentially much higher species diversity within snakeheads than currently recognized. In total, 90 BINs were recovered and within a total of 15 currently recognized species multiple BINs were identified. This higher species diversity is mostly due to either the incorporation of undescribed, narrow range, endemics from the Eastern Himalaya biodiversity hotspot or the incorporation of several widespread species characterized by deep genetic splits between geographically well-defined lineages. In the latter case, over-lumping in the past has deflated the actual species numbers. Further integrative approaches are clearly needed for providing a better taxonomic understanding of snakehead diversity, new species descriptions and taxonomic revisions of the group. PMID:28931084

  2. Nuclear DNA content in 20 species of Siluriformes (Teleostei: Ostariophysi from the Neotropical region

    Directory of Open Access Journals (Sweden)

    Paulo César Fenerich


    Full Text Available In the present study, 20 species of Siluriformes fish were analyzed in order to determine their nuclear DNA content and compare these data with their diploid number. In addition, the extension and importance of the changes that occurred during the process of diversification in the group of Neotropical freshwater catfish were investigated. The only species studied of the family Doradidae, Rhinodoras d'orbignyi (2n = 58, presented 3.46 ± 0.13 pg of DNA. Among the species of the family Heptapteridae, the values of nuclear DNA content and the diploid numbers ranged from 1.13 ± 0.09 pg of DNA in Pimelodella sp. (2n = 46 to 2.38 ± 0.07 pg of DNA in Imparfinis mirini (2n = 58. The family Loricariidae showed the widest variation in diploid number and nuclear DNA content values, ranging from 2n = 52 and 3.96 ± 0.22 pg of DNA in Liposarcus anisitsi to 2n = 76 and 4.90 ± 0.12 pg of DNA in Hypostomus sp. 4. In this group, two local samples of Pimelodus maculatus (Pimelodidae were analyzed, and both exhibited 2n = 56, but different nuclear DNA content values (2.68 ± 0.22 pg and 2.82 ± 0.20 pg, respectively. Among the Pseudopimelodidae species analyzed, Pseudopimelodus mangurus (2n = 54 showed 2.23 ± 0.15 pg and Microglanis cottoides (2n = 54 exhibited 2.50 ± 0.18 pg of DNA. Two species of Trichomycterus (Trichomycteridae also presented the same diploid number, 2n = 54 chromosomes, but, while the species from the Quinta stream presented a DNA content of 2.62 ± 0.19 pg, in the sample from the Capivara river this value was 2.30 ± 0.23 pg. In the analyzed species, the results showed that the changes in DNA content were frequently not followed by changes in the diploid number. This fact permits to suggest that, in addition to structural chromosome rearrangements, other mechanisms, including deletions, duplications and polyploidy, could be involved in the process of species differentiation in the representatives of the fish order Siluriformes.

  3. Genetic diversity of Hypostomus ancistroides (Teleostei, Loricariidae from an urban stream

    Directory of Open Access Journals (Sweden)

    Silvia H. Sofia


    Full Text Available In this study, random amplified polymorphic DNA (RAPD markers were applied to analyze the genetic diversity of samples of the Neotropical catfish Hypostomus ancistroides, collected from four sites (S1, S2, S3 and S4 along an urban stream in Southern Brazil. The 11 primers used in RAPD analysis amplified 147 loci, 76 (51.7% of which were polymorphic. The proportions of polymorphic loci observed in the four samples were: 29.93% (S1, 31.97% (S2, 23.81% (S3 and 38.77% (S4. The average heterozygosity within sampling localities ranged from 0.1230 to 0.1526 and unbiased genetic distances ranged from 0.0253 to 0.0445. AMOVA partitioned 90.85% of the total variation within samples and 9.15% among samples. Excepting for the sample pair S1-S2 (phiST = 0.02784; p > 0.05, all others pairwise phiST values were significantly greater than zero, indicating moderate genetic differentiation among catfish samples from four localities. The relative low levels of genetic variation detected in all groups studied could be related to different factors, including the sedentary habit of these fish, which can be eroding the genetic variation of H. ancistroides from each locality.

  4. Ejaculate of sneaker males is pheromonally inconspicuous in the black goby, Gobius niger (Teleostei, Gobiidae). (United States)

    Locatello, L; Mazzoldi, C; Rasotto, M B


    The black goby, Gobius niger, shows alternative male mating tactics, i.e., parental and sneaker males. Males release a sexual pheromone that attracts females and stimulates aggressive displays in males. This pheromone is produced by the mesorchial gland, a structure well developed in parental males but markedly undeveloped in sneakers. We measured the behavioral response of parental males to the ejaculates of males performing different reproductive tactics. Parental males reacted to the ejaculate of other parental males, with stereotypic aggressive behaviors, but not to the ejaculate of sneakers; consequently sneaker male ejaculate appears to be pheromonally inconspicuous. Copyright 2002 Wiley-Liss, Inc.

  5. Strong reproductive skew among males in the multiply mated swordtail Xiphophorus multilineatus (Teleostei). (United States)

    Luo, J; Sanetra, M; Schartl, M; Meyer, A


    Male swordtails in the genus Xiphophorus display a conspicuous ventral elongation of the caudal fin, the sword, which arose through sexual selection due to female preference. Females mate regularly and are able to store sperm for at least 6 months. If multiple mating is frequent, this would raise the intriguing question about the role of female choice and male-male competition in shaping the mating system of these fishes. Size-dependent alternate mating strategies occur in Xiphophorus; one such strategy is courtship with a sigmoid display by large dominant males, while the other is gonopodial thrusting, in which small subordinate males sneak copulations. Using microsatellite markers, we observed a frequency of multiple paternity in wild-caught Xiphophorus multilineatus in 28% of families analyzed, but the actual frequency of multiple mating suggested by the correction factor PrDM was 33%. The number of fathers contributing genetically to the brood ranged from one to three. Compared to other species in the family Poeciliidae, both frequency and degree of multiple paternity were low. Paternity was found to be highly skewed, with one male on average contributing more than 70% to the offspring. Hence in this Xiphophorus mating system, typically one male dominates and sneaker males do not appear to be particularly effective. Postcopulatory mechanisms, however, such as sperm competition, are also indicated by our data, using sex-linked phenotypes among the offspring.

  6. A case of partial xanthism in a marblefish Aplodactylus punctatus (Teleostei: Aplodactylidae) from southern Peru


    Béarez, Philippe; Treviño, Hugo Treviño; Huamani, Isaac


    Se reporta por primera vez en Ilo, sur del Perú, una jerguilla amarilla (Aplodactylus punctatus). Esa condición de tener una piel de color amarillo se denomina xantismo. Este registro, único, corresponde probablemente a una extensión hacia el norte del rango de distribución de la «jerguilla reina», conocida de la costa central de Chile. A yellow skinned jerguilla (Aplodactylus punctatus) is reported for the first time from Ilo, Southern Peru. This condition of skin, in which yellow colorat...

  7. Un caso de xantismo parcial en Aplodactylus punctatus (Teleostei: Aplodactylidae del sur de Perú

    Directory of Open Access Journals (Sweden)

    Philippe Béarez


    Full Text Available Se reporta por primera vez en Ilo, sur del Perú, una jerguilla amarilla (Aplodactylus punctatus. Esa condición de tener una piel de color amarillo se denomina xantismo. Este registro, único, corresponde probablemente a una extensión hacia el norte del rango de distribución de la «jerguilla reina», conocida de la costa central de Chile.

  8. The complete mitochondrial genome of the tiger tail seahorse, Hippocampus comes (Teleostei, Syngnathidae). (United States)

    Chang, Chia-Hao; Lin, Han-Yang; Jang-Liaw, Nian-Hong; Shao, Kwang-Tsao; Lin, Yeong-Shin; Ho, Hsuan-Ching


    The complete mitochondrial genome of the tiger tail seahorse was sequenced using a polymerase chain reaction-based method. The total length of mitochondrial DNA is 16,525 bp and includes 13 protein-coding genes, 2 ribosomal RNA, 22 transfer RNA genes, and a control region. The mitochondrial gene arrangement of the tiger tail seahorse is also matching the one observed in the most vertebrate creatures. Base composition of the genome is A (32.8%), T (29.8%), C (23.0%), and G (14.4%) with an A+T-rich hallmark as that of other vertebrate mitochondrial genomes.

  9. A new species of seahorse (Teleostei: Syngnathidae) from the South China Sea. (United States)

    Zhang, Yan-Hong; Qin, Geng; Wang, Xin; Lin, Qiang


    A new species of seahorse, Hippocampus casscsio sp. nov. was collected over shallow seagrass beds in Beibu Bay, China. This species is diagnosed from all other seahorse species by morphological characters, including the lower number of tail rings (35); 15 pectoral-fin rays; 16 dorsal-fin rays; a rounded nuchal plate without a raised coronet; a snout length 30% head length; two cheek spines and a dark brown coloration. In addition, molecular analysis showed all individuals of the new species clustering together suggesting a monophyletic lineage. This combined analysis supports the distinctness of H. casscsio sp. nov. as a new species, which is described herein.

  10. Estimating population parameters of longsnout seahorses, Hippocampus reidi (Teleostei: Syngnathidae through mark-recapture

    Directory of Open Access Journals (Sweden)

    Alexandre C. Siqueira


    Full Text Available ABSTRACT Estimating population parameters is essential for understanding the ecology of species, which ultimately helps to assess their conservation status. The seahorse Hippocampus reidi is directly exposed to anthropogenic threats along the Brazilian coast, but the species still figures as Data Deficient (DD at IUCN’s Red List. To provide better information on the ecology of this species, we studied how population parameters vary over time in a natural subtropical environment. By combing mark-recapture models for open and closed populations, we estimated abundance, survival rate, emigration probability, and capture probability. We marked 111 individuals, which showed a 1:1 sex ratio, and an average size of 10.5 cm. The population showed high survival rate, low temporary emigration probability and variable capture probability and abundance. Our models considering relevant biological criteria illuminate the relatively poorly known population ecology and life history of seahorses. It is our hope that this study inspires the use of mark-recapture methods in other populations of H. reidi in a collective effort to properly assess their conservation status.

  11. The complete mitochondrial genome of the three-spot seahorse, Hippocampus trimaculatus (Teleostei, Syngnathidae). (United States)

    Chang, Chia-Hao; Shao, Kwang-Tsao; Lin, Yeong-Shin; Liao, Yun-Chih


    The complete mitochondrial genome of the three-spot seahorse was sequenced using a polymerase chain reaction-based method. The total length of mitochondrial DNA is 16,535 bp and includes 13 protein-coding genes, 2 ribosomal RNA genes, 22 transfer RNA genes, and a control region. The mitochondrial gene order of the three-spot seahorse also conforms to the distinctive vertebrate mitochondrial gene order. The base composition of the genome is A (32.7%), T (29.3%), C (23.4%), and G (14.6%) with an A + T-rich hallmark as that of other vertebrate mitochondrial genomes.

  12. Genetic population structure of sympatric and allopatric populations of Baltic ciscoes (Coregonus albula complex, Teleostei, Coregonidae). (United States)

    Mehner, Thomas; Pohlmann, Kirsten; Elkin, Che; Monaghan, Michael T; Nitz, Barbara; Freyhof, Jörg


    Teleost fishes of the Coregonidae are good model systems for studying postglacial evolution, adaptive radiation and ecological speciation. Of particular interest is whether the repeated occurrence of sympatric species pairs results from in-situ divergence from a single lineage or from multiple invasions of one or more different lineages. Here, we analysed the genetic structure of Baltic ciscoes (Coregonus albula complex), examining 271 individuals from 8 lakes in northern Germany using 1244 polymorphic AFLP loci. Six lakes had only one population of C. albula while the remaining two lakes had C. albula as well as a sympatric species (C. lucinensis or C. fontanae). AFLP demonstrated a significant population structure (Bayesian thetaB = 0.22). Lower differentiation between allopatric (thetaB = 0.028) than sympatric (0.063-0.083) populations contradicts the hypothesis of a sympatric origin of taxa, and there was little evidence for stocking or ongoing hybridization. Genome scans found only three loci that appeared to be under selection in both sympatric population pairs, suggesting a low probability of similar mechanisms of ecological segregation. However, removal of all non-neutral loci decreased the genetic distance between sympatric pairs, suggesting recent adaptive divergence at a few loci. Sympatric pairs in the two lakes were genetically distinct from the six other C. albula populations, suggesting introgression from another lineage may have influenced these two lakes. This was supported by an analysis of isolation-by-distance, where the drift-gene flow equilibrium observed among allopatric populations was disrupted when the sympatric pairs were included. While the population genetic data alone can not unambiguously uncover the mode of speciation, our data indicate that multiple lineages may be responsible for the complex patterns typically observed in Coregonus. Relative differences within and among lakes raises the possibility that multiple lineages may be present in northern Germany, thus understanding the postglacial evolution and speciation in the C. albula complex requires a large-scale phylogenetic analysis of several potential founder lineages.

  13. Mitogenomic evidence for an Indo-West Pacific origin of the Clupeoidei (Teleostei: Clupeiformes.

    Directory of Open Access Journals (Sweden)

    Sébastien Lavoué

    Full Text Available The clupeoid fishes are distributed worldwide, with marine, freshwater and euryhaline species living in either tropical or temperate environments. Regional endemism is important at the species and genus levels, and the highest species diversity is found in the tropical marine Indo-West Pacific region. The clupeoid distribution follows two general pattern of species richness, the longitudinal and latitudinal gradients. To test historical hypotheses explaining the formation of these two gradients, we have examined the early biogeography of the Clupeoidei in reconstructing the evolution of their habitat preferences along with their ancestral range distributions on a time-calibrated mitogenomic phylogeny. The phylogenetic results support the distinction of nine main lineages within the Clupeoidei, five of them new. We infer several independent transitions from a marine to freshwater environment and from a tropical to temperate environment that occurred after the initial diversification period of the Clupeoidei. These results combined with our ancestral range reconstruction hypothesis suggest that the probable region of origin and diversification of the Clupeoidei during the Cretaceous period was the tropical marine precursor to the present Indo-West Pacific region. Thus, our study favors the hypotheses of "Region of origin" and "Tropical conservatism" to explain the origins of the longitudinal and latitudinal gradients of clupeoid species richness, respectively. Additional geological and paleontological evidence further define the tropical marine paleo-region of origin as the eastern Tethys Sea region. The Cretaceous fossil record of the Clupeoidei is partially incongruent with the results here as it contains taxa found outside this region. We discuss three possible causes of conflict between our biogeographical hypothesis and the distributions of the Cretaceous clupeoid fossils: regional extinction, incomplete taxonomic sampling and incorrect timescale estimation.

  14. The eyes of lanternfishes (Myctophidae, Teleostei): novel ocular specializations for vision in dim light. (United States)

    de Busserolles, Fanny; Marshall, N Justin; Collin, Shaun P


    Lanternfishes are one of the most abundant groups of mesopelagic fishes in the world's oceans and play a critical role in biomass vertical turnover. Despite their importance, very little is known about their physiology or how they use their sensory systems to survive in the extreme conditions of the deep sea. In this study, we provide a comprehensive description of the general morphology of the myctophid eye, based on analysis of 53 different species, to understand better their visual capabilities. Results confirm that myctophids possess several visual adaptations for dim-light conditions, including enlarged eyes, an aphakic gap, a tapetum lucidum, and a pure rod retina with high densities of long photoreceptors. Two novel retinal specializations were also discovered. The first specialization is a fundal pigmentation in adult eyes, found within an isolated retinal region (typically central retina) composed of modified pigment epithelial cells, which we hypothesize to be the remnant of a more pronounced visual specialization important in larval stages. The second specialization is an aggregation of extracellular microtubular-like structures found within the sclerad region of the inner nuclear layer of the retina. We hypothesize that the marked interspecific differences in the hypertrophy of these microtubular-like structures may be related to inherent differences in visual function. A general interspecific variability in other parts of the eye is also revealed and examined in this study. The contribution of both ecology and phylogeny to the evolution of ocular specializations and vision in dim light are discussed. Copyright © 2013 Wiley Periodicals, Inc.

  15. Parasitofauna study of the brown trout, Salmo trutta (Pisces, Teleostei from Corsica (Mediterranean island rivers

    Directory of Open Access Journals (Sweden)

    Quilichini Y.


    Full Text Available Corsica is a mediterranean island characterised by a great number of rivers. Salmonides are the main fishes which populate these rivers. Very appreciated by fishermen, Salmonides are represented by three species in the insular hydrographical network, among which an autochthonous species, the brown trout (Salmo trutta. In the present work, we have analysed the parasitofauna of this species. According to our knowledge, this research has never been carried out in Corsica. In a first step, we drew up an inventory of the parasites found in this freshwater fish. In a second step, we studied the differences which appeared in the composition of parasite communities of this species.

  16. Patterns of oocyte development in natural habitat and captive Salminus hilarii Valenciennes, 1850 (Teleostei: Characidae). (United States)

    Honji, R M; Narcizo, A M; Borella, M I; Romagosa, E; Moreira, R G


    Fecundity and oocyte development in Salminus hilarii female brood stock were analyzed with the aim of investigating the impact of migration impediment on oogenesis. Histological analyses of the ovaries were performed in adult females caught in two different environments--the Tietê River (natural) and captivity--and the gonadossomatic index, oocyte diameter and fecundity determined. Five germ cell development stages (oogonium, perinucleolar, cortical alveoli, vitellogenic, ripe) and two other structures (postovulatory follicles and atretic oocytes) were observed in females caught in the river. Captive animals lacked the ripe oocytes and postovulatory follicles and had a relatively higher number of atretic oocytes. Females in captivity are known to produce larger oocytes, and they release fewer eggs in each spawn (absolute fecundity) when compared with animals that are able to migrate. Our results suggest that the Tietê River is undergoing alterations which are being reflected in the reproductive performance of S. hilarii, mainly due to the presence of atretic oocytes in females caught in the river. The lack of postovulatory follicles and ripe oocytes in captive animals reveals that migratory impediment negatively impacts final oocyte maturation. However, the stage of maturation reached is adequate for ovulation induction with hormone manipulation.

  17. A new genus of Neotropical rheophilic catfishes, with four new species (Teleostei: Siluriformes: Pseudopimelodidae

    Directory of Open Access Journals (Sweden)

    Oscar Akio Shibatta


    Full Text Available ABSTRACT Rhyacoglanis, a new genus of the South American freshwater catfish family Pseudopimelodidae is described from cis-Andean portions of the continent. Rhyacoglanis is distinguished from other genera of the family by three synapomorphies: presence of a light blotch on the cheek; a connection between the middle of the dark caudal-fin stripe and the dark caudal-peduncle pigmentation; and 30-35 total vertebrae. Species of Rhyacoglanis are rheophilic and strongly associated with rapids and other swift-flowing waters. A phylogenetic analysis based on 41 morphological characters yields a hypothesis of monophyly of the Pseudopimelodidae and Rhyacoglanis. Pimelodus pulcher Boulenger, 1887, from the western Amazon basin is designated as type-species of the new genus and redescribed. Four new species are described: Rhyacoglanis annulatus, from the río Orinoco basin, with a nearly ringed dark band on the caudal peduncle, and a larger distance between anus and anal-fin origin; R. epiblepsis, from the rio Madeira basin, with numerous dark spots scattered on the body, and rounded caudal-fin lobes; R. paranensis, from the upper rio Paraná basin, with three distinct dark bands on the body, and 31-33 total vertebrae; and R. seminiger, from the rio Juruena basin, with subdorsal and subadipose dark bands fused anteroposteriorly, and a separate dark band on the caudal peduncle.

  18. Mitochondrial molecular clocks and the origin of the major Otocephalan clades (Pisces: Teleostei)

    DEFF Research Database (Denmark)

    Peng, Zuogang; He, Shunping; Wang, Jun


    The Otocephala, a clade including ostariophysan and clupeomorph teleosts, represents about a quarter of total fish species diversity, with about 1000 genera and more than 7000 species. A series of recent papers have defended that the origin of this clade and of its major groups may be significantly...... otophysans could have originated before the splitting of the Pangean supercontinent is of extreme importance, since otophysan fishes are among the most useful animal groups for the determination of historical continental relationships. In the present work we examined divergence times for each major...... otocephalan group by an analysis of complete mtDNA sequences, in order to investigate if these divergence times support the hypotheses advanced in recent studies. The complete mtDNA sequences of nine representative non-otocephalan fish species and of twenty-one representative otocephalan species was compared...

  19. Two new species of shovel-jaw carp Onychostoma (Teleostei: Cyprinidae) from southern Vietnam. (United States)

    Hoang, Huy Duc; Pham, Hung Manh; Tran, Ngan Trong


    Two new species of large shovel-jaw carps in the genus Onychostoma are described from the upper Krong No and middle Dong Nai drainages of the Langbiang Plateau in southern Vietnam. These new species are known from streams in montane mixed pine and evergreen forests between 140 and 1112 m. Their populations are isolated in the headwaters of the upper Sre Pok River of the Mekong basin and in the middle of the Dong Nai basin. Both species are differentiated from their congeners by a combination of the following characters: transverse mouth opening width greater than head width, 14-17 predorsal scales, caudal-peduncle length 3.9-4.2 times in SL, no barbels in adults and juveniles, a strong serrated last simple ray of the dorsal fin, and small eye diameter (20.3-21.5% HL). Onychostoma krongnoensis sp. nov. is differentiated from Onychostoma dongnaiensis sp. nov. by body depth (4.0 vs. 3.2 times in SL), predorsal scale number (14-17 vs. 14-15), dorsal-fin length (4.5 vs. 4.2 times in SL), caudal-peduncle length (3.9 vs. 4.2 times in SL), colour in life (dark vs. bright), and by mitochondrial DNA (0.2% sequence divergence). Molecular evidence indicates that both species are members of Onychostoma and are distinct from all congeners sampled (uncorrected sequence divergences at the 16S rRNA gene of >2.0% for all Onychostoma for which homologous 16S rRNA sequences are available).

  20. Discovering Hidden Diversity of Characins (Teleostei: Characiformes) in Ecuador’s Yasuní National Park (United States)

    Escobar-Camacho, Daniel; Barriga, Ramiro; Ron, Santiago R.


    Background Management and conservation of biodiversity requires adequate species inventories. The Yasuní National Park is one of the most diverse regions on Earth and recent studies of terrestrial vertebrates, based on genetic evidence, have shown high levels of cryptic and undescribed diversity. Few genetic studies have been carried out in freshwater fishes from western Amazonia. Thus, in contrast with terrestrial vertebrates, their content of cryptic diversity remains unknown. In this study, we carried out genetic and morphological analyses on characin fishes at Yasuní National Park, in eastern Ecuador. Our goal was to identify cryptic diversity among one of the most speciose fish families in the Amazon region. This is the first time that genetic evidence has been used to assess the species content of the Napo Basin, one of the richest regions in vertebrate diversity. Results Phylogenetic analyses of partial mitochondrial 16S ribosomal RNA gene (∼600 pb) DNA sequences from 232 specimens of the family Characidae and its closest groups revealed eight candidate new species among 33 species sampled, representing a 24% increase in species number. Analyses of external morphology allowed us to confirm the species status of six of the candidate species. Conclusions Our results show high levels of cryptic diversity in Amazonian characins. If this group is representative of other Amazonian fish, our results would imply that the species richness of the Amazonian ichthyofauna is highly underestimated. Molecular methods are a necessary tool to obtain more realistic inventories of Neotropical freshwater fishes. PMID:26275041

  1. Discovering Hidden Diversity of Characins (Teleostei: Characiformes) in Ecuador's Yasuní National Park. (United States)

    Escobar-Camacho, Daniel; Barriga, Ramiro; Ron, Santiago R


    Management and conservation of biodiversity requires adequate species inventories. The Yasuní National Park is one of the most diverse regions on Earth and recent studies of terrestrial vertebrates, based on genetic evidence, have shown high levels of cryptic and undescribed diversity. Few genetic studies have been carried out in freshwater fishes from western Amazonia. Thus, in contrast with terrestrial vertebrates, their content of cryptic diversity remains unknown. In this study, we carried out genetic and morphological analyses on characin fishes at Yasuní National Park, in eastern Ecuador. Our goal was to identify cryptic diversity among one of the most speciose fish families in the Amazon region. This is the first time that genetic evidence has been used to assess the species content of the Napo Basin, one of the richest regions in vertebrate diversity. Phylogenetic analyses of partial mitochondrial 16S ribosomal RNA gene (∼600 pb) DNA sequences from 232 specimens of the family Characidae and its closest groups revealed eight candidate new species among 33 species sampled, representing a 24% increase in species number. Analyses of external morphology allowed us to confirm the species status of six of the candidate species. Our results show high levels of cryptic diversity in Amazonian characins. If this group is representative of other Amazonian fish, our results would imply that the species richness of the Amazonian ichthyofauna is highly underestimated. Molecular methods are a necessary tool to obtain more realistic inventories of Neotropical freshwater fishes.

  2. Microsatellite Development for an Endangered Bream Megalobrama pellegrini (Teleostei, Cyprinidae Using 454 Sequencing

    Directory of Open Access Journals (Sweden)

    Zuogang Peng


    Full Text Available Megalobrama pellegrini is an endemic fish species found in the upper Yangtze River basin in China. This species has become endangered due to the construction of the Three Gorges Dam and overfishing. However, the available genetic data for this species is limited. Here, we developed 26 polymorphic microsatellite markers from the M. pellegrini genome using next-generation sequencing techniques. A total of 257,497 raw reads were obtained from a quarter-plate run on 454 GS-FLX titanium platforms and 49,811 unique sequences were generated with an average length of 404 bp; 24,522 (49.2% sequences contained microsatellite repeats. Of the 53 loci screened, 33 were amplified successfully and 26 were polymorphic. The genetic diversity in M. pellegrini was moderate, with an average of 3.08 alleles per locus, and the mean observed and expected heterozygosity were 0.47 and 0.51, respectively. In addition, we tested cross-species amplification for all 33 loci in four additional breams: M. amblycephala, M. skolkovii, M. terminalis, and Sinibrama wui. The cross-species amplification showed a significant high level of transferability (79%–97%, which might be due to their dramatically close genetic relationships. The polymorphic microsatellites developed in the current study will not only contribute to further conservation genetic studies and parentage analyses of this endangered species, but also facilitate future work on the other closely related species.

  3. A fossil unicorn crestfish (Teleostei, Lampridiformes, Lophotidae) from the Eocene of Iran. (United States)

    Davesne, Donald


    Lophotidae, or crestfishes, is a family of rare deep-sea teleosts characterised by an enlarged horn-like crest on the forehead. They are poorly represented in the fossil record, by only three described taxa. One specimen attributed to Lophotidae has been described from the pelagic fauna of the middle-late Eocene Zagros Basin, Iran. Originally considered as a specimen of the fossil lophotid † Protolophotus , it is proposed hereby as a new genus and species † Babelichthys olneyi , gen. et sp. nov., differs from the other fossil lophotids by its relatively long and strongly projecting crest, suggesting a close relationship with the modern unicorn crestfish, Eumecichthys . This new taxon increases the diversity of the deep-sea teleost fauna to which it belongs, improving our understanding of the taxonomic composition of the early Cenozoic mesopelagic ecosystems.

  4. A fossil unicorn crestfish (Teleostei, Lampridiformes, Lophotidae from the Eocene of Iran

    Directory of Open Access Journals (Sweden)

    Donald Davesne


    Full Text Available Lophotidae, or crestfishes, is a family of rare deep-sea teleosts characterised by an enlarged horn-like crest on the forehead. They are poorly represented in the fossil record, by only three described taxa. One specimen attributed to Lophotidae has been described from the pelagic fauna of the middle-late Eocene Zagros Basin, Iran. Originally considered as a specimen of the fossil lophotid †Protolophotus, it is proposed hereby as a new genus and species †Babelichthys olneyi, gen. et sp. nov., differs from the other fossil lophotids by its relatively long and strongly projecting crest, suggesting a close relationship with the modern unicorn crestfish, Eumecichthys. This new taxon increases the diversity of the deep-sea teleost fauna to which it belongs, improving our understanding of the taxonomic composition of the early Cenozoic mesopelagic ecosystems.

  5. Nemacheilus Paucimaculatus, a new species of loach from the Southern Malay Peninsula (Teleostei: Nemacheilidae)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula


    Roč. 59, č. 2 (2011), 201-204 ISSN 0217-2445 R&D Projects: GA ČR GA206/08/0637; GA ČR GA206/05/2556; GA AV ČR IAA600450508 Institutional research plan: CEZ:AV0Z50450515 Keywords : Cobitoidea * Malaysia * Johor Subject RIV: EG - Zoology Impact factor: 1.467, year: 2011

  6. A new genus and two new species of loaches (Teleostei: Nemacheilidae) from Myanmar

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula


    Roč. 22, č. 1 (2011), 1-10 ISSN 0936-9902 R&D Projects: GA ČR GA206/08/0637; GA ČR GA206/05/2556; GA AV ČR IAA600450508 Institutional research plan: CEZ:AV0Z50450515 Keywords : Schist ore callidora * Myanmar Subject RIV: EG - Zoology Impact factor: 0.900, year: 2011

  7. Schistura shuensis, a new species of loach from Myanmar (Teleostei: Nemacheilidae)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula


    Roč. 24, č. 3 (2014), s. 217-223 ISSN 0936-9902 R&D Projects: GA ČR GA206/08/0637 Institutional support: RVO:67985904 Keywords : Schistura shuensis Subject RIV: EG - Zoology Impact factor: 1.400, year: 2014

  8. Larval development and shape variation of the kelpfish Myxodes viridis (Teleostei: Clinidae

    Directory of Open Access Journals (Sweden)

    Francisca Zavala-Muñoz


    Full Text Available Larval development and shape ontogeny of the kelpfish Myxodes viridis (Clinidae are described for the first time. A total of 214 individuals ranging between 3.51 and 23.09 mm standard length collected off central Chile were assessed employing classic and geometric morphometrics, illustration with camera lucida and a double-staining technique for cartilaginous and bone structure observation. Based on characteristics such as yolk sac presence and fin formation, six stages of larval development were differentiated: yolk sac, preflexion, flexion, early postflexion, late postflexion and juvenile. Shape changes during development are subtle and occur smoothly, being more significant in the head and preanal length, and ontogenetic allometry accounts for almost 15%. Cartilage formation takes place first at the branchial arches and cranium; then hypural, haemal and neural arches are consecutively formed. Bony structure ossification occurs late in the development. Vertebral centra ossify directly, without cartilaginous matrix replacement.

  9. Comportamento e habitos alimentares de quatro especies de cichilidae (teleostei) no Pantanal Matogrossense


    Francisco de Arruda Machado


    Resumo: Foram estudados o comportamento e o hábito alimentar de quatro espécies de Cichlidae, no Pantanal Matogrossense, Município de Poconé, Mato Grosso. As observações e coletas foram feitas entre o Km 9 e o Km 130 da Rodovia transpantaneira, nos anos de 1979 a 1983, em meses diversos (cobrindo épocas de seca e cheia), em lagoas, rios e corixos situados ao longo dessa rodovia. Astronotus ocellatus vive em pequenos grupos de 3 a 9 indivíduos, de dimensões semelhantes entre si. Alimenta-se, e...

  10. Three new species of blood flukes (Digenea: Aporocotylidae) infecting pufferfishes (Teleostei: Tetraodontidae) from off Bali, Indonesia. (United States)

    Yong, R Q-Y; Cutmore, S C; Bray, R A; Miller, T L; Semarariana, I W Y; Palm, H W; Cribb, T H


    We describe three new species of blood flukes (Aporocotylidae) and propose their classification within the genus Psettarium Goto & Ozaki, 1929. All three species were collected from the circulatory systems of pufferfishes caught off Bali, central Indonesia. Psettarium pulchellum n. sp. was found in the gills of both the narrow-lined puffer (Arothron manilensis de Procé) and the spiny blaasop (Tylerius spinosissimus Regan), while P. ogawai n. sp. and P. jimbaranense n. sp. were found in the gills of the reticulated puffer (Arothron reticularis Bloch & Schneider). The morphological characteristics of these taxa necessitated emendation of the diagnosis for the genus Psettarium, to accommodate the presence of an oral sucker, multiple or entirely post-caecal testes and a degenerate posterior testis. Features such as proportion of body length occupied by the oesophagus, and posterior caeca being ≥7× the length of anterior caeca, are no longer regarded as useful genus-level characters. Additionally, Sasala nolani is reassigned to this genus as Psettarium nolani n. comb. In phylogenetic analyses of the 28S and ITS2 rDNA regions, all three new taxa form a well-supported clade, together with Psettarium sinense and Psettarium nolani n. comb., the two other species of tetraodontid-infecting aporocotylids for which comparative rDNA data were available. The short branch lengths within this clade, despite dramatic morphological differences between the five species, suggest that rapid morphological diversification has occurred among the tetraodontid-infecting aporocotylids. The genus Psettarium has long been considered problematic. Further commentary is given on the history of this genus and how the issues presented might be resolved. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  11. Karyotype and chromosome banding of endangered crucian carp, carassius carassius (Linnaeus, 1758) (Teleostei, Cyprinidae)

    Czech Academy of Sciences Publication Activity Database

    Knytl, M.; Kalous, L.; Ráb, Petr


    Roč. 7, č. 3 (2013), s. 205-215 ISSN 1993-0771 R&D Projects: GA ČR(CZ) GPP506/11/P596 Institutional support: RVO:67985904 Keywords : fish cytogenetics * paleotetraploid * heterochromatin * metaphase chromosomes Subject RIV: EG - Zoology Impact factor: 1.211, year: 2013

  12. Diagnosis and interrelationships of fishes of the genus Channa Scopoli (Teleostei: Channidae of northeastern India

    Directory of Open Access Journals (Sweden)

    W. Vishwanath


    Full Text Available Diagnostic characters of nine species of the genus Channa Scopoli of northeastern India are given. Examination of morphological and osteological characters revealed that the fish under study comprised two phylectic groups: marulius and gachua. The Marulius group is characteristic by having a very prominent V-shaped sharp isthmus, cephalic sensory pores arranged in groups, absence of scales on the lower jaw, a sharp prominent spinelike hypurapophysis, more branchial toothplates than epibranchial, and an elongated urostyle. The Gachua group is characterized by a U-shaped isthmus, cephalic sensory pores evenly arranged in a single row, the presence of one or two large cycloid scales on each side of the lower jaw, absence of a sharp prominent spine-like hypurapophysis, absence or presence of one tooth plate in the epibranchial, and absence of an elongated urostyle. An elongated bone is present in between two last hemal spines of all species examined. A key to known species of Channa of northeastern India is also given

  13. Schistura maculosa, a new species of loach (Teleostei: Nemacheilidae) from Mizoram, northeastern India. (United States)

    Lalronunga, Samuel; Lalnuntluanga; Lalramliana


    Schistura maculosa, a new species of loach, is described from Tuingo and Pharsih Rivers, tributaries of Tuivai River (Barak drainage) in Mizoram, northeastern India. It is distinguished from other closely related Schistura species in having an axillary pelvic lobe; an incomplete lateral line; 20-30 narrow black bars on the body; 3-4 rows of black spots horizontally across the dorsal-fin; a slightly emarginate caudal-fin, with 5-7 rows of black spots more or less regularly arranged vertically on rays across the fin, and 8+8 branched caudal-fin rays.

  14. New insights on early evolution of spiny-rayed fishes (Teleostei: Acanthomorpha

    Directory of Open Access Journals (Sweden)

    Wei-Jen eChen


    Full Text Available The Acanthomorpha is the largest group of teleost fishes with about one third of extant vertebrate species. In the course of its evolution this lineage experienced several episodes of radiation, leading to a large number of descendant lineages differing profoundly in morphology, ecology, distribution and behavior. Although Acanthomorpha was recognized decades ago, we are only now beginning to decipher its large-scale, time-calibrated phylogeny, a prerequisite to test various evolutionary hypotheses explaining the tremendous diversity of this group. In this study, we provide new insights into the early evolution of the acanthomorphs and the euteleost allies based on the phylogenetic analysis of a newly developed dataset combining nine nuclear and mitochondrial gene markers. Our inferred tree is time-calibrated using 15 fossils, some of which have not been used before. While our phylogeny strongly supports a monophyletic Neoteleostei, Ctenosquamata (i.e., Acanthomorpha plus Myctophiformes, and Acanthopterygii, we find weak support (bootstrap value < 48% for the traditionally defined Acanthomorpha, as well as evidence of non-monophyly for the traditional Paracanthopterygii, Beryciformes, and Percomorpha. We corroborate the new Paracanthopterygii sensu Miya et al. (2005 including Polymixiiformes, Zeiformes, Gadiformes, Percopsiformes, and likely the enigmatic Stylephorus chordatus. Our timetree largely agrees with other recent studies based on nuclear loci in inferring an Early Cretaceous origin for the acanthomorphs followed by a Late Cretaceous/Early Paleogene radiation of major lineages. This is in contrast to mitogenomic studies mostly inferring Jurassic or even Triassic ages for the origin of the acanthomorphs. We compare our results to those of previous studies, and attempt to address some of the issues that may have led to incongruence between the fossil record and the molecular clock studies, as well as between the different molecular timetrees.

  15. Reanalysis and revision of the complete mitochondrial genome of Rachycentron canadum (Teleostei, Perciformes, Rachycentridae). (United States)

    Musika, Jidapa; Khongchatee, Adison; Phinchongsakuldit, Jaros


    The complete mitochondrial genome of cobia, Rachycentron canadum, was reanalyzed and revised. The genome is 18,008 bp in length, containing 13 protein-coding genes, 2 ribosomal RNA (rRNA) genes, 22 transfer RNA (tRNA) genes, and a control region or displacement loop (D-loop). The gene arrangement is identical to that observed in most vertebrates. Base composition on the heavy strand is 30.14% A, 25.22% C, 15.80% G and 28.84% T. The D-loop region exhibits an A + T rich pattern, containing short tandem repeats of TATATACATGG, TATATGCACAA and TATATGCACGG. The mitochondrial genome studied differs from the previously published genome in two segments; the control region to 12S and ND5 to tRNA(Glu). The 12S sequence also differs from those published in the databases. Phylogeny analyses revealed that the differences could be due to errors in sequence assembly and/or sample misidentification of the previous studies.

  16. Evolutionary history of asexual hybrid loaches (Cobitis: Teleostei) inferred from phylogenetic analysis of mitochondrial DNA variation

    Czech Academy of Sciences Publication Activity Database

    Janko, Karel; Kotlík, Petr; Ráb, Petr


    Roč. 16, - (2003), s. 1280-1287 ISSN 1010-061X R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/00/0668; GA ČR GA206/01/0989; GA AV ČR IBS5045111 Institutional research plan: CEZ:AV0Z5045916 Keywords : asexual vertebrates * Cobitis * maternal ancestry Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.010, year: 2003

  17. Molecular Evidence for Multiple Origins of the European Spined Loaches (Teleostei, Cobitidae)

    Czech Academy of Sciences Publication Activity Database

    Percides, A.; Bohlen, Jörg; Šlechtová, Vendula; Doadrio, I.


    Roč. 11, č. 1 (2016), e0144628-e0144628 E-ISSN 1932-6203 R&D Projects: GA ČR GA206/08/0637 Institutional support: RVO:67985904 Keywords : mitochondrial DNA sequences * cytochrome b gene * phylogenetic relationship Subject RIV: EG - Zoology Impact factor: 2.806, year: 2016

  18. Identification and chromosome mapping of repetitive elements in the Astyanax scabripinnis (Teleostei: Characidae) species complex. (United States)

    Barbosa, Patrícia; de Oliveira, Luiz Antonio; Pucci, Marcela Baer; Santos, Mateus Henrique; Moreira-Filho, Orlando; Vicari, Marcelo Ricardo; Nogaroto, Viviane; de Almeida, Mara Cristina; Artoni, Roberto Ferreira


    Most part of the eukaryotic genome is composed of repeated sequences or multiple copies of DNA, which were considered as "junk DNA", and may be associated to the heterochromatin. In this study, three populations of Astyanax aff. scabripinnis from Brazilian rivers of Guaratinguetá and Pindamonhangaba (São Paulo) and a population from Maringá (Paraná) were analyzed concerning the localization of the nucleolar organizer regions (Ag-NORs), the As51 satellite DNA, the 18S ribosomal DNA (rDNA), and the 5S rDNA. Repeated sequences were also isolated and identified by the Cot - 1 method, which indicated similarity (90%) with the LINE UnaL2 retrotransposon. The fluorescence in situ hybridization (FISH) showed the retrotransposon dispersed and more concentrated markers in centromeric and telomeric chromosomal regions. These sequences were co-localized and interspaced with 18S and 5S rDNA and As51, confirmed by fiber-FISH essay. The B chromosome found in these populations pointed to a conspicuous hybridization with LINE probe, which is also co-located in As51 sequences. The NORs were active at unique sites of a homologous pair in the three populations. There were no evidences that transposable elements and repetitive DNA had influence in the transcriptional regulation of ribosomal genes in our analyses.

  19. Lake Tanganyika--a 'melting pot' of ancient and young cichlid lineages (Teleostei: Cichlidae?

    Directory of Open Access Journals (Sweden)

    Juliane D Weiss

    Full Text Available A long history of research focused on the East Africa cichlid radiations (EAR revealed discrepancies between mtDNA and nuclear phylogenies, suggesting that interspecific hybridisation may have been significant during the radiation of these fishes. The approximately 250 cichlid species of Lake Tanganyika have their roots in a monophyletic African cichlid assemblage, but controversies remain about the precise phylogenetic origin and placement of different lineages and consequently about L. Tanganyika colonization scenarios. 3312 AFLP loci and the mitochondrial ND2 gene were genotyped for 91 species representing almost all major lacustrine and riverine haplotilapiine east African cichlid lineages with a focus on L. Tanganyika endemics. Explicitly testing for the possibility of ancient hybridisation events, a comprehensive phylogenetic network hypothesis is proposed for the origin and diversification of L. Tanganyika cichlids. Inference of discordant phylogenetic signal strongly suggests that the genomes of two endemic L. Tanganyika tribes, Eretmodini and Tropheini, are composed of an ancient mixture of riverine and lacustrine lineages. For the first time a strong monophyly signal of all non-haplochromine mouthbrooding species endemic to L. Tanganyika ("ancient mouthbrooders" was detected. Further, in the genomes of early diverging L. Tanganyika endemics Trematocarini, Bathybatini, Hemibatini and Boulengerochromis genetic components of other lineages belonging to the East African Radiation appear to be present. In combination with recent palaeo-geological results showing that tectonic activity in the L. Tanganyika region resulted in highly dynamic and heterogeneous landscape evolution over the Neogene and Pleistocene, the novel phylogenetic data render a single lacustrine basin as the geographical cradle of the endemic L. Tanganyika cichlid lineages unlikely. Instead a scenario of a pre-rift origin of several independent L. Tanganyika precursor lineages which diversified in ancient rivers and precursor lakes and then amalgamated in the extant L. Tanganyika basin is put forward as an alternative: the 'melting pot Tanganyika' hypothesis.

  20. Petroscirtes pylei, a new saber-toothed blenny from the Fiji Islands (Teleostei: Blenniidae) (United States)

    Smith-Vaniz, W.F.


    Petroscirtes pylei is described from three specimens, 20.3-40.9 mm SL, obtained from a deep-water reef off Suva, Viti Levu, Fiji Islands. It is distinguished from all other congeners by its color pattern, including the presence of two dark body stripes, the lower one broadly extending onto the anal fin, and the dorsal fin with a broad, dark basal stripe, superimposed by a conspicuous white spot centered on the 4th spine. Among Petroscirtes, only the new species and P. springeri typically have 12 dorsal-fin spines but they are not closely related. The holotype was collected in 104-110 m, the second deepest depth record for a species of Petroscirtes. Discovery of this new species, and an apparently second new deep-water Petroscrites (uncollected), at a different Fijian reef indicates that our knowledge of the biodiversity of this habitat and of the saber-toothed blennies is very incomplete. Copyright ?? 2005 Magnolia Press.

  1. Diversity of neotropical electric fish Microsternarchus (Teleostei: Gymnotiformes: Hypopomidae: an electrophysiological and geometric morphometric approach

    Directory of Open Access Journals (Sweden)

    Adília Nogueira


    Full Text Available The South American hypopomid electric fish tribe Microsternarchini includes three small species from the Upper Orinoco and Negro rivers. These are placed in monotypic genera: Microsternarchus, Racenisia and Procerusternarchus. Recent collections from tributaries in Negro, Solimões and Amazonas Basins have revealed new specimens of Microsternarchus with significant variations in external morphology and in Electric Organ Discharge parameters (EOD. In order to estimate the diversity within the genus a previous molecular study was done using DNA barcoding, that suggested the presence of multiple Microsternarchus's lineages with high levels of genetic divergence between them. Here we try to determine if the variation in morphology and EOD parameters in the new specimens meet the genetic divergence found. To test the presence of differences in shape among the different lineages we performed a geometric morphometric analysis, which included a relative warp and multivariate analysis on distances between 14 anatomical landmarks defined on the basis of external morphology and homologous among the lineages. The EOD variations were also explored using multivariate analyses of 20 electrophysiological parameters calculated through an algorithm developed in Matlab. The results show that there are significant differences in body shape and EOD in three lineages of Microsternarchus, and the features that contributed most were related to the shape of the head, the coefficient of variation of the signal and the duration and area of the different phases of the pulse. The discrimination of the three lineages confirms the occurrence of new species in the group that are currently being described.

  2. Molecular phylogeny and biogeography of the Neotropical cichlid fish tribe Cichlasomatini (Teleostei: Cichlidae: Cichlasomatinae). (United States)

    Musilová, Zuzana; Rícan, Oldrich; Janko, Karel; Novák, Jindrich


    We have conducted the first comprehensive molecular phylogeny of the tribe Cichlasomatini including all valid genera as well as important species of questionable generic status. To recover the relationships among cichlasomatine genera and to test their monophyly we analyzed sequences from two mitochondrial (16S rRNA, cytochrome b) and one nuclear marker (first intron of S7 ribosomal gene) totalling 2236 bp. Our data suggest that all genera except Aequidens are monophyletic, but we found important disagreements between the traditional morphological relationships and the phylogeny based on our molecular data. Our analyses support the following conclusions: (a) Aequidens sensu stricto is paraphyletic, including also Cichlasoma (CA clade); (b) Krobia is not closely related to Bujurquina and includes also the Guyanan Aequidens species A. potaroensis and probably A. paloemeuensis (KA clade). (c) Bujurquina and Tahuantinsuyoa are sister groups, closely related to an undescribed genus formed by the 'Aequidens'pulcher-'Aequidens'rivulatus groups (BTA clade). (d) Nannacara (plus Ivanacara) and Cleithracara are found as sister groups (NIC clade). Acaronia is most probably the sister group of the BTA clade, and Laetacara may be the sister group of this clade. Estimation of divergence times suggests that the divergence of Cichlasomatini started around 44Mya with the vicariance between coastal rivers of the Guyanas (KA and NIC clades) and remaining cis-andean South America, followed by evolution of the Acaronia-Laetacara-BTA clade in Western Amazon, and the CA clade in the Eastern Amazon. Vicariant divergence has played importantly in evolution of cichlasomatine genera, with dispersal limited to later range extension of species within genera.

  3. Ecology and potential for fishery of the small barbs (Cyprinidae, Teleostei) of Lake Tana, Ethiopia


    Dejen, E.


    Lake Tana is by far the largest lake of Ethiopia and source of the Blue Nile. By feeding on zooplankton, small barbs (< 10 cm) occupy a central position in Lake Tana's ecosystem. Catching them could release pressure on the overexploited, unique species flock of large barbs (up to 100 cm). Aiming at small barbs, we need first to assess its possible impact on the food web and productivity. To advise on sustainable management, the biology and ecology of the small Barbus species in Lake Tana w...

  4. Ecology and potential for fishery of the small barbs (Cyprinidae, Teleostei) of Lake Tana, Ethiopia

    NARCIS (Netherlands)

    Dejen, E.


    Lake Tana is by far the largest lake of Ethiopia and source of the Blue Nile. By feeding on zooplankton, small barbs (< 10 cm) occupy a central position in Lake Tana's ecosystem. Catching them could release pressure on the overexploited, unique species flock of large barbs (up to 100 cm).

  5. Molecular Phylogeny and Zoogeography of the Capoeta damascina Species Complex (Pisces: Teleostei: Cyprinidae.

    Directory of Open Access Journals (Sweden)

    Nisreen Alwan

    Full Text Available Capoeta damascina was earlier considered by many authors as one of the most common freshwater fish species found throughout the Levant, Mesopotamia, Turkey, and Iran. However, owing to a high variation in morphological characters among and within its various populations, 17 nominal species were described, several of which were regarded as valid by subsequent revising authors. Capoeta damascina proved to be a complex of closely related species, which had been poorly studied. The current study aims at defining C. damascina and the C. damascina species complex. It investigates phylogenetic relationships among the various members of the C. damascina complex, based on mitochondrial and nuclear DNA sequences. Phylogenetic relationships were projected against paleogeographical events to interpret the geographic distribution of the taxa under consideration in relation to the area's geological history. Samples were obtained from throughout the geographic range and were subjected to genetic analyses, using two molecular markers targeting the mitochondrial cytochrome oxidase I (n = 103 and the two adjacent divergence regions (D1-D2 of the nuclear 28S rRNA genes (n = 65. Six closely related species were recognized within the C. damascina complex, constituting two main lineages: A western lineage represented by C. caelestis, C. damascina, and C. umbla and an eastern lineage represented by C. buhsei, C. coadi, and C. saadii. The results indicate that speciation of these taxa is rather a recent event. Dispersal occurred during the Pleistocene, resulting in present-day distribution patterns. A coherent picture of the phylogenetic relationships and evolutionary history of the C. damascina species complex is drawn, explaining the current patterns of distribution as a result of paleogeographic events and ecological adaptations.

  6. Molecular Phylogeny and Zoogeography of the Capoeta damascina Species Complex (Pisces: Teleostei: Cyprinidae). (United States)

    Alwan, Nisreen; Esmaeili, Hamid-Reza; Krupp, Friedhelm


    Capoeta damascina was earlier considered by many authors as one of the most common freshwater fish species found throughout the Levant, Mesopotamia, Turkey, and Iran. However, owing to a high variation in morphological characters among and within its various populations, 17 nominal species were described, several of which were regarded as valid by subsequent revising authors. Capoeta damascina proved to be a complex of closely related species, which had been poorly studied. The current study aims at defining C. damascina and the C. damascina species complex. It investigates phylogenetic relationships among the various members of the C. damascina complex, based on mitochondrial and nuclear DNA sequences. Phylogenetic relationships were projected against paleogeographical events to interpret the geographic distribution of the taxa under consideration in relation to the area's geological history. Samples were obtained from throughout the geographic range and were subjected to genetic analyses, using two molecular markers targeting the mitochondrial cytochrome oxidase I (n = 103) and the two adjacent divergence regions (D1-D2) of the nuclear 28S rRNA genes (n = 65). Six closely related species were recognized within the C. damascina complex, constituting two main lineages: A western lineage represented by C. caelestis, C. damascina, and C. umbla and an eastern lineage represented by C. buhsei, C. coadi, and C. saadii. The results indicate that speciation of these taxa is rather a recent event. Dispersal occurred during the Pleistocene, resulting in present-day distribution patterns. A coherent picture of the phylogenetic relationships and evolutionary history of the C. damascina species complex is drawn, explaining the current patterns of distribution as a result of paleogeographic events and ecological adaptations.

  7. Reproductive biology of weakly electric fish Eigenmannia trilineata López and Castello, 1966 (Teleostei, Sternopygidae

    Directory of Open Access Journals (Sweden)

    Júlia Giora


    Full Text Available This study described the reproductive biology of a population of the weakly electric fish Eigenmannia trilineata from southern Brazil, providing the information on the estimation of reproductive period, fecundity, spawning type, first maturation size, and analysis of gonadal morphology and histology of the species, relating these data to alimentary and abiotic characters. The species showed a relatively long reproductive period, a relative fecundity of 0.27 oocytes per mg of total weight and a parcelled spawning type. First maturation size estimated for the females was 80.5 mm and for the males 63.5 mm of total length. Sex ratio did not differ from 1:1 under a X²test (α= 0.01 during all the sampled months. Sexual dimorphism was related to total length, and males had larger total length than females. The abiotic factors photoperiod and water conductivity presented significant correlations with female GSI, while male GSI presented a significant correlation only with photoperiod.Este trabalho descreve a biologia reprodutiva de uma população do peixe elétrico Eigenmannia trilineata do Sul do Brasil. São apresentadas informações a respeito do período reprodutivo, fecundidade, tipo de desova, tamanho de primeira maturação, morfologia e histologia das gônadas da espécie, relacionando estes dados a caracteres alimentares e abióticos. A espécie apresentou período reprodutivo relativamente longo, com fecundidade relativa de 0,27 ovócito por miligrama do peso da fêmea e desova do tipo parcelada. O tamanho de primeira maturação gonadal estimado para fêmeas foi 80,5 mm e para machos, 63,5 mm de comprimento total. A proporção sexual, testada pelo teste X² (Α= 0.01, foi de 1:1 durante todos os meses amostrados; dimorfismo sexual relacionado ao comprimento total foi detectado, possuindo os machos um maior comprimento total. Dos fatores abióticos testados, fotoperíodo e condutividade da água mostraram correlação significativa com o IGS das fêmeas, enquanto somente fotoperíodo apresentou-se relacionado ao IGS dos machos.

  8. Devario in Bangladesh: Species diversity, sibling species, and introgression within danionin cyprinids (Teleostei: Cyprinidae: Danioninae) (United States)

    Rahman, Md. Mizanur; Norén, Michael; Mollah, Abdur Rob


    Four species of Devario are recorded from Bangladesh: D. aequipinnatus, D. anomalus, D. coxi, new species, and D. devario. Devario aequipinnatus has a wide distribution in northern India and Bangladesh. Devario coxi, from southeastern Bangladesh near Cox’s Bazar, differs from D. aequipinnatus in mtDNA (COI, p-distance 1.8%), colouration, proportional measurements, and meristics. The minor morphological differences and low frequency of overlapping meristics suggest relatively recent separation of D. coxi from other D. aequipinnatus. Devario anomalus occurs only in southeastern Bangladesh and is here reported from localities in addition to the type locality. It differs from the similar D. xyrops in adjacent Myanmar by slender body shape and by 2.3% p-distance in the COI gene. Specimens of D. anomalus from the Sangu River were found to have the mitochondrial genome of D. aequipinnatus from Bangladesh, but agree with other D. anomalus in the nuclear RAG1 gene. Devario devario has a wide distribution on the Indian Peninsula and border regions; in Bangladesh it is restricted in distribution to the Ganga, Brahmaputra, and Meghna drainages. Reports of D. assamensis and D. malabaricus from Bangladesh are misidentifications. Perilampus ostreographus M’Clelland, 1839, is tentatively synonymized with D. aequipinnatus. Phylogenetic analysis of 14 species of striped devarios based on the COI gene results in a polytomy with four unresolved clades. Devario deruptotalea from the Chindwin basin is the sister group of D. aequipinnatus+D. coxi. Devario devario is the sistergroup of D. xyrops+D. anomalus. PMID:29166410

  9. Muscular system in the pacific bluefin tuna Thunnus orientalis (Teleostei: Scombridae). (United States)

    Nakae, Masanori; Sasaki, Kunio; Shinohara, Gento; Okada, Tokihiko; Matsuura, Keiichi


    The muscular system in the Pacific bluefin tuna Thunnus orientalis is studied in detail. For the first time, a complete description of the muscular anatomy of a thunnid is provided here. Eighty-two elements including subdivisions of components of the muscular system are identified. This is less than found in a basal perciform and two other investigated scombrid species, owing mainly to the absence or fusion of pectoral, pelvic and caudal fin muscles. The absence of elements of the basal perciform pattern was most prominent in the caudal fin, which includes only the flexor dorsalis, flexor ventralis, hypochordal longitudinalis, and interradialis. In the caudal fin, the medial fan-shaped ray was identified as the first dorsal ray, judging from myological and neuroanatomical characters. The highly developed gill filament muscles in Thunnus orientalis and sheet-like rectus communis control gill ventilation. Long body muscle tendons reduce the metabolic energy needed during rapid and continuous swimming. These characters are interpreted as adaptations in the context of the oceanic life style of the species. Copyright © 2013 Wiley Periodicals, Inc.

  10. A fourth teleost lineage possessing extra-oral teeth: the genus atherion (teleostei; atheriniformes). (United States)

    Sire, J Y; Allizard, F


    In the course of an evolutionary and developmental study on the dermal skeleton, our attention was drawn to the existence of denticles located outside the oral cavity in the atheriniform species Atherion elymus. These denticles, attached to the surface of most dermal bones of the head, are especially numerous on the snout, chin and the undersides of the lower region of the head, where they are aligned forming a crenulated keel. Using light, scanning and transmission electron microscopy, we clearly demonstrate the dental (vs bony) nature of these denticles. They are small, conical elements mostly oriented backwards and are not ankylosed to the bone support. Ligaments originating from the internal and external surface of the base of the dentine cone link the denticles to the attachment bone, which itself merges with the bone support below. The denticles have the same form and structure as teeth, from which they differ only in having a larger base and a pulp cavity that is nearly completely filled with secondary dentine by centripetal deposition. This suggests that the denticles have a longer functional history than teeth. Atherion is now the fourth teleost lineage found to develop such denticles on the head.

  11. Rivulus berovidesi, a new killifish species (Teleostei: Rivulidae) from western Cuba. (United States)

    Silva, Rodet Rodriguez


    Rivulus berovidesi, a new killifish species, is described from a small stream in Sierra de Cajalbana, northwestern Cuba. It is readily distinguished from Rivulus cylindraceus Poey by the combination of an exclusive color pattern and meristic characters such as a d-type frontal scalation pattern (versus e-type pattern in Rivulus cylindraceus). The current diagnosis of Rivulus berovidesi based on chromatic, morphological and meristic characters is consistent with a recent molecular analysis of this genus in Cuba.

  12. Leptobotia micra, a new species of loach (Teleostei: Botiidae) from Guilin, southern China

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula


    Roč. 4250, č. 1 (2017), s. 90-100 ISSN 1175-5326 R&D Projects: GA ČR GA13-37277S Institutional support: RVO:67985904 Keywords : Cypriniformes * Cobitoidea * taxonomy Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.972, year: 2016

  13. The "pseudo-craniovertebral articulation" in the deep-sea fish Stomias boa (Teleostei: Stomiidae). (United States)

    Schnell, Nalani K; Bernstein, Peter; Maier, Wolfgang


    Many predatory deep-sea fishes show highly specialized modifications of their feeding apparatus, e.g., elongate jaws studded with long daggerlike teeth, often combined with a very distensible stomach, to be capable of swallowing relatively large prey. These striking features can be observed in members of the marine teleost family Stomiidae. The present study gives a detailed morphological description of the mesopelagic predatory fish, Stomias boa, based on a combined approach of clearing and double staining, serial sections and dissection. In this genus, large pads made of dense connective tissue extend from the first enlarged neural arch to the ventral side of the chordal sheath, embracing the prominent exoccipitals and thus constituting a kind of double ball- and socket joint for the head. The notochordal occipito-vertebral gap is enlarged, probably not by loss of vertebral centra as is proposed for other genera of the stomiid family, e.g., in Astronesthes or Photostomias. We conclude that this "pseudo-craniovertebral articulation" serves as a functional substitute for the absent vertebrae and strengthens the flexible, anterior part of the vertebral column during extreme dorsal expansion of the gape during prey capture and swallowing. (c) 2007 Wiley-Liss, Inc.

  14. Bagrichthys vaillantii (Popta, 1906), a valid species of bagrid catfish from eastern Borneo (Teleostei: Siluriformes)

    NARCIS (Netherlands)

    Ng, H.H.


    Bagrichthys vaillantii (Popta, 1906), a species of bagrid catfish previously considered a junior synonym of B. macracanthus Bleeker, 1854, is found to be a valid species distinct from the latter. It can be differentiated from B. macracanthus in having a shorter dorsal spine, smaller eye and steeper

  15. Spontaneous behavior of basal Copionodontinae cave catfishes from Brazil (Teleostei, Siluriformes, Trichomycteridae

    Directory of Open Access Journals (Sweden)

    Bianca Rantin


    Full Text Available Cave animals are particularly interesting due to their behavioral specializations, resultant from evolution in isolation. We present data from a spontaneous behavior study (spatial distribution and preference for microhabitats of two troglobitic catfish from Brazil: Glaphyropoma spinosum and a new species of Copionodon. We compared the data with those obtained of a sympatric epigean species, Copionodon pecten. These Trichomycteridae species belong to a basal and apparently monophyletic subfamily – Copionodontinae, endemic to Chapada Diamantina, central Bahia state, eastern Brazil. We observed the fishes in natural and laboratory conditions through ad libitum and focal animal methods. Each spatial behavioral category (hidden, bottom, midwater, surface and wall swimming and stationary in the bottom was timed individually, with a sample of 12 specimens per species. Unlike most troglobitic fishes, cave copionodontines tested herein did not extend exploratory behavior to midwater, with benthonic and thigmotactic-related exploratory behavior. This behavior is possibly related to its feeding behavior specializations, strong territorialism and photophobic behavior. The epigean Copionodon species is also benthonic. The spatial behavior of the cave Copionodontinae could be interpreted as a retained and plesiomorphic character-state in relation to other trichomycterid catfishes.

  16. A new species of Saturnius Manter, 1969 (Digenea: Hemiuridae) from Mediterranean mullet (Teleostei: Mugilidae)

    Czech Academy of Sciences Publication Activity Database

    Marzoug, D.; Rima, M.; Boutiba, Z.; Georgieva, Simona; Kostadinova, Aneta; Pérez-del-Olmo, A.


    Roč. 87, č. 2 (2014), s. 127-134 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Digenea * phylogeny * Platyhelminthes * Trematoda * inference * evolution Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.336, year: 2014

  17. A new cryptic species of Aponurus Looss, 1907 (Digenea: Lecithasteridae) from Mediterranean goatfish (Teleostei: Mullidae)

    Czech Academy of Sciences Publication Activity Database

    Carreras-Aubets, M.; Repulles-Albelda, A.; Kostadinova, Aneta; Carrasson, M.


    Roč. 79, č. 2 (2011), 145-159 ISSN 0165-5752 R&D Projects: GA MŠk LC522; GA ČR GAP505/10/1562 Institutional research plan: CEZ:AV0Z60220518 Keywords : N. SP DIGENEA * ALLOMETRIC GROWTH * MARINE FISHES * MULLUS-SURMULETUS * TREMATODES * MONORCHIIDAE * HEMIUROIDEA * BELIZE * ISRAEL Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.250, year: 2011

  18. Functional analysis of a specialized prey processing behavior: winnowing by surfperches (Teleostei: Embiotocidae). (United States)

    Drucker, E G; Jensen, J S


    Several surfperches (Embiotocidae), including the black surfperch, Embiotoca jacksoni, exhibit a specialized prey handling behavior known as winnowing, in which ingested food and non-nutritive debris are separated within the oropharyngeal cavity. Prey items are swallowed, and unpalatable material is ejected from the mouth. Winnowing is believed to play an important role in the partitioning of food resources among sympatric embiotocids. We present a mechanistic model for this separative prey processing based on high-speed video analysis, cineradiography, electromyography, and buccal and opercular cavity pressure transducer recording. Winnowing by embiotocids is characterized by premaxillary protrusions repeated cyclically with reduced oral gape. Protrusion is accompanied by depression of the hyoid apparatus and adduction of the opercula. Alternating expansion and contraction of the buccal and opercular cavities generate regular pressure waveforms that indicate bidirectional water flow during processing. Separation of food from debris by Embiotoca jacksoni occurs in three phases. The prey-debris bolus is transported anteriorly and posteriorly within the oropharyngeal cavity and is then sheared by the pharyngeal jaws. Mechanical processing is complemented by the rinsing action of water currents during hydraulic prey transport. The feeding apparatus of Embiotoca jacksoni is functionally versatile, although not obviously specialized relative to that of nonwinnowing surfperches. Protrusion of the premaxillae and depression of the hyoid apparatus are critical to both prey capture and subsequent prey processing. The pharyngeal jaws exhibit kinematic patterns during separation of food from debris distinct from those observed during mastication of uncontaminated prey. This behavioral flexibility facilitates resource partitioning and the coexistence of E. jacksoni in sympatric embiotocid assemblages.

  19. Ultrastructure (SEM of the gills of Prochilodus Scrofa Steindachner (Pisces, Teleostei

    Directory of Open Access Journals (Sweden)

    Daura Regina Eiras-Stofella


    Full Text Available Gills arches of the freshwater fish Prochilodus scrofa Steindachner, 1881 (Lt= 8.0-12.4cm were removed to be analyzed in a scanning electron microscope. The morphology of the superficial structures of the gill filaments and pharyngeal region of the gills arches was discussed and related to their functional aspects. A great quantity of mucous secretory cells and of microridges, along with the pavement cell surface of the primary lamellae and branchial pharyngeal region, indicate the existence of a protection strategy of the respiratory lamellae. The chloride cells are abundant, specially on the distal portion of the primary lamellae, and bring out the osmo regulatory capacity of this species. This fish seems not to be a filtering one according to: its short and simple gill rakers; presence of several taste buds turned towards the mouth opening; evidence of spines on the external side of the arches and an abundant secretion of mucous in the pharyngeal region. This species probably selects the food to be swallowed through its chemical receptors and retains it with the help of spines and mucous secretion this way protecting the gills filaments against the rubbing of particles over them.

  20. Diet of Astyanax species (Teleostei, Characidae in an Atlantic Forest River in Southern Brazil

    Directory of Open Access Journals (Sweden)

    Fábio Silveira Vilella


    Full Text Available Feeding habits of six species of Astyanax from river Maquiné are described. Fishes were sampled bi-monthly from November/95 to September/96 in two zones of the river. Items were identified, counted and had their abundance estimated according to a semi-quantitative scale. Frequency of occurrence, alimentary importance index (IFI values and a similarity analysis of diets for each species-river zone sample were examined. All the species were considered typically omnivorous, with insects and vegetal matter being the most important items in their diet. These species could act as seed dispersers, particularly for macrophytes. Intra-specific spatial differences were not observed in comparisons of samples from two diferent regions of the river, except for A. fasciatus. The presence of Podostemaceae macrophytes in the mid-course of the river seemed to be important both as an autochthonous food resource and as habitat for several organisms preyed by the Astyanax species.Seis espécies do gênero Astyanax, presentes no rio Maquiné, RS, foram estudadas quanto aos seus hábitos alimentares. Os exemplares foram amostrados bimensalmente de novembro de 1995 a setembro de 1996 nas zonas ritral e potamal do rio. Os itens alimentares foram identificados e quantificados de acordo com uma escala semi-quantitativa de abundância, utilizando-se para análise a frequência de ocorrência e um índice de importância alimentar para cada espécie e zona do rio. Análises multivariadas de agrupamento e ordenação foram utilizadas para comparar as dietas intra e interespecíficas. Todas as espécies foram consideradas onivoras, sendo que os itens mais importantes foram os insetos e restos de vegetais superiores. Sugere-se que as espécies estudadas possam atuar como dispersoras de sementes, particularmente para macrófitas. Diferenças espaciais intraespecíficas não foram encontradas, exceto para A. fasciatus. A presença de Podostemaceae no curso médio do rio parece ser uma fonte importante de alimento para as espécies, além de servir de refúgio para diversos organismos que são predados por Astyanax sp.

  1. Diversity and distribution of fossil codlets (Teleostei, Gadiformes, Bregmacerotidae): review and commentary

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Brzobohatý, R.; Gregorová, R.


    Roč. 96, č. 1 (2016), s. 13-39 ISSN 1867-1594 R&D Projects: GA ČR GP13-19250P Institutional support: RVO:67985831 Keywords : Bregmacerotidae * codlets * fish * Gadiformes * Neogene * osteology * Paleogene Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.278, year: 2016

  2. Juvenile Thalassoma amblycephalum Bleeker (Labridae, Teleostei) dwelling among the tentacles of sea anemones

    DEFF Research Database (Denmark)

    Arvedlund, Michael; Iwao, Kenji; Brolund, Thea Marie


    each) of the juvenile wrasse Thalassoma amblycephalum dwelling among the tentacles of the two sea anemones Entacmaea quadricolor (clonal type), and Heteractis magnifica at a coral reef in southern Japan during 16 months in daylight hours. There are only two past records of this facultative association......, one from east Africa and one from Indonesia. The wrasse remained close to and was occasionally in physical contact with the host when foraging amongst the tentacles. When frightened, they took shelter among corals, away from the host anemone. The wrasse co-existed with the anemonefishes Amphiprion...

  3. A survey of nematodes of the genus Cucullanus Müller, 1777 (Nematoda, Seuratoidea) parasitic in marine fishes off Brazil, including description of three new species

    Czech Academy of Sciences Publication Activity Database

    Vieira, F.M.; Pereira, F.B.; Pantoja, C.; Soares, I.A.; Pereira, A.N.; Timi, J.T.; Scholz, Tomáš; Luque, J.L.


    Roč. 4039, č. 2 (2015), s. 289-311 ISSN 1175-5326 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : new species * Cucullanidae * parasites * Lophiiformes * Perciformes * Gadiformes * Anguilliformes * Ophidiiformes Subject RIV: EG - Zoology Impact factor: 0.994, year: 2015

  4. Aspectos biológicos de Diapterus rhombeus (Cuvier (Teleostei, Gerreidae na Baía de Guaratuba, Paraná, Brasil Biological aspects of Diapterus rhombeus (Cuvier (Teleostei, Gerreidae at Guaratuba Bay, Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Paulo de Tarso da Cunha Chaves


    Full Text Available Diapterus rhombeus (Cuvier, 1829 is one of the most common Gerreidae species in the estuarine region at the Guaratuba Bay, Southern Brazil. Based on studies developed between July, 1993 and January, 1997, it was observed that its presence in the mangrove area is not regular: the smallest individuais are more abundam during late summer and in autumn, and the largest ones during spring and early summer. Its diet comprises plant material and invertebrates, specially polychaets. The morphological aspects of the gonads, the monthly changes on the Condition Factor, and lhe monthly distribution of the individual size groups, suggest that this population spawns during the spring, out the estuarine region. The smaller individuais use the mangrove area of Guaratuba Bay to a growth phase, and the adulls to make somatic reserves to the spawning period.

  5. Atividade reprodutiva de peixes (Teleostei e o defeso da pesca de arrasto no litoral norte de Santa Catarina, Brasil Reproductive activity of fish (Teleostei and closed season to shrimp trawling off ther northern coast of Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Leda M. de Souza


    Full Text Available Desembarques de arrasto visando à pesca do camarão sete-barbas, Xiphopenaeus kroyeri, foram acompanhados de 2005 a 2007 no município de São Francisco do Sul, Santa Catarina. Setenta e seis espécies de teleósteos foram registradas como captura incidental e seus indivíduos foram avaliados quanto ao estádio de maturação e Índice de Atividade Reprodutiva. Constatou-se que indivíduos de metade das espécies são capturados com gônadas maduras, em estações que variaram conforme a espécie. Em Isopisthus parvipinnis a atividade enquadrou-se na categoria "muito intensa" na primavera de 2005 e no verão de 2007; em Menticirrhus americanus, Stellifer sp., Pomadasys corvinaeformis, Stellifer brasiliensis, Syacium papillosum, Larimus breviceps, Diapterus rhombeus, Symphurus tessellatus, Chirocentrodon bleekerianus, Pellona harroweri, Anchoa tricolor e Selene setapinnis apenas em uma estação, dependendo da espécie. O verão de 2007, seguido da primavera de 2005, foram as estações em que o arrasto incidiu sobre maior número de espécies em atividade reprodutiva "intensa" ou "muito intensa". No verão de 2007 o arrasto camaroeiro incidiu sobre um conjunto de espécies em atividade reprodutiva maior que na mesma estação em 2006. Atribui-se esse fato à proibição legal do arrasto de camarão no trimestre de outubro-dezembro de 2006, favorecendo a atividade reprodutiva das espécies na estação subseqüente. Recomenda-se que a gestão da pesca camaroeira na região mantenha o defeso de arrasto na primavera, assim beneficiando não apenas as espécies de peixes que desovam nesta estação, mas também aquelas que se preparam para a desova no verão.Shrimp trawling was monitored in southern Brazil in order to study the reproductive status of teleosts occurring as by-catch. From 2005 to 2007 seventy-six fish species were found in this kind of fisheries. Gonad stages were evaluated and the Reproductive Activity Index was calculated. Mature individuals were 50% of the total caught as by-catch. Breeding activity in Isopisthus parvipinnis was "very high" in spring 2005 and summer 2007, and in a particular season (depending on the species in Menticirrhus americanus, Stellifer sp., Pomadasys corvinaeformis, Stellifer brasiliensis, Syacium papillosum, Larimus breviceps, Diapterus rhombeus, Symphurus tessellatus, Chirocentrodon bleekerianus, Pellona harroweri, Anchoa tricolor, and Selene setapinnis. In the summer of 2007, followed by the spring of 2005, trawling caught more species in "high" or "very high" breeding activity. In the summer of 2007 a larger number of species was in reproductive activity than the same season of 2006, due to a closed season in October-December 2006. Aiming to improve the fish breeding activity in this region, it is recommended to close this area for shrimp trawling during the spring. This measure could be positive for both species that spawn in spring and those preparing to spawn in the summer.

  6. Aspectos biológicos de Diapterus rhombeus (Cuvier) (Teleostei, Gerreidae) na Baía de Guaratuba, Paraná, Brasil Biological aspects of Diapterus rhombeus (Cuvier) (Teleostei, Gerreidae) at Guaratuba Bay, Paraná, Brazil


    Paulo de Tarso da Cunha Chaves; Gislaine Otto


    Diapterus rhombeus (Cuvier, 1829) is one of the most common Gerreidae species in the estuarine region at the Guaratuba Bay, Southern Brazil. Based on studies developed between July, 1993 and January, 1997, it was observed that its presence in the mangrove area is not regular: the smallest individuais are more abundam during late summer and in autumn, and the largest ones during spring and early summer. Its diet comprises plant material and invertebrates, specially polychaets. The morphologica...

  7. Ecomorphology and food habits of teleost fishes Trachinotus carolinus (Teleostei: Carangidae and Menticirrhus littoralis (Teleostei: Sciaenidae, inhabiting the surf zone off Niterói, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Luana Prestrelo Palmeira


    Full Text Available The ecomorphology and food habits of juvenile Trachinotus carolinus and Menticirrhus littoralis caught in the surf zone of sandy beaches in Niterói, RJ, were investigated between July 2006 and May 2007. These fish species differ morphologically, but present similarities in their diet composition suggest some slight overlapping in their diet. The importance of food items was assessed using Kawakami and Vazzoler's feeding index. Morphometric variables were recorded to correlate with the diet composition of the different size classes for each species. A total of 210 fishes (Trachinotus carolinus - 122, Menticirrhus littoralis - 88, ranging between 24.2 mm and 112 mm total length, were analyzed, but the stomachs of only 84.8% of them contained food. Trachinotus carolinus presented mysids, Polychaetes and Emerita spp. as the predominant items in their diet. Formicidae and Isopoda were the most important items for class I individuals, whereas mysids and Emerita spp. were important for classes II and III. Class I individuals also showed smaller sized prey (amphipods and isopods and clupeid fish larvae in their diet. Emerita spp. dominated the food items of Menticirrhus littoralis regardless of the size class. Polychaetes, the second most important item was better represented in class sizes II and III. The main morphometric variable correlated with such differences included mouth position and diameter of the eye.A ecomorfologia e os hábitos alimentares de juvenis de Trachinotus carolinus e Menticirrhus littoralis capturados na zona de arrebentação de praias arenosas em Niterói, RJ, foram investigados entre julho de 2006 e Maio de 2007. Ambas as espécies diferem morfologicamente, mas apresentam semelhanças em sua dieta, sugerindo uma possível sobreposição alimentar. A importância dos itens alimentares foi avaliada utilizando o índice alimentar de Kawakami e Vazzoler. Variáveis morfométricas foram correlacionadas à dieta observada para diferentes classes de tamanho, para cada espécie. Um total de 210 peixes (Trachinotus carolinus - 122, Menticirrhus littoralis - 88, variando entre 24.2 mm e 112 mm de comprimento total, foram analisados, mas apenas 84.8% continham alimento. Trachinotus carolinus apresentou mysidáceos, poliquetas e Emerita spp. como os itens predominantes na dieta. Formicidae e Isopoda foram os itens mais importantes para a classe I de tamanho dos indivíduos, enquanto que mysidáceos e Emerita spp. foram importantes para as classes II e III. Indivíduos da classe I também apresentaram itens de menor tamanho (anfípodos e isópodos bem como larvas de peixes clupeídeos na dieta. Emerita spp. dominou a alimentação de Menticirrhus littoralis, independentemente da classe de tamanho. Poliquetas, o segundo item mais importante, foi mais bem representado na classe II e III de tamanho dos indivíduos. As principais variáveis morfométricas correlacionadas com essas diferenças incluíram a posição da boca e o diâmetro do olho.

  8. Reprodução de Stellifer rastrifer (Jordan (Teleostei, Sciaenidae na Baía de Guaratuba, Paraná, Brasil Reproduction of Stellifer rastrifer (Jordan (Teleostei, Sciaenidae at the Guaratuba Bay, Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Paulo de Tarso da Cunha Chaves


    Full Text Available A total of 1312 individuais of S. rastrifer were sampled from March 1994 to September 1996 at the Guaratuba Bay, Southern Brazilian coast. This species is a permanently inhabitant of the mangrove area throughout the year. The weight/length relationship of the species in the region is "In TW =-12,35 + 3,22 In TL", and the individuais may reach 172mm of total length. The analyses of gonadal morphology and gonadossomatic index indicate that S. rastrifer is a multiple spawner species, that reproduces at the mangrove area during a long period of the year. The reproductive activity is more intense during the winter and mainly the spring, when the value of Condition Factor declines and empty folheies are found in the ovaries.

  9. Gonadal structure and gametogenesis of Loricaria lentiginosa Isbrücker (Pisces, Teleostei, Siluriformes Estrutura gonadal e gametogênese de Loricaria lentiginosa Isbrücker (Pisces, Teleostei, Siluriformes

    Directory of Open Access Journals (Sweden)

    Rodrigo J. Guimarães-Cruz


    Full Text Available The gonadal structure and gametogenesis of Loricaria lentiginosa Isbrücker, 1979 were studied through anatomical and histological techniques. Forty two males and ten females in maturation/mature stage were captured in the reservoir of Porto Colombia, Paraná river basin, Minas Gerais, using gill nets, from November 2001 to October 2002 (tri-monthly captures. Examination of the testes revealed that they were paired, elongated and not fringed organs. Histologically, the testes presented three distinct regions: cranial espermatogenic; transistion espermatogenic and secretory; and caudal exclusively secretory. Standard histochemical techniques detected neutral glycoproteins from the secretion of the tubules of the caudal region. Espermatogenesis occurred in cysts throughout the whole extension of the wall of the seminiferous tubules, which anastomosis themselves and liberated the spermatozoa into the lumen of the espermatic ducts. The ovaries were paired, saculiformes and, histologically, they presented ovigerous lamellae that contained the cells of ovogenic ancestry. The oocytes were classified into four stages, based on their cytological characteristics and the cell layers that surrounded them. Post-ovulatory follicles and vitelogenic oocytes in the follicular atresia process also were observed.A estrutura gonadal e a gametogênese de Loricaria lentiginosa Isbrücker, 1979 foram estudadas através de técnicas anatômicas e histológicas. Capturaram-se, trimestralmente, no reservatório de Porto Colômbia, bacia do rio Paraná, Minas Gerais, quarenta e dois machos e dez fêmeas nos estádios em maturação/maduro, utilizando-se redes de emalhar, no período de novembro de 2001 a outubro de 2002. Os testículos são órgãos pares, alongados e não franjados. Histologicamente, os testículos apresentam três regiões distintas: cranial espermatogênica, transição espermatogênica e secretora e caudal exclusivamente secretora. Na secreção dos túbulos da região caudal detectaram-se glicoproteínas neutras. A espermatogênese ocorre em cistos em toda a extensão da parede dos túbulos seminíferos, os quais anastomosam-se e liberam os espermatozóides no lume dos ductos espermáticos. Os ovários são órgãos pares, saculiformes e, histologicamente, apresentam lamelas ovulígeras que contém as células da linhagem ovogênica. Os ovócitos foram classificados em quatro estádios, baseando-se em suas características citológicas e nas camadas que os circundam. Folículos pós-ovulatórios e ovócitos vitelogênicos em processo de atresia folicular foram também observados.

  10. Dieta de Hatcheria macraei (Girard, 1855 (Teleostei, Siluriformes, Trichomycteridae en el río Chubut, Argentina Diet of Hatcheria macraei (Girard, 1855 (Teleostei, Siluriforms, Trichomycteridae in the Chubut River, Argentina

    Directory of Open Access Journals (Sweden)

    Ricardo A Ferriz


    Full Text Available Se realizó un estudio sobre la dieta de Hatcheria macraei capturados en el río Chubut, Bajada del Cóndor (43°31'21,12''S, 69°06'22,1''W, en abril 2000. El régimen alimentario de este tricomictérido correspondió al tipo carnívoro bentófago y las presas dominantes, tanto en juveniles como en adultos, fueron larvas de chironómidos, larvas de tricópteros y cladóceros. Los ejemplares adultos presentaron una mayor diversidad en la dieta que los juveniles.A study of the diet of Hatcheria macraei caught in Chubut River, Bajada del Cóndor (43°31'21,12''S; 69°06'22,1''W was performed in April 2000. The feeding regime of this Trichomycteridae agreed with the carnivorous bentophagous type, and the dominant preys of both adults and juveniles were chironomid larvae, tricopter larvae, and cladocerans. The adult specimens exhibited a more diverse diet than the juveniles.

  11. Juvenile growth of white mullet Mugil curema (Teleostei: Mugilidae in a coastal lagoon southwest of the Gulf of California Crecimiento de juveniles de la lisa blanca Mugil curema (Teleostei: Mugilidae en una laguna costera del suroeste del golfo de California

    Directory of Open Access Journals (Sweden)

    Casimiro Quiñonez-Velázquez


    Full Text Available Otolith micro structure was used to determine the age and evaluate the growth of juvenile white mullet (Mugil curema during their residence in the coastal lagoon El Conchalito, B.C.S., Mexico, from May 1997 to May 1998. Juveniles were sampled monthly during the full and ebbing phases of the maximum high tide. The juveniles studied were between 16 and 42 mm standard length (SL and from 22 to 109 days old. The Gompertz growth model appropriately described the relationship between age and SL (r = 0.94. The average growth rate was 0.29 mm d-1 between 20 and 110 days of age, which was lower than the growth rate of the juveniles prior to entering the lagoon. This suggests that growth is faster along the coast than in the lagoon. The strategy of entering protected areas allows individuals to reach a size that maximizes escape from predators and, therefore, the probability of survival when reentering the coastal habitat.Utilizando la microestructura de los otolitos se determinó la edad y se evaluó el crecimiento de juveniles de lisa blanca Mugil curema durante su permanencia en la laguna costera El Conchalito, B.C.S., México, de mayo de 1997 a mayo de 1998. Los juveniles se recolectaron durante la fase estacionaria y de descenso de la maxima pleamar de cada mes. Durante el estudio, se analizaron juveniles de 16 a 42 mm de longitud estándar (LE con edad entre 22 y 109 días. El modelo de Gompertz describió adecuadamente la relación entre la edad y LE (r² = 0,94. La tasa promedio de crecimiento entre 20 y 110 días de edad fue de 0,29 mm día-1 , menor que la tasa de crecimiento de los juveniles antes de incorporarse a la laguna. Esto sugiere que el crecimiento es más rápido en la costa que en la laguna, y la estrategia de introducirse a zonas protegidas es para alcanzar una longitud que maximice el escape a la depredación y maximice la probabilidad de supervivencia cuando se reincorporen al ambiente costero.

  12. Hypopomus Gill: nova apomorfia e notas sobre suas relações filogenéticas (Teleostei, Gymnotiformes, Rhamphichthyoidea Hypopomus Gill: new apomorphy and notes on its phylogenetic relationships (Teleostei, Gymnotioformes, Rhamphichthoidea

    Directory of Open Access Journals (Sweden)

    Mauro L. Triques


    Full Text Available O monofiletismo de Hypopomus Gill, 1864 é corroborado pela presença de canto da boca curvo para cima, homoplasticamente também em Steatogenys Boulenger, 1898. Sua sinonímia com Parupygus Hoedeman, 1962 é corroborada. Três de sete apomorfias previamente atribuídas para definir o monofiletismo de Hypopomidae são refutadas (região posterior do paresfenóide estreita, depressão na face dorsal do basi-hial e opérculo trapezoidal e outras quatro são propostas para unir Hypopomus a Rhamphichthyidae (mandíbula incluída; alongamento anterior do dentário; cartilagem palatina alongada e processo ascendente do mesopterigóide curvo para trás. Assim, estudos mais elaborados são necessários para avaliar a posição filogenética do gênero.The monophyly of Hypopomus Gill, 1864 is corroborated, on the basis of the presence of mouth corner upturned, homoplastically also in Steatogenys Boulenger, 1898. Its synonymy with Parupygus Hoedeman, 1962 is corroborated. Three of seven synapomorphies attributed to the monophyly of Hypopomidae are refuted (posterior region of parasphenoid narrow, depression on the dorsal surface of bashyal and trapezoidal opercle and four other are presented to unite Hypopomus to Rhamphichthyidae (lower jaw included; anterior elongation of dentary; elongation of palatine cartilage and ascending process of mesopterygoid backward curved. Thus, further studies are necessary to assess the phylogenetic position of the genus.

  13. Morfologia e crescimento do músculo estriado esquelético no pirarucu Arapaima gigas Cuvier, 1817 (Teleostei, Arapaimidae = Morphology and skeletal muscle growth in pirarucu Arapaima gigas Cuvier, 1817 (Teleostei, Arapaimidae

    Directory of Open Access Journals (Sweden)

    Fernanda Regina Carani


    Full Text Available O objetivo deste trabalho foi avaliar as características morfológicas e de crescimento do músculo estriado esquelético no pirarucu (Arapaima gigas. Foram utilizados animais em duas fases de crescimento: alevinos, com 50 dias de idade, e juvenis, com umano de idade. Após eutanásia dos animais, fragmentos musculares das regiões dorsal, lateral cranial e lateral caudal foram coletados e congelados em nitrogênio líquido. Cortes histológicos (10 mm foram submetidos às colorações HE e Tricrômico de Gomori, para a análise morfológica, e NADH-TR, para a análise do metabolismo oxidativo das fibras musculares. Foi calculado o menor diâmetro das fibras musculares brancas nas regiões dorsal e lateral cranial. A musculatura dorsal branca mostrou-se mais desenvolvida e, namusculatura lateral, observaram-se compartimentos distintos: superficial vermelho e profundo branco. Nos alevinos, o crescimento muscular ocorreu predominantemente por hiperplasia das fibras e, nos juvenis, predominou o crescimento muscular por hipertrofia.The aim of this work was to evaluate the morphological and growth characteristics of skeletal muscle tissue in pirarucu (Arapaimagigas using alevins (50 days old and juveniles (1 year old. Muscle samples were collected from dorsal, lateral cranial and lateral caudal regions, and then frozen in liquid nitrogen. Histological frozen sections (10μm were stained with HE and Gomori Trichrome formorphological analysis, and NADH-TR to evaluate muscle fiber oxidative metabolism. Morphometric analysis samples were obtained from dorsal and lateral cranial regions, and the smallest-diameter white fibers were measured. White dorsal muscle was thicker, andtwo muscle fiber compartments were identified in the lateral cranial region: red (superficial and white (deep muscle. Hyperplasia muscle growth predominated in alevins and hypertrophy in juveniles.

  14. A mathematical model for growth in weight of silver catfish (Rhamdia quelen (Heptapteridae, Siluriformes, Teleostei Modelo matemático para crescimento em peso de jundiá (Rhamdia quelen (Heptapteridae, Siluriformes, Teleostei

    Directory of Open Access Journals (Sweden)

    Ana Paula da Silva Benaduce


    Full Text Available The use of a mathematical model applied to biological science helps to predict the specific data. Based on biological data (weight and age of silver catfish, Rhamdia quelen, a mathematical model was elaborated based on a nonlinear difference equation to demonstrate the relationship between age and growth in weight. Silver catfish growth was described following the Beverton-Holt model Pt+1 = (r Pt / (1+ a Pt , where r > 0 is the maximum growth rate and a > 0 is a constant of growth inhibition. The solution of this equation is Pt= 1 /{[1/P0 - a / (r-1] 1/r t + a/ (r-1}, were P0 is the initial weight of the fish. Through this model it was observed that the female reaches the theoretical maximum weight approximately at the age of 18 years and the male at the age of 12 years in a natural environment.A formulação de modelos matemáticos aplicado às ciências biológicas auxilia na previsão de dados específicos. Fundamentado em dados biológicos (peso e idade de jundiá, Rhamdia quelen, elaborou-se um modelo matemático com base em equações a diferenças não lineares para demonstrar a relação entre idade e crescimento em peso. O crescimento do jundiá foi descrito segundo o modelo de Beverton-Holt Pt+1 = (r Pt / (1+ a Pt, onde r > 0 é a taxa de crescimento máxima e a > 0 é uma constante de inibição do crescimento. A solução dessa equação é Pt= 1 / {[1/P0 - a / (r-1] 1/r t + a/ (r-1}, onde P0 é o peso inicial do peixe. Por esse modelo foi observado que fêmeas alcançam o peso máximo aproximadamente aos 18 anos e os machos aos 12 anos, em ambiente natural.

  15. Inoculação de suspensão bacteriana de Plesiomonas shigelloides em Jundiá, Rhamdia quelen (Teleostei: Pimelodidae Inoculation of bacterial suspension of Plesiomonas shigelloides in jundiá, Rhamdia quelen (Teleostei: Pimelodidae

    Directory of Open Access Journals (Sweden)

    Cheila de Lima Boijink


    Full Text Available Com o crescimento da aqüicultura mundial e intensificação da criação de peixes, os animais ficam sujeitos às enfermidades bacterianas e outras. Com o objetivo de avaliar a patogenicidade da Plesiomonas shigelloides para jundiás (Rhamdia quelen, diferentes concentrações bacterianas (3 x 10(8 e 9 x 10(8 UFC - Unidade Formadora de Colônia/ml foram inoculadas por via intraperitoneal. Foram utilizados 84 jundiás juvenis com peso e comprimento médios de 24,37 ± 4,28g e 14,42 ± 1,62cm, respectivamente. Os animais inoculados foram mantidos durante 21 dias, em caixas d'agua de amianto, em condições semelhantes de temperatura, pH, alcalinidade e dureza. Os jundiás foram sacrificados a cada dois dias para contagem de UFC/ml de tecido renal. Por observações diárias, constatou-se que a inoculação intraperitoneal de Plesiomonas shigelloides não ocasionou nenhuma alteração nos jundiás, independente da concentração inoculada. As contagens das bactérias nos rins dos jundiás mantiveram-se entre 10(5 e 10(6UFC/ml até o 21º dia, quando o experimento foi finalizado.As worldwide aquaculture has grown, and intensification in fish raising, the animals are subject to bacterial diseases and others. With the aim of evaluating pathogenicity of Plesiomonas shigelloides for "jundiá" (Rhamdia quelen, different bacterial concentrations (3 x 10(8 e 9 x 10(8 CFU - Colony Former Unit/ml were inoculated via peritoneum. Eigthy four juvenile "jundiá" averaging 24.37 ± 4,28g of weight and 14.42 ± 1,62cm of length were utilized. The inoculated animals were maintained for 21 days, in asbestos water tanks, at similar temperature, pH, alkalinity and hardness conditions. The "jundiás" were slaughtered every other day for counting UFC/ml renal tissue. For daily inspections, it was observed that intraperitoneal inoculation of Plesiomonas shigelloides did not cause any change in the catfishes, regardless inoculated concentration. Bacteria counting in "jundiás" kidneys was maintained between 10(5 and 10(6 UFC/ml until the 21st day, when the experiment was ended.

  16. Avaliação da mutagênese e genotoxicidade em Eigenmannia virescens (Teleostei: Gymnotiformes expostos ao benzeno Avaliation of mutagenicity and gentotoxicity in Eigenmannia virescens (Teleostei: Gymnotiformes exposed to benzene

    Directory of Open Access Journals (Sweden)

    Augusto Bücker


    Full Text Available Os efeitos de substâncias genotóxicas sobre o genoma de peixes tem sido objeto de muitos estudos, sobretudo daqueles que buscam estabelecer a resposta dos genes aos estímulos ambientais. O presente trabalho teve como objetivo realizar um estudo sobre mutagenicidade e genotoxicidade em peixes elétricos da espécie Eingenmannia virescens, pela exposição ao benzeno (50ppm, utilizando as técnicas da Freqüência de Micronúcleos (MNs e o Ensaio do Cometa. Foram coletadas amostras do sangue de dez peixes em diferentes tempos de exposição: T0, 24h, 48h, 72h, 96h e 360h (15 dias. Para a análise das lâminas no Teste do MN, foram contadas 1.000 células e estipulada a freqüência de ocorrência de MNs. Para análise do Ensaio do Cometa a contagem foi feita estipulando quatro classes de danos: I - II - III - IV, e para a análise estatística foram atribuídos valores numéricos (ranques de 0 a 3, respectivamente, verificando diferenças significativas para a soma dos ranques em todos os tempos de exposição em relação ao T0. No Teste do Micronúcleo não foi possível detectar efeitos mutagênicos significativos nos eritrócitos analisados. No entanto, para o Ensaio do Cometa os resultados sugerem ação genotóxica do benzeno, devido a um aumento gradual no número de células com maiores classes de danos de acordo com maior tempo de exposição, indicando um efeito tempo-dependente. Estes resultados sugerem maior sensibilidade do Ensaio do Cometa que o Teste do MN.The effects of genotoxic substances on fishes genome have been object of many studies, especially those which attempt to establish the responses of genes to environmental stimulus. The objective of this study was to evaluate the mutagenicity and genotoxicity in electric fishes of species Eingenmannia virescens, under to benzene exposure (50ppm, utilizing Micronuclei Test (MNs and Comet Assay techniques. Ten fish blood samples were collected in different times of exposure: T0, 24h, 48h, 72h, 96h and 360h (15 days. To determine the frequency of MNs, 1.000 cells per microscopical slides were counted. For the Comet Assay analysis, four damage classes were defined: I - II - III - IV, and for the statistic analysis number values (ranks from 0 to 3 were assigned for each class. The sum of ranks (values for all times of exposure was compared to T0 and these differences were statistically analyzed. On Micronuclei Test demonstrated do not possible detect significant mutagenic effects in the erythrocytes analyzed. On the other hand, for the Comet Assay, the results suggested genotoxic action of benzene, proper the gradual increase of number of cells with greatest damage class with the greatest of exposure time, indicating an effect time-dependent. These results suggested the most sensibility for the Comet Assay like Micronuclei Test.

  17. Tolerância de juvenis do pampo Trachinotus marginatus (Teleostei, Carangidae ao choque agudo de salinidade em laboratório Acute salinity tolerance of juvenile pompano Trachinotus marginatus (Teleostei, Carangidae under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Luís André Sampaio


    Full Text Available O pampo Trachinotus marginatus é uma espécie com potencial para piscicultura, mas a sua utilização pode ser limitada pelas variações de salinidade comuns em estuários ou em ambientes super-salinos. Este trabalho foi realizado com o objetivo de determinar a tolerância à salinidade de juvenis de T. marginatus em laboratório. Foram testadas 12 salinidades em duplicata (0, 6, 8, 10, 15, 25, 45, 55, 58, 61, 65 e 75‰ e um tratamento controle (35‰. Dez peixes (comprimento total: 20,7±2,3mm e peso úmido: 427±113mg foram colocados em tanques plásticos de 3L. A temperatura da água foi mantida em 24ºC com um banho termostatisado, aeração constante e, a cada 24 horas, os meios experimentais foram completamente renovados. Após 96 horas de exposição, as salinidades letais médias inferior e superior, com os respectivos intervalos de confiança (IC 95%, foram estimadas em 6,99‰ (IC 95% = 6,86-7,13‰ e 58,50‰ (IC 95% = 56,81-60,24‰, respectivamente. Estes resultados permitem caracterizar esta espécie como eurialina. O estudo da influência da salinidade sobre T. marginatus deve ser aprofundado, buscando avaliar principalmente os efeitos sobre o crescimento, de modo que seja possível determinar o potencial do seu cultivo em ambientes com diferentes salinidades.The pompano Trachinotus marginatus shows good potential for aquaculture, but the success of its culture might be limited by the salinity fluctuations common in estuaries or in hyper-saline environments. The objective of this work was to establish the salinity tolerance of juvenile T. marginatus under laboratory conditions. Twelve salinities (0, 6, 8, 10, 15, 25, 45, 55, 58, 61, 65, and 75‰ plus a control (35‰ were tested in duplicate. Groups of ten fish (total length: 20.7±2,3mm and wet weight: 427±113mg were placed in plastic tanks with 3L of water. A water bath was set to control the temperature at 24ºC, water was continuously aerated, and completely exchanged every 24h. After 96 hours, lower and upper medium lethal salinities and their respective confidence intervals (CI 95% were estimated as 6.99‰ (CI 95% = 6.86-7.13‰, and 58.50‰ (CI 95% = 56.81-60.24‰, respectively. These results allow the characterization of this species as euryhaline. The influence of salinity on T. marginatus should be studied with more detail, with special attention to its effects on growth, in order to determine the potential for T. marginatus culture in different salinities.

  18. Desenvolvimento gonadal do jundiá, Rhamdia quelen (Teleostei, Siluriformes, em viveiros de terra, na região sul do Brasil = Gonadal development of jundiá, Rhamdia quelen (Teleostei, Siluriformes, in earthen ponds in southern Brazil

    Directory of Open Access Journals (Sweden)

    Luciana Ghiraldelli


    Full Text Available O presente estudo caracterizou o desenvolvimento gonadal de jundiá até a maturação sexual, quando cultivados em viveiros de terra, visando subsidiar o desenvolvimento de tecnologia de cultivo para esta espécie na região sul do Brasil. Alevinos de jundiá (peso médio 8 ± 3,73 g foram estocados em três viveiros, na densidade de 0,6indivíduos m-2. Catorze indivíduos foram amostrados mensalmente, de setembro de 2001 a outubro de 2002. Os estádios de maturação gonadal foram caracterizados macroscopicamente, e fragmentos de ovários e testículos de alguns exemplares foram fixados em formalina 4% para análise histológica. Foram analisados 118 exemplares: 60 machos e 58 fêmeas. Os machos apresentaram atividade reprodutiva precoce, quandocomparados às fêmeas. Testículos e ovários apresentaram morfologia similar a de outras espécies de Siluriformes. De acordo com a análise microscópica, as gônadas foram classificadas em quatro estádios de desenvolvimento: imaturo, em maturação inicial, em maturação final e maduro. A relação gonadossomática variou de 0,29 a 9,16 para os machose de 0,11 a 13,03 para as fêmeas. Indivíduos maduros foram observados nos meses de verão (dezembro/2001 e janeiro/2002, outono (abril e maio/2002 e primavera (setembro e outubro/2002, acompanhando o aumento de temperatura.The study characterized the gonadal development of jundiá from approximately 8 g until gonadal maturation, to provide further knowledge for farming jundiá in Southern Brazil. Jundiá fingerlings(average weight 8.00 ± 3.73 g were stocked in three ponds at 0.6 fish m-2. Fourteen fish were sampled each month from September 2001 to October 2002. Gonadal maturation stages were characterized macroscopically, and samples of ovaries and testicles were fixedin 4-%-buffered formalin for histological examination. One hundred and eighteen fish were analyzed: 60 males e 58 females. Jundiá males matured earlier than females. Testicles and ovaries presented similar morphology to other Siluriformes species. Gonads were classified in four development phases of the ovarian follicle, according to histology: immature, initial maturation, final maturation and mature. The gonadosomatic index varied from 0.29 to 9.16 for males and from 0.11 to 13.03 for females. Mature individuals were observed during summer (December/2001 and January/2002, fall (April and May/2002 and spring (September and October/2002, following the increase in water temperature.

  19. Occurrence and ultrastructural characterization of "nuage" during oogenesis and early spermatogenesis of Piaractus mesopotamicus Holmberg, 1887 (Teleostei

    Directory of Open Access Journals (Sweden)

    F. C. Abdalla

    Full Text Available We investigated the occurrence and ultrastructurally characterized electrondense nuclear material (nuage released from the nucleus during oogenesis and early spermatogenesis of Piaractus mesopotamicus, a fish from Pantanal Matogrossense (Brazil having a seasonal reproductive cycle. The female germ cells presented two instances of nuclear material extrusion: in the oogonia and in the oocyte in the perinucleolar phase. In males, material with similar morphology and behavior occurred in the spematogonia. In all cases, this material was associated to mitochondria. The possible function of this material is discussed.

  20. Morphometric variation of the Herichthys bartoni (Bean, 1892 species group (Teleostei: Cichlidae: How many species comprise H. labridens (Pellegrin, 1903?

    Directory of Open Access Journals (Sweden)

    Omar Mejía

    Full Text Available Cichlids of the tribe Heroini have long been a source of taxonomical conflict. In particular, the species included in the Herichthys bartoni group have failed to be recovered as monophyletic in different molecular studies. In this paper we use traditional and geometric morphometrics to evaluate morphological variation in the species included in the H. bartoni complex in order to evaluate the number of species it contains. An update of a previously published DNA barcoding study suggests the existence of three genetic clusters that included the six recognized species analyzed in this study, none of them recovered as monophyletic. On the other hand, geometric morphometrics arise as a useful tool to discriminate species due that traditional morphometrics showed a high overlap in the characters analyzed that prevents the proposal of diagnostic characters.

  1. Biflagellate spermatozoon structure of the hermaphrodite fish Satanoperca jurupari (Heckel, 1840 (Teleostei, Cichlidae from the Amazon River

    Directory of Open Access Journals (Sweden)

    E. MATOS

    Full Text Available The ultrastructural features of the sperm were studied in the hermaphroditic teleost Satanoperca jurupari HECKEL, 1840 from Amazon River. Spermatocytes, spermatids and sperm develop in the testicular cysts among the different oocyte stages. Different stages of early spermatocyte development, mainly the ones with synaptonemal complexes were often observed. The mature spermatozoa belong to the introsperm type, with a short head (~ 3 mm long and 1.3 mum wide without acrosome, short midpiece (~ 1.2 mum long and 1.8 mum wide containing several mitochondria surrounding two centrioles and forming a mitochondrial collar. They have two flagella (each ~15 mum long each of which has a common 9 + 2 microtubular pattern. Each flagellum has two opposite lateral cytoplasmic extensions that begin about 3 mum the midpiece still close to the end piece of flagellum.

  2. Comparison of spermiogenesis in the externally fertilizing Hemigrammus erythrozonus and the inseminating Corynopoma riisei (Teleostei: Characiformes: Characidae

    Directory of Open Access Journals (Sweden)

    Anna Pecio

    Full Text Available Spermiogenesis and sperm ultrastructure were analyzed in two species of characids with different modes of fertilization: externally fertilizing Hemigrammus erythrozonus and inseminating Corynopoma riisei. Spermiogenesis in H. erythrozonus is characterized by lateral development of the flagellum, nuclear rotation, formation of a shallow nuclear fossa, condensation of the chromatin by elimination of the electron-lucent area from the peripheral region of the nucleus, and renewal of the nuclear membrane. Multilammelated membrane and multivesicular bodies were also observed during elimination of the excess cytoplasm. The spermatozoon exhibits characters typical of "aquasperm," i.e. a spherical head containing a spherical nucleus with highly condensed chromatin, several small mitochondria located at the base of the nucleus within a cytoplasmic collar that extends into a long cytoplasmic sleeve surrounding the anterior part of the single flagellum, which is contained within a cytoplasmic canal. The flagellum lacks fins. The proximal and distal centrioles are nearly parallel to one another, with the anterior tips of both located within shallow nuclear fossae. Spermiogenesis in C. riisei is characterized by nuclear elongation alongside the forming flagellum, formation of an elongate cytoplasmic canal, displacement and elongation of the mitochondria, and uniform condensation of chromatin throughout the nucleus through enlargement of the diameter of the chromatin granules. The spermatozoon has an elongate nucleus with two elongate mitochondria localized to one side. Mitochondria are also located posterior to the nucleus forming a mitochondrial region. The single flagellum, which lacks fins, is lateral to the nucleus and initially contained within the greatly elongate cytoplasmic canal before exiting the canal at its posterior terminus. The spermatozoon of C. riisei exhibits several characters typical of "introsperm," such as an elongate nucleus and midpiece (mitochondrial region. The nuclear chromatin in the spermatozoon remains "flocculent" and is never as condensed as that seen in many characid sperm. Differences in spermiogenesis between externally fertilizing and inseminating characids are discussed.

  3. Biflagellate spermatozoon structure of the hermaphrodite fish Satanoperca jurupari (Heckel, 1840 (Teleostei, Cichlidae from the Amazon River

    Directory of Open Access Journals (Sweden)

    MATOS E.


    Full Text Available The ultrastructural features of the sperm were studied in the hermaphroditic teleost Satanoperca jurupari HECKEL, 1840 from Amazon River. Spermatocytes, spermatids and sperm develop in the testicular cysts among the different oocyte stages. Different stages of early spermatocyte development, mainly the ones with synaptonemal complexes were often observed. The mature spermatozoa belong to the introsperm type, with a short head (~ 3 mm long and 1.3 mum wide without acrosome, short midpiece (~ 1.2 mum long and 1.8 mum wide containing several mitochondria surrounding two centrioles and forming a mitochondrial collar. They have two flagella (each ~15 mum long each of which has a common 9 + 2 microtubular pattern. Each flagellum has two opposite lateral cytoplasmic extensions that begin about 3 mum the midpiece still close to the end piece of flagellum.

  4. Notes on the genus Amphiprion Bloch & Schneider, 1801 (Teleostei: Pomacentridae) and its host sea anemones in the Seychelles

    NARCIS (Netherlands)

    Hartog, den J.C.


    The genus Amphiprion Bloch & Schneider, 1801, is represented in the Seychelles by two species, A. akallopisos Bleeker, 1853, and the endemic A. fuscocaudatus Allen, 1972. Throughout its distributional range Amphiprion akallopisos has exclusively been recorded to associate with the clownfish anemones

  5. The influence of oceanographic conditions on the spatial and temporal patterns of Pleuronectiforms larvae (Teleostei in the equatorial Atlantic Ocean

    Directory of Open Access Journals (Sweden)

    Paulo de Oliveira Mafalda Junior

    Full Text Available ABSTRACT In this study, we analyzed the composition, distribution and abundance of Pleuronectiform larvae in relation to abiotic factors (temperature and salinity and biotic factors (phytoplanktonic and zooplanktonic biomass in the equatorial Atlantic Ocean. The working hypothesis was that the composition and distribution pattern of Pleuronectiform larvae species present differences between the areas studied according to the hydrographical environment/factors analyzed. Ichthyoplankton was collected during Period: 1 (August - October 1995, 2 (January - April 1997, 3 (April - July 1998 and 4 (September - December 2000, in the equatorial Atlantic Ocean. We examined 562 Bongo-net (500 μm samples that contained 719 Pleuronectiform larvae belonging to three families: Bothidae (Bothus ocellatus and Engyophrys senta, Paralichthyidae (Syacium papillosum, Citharichthys spilopterus and Citharichthys sp. and Cynoglossidae (Symphurus sp.. The Pleuronectiform larvae accounted for 4% of total fish larvae and occurred at 37% of the oceanographic stations. B. ocellatus was the species with the highest relative abundance (70%, the greatest value occurring during Period 3 (77%, whereas the lowest relative abundance (57% was recorded in Period 1. S. papillosum was the species presenting the second highest relative abundance (14%, with higher values during periods 1 and 4. The results demonstrated that environmental factors influence the distribution and abundance of Pleuronectiform larvae so that each species occurs in a more favourable period and place for spawning and growth. B. ocellatus was related to warmer waters and greater phytoplanktonic and zooplanktonic biomass, while S. papillosum occurred in saltier waters and at lower temperatures.

  6. Fishery of the Goliath grouper, Epinephelus itajara (Teleostei: Epinephelidae based on local ecological knowledge and fishery records in Yucatan, Mexico

    Directory of Open Access Journals (Sweden)

    Alfonso Aguilar-Perera


    Full Text Available The Goliath grouper, Epinephelus itajara, a large-bodied (~ 2.5 m TL, > 400 kg and critically endangered fish (Epinephelidae, is highly vulnerable to overfishing. Although protected from fishing in many countries, its exploitation in Mexico is unregulated; a situation that puts its populations at risk. Fishery records of E. itajara are scarce, which prevents determination of its fishery status. This work aimed to elucidate the E. itajara fishery in the northern Yucatan Peninsula by 1 analyzing available catch records and 2 interviewing veteran fishermen (local ecological knowledge from two traditional landing sites: Dzilam de Bravo and Puerto Progreso. Historic fishery records from two fishing cooperatives were analyzed in order to elucidate the current situation and offer viable alternatives for conservation and management. Catches have decreased severely. Local knowledge obtained from fishermen represented a very important source of information for reconstructing the fisheries history of this species. Conservation measures that incorporate regional and international regulations on critically endangered fish species are suggested. Rev. Biol. Trop. 57 (3: 557-566. Epub 2009 September 30.La cherna, Epinephelus itajara, un mero (Epinephelidae corpulento (~ 2.5 m TL, > 400 kg y amenazado, es altamente vulnerable a la sobrepesca. Si bien es protegido en varios países, en México su explotación no está regulada; situación que pone a su población en riesgo. Sus registros pesqueros son escasos, lo que impide determinar su condición pesquera. Este trabajo intentó ilustrar la pesquería en el norte de la Península de Yucatán usando procedimientos que involucraron analizar registros y entrevistar a pescadores veteranos (conocimiento ecológico tradicional de dos sitios de desembarque: Dzilam de Bravo y Puerto Progreso. Se analizaron registros pesqueros históricos de dos cooperativas pesqueras para determinar la situación actual y ofrecer alternativas viables para conservación y manejo. Las capturas han disminuido drásticamente. El conocimiento local obtenido de los pescadores representa una fuente muy importante de información para ayudar a reconstruir la historia pesquera de esta especie. Se sugieren medidas de conservación que incorporen regulaciones nacionales e internacionales para especies de peces.

  7. A new species of sea urchin associating clingfish of the genus Dellichthys from New Zealand (Teleostei, Gobiesocidae

    Directory of Open Access Journals (Sweden)

    Kevin W. Conway


    Full Text Available A new species of clingfish, Dellichthys trnskii sp. n. is described on the basis of 27 specimens, 11.9–46.0 mm SL, collected from intertidal and shallow coastal waters of New Zealand. It is distinguished from its only congener, D. morelandi Briggs, 1955 by characters of the cephalic sensory system and oral jaws, snout shape, and colouration in life. A rediagnosis is provided for D. morelandi, which is shown to exhibit sexual dimorphism in snout shape.


    Directory of Open Access Journals (Sweden)

    JÉGU M.


    Full Text Available Tometes lebaili n. sp. diffère de Tometes trilobatus Valenciennes, 1850, par la position de la bouche, oblique et dirigée vers le haut. T. lebaili présente 7 à 8 dents à la série labiale du dentaire contre 5 chez T. trilobatus. T. trilobatus, citée des rapides de l’Araguari (Amapá, Brésil à l’Oyapock (Guyane française, est remplacée plus à l’ouest par T. lebaili n. sp., décrite de la Mana (Guyane fr. au Commewine (Surinam et peut-être présente dans le Sinnamary. La taille maximale observée pour T. lebaili est de 512 mm LS.

  9. Scaling mimesis: Morphometric and ecomorphological similarities in three sympatric plant-mimetic fish of the family Carangidae (Teleostei). (United States)

    Queiroz, Alexya Cunha de; Vallinoto, Marcelo; Sakai, Yoichi; Giarrizzo, Tommaso; Barros, Breno


    The mimetic juveniles of a number of carangid fish species resemble plant parts floating near the water surface, such as leaves, seeds and other plant debris. The present study is the first to verify the morphological similarities and ecomorphological relationships between three carangids (Oligoplites saurus, Oligoplites palometa and Trachinotus falcatus) and their associated plant models. Behavioral observations were conducted in the estuary of Curuçá River, in northeastern Pará (Brazil) between August 2015 and July 2016. Individual fishes and associated floating objects (models) were sampled for comparative analysis using both geometric and morphometric approaches. While the mimetic fish and their models retain their own distinct, intrinsic morphological features, a high degree of morphological similarity was found between each fish species and its model. The morphometric analyses revealed a general tendency of isometric development in all three fish species, probably related to their pelagic habitats, during all ontogenetic stages.

  10. Dysomma alticorpus, a new species of cutthroat eel from the Gulf of Aqaba, Red Sea (Teleostei: Synaphobranchidae). (United States)

    Fricke, Ronald; Golani, Daniel; Appelbaum-Golani, Brenda; Zajonz, Uwe


    The cutthroat eel Dysomma alticorpus n. sp. is described based on a single specimen collected in a trammel net at a depth of 350m off Eilat, Israel, Gulf of Aqaba, Red Sea. The new species belongs to the Dysomma anguillare species complex, which comprises species possessing a well-developed pectoral fin, intermaxillary teeth, a uniserial row of 7-15 large compound teeth in the lower jaw (which may be followed by a few smaller teeth), and an anteriorly situated anus with the trunk shorter than the head length. It is characterised by a combination of the following characters: origin of the dorsal fin well anterior to the base of the pectoral fin, predorsal length 13.8% TL; preanal length 22.8% TL; three compound teeth on the vomer; head pores: IO 4, SO 3; M 6; POP 0; AD 1, F 0, ST 0; lateral-line pores: predorsal 4, prepectoral 8, preanal 14, total 57-58, the last at the posterior two-thirds of the total length; MVF 7-16-115; total vertebrae 115. Dysomma alticorpus n. sp. is compared with other species of the genus. A revised key to the species of the genera Dysomma and Dysommina is provided. Copyright © 2018 Académie des sciences. Published by Elsevier Masson SAS. All rights reserved.

  11. Australoheros mattosi Ottoni, 2012 (Teleostei: Cichlidae: live coloration, population differences, and new data on adult external anatomy

    Directory of Open Access Journals (Sweden)

    Gilmar Ferreira Carmo


    Full Text Available Recently collected specimens of Australoheros mattosi in water courses around locality type (Das Velhas River drainage, including Upper Cipó River, Minas Gerais, Brazil revealed new data on the adult live coloration (iridescent markings on the base of the dorsal and anal fins and reddish to grayish hyaline coloration on the distal margin of the caudal-fin, population (dorsal head profile and head ground coloration and ontogenetic variations (variation in the nostril position, head ventral profile, scales on the cheek and the anal and dorsal fins, spot on the posterior margin of the operculum, and ground coloration in alcohol on the external morphology and new morphometric data (pelvic-pectoral distance, eye position in relation to the horizontal axis at the symphysis and the 5th ceratobranchial levels on adult individuals.

  12. Mitochondrial phylogeny of Chinese barred species of the cyprinid genus Acrossocheilus Oshima, 1919 (Teleostei: Cypriniformes) and its taxonomic implications. (United States)

    Yuan, Le-Yang; Liu, Xiao-Xiang; Zhang, E


    Sequences from the mitochondrial control region of 14 putative species of Acrossocheilus (Cyprinidae) were examined to elucidate phylogenetic relationships within species of the barred group in that genus. Phylogenetic reconstructions were generated using three tree-building methods: maximum parsimony, maximum likelihood, and Bayesian inference. The resultant phylogenies were consistent with monophyly of the majority of the morphologically recognized species. However, mitochondrial DNA sequence evidence is incongruent with monophyly of A. fasciatus, as currently conceived. This species occurs only in the upper Qiantang-Jiang basin in Zhejiang and Anhui provinces, and coastal rivers in the Zhejiang Province. The species formerly recognized as A. paradoxus from Zhejiang Province is A. fasciatus. The specimens previously reported as A. fasciatus from river basins in Fujian Province are misidentified A. wuyiensis. The barred group of Acrossocheilus is shown to be polyphyletic. Acrossocheilus is restricted to the barred species here placed in "Clade II," containing A. paradoxus and relatives. Separate generic status is recommended for A. monticola and for A. longipinnis and their closest relatives, although more information on phylogenetic relationships based on multiple genes is required to develop robust phylogenetic hypotheses and diagnoses. Masticbarbus Tang, 1942 is available for A. longipinnis and three allied species (A. iridescens, A. microstomus and A. lamus).

  13. Evolutionary history of the Lake Tanganyika cichlid tribe Lamprologini (Teleostei: Perciformes) derived from mitochondrial and nuclear DNA data


    Sturmbauer, Christian; Salzburger, Walter; Duftner, Nina; Schelly, Robert; Koblmueller, Stephan


    Lake Tanganyika comprises a cichlid species flock with substrate-breeding and mouthbrooding lineages. While sexual selection via mate choice on male mating color is thought to boost speciation rates in mouthbrooding cichlids, this is not the case in substrate-breeding lamprologines, which mostly form stable pairs and lack sexual dichromatism. We present a comprehensive reconstruction of the evolution of the cichlid tribe Lamprologini, based upon mtDNA sequences and multilocus nuclear DNA (AFL...

  14. Pleistocene to holocene expansion of the black-belt cichlid in Central America, Vieja maculicauda (Teleostei: Cichlidae.

    Directory of Open Access Journals (Sweden)

    Caleb D McMahan

    Full Text Available The distributions of many Northern Hemisphere organisms have been influenced by fluctuations in sea level and climatic conditions during Pleistocene interglacial periods. These cycles are associated with range contraction and refugia for northern-distributed organisms as a response to glaciers. However, lower sea levels in the tropics and sub-tropics created available habitat for expansion of the ranges of freshwater organisms. The goal of this study was to use ecological niche modeling to test the hypothesis of north to south range expansion of Vieja maculicauda associated with Pleistocene glacial cycles. Understanding the biogeography of this widespread species may help us better understand the geology and interconnectivity of Central American freshwaters. Occurrence data for V. maculicauda was based on georeferencing of all museum records of specimens recovered from FishNet2. General patterns of phylogeographic structure were assessed with mtDNA. Present day niche models were generated and subsequently projected onto paleoclimatic maps of the region during the Last Interglacial, Last Glacial Maximum, and mid-Holocene. Phylogenetic analysis of mtDNA sequence data showed no phylogeographic structure throughout the range of this widespread species. Present day niche models were congruent with the observed distribution of V. maculicauda in Central America. Results showed a lack of suitable freshwater habitat in northern Central America and Mexico during the Last Interglacial, with greatest range expansion during the Last Glacial Maximum and mid-Holocene. Results support the hypothesis of a north to south range expansion of V. maculicauda associated with glacial cycles. The wide distribution of this species compared to other closely related cichlids indicates the latter did not respond to the degree of V. maculicauda in expansion of their distributions. Future work aimed at comparisons with other species and modeling of future climatic scenarios will be a fruitful area of investigation.

  15. A popular and potentially sustainable fishery resource under pressure–extinction risk and conservation of Brazilian Sciaenidae (Teleostei: Perciformes

    Directory of Open Access Journals (Sweden)

    Ning Labbish Chao


    Full Text Available Croakers (Sciaenidae are major fishery resource in Brazil; constituting 22% of marine and 9% of freshwater fishery landings. Croakers are subject to heavy fishing pressure throughout Brazil, but habitat alteration is also an important threat to regional populations. In this regional Sciaenidae assessment, each species was analyzed for relative risk of extinction, including the identification and quantification of the impact of major threats and existing conservation measures, based on application of the Categories and Criteria of the IUCN Red List of Threatened Species. Of the 52 species of Sciaenid fishes (34 marine and 18 freshwater present in Brazilian waters, the majority are at low risk of extinction, with 10 species classified as Data Deficient (DD and 36 as Least Concern (LC. However the Southern black drum (Pogonias cromis, listed as Endangered (EN is the most threatened species in the region, while three other species are classified as Near Threatened (NT. A large portion of Brazilian croakers is landed by small-scale artisanal fisheries, which are scattered along coastal and riverine communities. However, our assessments reveal that available fishery landing statistics may have greatly underestimated the artisanal fishery production and by-catch of Sciaenids. We recommend establishing, with adequate enforcement, coastal and riverine protected areas as well as strategic fishing seasons to improve and maintain the conservation status of Sciaenids and sustainable Sciaenid fisheries.

  16. Phylogenetic relationships and timing of diversification in gonorynchiform fishes inferred using nuclear gene DNA sequences (Teleostei: Ostariophysi). (United States)

    Near, Thomas J; Dornburg, Alex; Friedman, Matt


    The Gonorynchiformes are the sister lineage of the species-rich Otophysi and provide important insights into the diversification of ostariophysan fishes. Phylogenies of gonorynchiforms inferred using morphological characters and mtDNA gene sequences provide differing resolutions with regard to the sister lineage of all other gonorynchiforms (Chanos vs. Gonorynchus) and support for monophyly of the two miniaturized lineages Cromeria and Grasseichthys. In this study the phylogeny and divergence times of gonorynchiforms are investigated with DNA sequences sampled from nine nuclear genes and a published morphological character matrix. Bayesian phylogenetic analyses reveal substantial congruence among individual gene trees with inferences from eight genes placing Gonorynchus as the sister lineage to all other gonorynchiforms. Seven gene trees resolve Cromeria and Grasseichthys as a clade, supporting previous inferences using morphological characters. Phylogenies resulting from either concatenating the nuclear genes, performing a multispecies coalescent species tree analysis, or combining the morphological and nuclear gene DNA sequences resolve Gonorynchus as the living sister lineage of all other gonorynchiforms, strongly support the monophyly of Cromeria and Grasseichthys, and resolve a clade containing Parakneria, Cromeria, and Grasseichthys. The morphological dataset, which includes 13 gonorynchiform fossil taxa that range in age from Early Cretaceous to Eocene, was analyzed in combination with DNA sequences from the nine nuclear genes and a relaxed molecular clock to estimate times of evolutionary divergence. This "tip dating" strategy accommodates uncertainty in the phylogenetic resolution of fossil taxa that provide calibration information in the relaxed molecular clock analysis. The estimated age of the most recent common ancestor (MRCA) of living gonorynchiforms is slightly older than estimates from previous node dating efforts, but the molecular tip dating estimated ages of Kneriinae (Kneria, Parakneria, Cromeria, and Grasseichthys) and the two paedomorphic lineages, Cromeria and Grasseichthys, are considerably younger. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. DNA barcoding at riverscape scales: Assessing biodiversity among fishes of the genus Cottus (Teleostei) in northern Rocky Mountain streams (United States)

    Michael K. Young; Kevin S. McKelvey; Kristine L. Pilgrim; Michael K. Schwartz


    There is growing interest in broad-scale biodiversity assessments that can serve as benchmarks for identifying ecological change. Genetic tools have been used for such assessments for decades, but spatial sampling considerations have largely been ignored. Here, we demonstrate how intensive sampling efforts across a large geographical scale can influence identification...

  18. Larvae of migratory fish (Teleostei: Ostariophysi in the lotic remnant of the Paraná River in Brazil

    Directory of Open Access Journals (Sweden)

    Evelyn Barzotto


    Full Text Available ABSTRACT Fish larvae and adults are morphologically distinct from each other and have different ecological requirements. Research on the dynamics of ichthyoplankton provides valuable information about the early stages of the life cycle of fish. This study analyzed the temporal and spatial distribution of the larval stages of three migratory species - Salminus brasiliensis (Cuvier, 1816, Prochilodus lineatus (Valenciennes, 1836 and Pseudoplatystoma corruscans (Agassiz, 1829 - to identify possible spawning areas in the last lotic remnant of the upper Paraná River, in the Brazilian territory. A total of 26 points were sampled monthly from October 2003 to November 2004. The PERMANOVA detected significant differences between the months only for S. brasiliensis (Pseudo-F = 3.88, p = 0.0021 and P. corruscans (Pseudo-F = 3.35, p = 0.004. Among the environmental variables, temperature was the most important and the Mantel test detected a significant correlation between temperature and the densities, only for P. lineatus (r = 0.09, p = 0.03. The species in our data chose for spawning tributaries that are not dammed, of which most are outside conservation areas. Therefore, recruitment, maintenance and possible actions aiming to recover the stocks of these species are dependent on the conservation of tributaries and floodplain lakes in the region, in addition to monitoring to prevent fishing during the reproductive period.

  19. Evolutionary history of Otophysi (Teleostei, a major clade of the modern freshwater fishes: Pangaean origin and Mesozoic radiation

    Directory of Open Access Journals (Sweden)

    Saitoh Kenji


    Full Text Available Abstract Background Freshwater harbors approximately 12,000 fish species accounting for 43% of the diversity of all modern fish. A single ancestral lineage evolved into about two-thirds of this enormous biodiversity (≈ 7900 spp. and is currently distributed throughout the world's continents except Antarctica. Despite such remarkable species diversity and ubiquity, the evolutionary history of this major freshwater fish clade, Otophysi, remains largely unexplored. To gain insight into the history of otophysan diversification, we constructed a timetree based on whole mitogenome sequences across 110 species representing 55 of the 64 families. Results Partitioned maximum likelihood analysis based on unambiguously aligned sequences (9923 bp confidently recovered the monophyly of Otophysi and the two constituent subgroups (Cypriniformes and Characiphysi. The latter clade comprised three orders (Gymnotiformes, Characiformes, Siluriformes, and Gymnotiformes was sister to the latter two groups. One of the two suborders in Characiformes (Characoidei was more closely related to Siluriformes than to its own suborder (Citharinoidei, rendering the characiforms paraphyletic. Although this novel relationship did not receive strong statistical support, it was supported by analyzing independent nuclear markers. A relaxed molecular clock Bayesian analysis of the divergence times and reconstruction of ancestral habitats on the timetree suggest a Pangaean origin and Mesozoic radiation of otophysans. Conclusions The present timetree demonstrates that survival of the ancestral lineages through the two consecutive mass extinctions on Pangaea, and subsequent radiations during the Jurassic through early Cretaceous shaped the modern familial diversity of otophysans. This evolutionary scenario is consistent with recent arguments based on biogeographic inferences and molecular divergence time estimates. No fossil otophysan, however, has been recorded before the Albian, the early Cretaceous 100-112 Ma, creating an over 100 million year time span without fossil evidence. This formidable ghost range partially reflects a genuine difference between the estimated ages of stem group origin (molecular divergence time and crown group morphological diversification (fossil divergence time; the ghost range, however, would be filled with discoveries of older fossils that can be used as more reasonable time constraints as well as with developments of more realistic models that capture the rates of molecular sequences accurately.

  20. Evolutionary history of Otophysi (Teleostei), a major clade of the modern freshwater fishes: Pangaean origin and Mesozoic radiation. (United States)

    Nakatani, Masanori; Miya, Masaki; Mabuchi, Kohji; Saitoh, Kenji; Nishida, Mutsumi


    Freshwater harbors approximately 12,000 fish species accounting for 43% of the diversity of all modern fish. A single ancestral lineage evolved into about two-thirds of this enormous biodiversity (≈ 7900 spp.) and is currently distributed throughout the world's continents except Antarctica. Despite such remarkable species diversity and ubiquity, the evolutionary history of this major freshwater fish clade, Otophysi, remains largely unexplored. To gain insight into the history of otophysan diversification, we constructed a timetree based on whole mitogenome sequences across 110 species representing 55 of the 64 families. Partitioned maximum likelihood analysis based on unambiguously aligned sequences (9923 bp) confidently recovered the monophyly of Otophysi and the two constituent subgroups (Cypriniformes and Characiphysi). The latter clade comprised three orders (Gymnotiformes, Characiformes, Siluriformes), and Gymnotiformes was sister to the latter two groups. One of the two suborders in Characiformes (Characoidei) was more closely related to Siluriformes than to its own suborder (Citharinoidei), rendering the characiforms paraphyletic. Although this novel relationship did not receive strong statistical support, it was supported by analyzing independent nuclear markers. A relaxed molecular clock Bayesian analysis of the divergence times and reconstruction of ancestral habitats on the timetree suggest a Pangaean origin and Mesozoic radiation of otophysans. The present timetree demonstrates that survival of the ancestral lineages through the two consecutive mass extinctions on Pangaea, and subsequent radiations during the Jurassic through early Cretaceous shaped the modern familial diversity of otophysans. This evolutionary scenario is consistent with recent arguments based on biogeographic inferences and molecular divergence time estimates. No fossil otophysan, however, has been recorded before the Albian, the early Cretaceous 100-112 Ma, creating an over 100 million year time span without fossil evidence. This formidable ghost range partially reflects a genuine difference between the estimated ages of stem group origin (molecular divergence time) and crown group morphological diversification (fossil divergence time); the ghost range, however, would be filled with discoveries of older fossils that can be used as more reasonable time constraints as well as with developments of more realistic models that capture the rates of molecular sequences accurately.

  1. Phylogeny and high diversity of the Old World cyprinodont, Genus Aphanius (Teleostei, Cyprinodontidae in the Iranian Plateau

    Directory of Open Access Journals (Sweden)

    Zeinab Gholami


    Full Text Available To date, 28 species of Aphanius have been recognized in the World, of which 14 species are described from six endorheic and eight exorheic basins in Iran. Here we report the taxonomic status and phylogenetic relationships of the 14 Iranian Aphanius species to understand their evolutionary history, and thus to contribute to future conservation strategies and habitat management. Based on the cytochrome b gene in combination with geological data, they are representatives of three large clades i.e. (i A. dispar clade (A. dispar, A. ginaonis, A. furcatus and A. sirhani, (ii A. mento clade and (iii Inland Aphanius species clade (A. vladykovi, A. darabensis, A. shirini, A. isfahanensis, A. farsicus, A. arakensis, A. kavirensis, A. mesopotamicus, A. pluristriatus and A. sophiae. The latest clade comprises three subclades (A. vladykovi-, A. shirini- and A. sophiae subclade and represents an “old” evolutionary group that had diverged in the Late Miocene and Early Pliocene (ca. 10–5 Million years ago (A. vladykovi and A. shirini subclades and A. isfahanensis of the A. sophiae subclade and a “young” evolutionary group that may have diverged during the Late Pleistocene (100,000–11,700 y. ago and Early to Middle Holocene (11,700–4,000 y. ago (A. sophiae subclade, but without A. isfahanensis. The A. sophiae subclade is the most remarkable group with seven species that they are superficially very similar and often not clearly distinguishable by external characters alone. However, differences in cytochrome b and also between the otoliths clearly separate all species of this subclade. In addition, the species of the A. sophiae subclade show widely separated distribution areas with no hydrological connectivity in between, which additionally confirm their clarification as distinctive species. All Iranian Aphanius species are native except A. dispar, A. mesopotamicus and A. mento.

  2. Otolith morphology and hearing abilities in cave- and surface-dwelling ecotypes of the Atlantic molly, Poecilia mexicana (Teleostei: Poeciliidae) (United States)

    Schulz-Mirbach, Tanja; Ladich, Friedrich; Riesch, Rüdiger; Plath, Martin


    Cave fish have rarely been investigated with regard to their inner ear morphology, hearing abilities, and acoustic communication. Based on a previous study that revealed morphological differences in the saccular otolith between a cave and two surface populations of Poecilia mexicana, we checked for additional differences in utricular and lagenar otoliths and tested whether different populations have similar hearing sensitivities. We found pronounced differences in the shape of all three otoliths. Otoliths of the saccule and lagena from cave fish differed from those of surface fish in the features of the face oriented towards the sensory epithelium. In addition, otoliths of the utricle and lagena were significantly heavier in cave fish. Auditory sensitivities were measured between 100 and 1500 Hz, utilizing the auditory evoked potential recording technique. We found similar hearing abilities in cave and surface fish, with greatest sensitivity between 200 and 300 Hz. An acoustic survey revealed that neither ecotype produced species-specific sounds. Our data indicate that cave dwelling altered the otolith morphology in Atlantic mollies, probably due to metabolic differences. Different otolith morphology, however, did not affect general auditory sensitivity or acoustic behavior. PMID:20430090

  3. Growth parameters estimates of Maurolicus stehmanni Parin & Kobyliansky 1996 (Teleostei, Sternoptichydae from south and southeastern Brazilian waters

    Directory of Open Access Journals (Sweden)

    Andre Bellucco


    Full Text Available This paper on the otolith microstructure analysis of Maurolicus stehmanni presents estimates of the species growth parameters and longevity. The species inhabits the outer shelf and slope of the southern and southeastern Brazilian Exclusive Economic Zone (EEZ. Growth parameters are important for the knowledge of the species' life history and rational management. M. stehmanni constitutes an important link between the initial and final components of the alimentary chain of the open sea ecosystem, being one of the main food items for squids and large pelagic fish. Among the various applied methods those which presented the most coherent values for growth parameters and were best adapted to the von Bertallanfy's equation were: Li= 55mm K= 0.0088/day and to= 5.5 days Maurolicus stehmanni's longevity is of less than one year (around 220 days and the sagita daily otolith rings are useful for the determination of its age.Este estudo, baseado na análise da microestrutura dos otólitos de Maurolicus stehmanni, apresenta estimativas dos parâmetros de crescimento e longevidade para esta espécie que habita a plataforma externa e o talude da ZEE sul-sudeste do Brasil. Estes parâmetros são importantes para o conhecimento da estratégia de vida da espécie e para o manejo deste recurso, que constitui um importante elo entre os componentes iniciais e finais da teia alimentar no ecossistema de mar aberto, sendo um dos principais itens na dieta das lulas e grandes peixes pelágicos. Dentre os vários métodos aplicados, os valores dos parâmetros de crescimento mais coerentes com a estratégia da espécie e que melhor se ajustaram à equação de von Bertallanfy foram: Li= 55mm K= 0.0088/dia e to= 5.5 dias. A espécie vive cerca de 220 dias e as marcas diárias nos otólitos sagita são apropriadas para a determinação da idade.

  4. CEPF Western Ghats Special Series: Rediscovery of the threatened Western Ghats endemic sisorid catfish Glyptothorax poonaensis (Teleostei: Siluriformes: Sisoridae

    Directory of Open Access Journals (Sweden)

    N. Dahanukar


    Full Text Available Glyptothorax poonaensis Hora is an endemic sisorid catfish of the Western Ghats of India known only from its type locality in Mula-Mutha River, a tributary of Bhima River, at Pune. This fish has not been recorded from its type locality for more than 70 years and it was thought to be extinct. Here we report a recently discovered population of G. poonaensis from Indrayani River, a tributary of Bhima River. Based on 11 specimens, we have redescribed this species along with some comments on its taxonomy, length-weight relationship, feeding and breeding habits. We also performed molecular phylogeny of the fish by sequencing three mitochondrial genes encoding 16S ribosomal DNA, cytochrome b and cytochrome oxidase subunit I. Molecular analysis suggests that G. poonaensis is nested within a lineage of Glyptothorax species from northern and northeastern India and China. Further, our analysis reveals that southern Indian species of Glyptothorax do not form a monophyletic group. Molecular dating of divergence times indicates that G. poonaensis diverged from other northern Indian species 1.9 to 2.5 million years ago. Current knowledge suggests that the species could be found in two river basins with total extent of around 6100km2; however, the species is already suspected to be locally extinct from half of its known extent of occurrence. Furthermore, the habitat of the species may be threatened by increasing pollution, deforestation leading to siltation, halting of flow by damming, sandmining and introduced fish species. In the light of biodiversity conservation, especially in an important biodiversity hotspot like Western Ghats, such rare and endemic species needs prioritization.

  5. Mapping the potential distribution of the invasive Red Shiner, Cyprinella lutrensis (Teleostei: Cyprinidae) across waterways of the conterminous United States (United States)

    Poulos, Helen M.; Chernoff, Barry; Fuller, Pam L.; Butman, David


    Predicting the future spread of non-native aquatic species continues to be a high priority for natural resource managers striving to maintain biodiversity and ecosystem function. Modeling the potential distributions of alien aquatic species through spatially explicit mapping is an increasingly important tool for risk assessment and prediction. Habitat modeling also facilitates the identification of key environmental variables influencing species distributions. We modeled the potential distribution of an aggressive invasive minnow, the red shiner (Cyprinella lutrensis), in waterways of the conterminous United States using maximum entropy (Maxent). We used inventory records from the USGS Nonindigenous Aquatic Species Database, native records for C. lutrensis from museum collections, and a geographic information system of 20 raster climatic and environmental variables to produce a map of potential red shiner habitat. Summer climatic variables were the most important environmental predictors of C. lutrensis distribution, which was consistent with the high temperature tolerance of this species. Results from this study provide insights into the locations and environmental conditions in the US that are susceptible to red shiner invasion.

  6. Dynamics of ovarian maturation during the reproductive cycle of Metynnis maculatus, a reservoir invasive fish species (Teleostei: Characiformes

    Directory of Open Access Journals (Sweden)

    Thiago Scremin Boscolo Pereira

    Full Text Available In this study, we evaluated the dynamics of ovarian maturation and the spawning processes during the reproductive cycle of Metynnis maculatus. Adult females (n = 36 were collected bimonthly between April 2010 and March 2011. The mean gonadosomatic index (GSI was determined, ovarian and blood samples were submitted for morphometric evaluation and the steroid plasma concentration was determined by ELISA. This species demonstrated asynchronous ovarian development with multiple spawns. This study revealed that, although defined as a multiple spawning species, the ovaries of M. maculatus have a pattern of development with a predominance of vitellogenesis between April and August and have an intensification in spawning in September; in October, a drop in the mean GSI values occurred, and the highest frequencies of post-ovulatory follicles (POFs were observed. We observed a positive correlation between the POF and the levels of 17α-hydroxyprogesterone. Metynnis maculatus has the potential to be used as a source of pituitary tissue for the preparation of crude extracts for hormonal induction; the theoretical period for use is from September to December, but specific studies to determine the feasibility of this approach must be conducted.

  7. A southern species of the tropical catfish genus Phractocephalus (Teleostei: Siluriformes) in the Miocene of South America (United States)

    Azpelicueta, María de las Mercedes; Cione, Alberto Luis


    Catfish bones from Tortonian (Miocene) freshwater beds of central Argentina are here identified as pertaining to a new species of the tropical pimelodid genus Phractocephalus. The new species differs from the other recent and fossil species of the genus in skull, pectoral girdle and spine characters. The material was found in different localities near the city of Paraná, Entre Ríos Province. The bearing horizon is the so-called "Conglomerado osífero" which constitutes the lowermost beds of the fluvial Ituzaingó Formation. The aquatic vertebrate fauna occurring in the bearing bed shows a similar generic composition to several northern South American Miocene units where Phractocephalus remains were found. This report extends the range of Phractocephalus more than 2000 km to the South. The record is in agreement with higher global temperatures and putative ample hydrographic connections of the river basins in the Paraná area with the Amazon basin until at least the early late Miocene.

  8. Evidence of birth-and-death evolution of 5S rRNA gene in Channa species (Teleostei, Perciformes). (United States)

    Barman, Anindya Sundar; Singh, Mamta; Singh, Rajeev Kumar; Lal, Kuldeep Kumar


    In higher eukaryotes, minor rDNA family codes for 5S rRNA that is arranged in tandem arrays and comprises of a highly conserved 120 bp long coding sequence with a variable non-transcribed spacer (NTS). Initially the 5S rDNA repeats are considered to be evolved by the process of concerted evolution. But some recent reports, including teleost fishes suggested that evolution of 5S rDNA repeat does not fit into the concerted evolution model and evolution of 5S rDNA family may be explained by a birth-and-death evolution model. In order to study the mode of evolution of 5S rDNA repeats in Perciformes fish species, nucleotide sequence and molecular organization of five species of genus Channa were analyzed in the present study. Molecular analyses revealed several variants of 5S rDNA repeats (four types of NTS) and networks created by a neighbor net algorithm for each type of sequences (I, II, III and IV) did not show a clear clustering in species specific manner. The stable secondary structure is predicted and upstream and downstream conserved regulatory elements were characterized. Sequence analyses also shown the presence of two putative pseudogenes in Channa marulius. Present study supported that 5S rDNA repeats in genus Channa were evolved under the process of birth-and-death.

  9. Gross anatomy and histology of the alimentary system of Characidae (Teleostei: Ostariophysi: Characiformes) and potential phylogenetic information


    Alonso,Felipe; Mirande,Juan Marcos; Pandolfi,Matías


    A compared study of the morphology of the alimentary tract and liver of seven selected species corresponding to the main clades of the Characidae family is presented herein. Three new set of characters corresponding to 1) alimentary tract gross anatomy, 2) alimentary tract histology and 3) liver gross anatomy are evaluated as potential sources of data for future phylogenetic studies of the Characidae. Not considerable interspecific variation was observed at the histological level and therefor...

  10. Additional record of Batasio merianiensis (Chaudhuri 1913, a catfish (Teleostei: Bagridae in upper Brahmaputra River drainage in Arunachal Pradesh, India

    Directory of Open Access Journals (Sweden)

    L. Tamang


    Full Text Available This paper communicates the extension of the distribution range of Batasio merianiensis in Sille River in the upper Brahmaputra drainage, East Siang District, Arunachal Pradesh. Detailed examinations of the specimens revealed existence of few morphological variations against those reported by Heok Hee Ng in 2009 on the following characteristics: by having a longer preanal (70.4-73.4 vs. 66.3-68.2% SL; a longer prepectoral (25.1-29.3 vs. 21.4-25.7% SL; a longer adipose-fin base (22.0-27.6 vs. 16.9-22.2% SL; a shorter post-adipose distance (11.6-13.4 vs.13.4-15.5% SL; a deeper body at anus (depth 18.3-20.8 vs.15.2-18.4% SL and broader head (width 17.6-20.0 vs.13.5-16.2 % HL. Few additional characters of the fish are included along with brief information on its habitat. The LIPUM, the semi-traditional method of fishing in the river is identified as a major threat to this species.

  11. The complete mitochondrial transcript of the red tail loach Yasuhikotakia modesta as assembled from RNAseq (Teleostei: Botiidae)

    Czech Academy of Sciences Publication Activity Database

    Grau, J. H.; Hilgers, L.; Altmüller, J.; Šlechtová, Vendula; Bohlen, Jörg


    Roč. 2, č. 1 (2017), s. 46-47 ISSN 2380-2359 R&D Projects: GA ČR GA13-37277S Institutional support: RVO:67985904 Keywords : Yasuhikotakia modesta * loach * Botiidae Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3)

  12. General characteristics of the diet of Trachinotus paitensis (Teleostei: Carangidae from San Ignacio Lagoon, Baja California Sur, Mexico

    Directory of Open Access Journals (Sweden)

    V.H. Cruz Escalona


    Full Text Available The food habits of Trachinotus paitensis, in San Ignacio Lagoon B.C.S., Mexico, were investigated. We observed that T. paitensis is carnivorous, feeding mainly on benthic invertebrates (the gastropods Anachis spp., Bittium spp., and the crustacean larvae. We concluded that T. paitensis is an opportunist predator that impacts mainly on epibenthic invertebratesFueron investigados los hábitos alimenticios de Trachinotus paitensis, en la laguna San Ignacio B.C.S., México. Se observó que T. paitensis es carnívoro, y se alimenta principalmente de invertebrados bénticos (los gastrópodos Anachis spp., Bittium spp., y larvas de crustáceos. En conclusión esta especie es un depredador oportunista que tiene un impacto principalmente sobre las poblaciones de invertebrados epibénticos

  13. Molecular phylogeny of grey mullets (Teleostei: Mugilidae) in Greece: evidence from sequence analysis of mtDNA segments. (United States)

    Papasotiropoulos, Vasilis; Klossa-Kilia, Elena; Alahiotis, Stamatis N; Kilias, George


    Mitochondrial DNA sequence analysis has been used to explore genetic differentiation and phylogenetic relationships among five species of the Mugilidae family, Mugil cephalus, Chelon labrosus, Liza aurata, Liza ramada, and Liza saliens. DNA was isolated from samples originating from the Messolongi Lagoon in Greece. Three mtDNA segments (12s rRNA, 16s rRNA, and CO I) were PCR amplified and sequenced. Sequencing analysis revealed that the greatest genetic differentiation was observed between M. cephalus and all the other species studied, while C. labrosus and L. aurata were the closest taxa. Dendrograms obtained by the neighbor-joining method and Bayesian inference analysis exhibited the same topology. According to this topology, M. cephalus is the most distinct species and the remaining taxa are clustered together, with C. labrosus and L. aurata forming a single group. The latter result brings into question the monophyletic origin of the genus Liza.

  14. Redescription of Liza bandialensis (Teleostei: Mugilidae) with an identification key to mullet species of Eastern Central Atlantic. (United States)

    Trape, Sébastien; Harrison, Ian J; Diouf, Papa Samba; Durand, Jean-Dominique


    Liza bandialensis Diouf 1991 is redescribed because previous descriptions have not been in well-distributed publications and have lacked sufficient detail or reference to voucher specimens. The description provided here is based on specimens from the Sine Saloum estuary, Senegal (West Africa), from where the species was originally described. The distinctness of the species is confirmed both by meristic and molecular criteria. L. bandialensis presents a unique combination of characters with a low number of scales in the longitudinal series (32-33), 10.5-12 transverse scale rows, and distinctly yellowish dorsal, anal, and caudal fins. The currently known distribution of L. bandialensis includes coastal waters of Senegal, Gambia and Guinea Bissau. Finally, we provide a morphological identification key for the sixteen species of Mugilidae species occurring along the eastern central Atlantic coast of Africa. Copyright © 2011 Académie des sciences. All rights reserved.

  15. Kudoa unicapsula n. sp. (Myxosporea: Kudoidae) a parasite of the Mediterranean mullets Liza ramada and L. aurata (Teleostei: Mugilidae). (United States)

    Yurakhno, V M; Ovcharenko, M O; Holzer, A S; Sarabeev, V L; Balbuena, J A


    A new multivalvulid myxozoan parasite, Kudoa unicapsula n. sp., is described from the intestinal mesentery, intestine and pyloric caeca of the thin-lipped grey mullet Liza ramada (Risso 1826) and the golden grey mullet L. aurata (Risso, 1810) from the Mediterranean coastal waters of Spain. It is characterized by the presence of elongated, rice corn-like white cysts of 0.47-0.56 x 0.18-0.38 mm, filled with tetracapsulate, slightly asymmetric spores, rectangular in apical view and tear-shaped in lateral view with four polar capsules of considerably different size and slightly unequal spore valves with rounded edges, overlapping each other on the apex of the spore. One large polar capsule includes a polar filament coiled in two to three turns, and the other three polar capsules, which are very small, posses only a rudimental filament. Both light and electron microscopy data showed that this species differs from all previously described Kudoa spp. with unequal polar capsules. The molecular analysis based on 18S and 28S ribosomal deoxyribonucleic acid DNA sequence data of K. unicapsula n. sp. indicates a close relationship and thus phylogenetic clustering together with K. trifolia, a myxozoan from the same host and the same geographical location.

  16. Systematics of the grey mullets (Teleostei: Mugiliformes: Mugilidae): molecular phylogenetic evidence challenges two centuries of morphology-based taxonomy. (United States)

    Durand, J-D; Shen, K-N; Chen, W-J; Jamandre, B W; Blel, H; Diop, K; Nirchio, M; Garcia de León, F J; Whitfield, A K; Chang, C-W; Borsa, P


    The family Mugilidae comprises mainly coastal marine species that are widely distributed in all tropical, subtropical and temperate seas. Mugilid species are generally considered to be ecologically important and they are a major food resource for human populations in certain parts of the world. The taxonomy and systematics of the Mugilidae are still much debated and based primarily on morphological characters. In this study, we provide the first comprehensive molecular systematic account of the Mugilidae using phylogenetic analyses of nucleotide sequence variation at three mitochondrial loci (16S rRNA, cytochrome oxidase I, and cytochrome b) for 257 individuals from 55 currently recognized species. The study covers all 20 mugilid genera currently recognized as being valid. The family comprises seven major lineages that radiated early on from the ancestor to all current forms. All genera that were represented by two species or more, except Cestraeus, turned out to be paraphyletic or polyphyletic. Thus, the present phylogenetic results generally disagree with the current taxonomy at the genus level and imply that the anatomical characters used for the systematics of the Mugilidae may be poorly informative phylogenetically. The present results should provide a sound basis for a taxonomic revision of the mugilid genera. A proportion of the species with large distribution ranges (including Moolgarda seheli, Mugil cephalus and M. curema) appear to consist of cryptic species, thus warranting further taxonomic and genetic work at the infra-generic level. Copyright © 2012 Elsevier Inc. All rights reserved.

  17. A New Species of Ligophorus (Monogenea: Dactylogyridae) from the gills of the Flathead Mullet Mugil cephalus (Teleostei: Mugilidae) from Mexico. (United States)

    Rodríguez-González, Abril; Míguez-Lozano, Raúl; Llopis-Belenguer, Cristina; Balbuena, Juan Antonio


    A new monogenean species, Ligophorus yucatanensis n. sp. from the gills of the flathead mullet Mugil cephalus from the Yucatan Peninsula, Mexico, is described. The new species can be differentiated from all other species of Ligophorus by the morphology of the accessory piece of the copulatory organ. Its main lobe is cylindrical, tunnelled expanded distally, slightly bowed with a characteristic membranous opening at level of medial bifurcation of the accessory piece, forming a thick-walled bulbshaped expansion that ends in a round labium. The secondary lobe is spatulate, straight, and shorter than the main lobe. In addition, the new species can be distinguished from other species by the morphology of the haptoral ventral bar, and the distal end of the vaginal duct. Furthermore the ventral anchors are shorter than those of all other species of Ligophorus reported in the Gulf of Mexico and Caribbean Sea. In addition, the zoogeographical records of Ligophorus spp. on the M. cephalus species complex are briefly reviewed and updated.

  18. Cytogenetical and morphological features reveal significant differences among Venezuelan and Brazilian samples of Mugil curema (Teleostei: Mugilidae

    Directory of Open Access Journals (Sweden)

    Mauro Nirchio

    Full Text Available Karyotype of M. curema from the Gulf of Mexico and Brazil have been reported as possessing chromosome complement with 2n=28 and FN=48, whereas specimens from Venezuela has been reported as possessing a diploid number 2n=24 and a conserved FN (48. Although at first sight this variation suggests the presence of a chromosomal intraspecific (interpopulational variability, the possibility that we are dealing with two different species was examined. This work revisit the karyotypes of M. curema from Venezuela and Brazil, including new data on C-banding, and NOR localization, and compares morphologic characteristics of samples from both localities. Thus, besides diploid number, the constitutive heterochromatin distribution and NORs location, mark other differences between M. curema Cytotype 1 (2n=28; FN=48 and Cytotype 2 (2n=24; NF=48. Moreover, morphologic comparison revealed differences in the scale counts and pectoral fin rays: 35 scales in the middle body line and 15 pectoral fin rays in specimens possessing the karyotype 2n=28, compared with 37-39 scales in the middle body line and 17 pectoral fin rays in specimens with the karyotype 2n=24. These differences lead us to suggest that both cytotypes are not related merely to geographic polytipic variations but could correspond to different species.

  19. A comparative study of Ligophorus uruguayense and L. saladensis (Monogenea: Ancyrocephalidae) from Mugil liza (Teleostei: Mugilidae) in southern Brazil. (United States)

    Marchiori, Natalia C; Pariselle, Antoine; Pereira, Joaber; Agnese, Jean-Francois; Durand, Jean-Dominique; Vanhove, Maarten P M


    Representatives of Ligophorus Euzet et Suriano, 1977 were found on the gills of Mugil liza Valenciennes caught in southern Brazil. They were identified as Ligophorus uruguayense Failla Siquier et Ostrowski de Núñez, 2009 and Ligophorus saladensis Marcotegui et Martorelli, 2009, even though specific identification proved to be difficult due to inconsistencies in some diagnostic features reported for these two species. Therefore, a combined morphological and molecular approach was used to critically review the validity of these species, by means of phase contrast and confocal fluorescence microscopical examination of sclerotised hard parts, and assessing the genetic divergence between L. saladensis, L. uruguayense and their congeners using rDNA sequences. The main morphological differences between the two species relate to the shape of the accessory piece of the penis and the median process of the ventral bar. The accessory piece in L. uruguayense is shorter than in L. saladensis, has a cylindrical, convex upper lobe and straight lower lobe (vs with the distal tip of the lower lobe turning away from the upper lobe in the latter species). The ventral bar has a V-shaped anterior median part in L. uruguayense (vs U-shaped in L. saladensis). The two species are suggested to be part of a species complex together with L. mediterraneus Sarabeev, Balbuena et Euzet, 2005. We recommend to generalise such comparative assessment of species of Ligophorus for a reliable picture of the diversity and diversification mechanisms within the genus, and to make full use of its potential as an additional marker for mullet taxonomy and systematics.

  20. Nerocila sp. (Isopoda: Cymothoidae parasitizing Mugil liza (Teleostei: Mugilidae in São Francisco do Sul, Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Juliano Santos Gueretz


    Full Text Available Isopods from the family Cymothoidae are fish ectoparasites displaying low host specificity found commonly attached to the gills, mouth, opercular cavity, nostrils and body surface of several host species. Damage can vary according to the degree of parasitism and the infestation site and may provoke respiratory discomfort in hosts. The aim of this study was to report the occurrence of a Nerocila sp. Leach, 1818 isopod parasitizing Mugil liza Valenciennes, 1836 captured in the Babitonga Bay, Santa Catarina State, Brazil. The female parasite specimen was recovered from the pectoral fin of M. liza and was 24 mm in length and 11 mm in width, and the mean egg size was 1.18 ± 0.08 x 1.03 ± 0.06 mm.

  1. Three new species of Ligophorus (Monogenea: Dactylogyridae) on the gills of Mugil cephalus (Teleostei: Mugilidae) from the Japan Sea. (United States)

    Rubtsova, Nataliya Y; Balbuena, Juan A; Sarabeev, Volodimir L


    Comparative morphology and multivariate morphometric analysis of monogeneans collected on flathead mullets Mugil cephalus from 2 Russian localities of the Japan Sea revealed the presence of 3 new species of Ligophorus, namely, L. domnichi n. sp., L. pacificus n. sp., and L. cheleus n. sp., which are described herein. So far, only 1 species of dactylogyrid monogenean identified as Ligophorus chabaudi was known on flathead mullets in this sea, but after comparison with the present material, we propose that this form actually represents L. domnichi n. sp. Results support previous zoogeographical evidence, suggesting that flathead mullets from different seas harbor different species complexes of Ligophorus. One interesting finding is that the 3 new species have a U-shaped ovary, whereas ovate ovaries have been reported in previous descriptions of species of the genus, e.g., L. vanbenedenii, L. parvicirrus, L. imitans, and L. chongmingensis. The U-shaped ovary was revealed only when the worms were observed in lateral view. The additional examination of L. vanbenedenii, L. parvicirrus, L. imitans, and L. pilengas specimens from our collections also revealed a U-shaped ovary in these forms as well. Further studies should establish whether or not this character is shared by all members of the genus.

  2. Assessing population-level morphometric variation of the Mountain Mullet Agonostomus monticola (Teleostei: Mugilidae across its Middle American distribution

    Directory of Open Access Journals (Sweden)

    Bertha P. Díaz-Murillo


    Full Text Available ABSTRACT Population-level morphometric variation of the Mountain Mullet (Agonostomus monticola was assessed in 419 adult specimens from 25 sample sites (river basins across its Middle American distribution (Pacific and Atlantic-Caribbean drainages. This analysis was based on 36 standardized linear measurements and 19 landmarks on geometric morphometrics approach. Discriminant function analysis (DFA revealed 19 linear morphological characters with significant variation among groups. Geometrically, the most notable changes were associated to the curvature of the frontal region of the head, the anterior and posterior insertion of the first dorsal and anal fins. The resulting grouping based on the DFA and geometric morphometrics techniques (Pacific-A, Pacific-B and NE México-Caribbean were similar to those previously recovered by genetic techniques, where the Pacific-B (Ayuquila river basin was the most different group. Our results provide morphological evidence for considering Agonostomus monticola as a complex of evolutionary entities, represented by two forms in the Pacific Ocean and another in the Atlantic Ocean.

  3. The sagittal otolith morphology of four selected mugilid species from Iranian waters of the Persian Gulf (Teleostei: Mugilidae

    Directory of Open Access Journals (Sweden)

    Vahideh Salehi


    Full Text Available The members of mugilid species are usually difficult to recognize because of the well-known similarity observed in their external morphology. Nevertheless, their identification is very important for local fisheries management and conservation action. Therefore, in the present study we applied otolith morphology to evaluate its significance in identification of four selected mugilid species; Chelon subviridis (Valenciennes, 1836, Liza klunzingeri (Day, 1888, Ellochelon vaigiensis (Quoy & Gaimard, 1825 and Mugil cephalus Linnaeus, 1758 occurring in the Iranian waters of the Persian Gulf in southern Iran. The results indicated several otolith features to be important for identification of the selected mugilid species as follow; the position and sulcus centrality, the curvature of the cauda, and the type of anterior and posterior regions. Based on the total approach evidences, we conclude that otolith morphology in mugilid fishes can be evidently used for the species identification and probably estimation of their phylogeny. The findings are in agreement with the previous studies which documented taxonomic importance of otolith morphology.

  4. Karyotype supporting Mugil curema Valenciennes, 1836 and Mugil gaimardianus Desmarest, 1831 (Mugilidae: Teleostei as two valid nominal species

    Directory of Open Access Journals (Sweden)

    Mauro Nirchio


    Full Text Available In this study, we present the karyotypic features of two taxa, curema and gaimardianus (genus Mugil, supposed to be synonyms by some authors. Their cytogenetic differences are conspicuous and unambiguous, providing evidence that Mugil curema and Mugil gaimardanus are two valid nominal species.

  5. Phylogeny and biogeography of 91 species of heroine cichlids (Teleostei: Cichlidae) based on sequences of the cytochrome b gene. (United States)

    Pérez, Gustavo A Concheiro; Rícan, Oldrich; Ortí, Guillermo; Bermingham, Eldredge; Doadrio, Ignacio; Zardoya, Rafael


    Heroini constitute the second largest tribe of Neotropical cichlids and show their greatest diversity in Mesoamerica. Although heroine species are morphologically and ecologically very diverse, they were all historically assigned to one single genus, Cichlasoma that was never formally revised from a phylogenetic point of view. Here, we present the most comprehensive molecular phylogeny of the tribe Heroini to date, based on the complete DNA sequence of the mitochondrial gene cytochrome b, and the analysis of 204 individuals representing 91 species. Phylogenetic analyses did not support the monophyly of heroines because the genus Pterophyllum was placed as the sister group of all remaining heroines plus cichlasomatines. However, the recovered relative position of Pterophyllum was without strong statistical support. Within the remaining heroines, Hyspelecara and Hoplarchus are recovered with low support in a basal position with respect to a clade that includes Heros, Uaru, Mesonauta, and Symphysodon, and the circumamazonian (CAM) heroines. The first clade is restricted to South America. The largest clade of heroines, the CAM heroines, include more than 85% of the species within the tribe. This clade is mostly Mesoamerican, but also contains four species found in the Greater Antilles (Nandopsis), and three genera found in South America (the 'Heros' festae group, Australoheros, and Caquetaia). Up to eight major lineages can be recovered within the CAM heroines, but the phylogenetic relationships among them remain unresolved. Two large suprageneric groups can be distinguished, the amphilophines and the herichthyines. The amphilophines include Amphilophus, Archocentrus, Hypsophrys, Neetroplus, Parachromis, Petenia, and five additional unnamed genera (the 'Heros' istlanus group, the 'Amphilophus' calobrensis group, the 'Heros' urophthalmus group, the 'Heros' wesseli group, and the 'Heros' sieboldii group). The herichthyines include the crown-group herichthyines (Herichthys, Theraps, Vieja, and Paratheraps) and the genera Tomocichla, Herotilapia, and Thorichthys, together with three unnamed genera (the 'Heros' umbriferus group, the 'Heros' grammodes group, and the 'Heros' salvini group). Amphilophines are prevalent in southern Mesomerica south of the Motagua fault. Herichthyines have basal linages in Central America, whereas crown-group herichthyines and three related genera are found north from the Motagua fault. At least two independent origins are required to explain current Mesoamerican heroine distribution. Dispersal of heroines from South America into Mesoamerica was dated between 24 and 16 million years ago (MYA) based on geological calibrations and on standard fish mitochondrial cytochrome b rates, respectively. These datings cannot be reconciled with currently known geological evidence, and the existence of a connection between Central America and South America in the Miocene needs to be postulated in order to explain the origins of Mesoamerican heroine lineages. However, our datings agree with those estimated for the dispersal of other secondary freshwater fishes (Rivulidae, Synbranchus) into Mesoamerica, and predate the invasion of primary freshwater fishes by at least 10 myr.

  6. Buccal venom gland associates with increased of diversification rate in the fang blenny fish Meiacanthus (Blenniidae; Teleostei). (United States)

    Liu, Shang-Yin Vanson; Frédérich, Bruno; Lavoué, Sébastien; Chang, Jonathan; Erdmann, Mark V; Mahardika, Gusti Ngurah; Barber, Paul H


    At the macroevolutionary level, many mechanisms have been proposed to explain explosive species diversification. Among them morphological and/or physiological novelty is considered to have a great impact on the tempo and the mode of diversification. Meiacanthus is a genus of Blenniidae possessing a unique buccal venom gland at the base of an elongated canine tooth. This unusual trait has been hypothesized to aid escape from predation and thus potentially play an important role in their pattern of diversification. Here, we produce the first time-calibrated phylogeny of Blenniidae and we test the impact of two morphological novelties on their diversification, i.e. the presence of swim bladder and buccal venom gland, using various comparative methods. We found an increase in the tempo of lineage diversification at the root of the Meiacanthus clade, associated with the evolution of the buccal venom gland, but not the swim bladder. Neither morphological novelty was associated with the pattern of size disparification in blennies. Our results support the hypothesis that the buccal venom gland has contributed to the explosive diversification of Meiacanthus, but further analyses are needed to fully understand the factors sustaining this burst of speciation. Copyright © 2018 Elsevier Inc. All rights reserved.

  7. Crecimiento y mortalidad natural del pez Haemulon aurolineatum (Teleostei: Haemulidae del suroeste de la isla de Margarita, Venezuela

    Directory of Open Access Journals (Sweden)

    Edwis Bravo


    Full Text Available Se determinó el crecimiento y la mortalidad natural del cují (Haemulon aurolineatum del suroeste de la isla de Margarita, entre julio 2005 hasta junio 2006, para lo cual se analizó una muestra de 2 541 ejemplares colectados de la pesca artesanal de Boca del Río. La relación talla-peso entre machos y hembras no mostró diferencias significativas en las pendientes "b" (p>0.05, ts = -1.69 ni en los interceptos "a" (p>0.05, ts = -1.01, por lo que se estableció una relación común para ambos sexos, expresada mediante el modelo P = 0.038*LT2.87. A partir de los datos de distribución de frecuencia de tallas se estimó la longitud asintótica (L∞ con la rutina de Powell-Wetherall, y el coeficiente de crecimiento (k con la rutina ELEFAN I (Gayanilo et al.1996. Se empleó el análisis de la progresión modal, previa descomposición de la frecuencia de longitudes de acuerdo al método de Bhattacharya (1967, y se optimizaron las estimaciones de L∞ y k según Gulland y Holt (1959. Los parámetros de crecimiento estimados (L∞ = 24.2 cm y k = 0.48 año-1 mostraron un crecimiento moderadamente rápido. Los datos de frecuencias de longitudes fueron ajustados al modelo de von Bertalanffy (1960, mostrando una tendencia de tipo exponencial, donde se observó un crecimiento acelerado hasta los 2 años de edad, que luego se hizo lento a medida que el pez alcanzó la longitud máxima. La tasa de mortalidad natural fue alta (M = 1.15 año-1, probablemente causada por alta depredación.

  8. A Ploidy Difference Represents an Impassable Barrier for Hybridisation in Animals. Is There an Exception among Botiid Loaches (Teleostei: Botiidae)?

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula; Šlechta, Vlastimil; Šlechtová, Věra; Sember, Alexandr; Ráb, Petr


    Roč. 11, č. 7 (2016), e0159311-e0159311 E-ISSN 1932-6203 R&D Projects: GA ČR GA13-37277S Institutional support: RVO:67985904 Keywords : molecular phylogeny * genetic data Subject RIV: EG - Zoology Impact factor: 2.806, year: 2016

  9. A quantitative description of the reproductive biology of the Mediterranean blenny Aidablennius sphynx (Teleostei, Blenniidae) in its natural habitat

    NARCIS (Netherlands)

    Kraak, SBM

    This paper describes the reproductive behaviour of Aidablennius sphynx, which was studied in the field during four breeding seasons. Artificial nest sites were used for the determination of nest contents. The breeding season started at the end of April, when water temperature had just reached 14-15

  10. Impact of chronic cadmium exposure at environmental dose on escape behaviour in sea bass (Dicentrarchus labrax L.; Teleostei, Moronidae)

    International Nuclear Information System (INIS)

    Faucher, Karine; Fichet, Denis; Miramand, Pierre; Lagardere, Jean-Paul


    The effect of chronic exposure to a low concentration (0.5 μg l -1 ) of cadmium ions was investigated on escape behaviour of sea bass, Dicentrarchus labrax, using video analysis. Observations were also performed on the microanatomy of lateral system neuromasts. When fish were exposed for 4 h per day over 8 days to the cadmium ions, most of both types of neuromasts observed remained intact. However, some of them presented damaged sensory maculae. Whereas before cadmium exposure, fish responded positively to nearly all the lateral system stimulations, after exposure they decreased by about 10% their positive responses to stimulations. From the 15th day after the beginning of cadmium exposure, neuromasts presented progressively less damage, cadmium accumulation in gills and scales decreased significantly and fish escape behaviour had recovered. This study presents a new concept in ecotoxicology: using behavioural change to reveal the effects of pollution levels, scarcely detectable by currently used techniques (physiological responses). - Cadmium exposure involved a significant bioaccumulation in fish scales, slight damage to the lateral line system and a significant decrease in fish escape behaviour

  11. Understanding morphological variability in a taxonomic context in Chilean diplomystids (Teleostei: Siluriformes, including the description of a new species

    Directory of Open Access Journals (Sweden)

    Gloria Arratia


    Full Text Available Following study of the external morphology and its unmatched variability throughout ontogeny and a re-examination of selected morphological characters based on many specimens of diplomystids from Central and South Chile, we revised and emended previous specific diagnoses and consider Diplomystes chilensis, D. nahuelbutaensis, D. camposensis, and Olivaichthys viedmensis (Baker River to be valid species. Another group, previously identified as Diplomystes sp., D. spec., D. aff. chilensis, and D. cf. chilensis inhabiting rivers between Rapel and Itata Basins is given a new specific name (Diplomystes incognitus and is diagnosed. An identification key to the Chilean species, including the new species, is presented. All specific diagnoses are based on external morphological characters, such as aspects of the skin, neuromast lines, and main lateral line, and position of the anus and urogenital pore, as well as certain osteological characters to facilitate the identification of these species that previously was based on many internal characters. Diplomystids below 150 mm standard length (SL share a similar external morphology and body proportions that make identification difficult; however, specimens over 150 mm SL can be diagnosed by the position of the urogenital pore and anus, and a combination of external and internal morphological characters. According to current knowledge, diplomystid species have an allopatric distribution with each species apparently endemic to particular basins in continental Chile and one species (O. viedmensis known only from one river in the Chilean Patagonia, but distributed extensively in southern Argentina.

  12. An evaluation of fossil tip-dating versus node-age calibrations in tetraodontiform fishes (Teleostei: Percomorphaceae). (United States)

    Arcila, Dahiana; Alexander Pyron, R; Tyler, James C; Ortí, Guillermo; Betancur-R, Ricardo


    Time-calibrated phylogenies based on molecular data provide a framework for comparative studies. Calibration methods to combine fossil information with molecular phylogenies are, however, under active development, often generating disagreement about the best way to incorporate paleontological data into these analyses. This study provides an empirical comparison of the most widely used approach based on node-dating priors for relaxed clocks implemented in the programs BEAST and MrBayes, with two recently proposed improvements: one using a new fossilized birth-death process model for node dating (implemented in the program DPPDiv), and the other using a total-evidence or tip-dating method (implemented in MrBayes and BEAST). These methods are applied herein to tetraodontiform fishes, a diverse group of living and extinct taxa that features one of the most extensive fossil records among teleosts. Previous estimates of time-calibrated phylogenies of tetraodontiforms using node-dating methods reported disparate estimates for their age of origin, ranging from the late Jurassic to the early Paleocene (ca. 150-59Ma). We analyzed a comprehensive dataset with 16 loci and 210 morphological characters, including 131 taxa (95 extant and 36 fossil species) representing all families of fossil and extant tetraodontiforms, under different molecular clock calibration approaches. Results from node-dating methods produced consistently younger ages than the tip-dating approaches. The older ages inferred by tip dating imply an unlikely early-late Jurassic (ca. 185-119Ma) origin for this order and the existence of extended ghost lineages in their fossil record. Node-based methods, by contrast, produce time estimates that are more consistent with the stratigraphic record, suggesting a late Cretaceous (ca. 86-96Ma) origin. We show that the precision of clade age estimates using tip dating increases with the number of fossils analyzed and with the proximity of fossil taxa to the node under assessment. This study suggests that current implementations of tip dating may overestimate ages of divergence in calibrated phylogenies. It also provides a comprehensive phylogenetic framework for tetraodontiform systematics and future comparative studies. Copyright © 2014 Elsevier Inc. All rights reserved.

  13. A new mesophotic goby, Palatogobius incendius (Teleostei: Gobiidae, and the first record of invasive lionfish preying on undescribed biodiversity.

    Directory of Open Access Journals (Sweden)

    Luke Tornabene

    Full Text Available A new species of deep-reef fish in the goby genus Palatogobius is described from recent submersible collections off Curaçao and Dominica. Video footage of schools of this species reveal predation by the invasive Indo-Pacific lionfish (Pterois spp., the first record of undescribed fauna potentially being eaten by lionfish outside of its native range. We present molecular phylogenetic data for all valid species of Palatogobius and related genera, as well as a taxonomic key to the species of Palatogobius and a generic key to Palatogobius and related genera in the western Atlantic. Lastly, we discuss ecological and behavioral aspects of some deep-reef fishes in light of potential threats from invasive lionfish.

  14. Three sympatric karyomorphs in the fish Astyanax fasciatus (Teleostei, Characidae do not seem to hybridize in natural populations

    Directory of Open Access Journals (Sweden)

    Maressa Ferreira-Neto


    Full Text Available Ninety individuals of the characid fish Astyanax fasciatus (Cuvier, 1819 were collected at Água da Madalena stream (Botucatu, São Paulo, Brazil and analyzed for diploid chromosome number 2n and karyotype composition as well as for the chromosomal location of the 5S and 18S ribosomal DNA (rDNA. Whereas no chromosome differences were associated with sex, three different karyomorphs with diploid chromosome numbers 2n=46, 2n=48 and 2n=50 were found. No intermediate 2n numbers were discovered. The 2n=50 karyomorph showed some differences in 18S rDNA location compared to the two other karyomorphs. Finally, all specimens with the 2n=46 karyomorph showed the presence of a partly heterochromatic macro supernumerary chromosome, which was absent in all individuals with the two other karyomorphs. All these results suggest that indviduals of the three different karyomorphs are not likely to hybridize in the examined populations. Our findings strongly suggest the presence of three separate species (sensu biological species concept easily diagnosed on the basis of differences in the diploid chromosome numbers and other chromosomal markers.

  15. Cardiorespiratory responses of the facultative air-breathing fish jeju, Hoplerythrinus unitaeniatus (Teleostei, Erythrinidae), exposed to graded ambient hypoxia. (United States)

    Oliveira, R D; Lopes, J M; Sanches, J R; Kalinin, A L; Glass, M L; Rantin, F T


    The jeju, Hoplerythrinus unitaeniatus, is equipped with a modified part of the swim bladder that allows aerial respiration. On this background, we have evaluated its respiratory and cardiovascular responses to aquatic hypoxia. Its aquatic O2 uptake (V(O2)) was maintained constant down to a critical P(O2) (P(cO2)) of 40 mm Hg, below which V(O2) declined linearly with further reductions of P(iO2). Just below P(cO2), the ventilatory tidal volume (V(T)) increased significantly along with gill ventilation (V(G)), while respiratory frequency changed little. Consequently, water convection requirement (V(G)/V(O2)) increased steeply. The same threshold applied to cardiovascular responses that included reflex bradycardia and elevated arterial blood pressure (P(a)). Aerial respiration was initiated at water P(O2) of 44 mm Hg and breathing episodes and time at the surface increased linearly with more severe hypoxia. At the lowest water P(O2) (20 mm Hg), the time spent at the surface accounted for 50% of total time. This response has a character of a temporary emergency behavior that may allow the animal to escape hypoxia.

  16. Postglacial recolonization of eastern Blacknose Dace,Rhinichthys atratulus(Teleostei: Cyprinidae), through the gateway of New England. (United States)

    Tipton, Michelle L; Gignoux-Wolfsohn, Sarah; Stonebraker, Phoebe; Chernoff, Barry


    During the last ice age, much of North America far south as 40°N was covered by glaciers (Hewitt 2000). About 20,000 years ago, as the glaciers retreated, the hydrologic landscape changed dramatically creating waterways for fish dispersal. The number of populations responsible for recolonization and the regions from which they recolonized are unknown for many freshwater fishes living in New England and southeastern Canada. The Blacknose Dace,Rhinichthys atratulus, is one of the freshwater fish species that recolonized this region. We hypothesize that the earliest deglaciated region, modern-day Connecticut, was recolonized byR. atratulusvia a single founding event by a single population. In this paper, we test this hypothesis phylogenetically with regard to the major drainage basins within Connecticut. The mitochondrial DNA exhibits low nucleotide diversity, high haplotype diversity, and a dominant haplotype found across the state. A small percentage of individuals in the Housatonic drainage basin, however, share a haplotype with populations in New York drainage basins, a haplotype not found elsewhere in Connecticut's drainage basins. We calculated a range for the rate of divergence for NADH dehydrogenase subunit 2 (nd2) and control region (ctr) of 4.43-6.76% and 3.84-8.48% per million years (my), respectively. While this range is higher than the commonly accepted rate of 2% for mitochondrial DNA, these results join a growing list of publications finding high rates of divergence for various taxa (Peterson and Masel 2009). The data support the conclusion that Connecticut as a whole was recolonized initially by a single founding event that came from a single refugium. Subsequently, the Housatonic basin alone experienced a secondary recolonization event.

  17. Estudos ultraestruturais da glândula de Mehlis de Metamicrocotyla macracantha (Monogenea, Microcotylidae parasito de Mugil liza (Teleostei

    Directory of Open Access Journals (Sweden)

    Maria de Fatima Diniz Baptista Farias


    Full Text Available The ultrastructure of Mehlis' gland of Metamicrocotyla macracantha, a gill parasite collected from Mugil liza from Rio de Janeiro, Brazil, was studied by transmission electron microscopy. The Mehlis' gland consists of two types of secretory cells, S1 and S2, each producing a different secretory body. The S1 bodies are spherical, lamellae-like and were observed in different stages of development in the cytoplasm of these cells. The S2 bodies are spherical to ovoid with dense content, showing a crystalline structure. The cytoplasm of Mehlis' gland cells contains also free ribosomes, granular endoplasmatic reticulum and Golgi complex, characteristic organelles of secretory cells.

  18. Population structure and reproduction of Menticirrhus americanus (Linnaeus, 1758 (Teleostei, Sciaenidae in Ubatuba-Enseada Bay, Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Carolina Ferreira Haluch


    Full Text Available Population structure and reproductive aspects of the southern kingfish Menticirrhus americanus in Santa Catarina northern coast were investigated. Trawl nets were used for the monthly surveys between October (2003 and September (2004. A total of 425 individuals between 4.2 and 31.8cm (mean 12.7 ± 5.7 were analyzed, and the majority of the individuals (4.2 to12.5cm was captured mainly in summer, autumn and winter, while larger individuals were captured in spring. Females of all size classes were predominant during summer and winter, and weight/length relationship showed significant differences between sexes and a positive alometric growth for the species. The size at first maturity (L50 was estimated in 16.7cm for females and 15.4cm for males. The reproductive period occurred in warm seasons, and M. americanus showed multiple spawning. The hepatossomatic index demonstrated a similar seasonal pattern as the gonadosomatic index, and was a good indicator of the spawning. The condition factor wasn’t a good indicator of the spawning period, but it was related with the recovery process and gonad maturation. Characteristics of the population dynamic showed that M. americanus utilizes the study area for reproduction and recruitment.

  19. Not a simple case - A first comprehensive phylogenetic hypothesis for the Midas cichlid complex in Nicaragua (Teleostei: Cichlidae: Amphilophus). (United States)

    Geiger, Matthias F; McCrary, Jeffrey K; Schliewen, Ulrich K


    Nicaraguan Midas cichlids from crater lakes have recently attracted attention as potential model systems for speciation research, but no attempt has been made to comprehensively reconstruct phylogenetic relationships of this highly diverse and recently evolved species complex. We present a first AFLP (2793 loci) and mtDNA based phylogenetic hypothesis including all described and several undescribed species from six crater lakes (Apoyeque, Apoyo, Asososca Leon, Masaya, Tiscapa and Xiloá), the two great Lakes Managua and Nicaragua and the San Juan River. Our analyses demonstrate that the relationships between the Midas cichlid members are complex, and that phylogenetic information from different markers and methods do not always yield congruent results. Nevertheless, monophyly support for crater lake assemblages from Lakes Apoyeque, Apoyo, A. Leon is high as compared to those from L. Xiloá indicating occurrence of sympatric speciation. Further, we demonstrate that a 'three species' concept for the Midas cichlid complex is inapplicable and consequently that an individualized and voucher based approach in speciation research of the Midas cichlid complex is necessary at least as long as there is no comprehensive revision of the species complex available. Copyright 2010 Elsevier Inc. All rights reserved.

  20. Discovery of the oldest .i.Gobius./i. (Teleostei, Gobiiformes) from a marine ecosystem of Early Miocene age

    Czech Academy of Sciences Publication Activity Database

    Reichenbacher, B.; Gregorová, R.; Holcová, K.; Šanda, R.; Vukić, J.; Přikryl, Tomáš


    Roč. 16, č. 6 (2018), s. 493-513 ISSN 1477-2019 R&D Projects: GA ČR(CZ) GA16-21523S Institutional support: RVO:67985831 Keywords : Gobiidae * Miocene * comparative anatomy * marine ecosystem * Outer Carpathian flysh zone * Outer Carpathian flysch zone * Ždánice-Hustopeče Formation Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 2.963, year: 2016

  1. Cultivo primário de células hepáticas de Metynnis roosevelti (Pisces, Teleostei, Characidae

    Directory of Open Access Journals (Sweden)

    Ligia Maria Salvo


    Full Text Available A fim de obter culturas celulares e monocamada de células hepáticas do peixe subtropical Metynnis roosevelti, foram comparadas três metodologias: dissociação celular enzimática com tripsina versene 0,25%; utilização do soro fetal bovino; e soro homólogo, obtido por meio da punção da veia caudal, de exemplares adultos da mesma espécie de peixe. O meio de cultura utilizado foi F10-199 acrescido de L-glutamina 2 mM, insulina 10 µg/mL, fibronectina 50 µg/mL; e antibióticos. A dissociação celular enzimática apresentou maior eficiência na adesão e confluência da monocamada celular em comparação a outras metodologias utilizadas.

  2. Histological and allometric growth analysis of eye in Caspian kutum, Rutilus kutum Kamensky, 1901 (Teleostei: Cyprinidae during early developmental stages

    Directory of Open Access Journals (Sweden)

    Shaghayegh Hasanpour


    Full Text Available Fish larvae have several sensory systems that are functional at or soon after hatching and then are developed further during larval and juvenile stages. This study was conducted to investigate development of the eye in Rutilus kutum, based on histological and allometric growth analysis during early developmental stages up to 35 day post hatching with emphasis on retinal morphology. For this purpose, the histological sections were prepared and allometric growth pattern of the eye was calculated. The results showed that the most eye’s structures along with the retina of the newly hatched larvae, as the inner sensory (photosensitive tissue were completely differentiated. Allometric growth pattern of the eye diameter up to the inflexion point (7 dph was somewhat positive and then it became negative. The results revealed that the Caspian kutum is dependence on visual capability as visual feeder during their larval period which itself explains completion of eye structures and the high growth rate of eye before 3 dph i.e. beginning of mixed feeding.

  3. A new vision of the origin and the oocyte development in the Ostariophysi applied to Gymnotus sylvius (Teleostei: Gymnotiformes

    Directory of Open Access Journals (Sweden)

    Gisleine Fernanda França

    Full Text Available Based on new knowledge coming from marine perciform species, the origin of oocytes and their development in the Ostariophysi, Gymnotus sylvius is described. In both Gymnotus sylvius and marine perciform fish, oogonia are found in the germinal epithelium that forms the surface of the ovarian lamellae. At the commencement of folliculogenesis, proliferation of oogonia and their entrance into meiosis gives rise to germ cell nests that extend into the stroma from the germinal epithelium. Both cell nests and the germinal epithelium are supported by the same basement membrane that separates them from the stroma. At the time of meiotic arrest, oocytes in a cell nest become separated one from the other as processes of prefollicle cells, these being derived from epithelial cells in the germinal epithelium, gradually encompass and individualize them while also synthesizing a basement membrane around themselves during folliculogenesis. The oocyte enters primary growth while still within the cell nest. At the completion of folliculogenesis, the oocyte and follicle cells, composing the follicle, are encompassed by a basement membrane. The follicle remains connected to the germinal epithelium as the both share a portion of common basement membrane. Cells originating from the stroma encompass the ovarian follicle, except where there is a shared basement membrane, to form the theca. The follicle, basement membrane and theca form the follicular complex. Oocyte development occurs inside the follicular complex. Development is divided into the stages primary and secondary growth, oocyte maturation and ovulation. Cortical alveoli appear in the ooplasm just prior to the beginning of secondary growth, the vitellogenic stage that begins with yolk deposition and proceeds until the oocyte is full-grown and the ooplasm is filled with yolk globules. Maturation is characterized by the germinal vesicle or nuclear migration, germinal vesicle breakdown or nuclear envelop fragmentation and the resumption of meiosis. At the ovulation the egg is released from the follicular complex into the ovarian lumen. When compared to marine Perciformes that lay pelagic eggs, oocyte development in Gymnotus sylvius has fewer steps within the stages of development, the two most remarkable being the absence of oil droplet formation during primary and secondary growth, (and the consequent absence of the oil droplets fusion during maturation, and the hydrolysis of yolf preceding ovulation.

  4. General characteristics of the diet of Trachinotus paitensis (Teleostei: Carangidae) from San Ignacio Lagoon, Baja California Sur, Mexico. (United States)

    Cruz Escalona, V H; Abitia Cárdenas, L A


    The food habits of Trachinotus paitensis, in San Ignacio Lagoon B.C.S., Mexico, were investigated. We observed that T. paitensis is carnivorous, feeding mainly on benthic invertebrates (the gastropods Anachis spp., Bittium spp., and the crustacean larvae). We concluded that T. paitensis is an opportunist predator that impacts mainly on epibenthic invertebrates.

  5. Impact of chronic cadmium exposure at environmental dose on escape behaviour in sea bass (Dicentrarchus labrax L.; Teleostei, Moronidae)

    Energy Technology Data Exchange (ETDEWEB)

    Faucher, Karine [Centre de Recherche sur les Ecosystemes Littoraux Anthropises, UMR 6217, CNRS-Ifremer-ULR, B.P. 5, 17137 L' Houmeau (France)], E-mail:; Fichet, Denis; Miramand, Pierre [Centre de Recherche sur les Ecosystemes Littoraux Anthropises, UMR 6217, CNRS-Ifremer-ULR, Avenue Michel Crepeau, 17042 La Rochelle (France); Lagardere, Jean-Paul [Centre de Recherche sur les Ecosystemes Littoraux Anthropises, UMR 6217, CNRS-Ifremer-ULR, B.P. 5, 17137 L' Houmeau (France)


    The effect of chronic exposure to a low concentration (0.5 {mu}g l{sup -1}) of cadmium ions was investigated on escape behaviour of sea bass, Dicentrarchus labrax, using video analysis. Observations were also performed on the microanatomy of lateral system neuromasts. When fish were exposed for 4 h per day over 8 days to the cadmium ions, most of both types of neuromasts observed remained intact. However, some of them presented damaged sensory maculae. Whereas before cadmium exposure, fish responded positively to nearly all the lateral system stimulations, after exposure they decreased by about 10% their positive responses to stimulations. From the 15th day after the beginning of cadmium exposure, neuromasts presented progressively less damage, cadmium accumulation in gills and scales decreased significantly and fish escape behaviour had recovered. This study presents a new concept in ecotoxicology: using behavioural change to reveal the effects of pollution levels, scarcely detectable by currently used techniques (physiological responses). - Cadmium exposure involved a significant bioaccumulation in fish scales, slight damage to the lateral line system and a significant decrease in fish escape behaviour.

  6. Sexual development and reproductive pattern of the Mutton hamlet, Alphestes afer (Teleostei: Epinephelidae: a dyandric, hermaphroditic reef fish

    Directory of Open Access Journals (Sweden)

    Simone Marques

    Full Text Available There is little knowledge on the reproduction of the genus Alphestes. The reproduction of the Mutton hamlet, Alphestes afer, sampled in Pernambuco reefs (Brazil was studied based on macroscopic analysis during reproductive period and histological analysis of gonad material from March 2008 to October 2009. This study showed that A. afer is a diandric, protogynous hermaphrodite. Sex change followed protogynous mode in two pathways: primary males formed from immature female individuals or secondary males formed from resting, ripe or spent female individuals. The numerical distribution of gonad classes by size indicated that females from 11-18 cm L T were immature while females from 16-25 cm L T and males from 12-22 cm L T were in various stages of gonadal development. Individuals identified as immature bisexual and transitional (presenting both ovarian and sperm tissue were sized from 16-24 cm L T. Size of first reproduction for females was 18 cm L T and for males was 12 cm L T. Alphestes afer showed multiple spawning, with spawning season period from August to December 2008 and from August to October 2009. The sex-ratio (females: males in 2008 and 2009 was 0.94:1 during the months of spawning season. Males were smaller than females, reaching maximum size of 22 cm compared to 25 cm observed for females. Males showed a high sperm competition rank (3.8, suggesting intense sperm competition. This latter is a possible indication of a shift in the mating group structure from paired to group spawning. The presence of small males added to high sperm competition index, suggest that this species, while retaining the protogynous pattern, has a reproductive strategy similar to gonochorist epinephelids.

  7. Capillostrongyloides morae sp. n. (Nematoda: Capillariidae) from deep-sea fish (Teleostei, Moridae) in the western Mediterranean Sea

    Czech Academy of Sciences Publication Activity Database

    González-Solís, David; Carrasson, M.; Pérez-del-Olmo, A.


    Roč. 61, č. 1 (2014), s. 63-68 ISSN 0015-5683 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Gadiformes * Lepidion lepidion * Mora moro * Spain Subject RIV: EG - Zoology Impact factor: 1.147, year: 2014

  8. Comparative cytogenetics of two endangered leuciscine fish, Squalius aradensis and S. torgalensis (Teleostei, Cyprinidae, from the Iberian Peninsula

    Directory of Open Access Journals (Sweden)

    Catarina Nabais


    Full Text Available In this study, the description of the karyotypes of the endangered chubs Squalius aradensis (Coelho, Bogutskaya, Rodrigues and Collares-Pereira, 1998 and Squalius torgalensis (Coelho, Bogutskaya, Rodrigues and Collares-Pereira, 1998 is presented by means of conventional (Giemsa-staining, Chromomycin A3 (CMA3-fluorescence, Silver-impregnation (Ag-NORs and molecular (fluorescence in situ hybridization (FISH with 18S rDNA probe protocols. These endemic sister-species have an allopatric but adjacent distribution in the most southwestern part of the Iberian Peninsula. Diploid chromosome number was invariably 2n = 50 and karyotypes of both species were grossly similar, composed of metacentric and submetacentric elements with a reduced number of acrocentric pairs. Sequential staining using FISH with an 18S rDNA probe, CMA3 and Ag-NORs treatments revealed consistent positive signals located at the end of the short arms of a submetacentric chromosome pair, likely homologous in both species. While providing useful cytogenetic comparative data against other members of the genus Squalius Bonaparte, 1837, the work aimed to draw attention towards the conservation of two narrow-range and highly confined fish species.

  9. Characterization of the ovary fatty acids composition of Rhamdia quelen (Quoy & Gaimard (Teleostei: Siluriformes, throughout their reproductive cycle

    Directory of Open Access Journals (Sweden)

    Rodrigo Vargas Anido

    Full Text Available Knowledge about gonad fatty acid composition is important for broodstock diet formulation. This study characterized ovary fatty acid composition of wild female jundiá catfish (Rhamdia quelen in their different gonadal maturation stages. Female jundiá (n = 36, average weight= 383.8 + 208.8 g were captured in the rio Uruguay, comprising all seasons. Ovaries were extracted and classified according to their gonadal maturation stage. Gonad-somatic ratio varied significantly among seasons, being higher in spring (3.7, followed by summer (2.2, winter (0.9 and autumn (0.6. Main fatty acids groups detected were: saturated (SFA= 35.5%, monounsaturated (MUFA= 28.1% and polyunsaturated fatty acids (PUFA= 33.5%. Over the four seasons, palmitic acid was recorded in large quantities, followed by docosahexaenoic acid (DHA and arachidonic acid (ARA. ARA was present in higher concentrations in immature or maturing ovaries, and its content decreased along the maturation process. Conversely, DHA and eicosapentaenoic acid (EPA contents increased during maturation. Such variation resulted in an increase in EPA/ARA and DHA/ARA ratios in mature gonads, which can be important for successful breeding. Such findings suggest that jundiá broodstock diets should contain lipids that provide long chain polyunsaturated fatty acids from both the n-3 and n-6 series to ensure gonadal maturation completion.

  10. On a record of two alien fish species (Teleostei: Osphronemidae from the natural waters of Chennai, Tamil Nadu, India

    Directory of Open Access Journals (Sweden)

    J.D. Marcus Knight


    Full Text Available Aquarium trade has been the source of many alien species being introduced into the natural waters of Chennai.  Trichopsis vittata and Macropodus opercularis are being reported for the first from Chennai. However,  contrary to the propagule pressure theory both these species are not common in the aquarium trade, raising speculations of inter-basin water transfer playing a role in introducing non-native species into an ecosystem.  

  11. A macroscopic classification of the embryonic development of the one-sided livebearer Jenynsia multidentata (Teleostei: Anablepidae

    Directory of Open Access Journals (Sweden)

    Nathalia C. López-Rodríguez


    Full Text Available ABSTRACT This study proposes eight stages according to the main discernible changes recorded throughout the embryonic development of Jenynsia multidentata. The development of morphological embryo structures, pigmentation, and changes in tissues connecting mother and embryo were included in the stage characterization. From the fertilized egg (Stage 1, an embryo reaches the intermediary stages when presenting yolk syncytial layer (Stage 2, initial pigmentation of the outer layers of the retina and dorsal region of the head (Stage 3, and the sprouting of the caudal (Stage 4, dorsal and anal fins (Stage 5. During the later stages, the ovarian folds enter the gills, and the body pigmentation becomes more intense (Stage 6, the body becomes elongated (Stage 7, and there is a greater intensity in body pigmentation and increased muscle mass (Stage 8. The dry weight of the batches varied between 0.6 ± 0.3 mg (Stage 3 to 54.6 ± 19.7 mg (Stage 8, but the dry weight of the maternal-embryonic connecting tissues remained almost constant. After controlling the effect of those reproductive tissues, the gain in dry weight of the batches throughout development increased exponentially from Stage 6, reflecting the increase in size and weight of the embryos due to matrotrophy.

  12. Protogrammus alboranensis n. sp. (Teleostei: Callionymidae, a new species of dragonet from the Alboran Sea, western Mediterranean Sea

    Directory of Open Access Journals (Sweden)

    Carlos Farias


    Full Text Available Protogrammus alboranensis n. sp. is described on the basis of four specimens from the Alboran Sea, western Mediterranean Sea. It is characterized within the genus Protogrammus by a total of nine unbranched rays on the second dorsal fin, eight unbranched rays on the anal fin, a very small preopercular spine with an upcurved main tip and one point on the dorsal margin, which is lacking an antrorse spine at the base, the first and second spines of the first dorsal fin filamentous and much longer than the first ray of the second dorsal fin in males, the tip of the last ray of the second dorsal fin reaching beyond the caudal fin base in males, and the anal fin distally black in the males (translucent in females. A key to the species of Protogrammus is presented; the zoogeography of the species is discussed.

  13. The sagittal otolith morphology of four selected mugilid species from Iranian waters of the Persian Gulf (Teleostei: Mugilidae)


    Vahideh Salehi; Majid Askari Hesni; Azad Teimori; Mohammad Reza Lashkari


    The members of mugilid species are usually difficult to recognize because of the well-known similarity observed in their external morphology. Nevertheless, their identification is very important for local fisheries management and conservation action. Therefore, in the present study we applied otolith morphology to evaluate its significance in identification of four selected mugilid species; Chelon subviridis (Valenciennes, 1836), Liza klunzingeri (Day, 1888), Ellochelon vaigiensis (Quoy & Gai...

  14. A new mesophotic goby, Palatogobius incendius (Teleostei: Gobiidae), and the first record of invasive lionfish preying on undescribed biodiversity. (United States)

    Tornabene, Luke; Baldwin, Carole C


    A new species of deep-reef fish in the goby genus Palatogobius is described from recent submersible collections off Curaçao and Dominica. Video footage of schools of this species reveal predation by the invasive Indo-Pacific lionfish (Pterois spp.), the first record of undescribed fauna potentially being eaten by lionfish outside of its native range. We present molecular phylogenetic data for all valid species of Palatogobius and related genera, as well as a taxonomic key to the species of Palatogobius and a generic key to Palatogobius and related genera in the western Atlantic. Lastly, we discuss ecological and behavioral aspects of some deep-reef fishes in light of potential threats from invasive lionfish.

  15. Further evidence for the invasion and establishment of Pterois volitans (Teleostei: Scorpaenidae) along the Atlantic Coast of the United States (United States)

    Meister, H.S.; Wyanski, D.M.; Loefer, J.K.; Ross, Steve W.; Quattrini, A.M.; Sulak, K.J.


    We document the continued population expansion of red lionfish, Pterois volitans, the first documented successful introduction of an invasive marine fish species from the western Pacific to Atlantic coastal waters of the United States. Red lionfish are indigenous to the Indo-Pacific and have apparently established one or more breeding populations on reefs off the southeastern United States. Fifty-nine specimens, most presumably adult red lionfish, were documented or collected on live-bottom reefs off North Carolina, South Carolina, and Florida, and on a manmade structure off Georgia. Observation/collection depths and bottom water temperatures for these fish ranged from 40-99 m and 13.8-24.4??C, respectively. Eleven juvenile lionfish, believed to be expatriated from southeastern waters, were collected in estuaries along the coast of Long Island, NY, at depths of 0-5 m and water temperatures ranging from 13.8-16.5??C. Twelve of the total 70 specimens collected or observed were positively identified as red lionfish. Based on histological assessment of gonad tissue, two reproductively-active males and one immature female were collected. The life history of red lionfish, especially their reproductive biology and food habits, should be investigated along the east coast of the US to determine the potential impacts of this species on ecosystems they have invaded.

  16. Aporocotyle michaudi n. sp. (Digenea: Aporocotylidae) from the emerald rock cod, Trematomus bernacchii (Teleostei: Perciformes) in Antarctica. (United States)

    Santoro, Mario; Cipriani, Paolo; Pankov, Plamen; Lawton, Scott P


    Aporocotyle michaudi n. sp. is described from the gill blood vessels of the emerald rock cod Trematomus bernacchii in the Ross Sea, Antarctica. It is distinguished from all other species of Aporocotyle by its body tegument showing single conical spines, spinous buccal capsule, and genital atrium positioned medially; all congeners described to date are characterized by clusters of tegumental spines, unspined buccal capsule and genital atrium located in the lateral part of the body. Aporocotyle michaudi n. sp. clearly differs from A. notothenia (the only other species of Aporocotyle found in a perciform fish) in its shape and arrangement of tegumental spines, buccal capsule features, location of genital atrium, body size, ratio of esophagus/body length, anterior caeca/posterior caeca ratio, number of testes, cirrus sac and ovary size and shape, and host. The new species is easily distinguished from A. argentinensis (the species that most closely resembles A. michaudi) by the shape and arrangement of tegumental spines, buccal capsule features, genital atrium location, left anterior caecum longer than right, esophagus/body length ratio, number of testes, cirrus sac size and shape, host and molecular analyses. Phylogenetic analyses of partial 28S rDNA genetic data showed that sequences representing the new species form a distinct clade with all other sequences for species of Aporocotyle and appear basal within the genus. Aporocotyle michaudi n. sp. represents the only species of genus described in Antarctica. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  17. Distribution of Hatschekia pagellibogneravei (Copepoda: Hatschekiidae) on the gills of Pagellus bogaraveo (Teleostei: Sparidae) from Madeira, Portugal. (United States)

    Hermida, Margarida; Cruz, Cristina; Saraiva, Aurélia


    A population of the gill parasite Hatschekia pagellibogneravei (Hesse, 1878) was studied on one of its sparid fish hosts, the blackspot seabream, Pagellus bogaraveo (Brünnich), off the coast of Madeira Island, Portugal, northeast Atlantic. Very high infection levels of this copepod were detected, with no significant seasonal differences. Abundance was negatively correlated with fish size. There were significant differences in the distribution of this copepod among the gill arches of the host, which seem to be best explained by differences in water flow within the gill habitat.

  18. Crecimiento y mortalidad del pez Haemulon aurolineatum (Teleostei: Haemulidae en el suroeste de la isla de Margarita, Venezuela

    Directory of Open Access Journals (Sweden)

    Edwis Bravo


    Full Text Available Se determinó el crecimiento y la mortalidad natural del pez cují (Haemulon aurolineatum del suroeste de la Isla de Margarita (julio 2005 -junio 2006, para lo cual se analizó una muestra constituida por 2 541 ejemplares recolectados de la pesca artesanal de Boca del Río. La relación talla-peso entre machos y hembras no mostró diferencias significativas en las pendientes "b" (p>0.05; ts=-1.69 ni en los interceptos "a" (p>0.05; ts=-1.01, por lo que se estableció una relación común para ambos sexos: P=0.038*LT2.87. A partir de los datos de distribución de frecuencia de tallas se estimó la longitud asintótica ( aplicando la rutina de Powell-Wetherall, y el coeficiente de crecimiento (k a través de la rutina ELEFAN I (Gayanilo et al. 1996. Posteriormente se empleó el análisis de la progresión modal, previa descomposición de la frecuencia de longitudes de acuerdo al método de Bhattacharya (1967, y se optimizaron las estimaciones de y k según el procedimiento de Gulland y Holt (1959. Los parámetros de crecimiento estimados (L8=24.2 cm y k=0.48 año-1 mostraron un crecimiento moderadamente rápido. Los datos de frecuencias de longitudes fueron ajustados al modelo de von Bertalanffy (1960, indicando una tendencia de tipo exponencial: crecimiento acelerado hasta los 2 años de edad, que luego se hizo lento hasta que el pez alcanzó la longitud máxima. La tasa de mortalidad natural fue alta (M=1.15 año-1, probablemente por alta depredación.

  19. A new record of the non-native fish species Butis koilomatodon (Bleeker 1849 (Teleostei: Eleotridae for southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Riguel Feltrin Contente


    Full Text Available This work reports the second record of the Indo-Pacific invasive mud sleeper, Butis koilomatodon, for coastal São Paulo in southeastern Brazil, and represents the southernmost record for this species in the southwestern Atlantic Ocean. The risks of a potential invasion mediated by anthropogenic impacts on the area of occurrence are also discussed.

  20. A new record of the non-native fish species Butis koilomatodon (Bleeker 1849 (Teleostei: Eleotridae for southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Riguel Feltrin Contente


    Full Text Available This work reports the second record of the Indo-Pacific invasive mud sleeper, Butis koilomatodon, for coastal São Paulo in southeastern Brazil, and represents the southernmost record for this species in the southwestern Atlantic Ocean. The risks of a potential invasion mediated by anthropogenic impacts on the area of occurrence are also discussed.

  1. Protocheirodon, a new genus of Characidae (Teleostei: Characiformes with the redescription of the poorly known Protocheirodon pi

    Directory of Open Access Journals (Sweden)

    Richard P. Vari

    Full Text Available ABSTRACT Protocheirodon, a new genus of the Characidae, is proposed to include a species previously assigned to Leptagoniates . This action is supported by molecular and morphological phylogenetic hypotheses that place Protocheirodon pi as the sister group of the remaining tribes in the Cheirodontinae versus the traditional assignment of the species to the Aphyocharacinae. The phylogenetic position of Protocheirodon is recognized as a new tribe, the Protocheirodontini. Protocheirodon pi , originally described based on a small number of specimens from a single location in the río Mamoré basin in the southwestern Amazon, is redescribed on the basis of larger series of specimens from the western and central portions of the Amazon basin.

  2. Phylogenetic patterns in populations of Chilean species of the genus Orestias (Teleostei: Cyprinodontidae): results of mitochondrial DNA analysis. (United States)

    Lüssen, Arne; Falk, Thomas M; Villwock, Wolfgang


    Patterns of molecular genetic differentiation among taxa of the "agassii species complex" (Parenti, 1984) were analysed based on partial mtDNA control region sequences. Special attention has been paid to Chilean populations of Orestias agassii and species from isolated lakes of northern Chile, e.g., O. agassii, Orestias chungarensis, Orestias parinacotensis, Orestias laucaensis, and Orestias ascotanensis. Orestias tschudii, Orestias luteus, and Orestias ispi were analysed comparatively. Our findings support the utility of mtDNA control region sequences for phylogenetic studies within the "agassii species complex" and confirmed the monophyly of this particular lineage, excluding O. luteus. However, the monophyly of further morphologically defined lineages within the "agassii complex" appears doubtful. No support was found for the utility of these data sets for inferring phylogenetic relationships between more distantly related taxa originating from Lake Titicaca.

  3. Diet and food consumption of the pearl cichlid Geophagus brasiliensis (Teleostei: Cichlidae: relationships with gender and sexual maturity

    Directory of Open Access Journals (Sweden)

    Rodrigo F. Bastos

    Full Text Available Despite the importance of the pearl cichlid Geophagus brasiliensis for the aquarium fish trade worldwide and its wide distribution, many aspects of its biology, such as the relationships between its feeding ecology and reproductive behavior, are not fully understood in natural conditions on its native habitat. In this paper, we investigated its diet focusing on how differences in diet and food consumption are related to differences in gender and sexual maturity. The digestive tract of each individual was dissected and had its content analyzed, whereas each gonad was microscopically analyzed to determine gender (male/female and sexual maturity (immature/mature. A total of 28 females and 31 males were analyzed. Mature individuals were more common than immature specimens both for males (64.50% and females (64.30%. The analysis of 52 individuals with non-empty digestive tracts revealed a diet comprised of 27 items. According to the Index of Alimentary importance (%IAi, the most important food items in the diet were Gastropoda (37.30%, fragments of vascular plants (15.16%, detritus (10.14%, Amphipoda (9.24%, and fish scales (6.29%. Mature males had more empty stomachs (65.00% when compared to immature males (27.27% and immature (55.56% and mature females (40.00%. Also, mature females seemed to have more food consumption (greater mean values of total volume in their digestive tracts than mature males. Some hypotheses are proposed in order to distinguish if this gender-based difference in food consumption in mature individuals of the pearl cichlid could be associated with the development of primary and secondary sexual characteristics or with asymmetrical time invested in parental care activities.

  4. Comparative proteome and peptidome analysis of the cephalic fluid secreted by Arapaima gigas (Teleostei: Osteoglossidae) during and outside parental care. (United States)

    Torati, Lucas S; Migaud, Hervé; Doherty, Mary K; Siwy, Justyna; Mullen, Willian; Mesquita, Pedro E C; Albalat, Amaya


    Parental investment in Arapaima gigas includes nest building and guarding, followed by a care provision when a cephalic fluid is released from the parents' head to the offspring. This fluid has presumably important functions for the offspring but so far its composition has not been characterised. In this study the proteome and peptidome of the cephalic secretion was studied in parental and non-parental fish using capillary electrophoresis coupled to mass spectrometry (CE-MS) and GeLC-MS/MS analyses. Multiple comparisons revealed 28 peptides were significantly different between males and parental males (PC-males), 126 between females and parental females (PC-females), 51 between males and females and 9 between PC-males and PC-females. Identification revealed peptides were produced in the inner ear (pcdh15b), eyes (tetraspanin and ppp2r3a), central nervous system (otud4, ribeye a, tjp1b and syn1) among others. A total of 422 proteins were also identified and gene ontology analysis revealed 28 secreted extracellular proteins. From these, 2 hormones (prolactin and stanniocalcin) and 12 proteins associated to immunological processes (serotransferrin, α-1-antitrypsin homolog, apolipoprotein A-I, and others) were identified. This study provides novel biochemical data on the lateral line fluid which will enable future hypotheses-driven experiments to better understand the physiological roles of the lateral line in chemical communication.

  5. Comparative proteome and peptidome analysis of the cephalic fluid secreted by Arapaima gigas (Teleostei: Osteoglossidae during and outside parental care.

    Directory of Open Access Journals (Sweden)

    Lucas S Torati

    Full Text Available Parental investment in Arapaima gigas includes nest building and guarding, followed by a care provision when a cephalic fluid is released from the parents' head to the offspring. This fluid has presumably important functions for the offspring but so far its composition has not been characterised. In this study the proteome and peptidome of the cephalic secretion was studied in parental and non-parental fish using capillary electrophoresis coupled to mass spectrometry (CE-MS and GeLC-MS/MS analyses. Multiple comparisons revealed 28 peptides were significantly different between males and parental males (PC-males, 126 between females and parental females (PC-females, 51 between males and females and 9 between PC-males and PC-females. Identification revealed peptides were produced in the inner ear (pcdh15b, eyes (tetraspanin and ppp2r3a, central nervous system (otud4, ribeye a, tjp1b and syn1 among others. A total of 422 proteins were also identified and gene ontology analysis revealed 28 secreted extracellular proteins. From these, 2 hormones (prolactin and stanniocalcin and 12 proteins associated to immunological processes (serotransferrin, α-1-antitrypsin homolog, apolipoprotein A-I, and others were identified. This study provides novel biochemical data on the lateral line fluid which will enable future hypotheses-driven experiments to better understand the physiological roles of the lateral line in chemical communication.

  6. Leptobotia bellacauda, a new species of loach from the lower Yangtze basin in China (Teleostei: Cypriniformes: Botiidae)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula


    Roč. 4205, č. 1 (2016), s. 65-72 ISSN 1175-5326 R&D Projects: GA ČR GA13-37277S Institutional support: RVO:67985904 Keywords : morphology * taxonomy * Anhui Subject RIV: EG - Zoology Impact factor: 0.972, year: 2016

  7. Site fidelity and home range of the longsnout seahorse Hippocampus reidi (Teleostei: Syngnathidae) at the Varadero dock, northwest Cuba


    de la Nuez Hernández, Daril; Pastor Gutiérrez, Lourdes; Pérez Angulo, Alejandro; Piloto Cubero, Yuliet; Corrada Wong, Raúl Igor


    Fish populations of the Syngnathidae family, including the charismatic seahorse, have significantly declined worldwide during the last decades. Up to now, these populations have been poorly researched in their habitat in Cuba. The objective of this study was to determinate site fidelity and home range of the longsnout seahorse (Hippocampus reidi Ginsburg, 1933), which has been poorly studied and has been classified as a Data Deficient (DD) species by the IUCN. Sampling was conducted between A...

  8. Age and growth of Crystallogobius linearis (von Düben, 1845 (Teleostei: Gobiidae from the Adriatic Sea

    Directory of Open Access Journals (Sweden)

    M. La Mesa


    Full Text Available Age and growth of the crystal goby Crystallogobius linearis (von Düben, 1845 were investigated by means of daily growth increment counts on the sagittal otoliths. Samples of C. linearis, obtained as by-catch of the Aphia minuta fishery, were collected in a coastal area of the central Adriatic Sea between March and September 1996. Otolith age-readings were carried out on 167 specimens, ranged from 14 to 41 mm of total length, and indicated that the population was composed of individuals from two to seven months old. Growth of both males and females appeared practically linear over the whole size range studied, although in females a slight decrease in growth rate of older specimens was observed. Furthermore, the hatch date distribution of C. linearis, obtained by the backcalculation of the ageing data, indicated a long breeding season of at least eight months. The results of this study indicated that, as reported from literature for most nektonic gobies, the crystal goby is also characterised by a short life span, during which a high reproductive effort is displayed throughout a long breeding season.

  9. Dynamics of Rex3 in the genomes of endangered Iberian Leuciscinae (Teleostei, Cyprinidae) and their natural hybrids

    Czech Academy of Sciences Publication Activity Database

    Pereira, C. S.; Pazian, M. F.; Ráb, Petr; Collares-Pereira, M. J.


    Roč. 8, č. 81 (2015) ISSN 1755-8166 Institutional support: RVO:67985904 Keywords : Anaecypris hispanica * Chondrostoma s.l. sp * Karyotype differentiation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.506, year: 2015

  10. Before the freeze: otoliths from the Eocene of Seymour Island, Antarctica, reveal dominance of gadiform fishes (Teleostei). (United States)

    Schwarzhans, Werner; Mörs, Thomas; Engelbrecht, Andrea; Reguero, Marcelo; Kriwet, Jürgen


    The first record of fossil teleostean otoliths from Antarctica is reported. The fossils were obtained from late Early Eocene shell beds of the La Meseta Formation, Seymour Island that represent the last temperate marine climate phase in Antarctica prior to the onset of cooling and subsequent glaciation during the late Eocene. A total of 17 otolith-based teleost taxa are recognized, with 10 being identifiable to species level containing nine new species and one new genus: Argentina antarctica sp. nov., Diaphus? marambionis sp. nov., Macruronus eastmani sp. nov., Coelorinchus balushkini sp. nov., Coelorinchus nordenskjoeldi sp. nov., Palimphemus seymourensis sp. nov., Hoplobrotula? antipoda sp. nov., Notoberyx cionei gen. et sp. nov. and Cepola anderssoni sp. nov. Macruronus eastmani sp. nov. is also known from the late Eocene of Southern Australia, and Tripterophycis immutatus Schwarzhans, widespread in the southern oceans during the Eocene, has been recorded from New Zealand, southern Australia, and now Antarctica. The otolith assemblage shows a typical composition of temperate fishes dominated by gadiforms, very similar at genus and family levels to associations known from middle Eocene strata of New Zealand and the late Eocene of southern Australia, but also to the temperate Northern Hemisphere associations from the Paleocene of Denmark. The Seymour Island fauna bridges a gap in the record of global temperate marine teleost faunas during the early Eocene climate maximum. The dominant gadiforms are interpreted as the main temperate faunal component, as in the Paleocene of Denmark. Here they are represented by the families Moridae, Merlucciidae (Macruroninae), Macrouridae and Gadidae. Nowadays Gadidae are a chiefly Northern Hemisphere temperate family. Moridae, Macruroninae and Macrouridae live today on the lower shelf to deep-water or mesopelagically with Macruroninae being restricted to the Southern Ocean. The extant endemic Antarctic gadiform family Muraenolepididae is missing, as are the dominant modern Antarctic fishes of the perciform suborder Notothenioidei. Recently, there has been much debate on isolated jaw bones of teleost fishes found in the La Meseta Formation and whether they would represent gadiforms (Merlucciidae in this case) or some early, primitive notothenioid. Otoliths are known to often complement rather than duplicate skeletal finds. With this in mind, we conclude that our otolith data support the presence of gadiforms in the early Eocene of Antarctica while it does not rule out the presence of notothenioids at the same time.

  11. Eoalosa janvieri gen. et sp. nov., a new clupeid fish (Teleostei, Clupeiformes) from the Eocene of Monte Bolca, Italy. (United States)

    Marramà, Giuseppe; Carnevale, Giorgio


    Fishes of the family Clupeidae are extremely abundant in the Eocene fossiliferous limestone of Monte Bolca representing the most common group from this celebrated locality. A new clupeid from the Pesciara site, Eoalosa janvieri gen. et sp. nov., is described. The new taxon exhibits a unique combination of characters supporting its recognition as a new genus and species of clupeid fish that is tentatively placed in the subfamily Alosinae. The description of this new taxon improves our knowledge of the diversity of clupeoid fishes in the Eocene of Monte Bolca.

  12. Dynamics of tandemly repeated DNA sequences during evolution of diploid and tetraploid botiid loaches (Teleostei: Cobitoidea: Botiidae)

    Czech Academy of Sciences Publication Activity Database

    Sember, Alexandr; Bohlen, Jörg; Šlechtová, Vendula; Altmanová, Marie; Pelikánová, Šárka; Ráb, Petr


    Roč. 13, č. 3 (2018), č. článku e0195054. E-ISSN 1932-6203 R&D Projects: GA ČR GA13-37277S; GA MŠk EF15_003/0000460 Institutional support: RVO:67985904 Keywords : polyploidization * loach Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 2.806, year: 2016

  13. Distribution and abundance of carangidae (Teleostei, Perciformes associated with oceanographic factors along the northeast brazilian exclusive economic zone

    Directory of Open Access Journals (Sweden)

    Christiane Sampaio de Souza


    Full Text Available This work had as objective to study the distribution and abundance of the Carangidae larvae and to analyze the influence of the hydrological (temperature and salinity and biological factors (phytoplanktonic biomass and zooplanktonic biomass, on the space and temporal distribution of the larvae. Ichthyoplankton was collected during four expeditions from the Northeast Exclusive Economic Zone. Six species (Trachurus lathami, Decapterus punctatus, Chloroscombrus chrysurus, Selene setapinnis, Selene vomer and Elagatis bipinnulata and Caranx- Carangoides complex were identified. D. punctatus was the species most abundant (52% of the total, with higher abundance during the Period 3, while the Period 2 was the period of low abundance. C. chrysurus was the second species in abundance representing 30% of the total of carangid. This species had higher abundance during the Period 2 and the Period 1. However, in Period 3 abundance were lesser. The third species in abundance was T. lathami that corresponded 8% of the total of carangid larvae. S. setapinnis, S. vomer and E. bipinnulata were the species less abundant, representing together 2% of the total identified larvae. The larvae of Caranx- Carangoides complex represented 9% of the carangid total.Este trabalho teve como objetivo estudar a distribuição e abundância das larvas de Carangidae, foi analisada também a influência de fatores hidrológicos (temperatura e salinidade e biológicos (biomassa fitoplanctônica e biomassa zooplanctônica, sobre a distribuição espacial e temporal dessas larvas. O ictioplâncton foi coletado durante quatro expedições: Período 1 (Agosto Outubro 1995, Período 2 (Janeiro Abril 1997, Período 3 (Abril Julho 1998 e Período 4 (Setembro Dezembro 2000, realizadas na Zona Econômica Exclusiva do nordeste. Em um total de 313 larvas foram identificadas 6 espécies (Trachurus lathami, Decapterus punctatus, Chloroscombrus chrysurus, Selene setapinnis, Selene vomer e Elagatis bipinnulata e o Complexo Caranx Carangoides pertencentes à família Carangidae. D. punctatus foi a espécie mais abundante neste estudo (52% do total. Sua maior abundância foi observada no Período 3 e a menor no Período 2. C. chrysurus foi a segunda espécie em abundância representando 30% do total de carangídeos. Esta espécie teve maior abundância durante o Período 2, enquanto que os Períodos 1 e 3 foram ás épocas de menor abundância. A terceira espécie em abundância foi T. lathami que correspondeu 8% do total de larvas de carangídeos, sendo o Período 4 o mais abundante. S. setapinnis, S. vomer e E. bipinnulata foram bem menos abundantes que as outras espécies analisadas, representando juntas 2% do total de larvas identificadas. Larvas do Complexo Caranx - Carangoides representaram 9% do total de carangídeos.

  14. A Ploidy Difference Represents an Impassable Barrier for Hybridisation in Animals. Is There an Exception among Botiid Loaches (Teleostei: Botiidae?

    Directory of Open Access Journals (Sweden)

    Jörg Bohlen

    Full Text Available One of the most efficient mechanisms to keep animal lineages separate is a difference in ploidy level (number of whole genome copies, since hybrid offspring from parents with different ploidy level are functionally sterile. In the freshwater fish family Botiidae, ploidy difference has been held responsible for the separation of its two subfamilies, the evolutionary tetraploid Botiinae and the diploid Leptobotiinae. Diploid and tetraploid species coexist in the upper Yangtze, the Pearl River and the Red River basins in China. Interestingly, the species 'Botia' zebra from the Pearl River basin combines a number of morphological characters that otherwise are found in the diploid genus Leptobotia with morphological characters of the tetraploid genus Sinibotia, therefore the aim of the present study is to test weather 'B.' zebra is the result of a hybridisation event between species from different subfamilies with different ploidy level. A closer morphological examination indeed demonstrates a high similarity of 'B.' zebra to two co-occurring species, the diploid Leptobotia guilinensis and the tetraploid Sinibotia pulchra. These two species thus could have been the potential parental species in case of a hybrid origin of 'B.' zebra. The morphologic analysis further reveals that 'B.' zebra bears even the diagnostic characters of the genera Leptobotia (Leptobotiinae and Sinibotia (Botiinae. In contrast, a comparison of six allozyme loci between 'B.' zebra, L. guilinensis and S. pulchra showed only similarities between 'B.' zebra and S. pulchra, not between 'B.' zebra and L. guilinensis. Six specimens of 'B.' zebra that were cytogenetically analysed were tetraploid with 4n = 100. The composition of the karyotype (18% metacentric, 18% submetacentric, 36% subtelocentric and 28% acrocentric chromosomes differs from those of L. guilinensis (12%, 24%, 20% and 44% and S. pulchra (20%, 26%, 28% and 26%, and cannot be obtained by any combination of genomes from L. guilinensis and S. pulchra. Phylogenetic reconstructions based on sequence data of the mitochondrial cytochrome b gene and the nuclear RAG-1 gene invariably places 'Botia' zebra as sister species to S. pulchra, while L. guilinensis is only distantly related. The presented combination of genetic data demonstrates that 'B.' zebra is not the result of a hybridisation, but a species of tetraploid genus Sinibotia with a striking morphological evolution towards an enormous similarity with a co-occurring, but not directly related species. The complete lack of knowledge of the ecology of these species, their main predators or their ecological interactions hampers any conclusion regarding the evolutionary advantage of such adaptation.

  15. Ontogenic retinal changes in three ecologically distinct elopomorph fishes (Elopomorpha:Teleostei) correlate with light environment and behavior. (United States)

    Taylor, Scott M; Loew, Ellis R; Grace, Michael S


    Unlike the mammalian retina, the teleost fish retina undergoes persistent neurogenesis from intrinsic stem cells. In marine teleosts, most cone photoreceptor genesis occurs early in the embryonic and larval stages, and rods are added primarily during and after metamorphosis. This study demonstrates a developmental paradigm in elopomorph fishes in which retinas are rod-dominated in larvae, but undergo periods of later cone genesis. Retinal characteristics were compared at different developmental stages among three ecologically distinct elopomorph fishes-ladyfish (Elops saurus), bonefish (Albula vulpes), and speckled worm eel (Myrophis punctatus). The objectives were to improve our understanding of (1) the developmental strategy in the elopomorph retina, (2) the functional architecture of the retina as it relates to ecology, and (3) how the light environment influences photoreceptor genesis. Photoreceptor morphologies, distributions, and spectral absorption were studied at larval, juvenile, and adult stages. Premetamorphic retinas in all three species are rod-dominated, but the retinas of these species undergo dramatic change over the course of development, resulting in juvenile and adult retinal characteristics that correlate closely with ecology. Adult E. saurus has high rod densities, grouped photoreceptors, a reflective tapetum, and longer-wavelength photopigments, supporting vision in turbid, low-light conditions. Adult A. vulpes has high cone densities, low rod densities, and shorter-wavelength photopigments, supporting diurnal vision in shallow, clear water. M. punctatus loses cones during metamorphosis, develops new cones after settlement, and maintains high rod but low cone densities, supporting primarily nocturnal vision. M. punctatus secondary cone genesis occurs rapidly throughout the retina, suggesting a novel mechanism of vertebrate photoreceptor genesis. Finally, in postsettlement M. punctatus, the continuous presence or absence of visible light modulates rod distribution but does not affect secondary cone genesis, suggesting some degree of developmental plasticity influenced by the light environment.

  16. Dynamics of Rex3 in the genomes of endangered Iberian Leuciscinae (Teleostei, Cyprinidae and their natural hybrids

    Directory of Open Access Journals (Sweden)

    Carla Sofia A. Pereira


    Full Text Available Iberian Leuciscinae are greatly diverse comprising taxa of hybrid origin. With highly conservative karyotypes, Iberian Chondrostoma s.l. have recently demonstrated sub-chromosomal differentiation and rapid genome restructuring in natural hybrids, which was confirmed by ribosomal DNA (rDNA transposition and/or multiplication. To understand the role of repetitive DNAs in the differentiation of their genomes, a genetic and molecular cytogenetic survey was conducted in Achondrostoma oligolepis, Anaecypris hispanica, Iberochondrostoma lemmingii, I. lusitanicum, Pseudochondrostoma duriense, P. polylepis, Squalius pyrenaicus and hybrids between A. oligolepis x (P. duriense/P. polylepis, which represent 'alburnine', chondrostomine and Squalius lineages. The chromosomal distribution of Rex3 retroelement was found highly compartmentalized at centromeres and moderately at telomeres, co-localizing with 5S rDNA loci, and grossly correlating with heterochromatin and blocks of C0t-1 DNA. This accumulation was evident in at least 10 chromosome pairs, a pattern that seemed to be shared among the different species, likely predating their divergence. Nevertheless, species-specific clusters were detected in I. lusitanicum, P. duriense, P. polylepis and S. pyrenaicus demonstrating rapid and independent differentiation. Natural hybrids followed the same accumulation pattern and association with repetitive sequences but with increased number of Rex3 clusters and correlating with translocated 45S rDNA clusters. Rex3 sequence phylogeny didn't agree with its hosts' phylogeny but the observed distribution pattern is congruent with an evolutionary tendency to protect its activity, a robust regulatory system and/or events of horizontal transfer. This is the first report of retroelement physical mapping in Cyprinidae. It helped outlining conceivable ancestral homologies and recognizing retrotransposon activation in hybrids, being possibly associated with genome diversification in the subfamily. The extensive diversity of Iberian Leuciscinae makes them excellent candidates to explore the processes and mechanisms behind the great multiplicity distinguishing vertebrate genomes.

  17. Structural characterization of peptides derived from prosomatostatins I and II isolated from the pancreatic islets of two species of teleostean fish: the daddy sculpin and the flounder. (United States)

    Conlon, J M; Davis, M S; Falkmer, S; Thim, L


    The primary structures of three peptides from extracts from the pancreatic islets of the daddy sculpin (Cottus scorpius) and three analogous peptides from the islets of the flounder (Platichthys flesus), two species of teleostean fish, have been determined by automated Edman degradation. The structures of the flounder peptides were confirmed by fast-atom bombardment mass spectrometry. The peptides show strong homology to residues (49-60), (63-96) and (98-125) of the predicted sequence of preprosomatostatin II from the anglerfish (Lophius americanus). The amino acid sequences of the peptides suggest that, in the sculpin, prosomatostatin II is cleaved at a dibasic amino acid residue processing site (corresponding to Lys61-Arg62 in anglerfish preprosomatostatin II). The resulting fragments are further cleaved at monobasic residue processing sites (corresponding to Arg48 and Arg97 in anglerfish preprosomatostatin II). In the flounder the same dibasic residue processing site is utilised but cleavage at different monobasic sites takes place (corresponding to Arg50 and Arg97 in anglerfish preprosomatostatin II). A peptide identical to mammalian somatostatin-14 was also isolated from the islets of both species and is presumed to represent a cleavage product of prosomatostatin I.

  18. Genetic diversity and population structure in Meconopsis ...

    African Journals Online (AJOL)



    May 24, 2010 ... The location and main ecological characteristics of sample sites are shown in ..... suggest that this is wind-pollinated and allogamous plant species ... (Teleostei, Characidae) from an urban stream, Hydrobiology, 553: 245-254 ...

  19. Effect of feeding frequency and feeding rate on growth of ...

    African Journals Online (AJOL)

    Effect of feeding frequency and feeding rate on growth of Oreochromis mossambicus (Teleostei: Cichlidae) fry. ... Weight gain, specific growth rate and gross food conversion ratio were significantly affected by ... AJOL African Journals Online.

  20. Increased backcrossing has reduced the usefulness of ...

    African Journals Online (AJOL)

    Increased backcrossing has reduced the usefulness of morphological and allozyme data for identifying Oreochromis niloticus , O. mossambicus (Teleostei: Cichlidae) and their hybrids in the Pafuri reach of the Luvuvhu River in the Kruger National Park, South Africa.

  1. gonads of Cheimerius nufar (Ehrenberg, 1820)

    African Journals Online (AJOL)

    macroscopic changes in the gonads of Cheimerius nuJar. In addition .... Cytoplasm stains darker. ..... period. All stages present; 50% of lobules with sperm; main duct full .... in five species of grey mullets (Teleostei, Mugilidae) from natural.

  2. Short Note Effect of turbidity on the foraging success of ...

    African Journals Online (AJOL)

    Teleostei: Gobiidae). MC Parkinson, AJ Booth. Abstract. No Abstract. African Journal of Aquatic Science 2011, 36(2): 213–216. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  3. The predatory impact of invasive alien smallmouth bass, Micropterus ...

    African Journals Online (AJOL)

    Teleostei: Centrarchidae), on indigenous fishes in a Cape Floristic Region ... The Rondegat River is home to five species of indigenous fish and is partially invaded by M. dolomieu, which has penetrated the lower river up to a waterfall barrier.

  4. Karyotypic diversity in four species of the genus Gymnotus Linnaeus, 1758 (Teleostei, Gymnotiformes, Gymnotidae): physical mapping of ribosomal genes and telomeric sequences (United States)

    Scacchetti, Priscilla Cardim; Pansonato-Alves, José Carlos; Utsunomia, Ricardo; Oliveira, Claudio; Foresti, Fausto


    Abstract Conventional (Giemsa, C-Banding, Ag-NORs, CMA3) and molecular (5S rDNA, 18S rDNA, telomeric sequences) cytogenetic studies were carried out in specimens of ten distinct fish populations of the genus Gymnotus (Gymnotus sylvius Albert and Fernandes-Matioli, 1999, Gymnotus inaequilabiatus Valenciennes, 1839, Gymnotus pantherinus Steindachner, 1908, and G. cf. carapo Linnaeus, 1758) from different Brazilian hydrographic basins. Gymnotus sylvius presented a diploid number of 40 chromosomes (22m+12sm+6st), Gymnotus pantherinus presented 52 chromosomes (32m+18sm+2st), while Gymnotus inaequilabiatus (42m+10sm+2a)and Gymnotus cf. carapo (38m+12sm+4st) presented 54 chromosomes. The C-banding technique revealed centromeric marks in all chromosomes of all species. Besides that, conspicuous blocks of heterochromatin were found interstitially on the chromosomes of Gymnotus inaequilabiatus, Gymnotus cf. carapo,and Gymnotus pantherinus. All four species showed single nucleolus organizing regions confirmed by results obtained through Ag-NORs and FISH experiments using 18S rDNA probes, which showed the NORs localized on the first chromosome pair in Gymnotus inaequilabiatus, Gymnotus cf. carapo,and Gymnotus pantherinus, and on pair 2 in Gymnotus sylvius. CMA3 staining revealed additional unrelated NORs marks in Gymnotus sylvius and Gymnotus pantherinus. The 5S rDNA probes revealed signals on one pair in Gymnotus sylvius and two pairs in Gymnotus pantherinus; Gymnotus inaequilabiatus had about seventeen pairs marked, and Gymnotus cf. carapo had about fifteen pairs marked. It is considered that the high amount of heterochromatin identified in the chromosomes of Gymnotus inaequilabiatus and Gymnotus cf. carapo could have facilitated the dispersion of 5S rDNA in these species. Interstitial signals were detected on the first metacentric pair of Gymnotus sylvius by telomeric probes (TTAGGG)n indicating the possible occurrence of chromosomal fusions in this species. The present study reveals valuable cytotaxonomic markers for this group and allows a more precise evaluation of the processes involved in the karyotype differentiation and the interrelationships among different species of the genus Gymnotus. PMID:24260631

  5. Heliconema longissimum (Ortlepp, 1923) (Nematoda: Physalopteridae) from Pisodonophis boro (Teleostei: Ophichthidae) in Thailand, with remarks on the taxonomy of the Proleptinae Schulz, 1927

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Taraschewski, H.; Thairungroj Anantaphruti, M.; Maipanich, W.; Laoprasert, T.


    Roč. 66, č. 1 (2007), s. 73-80 ISSN 0165-5752 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Heliconema * Pisodonophis * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.125, year: 2007

  6. Influence of spawning procedure on gametes fertilization success in Salminus hilarii Valenciennes, 1850 (Teleostei: Characidae: Implications for the conservation of this species

    Directory of Open Access Journals (Sweden)

    Renato M. Honji


    Full Text Available Artificial reproduction and gamete fertilization were evaluated in Salminus hilarii wild and domesticated broodstocks. Wild and domesticated broodstocks were artificially induced to reproduction using a carp pituitary treatment. Four groups were considered: Group 1 (G1, fish caught in the wild maintained for three years in the same conditions as the domesticated broodstocks and spawned naturally; Group 2 (G2, broodstock born and raised in captivity and spawned naturally; Group 3 (G3, wild broodstocks, which were manually stripped for gamete collection and dry fertilization; and Group 4 (G4, domesticated males and females, also manually stripped. Oocytes, eggs, and larvae were sampled at different time intervals throughout embryonic development. Yolk sac absorption occurred approximately 24-29 h after hatching. Twenty-six h after hatching, the larvae mouths opened. Cannibalism was identified just 28-30 h after hatching. There was no morphological difference in embryonic development among all groups. The number of released eggs per gram of female was: G1: 83.3 ± 24.5 and G2: 103.8 ± 37.4; however, the fertilization success was lower in G2 (42.0 ± 6.37 % compared with G1 (54.7 ± 3.02% (P = 0.011. Hand-stripping of oocytes was not successful and the fertilization rate was zero. The reproduction of this species in captivity is viable, but it is necessary to improve broodstock management to enhance fertilization rates and obtain better fingerling production for restocking programs.A reprodução artificial e fertilização dos gametas foram avaliados em reprodutores selvagens e de cativeiro de Salminus hilarii. Reprodutores selvagens e de cativeiro foram induzidos artificialmente à reprodução utilizando hipófise de carpa. Quatros grupos foram considerados: Grupo 1 (G1, peixes capturados na natureza, mantidos por três anos nas mesmas condições de reprodutores de cativeiro e desovados naturalmente; Grupo 2 (G2, reprodutores nascidos e criados em cativeiro e desovados naturalmente; Grupo 3 (G3, reprodutores selvagens que foram extrusados manualmente para a coleta de gametas e fertilização a seco; e Grupo 4 (G4, com machos e fêmeas domesticadas, também extrusados manualmente. Oócitos, ovos e larvas foram amostrados em diferentes intervalos de tempo ao longo do desenvolvimento embrionário. A absorção do saco vitelínico ocorreu aproximadamente 24-29 h após a eclosão. Vinte e seis h após a eclosão, as larvas abriram a boca. O canibalismo foi identificado apenas 28-30 h após a eclosão. Não houve diferença morfológica no desenvolvimento embrionário entre todos os grupos. O número de ovos liberados por grama de fêmea foi: G1: 83,3 ± 24,5 e G2: 103,8 ± 37,4; embora, o sucesso na fertilização tenha sido menor no G2 (42,0 ± 6,37% em comparação com G1 (54,7 ± 3,02% (P = 0,011. A extrusão manual dos oócitos não foi bem sucedida e a taxa de fertilização foi zero. A reprodução em cativeiro desta espécie é viável, mas é necessário um melhor manejo dos reprodutores para aumentar as taxas de fertilização, visando a obtenção de uma melhor produção de alevinos para os programas de repovoamento.

  7. Length–weight and length–length relationships of 139 Indo-Pacific fish species (Teleostei) from the Davao Gulf, Philippines

    NARCIS (Netherlands)

    Gumanao, G.S.; Saceda-Cardoz, M.M.; Mueller, B.; Bos, A.R.


    Length–weight relationships (LWRs) of 139 coral reef andpelagic fish species (representing 34 fish families) were calculatedbased on 3806 individuals measured at local fish marketsnear the Davao Gulf in the southern Philippines duringweekly visits between March 2009 and July 2011, as well asin June

  8. A new genus and species of blind sleeper (Teleostei: Eleotridae) from Oaxaca, Mexico: First obligate cave gobiiform in the Western Hemisphere (United States)

    Walsh, Stephen J.; Chakrabarty, Prosanta


    Caecieleotris morrisi, new genus and species of sleeper (family Eleotridae), is described from a submerged freshwater cave in a karst region of the northern portion of the State of Oaxaca, Mexico, Río Papaloapan drainage, Gulf of Mexico basin. The new species represents the first cave-adapted sleeper known from the Western Hemisphere and is one of only 13 stygobitic gobiiforms known worldwide, with all others limited in distribution to the Indo-Pacific region. The new taxon represents a third independent evolution of a hypogean lifestyle in sleepers, the others being two species ofOxyeleotris (O. caeca and O. colasi) from New Guinea and a single species, Bostrychus microphthalmus, from Sulawesi. Caecieleotris morrisi, new species, is distinguished from epigean eleotrids of the Western Atlantic in lacking functional eyes and body pigmentation, as well as having other troglomorphic features. It shares convergent aspects of morphology with cave-dwelling species of Oxyeleotris and B. microphthalmus but differs from those taxa in lacking cephalic pores and head squamation, among other characters. Description of C. morrisi, new species, brings the total number of eleotrid species known from Mexico to 12. Seven of these, including the new species, occur on the Atlantic Slope.

  9. Comparison of the bioaccumulation from seawater and depuration of heavy metals and radionuclides in the spotted dogfish Scyliorhinus canicula (Chondrichthys) and the turbot Psetta maxima (Actinopterygii: Teleostei)

    International Nuclear Information System (INIS)

    Jeffree, Ross A.; Warnau, Michel; Teyssie, Jean-Louis; Markich, Scott J.


    The bioaccumulation of selected heavy metals and radionuclides ( 241 Am, 109 Cd, 57 Co, 51 Cr, 134 Cs, 54 Mn and 65 Zn) from seawater was experimentally compared in the Chondrichthyan Scyliorhinus canicula (spotted dogfish) and the Actinopterygian Teleost Psetta maxima (turbot), of comparable size, age and benthic feeding habits. The speciation of these elements in seawater (salinity 38 per mille , pH 8.1, temperature 16.5 deg. C) was also calculated to determine their potential bioavailability. The uptake rates, measured over 14 days, varied greatly among isotopes and between species. Concentration factors (CFs) in P. maxima varied 5-fold between ca. 0.2 for 51 Cr and 2.5 for 65 Zn and 134 Cs, whereas in S. canicula they varied by a much greater factor of 350, with CFs for 51 Cr and 241 Am ranging from ca. 0.4 to 140, respectively. With the exception of 134 Cs, all radiotracers were accumulated at a faster rate in S. canicula than in P. maxima, particularly for 241 Am and 65 Zn where the CFs attained during the uptake phase were, two and one order of magnitude greater in S. canicula, respectively. In contrast, 134 Cs reached a CF of about 2.5 in P. maxima, which was 5-fold greater than in S. canicula. Patterns of loss from the experimental depuration phase over 29 days showed greater similarities between species, compared to the uptake phase that highlighted the greater differences between elements. The distributions of these seven radioisotopes among six body components indicated that between the two species the skin of the dogfish displayed a greater bioaccumulation potential, particularly for 241 Am, 57 Co and 65 Zn. However 65 Zn was also distinctive from 241 Am and 57 Co in its pattern of bioaccumulation in dogfish, with its other body components attaining concentrations of 65 Zn that were comparable to the levels found in its skin. The heightened uptake of 134 Cs in turbot was characterised by a more even percentage distribution among its tissues compared to 241 Am and 57 Co, but every tissue of turbot had a higher concentration of 134 Cs, compared to dogfish, particularly the muscle and liver. The elevated uptake rates and higher CFs for most radioisotopes indicate that S. canicula is more susceptible than P. maxima to exposure and contamination by these metals and radionuclides in seawater. These experimentally-determined differences between dogfish and turbot in their bioaccumulation characteristics were assessed against a set of criteria erected to evaluate the working hypothesis that they were taxonomically based. The outcomes of this initial assessment were supportive of this hypothesis that warrants further investigation

  10. Rapid range expansion of the "whitefin" gudgeon Romanogobio cf. belingi (Teleostei: Cyprinidae) in a lowland tributary of the Vistula River (Southeastern Poland)

    Czech Academy of Sciences Publication Activity Database

    Nowak, M.; Klaczak, A.; Szczerbik, P.; Mendel, Jan; Popek, W.


    Roč. 49, č. 4 (2013), s. 319-326 ISSN 0003-4088 R&D Projects: GA ČR GP206/09/P608 Institutional support: RVO:68081766 Keywords : faunistic * Gobioninae * ichthyofauna monitoring * population dynamics * rare species Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.036, year: 2013

  11. Chromosomal studies of five species of the marine fishes from the Paranaguá Bay and the karyotypic diversity in the marine teleostei of the Brazilian coast

    Directory of Open Access Journals (Sweden)

    Roger Raupp Cipriano


    Full Text Available In this study, five species of marine fishes from the Paranaguá Bay in the Brazilian coast were evaluated. Eucinostomus argenteus and Diapterus rhombeus (Gerreidae presented 48 chromosomes, all of which more acrocentric (FN = 48; Strongylura timucu and S. marina (Belonidae also presented 48 chromosomes, but with a higher karyotypic complexity than the Gerreidae, 10M+2SM+36A (FN = 60 and 4M+44A (FN = 52, respectively. The fifth species, Mugil curema (Mugilidae, different than the others, presented only 28 chromosomes 20M+4ST+4A (FN = 48. The species presented diversity in the karyotypic macro-structure, which should be relevant for the cytotaxonomy and the evolution of this group of the vertebrate.Nas últimas décadas tem ocorrido no Brasil um incremento de estudos cariotípicos em peixes marinhos. Atualmente são conhecidos os cariótipos de 118 espécies, distribuídas em 43 famílias e 80 gêneros. Foram estudadas cinco espécies de peixes marinhos do complexo estuarino da Baía de Paranaguá na costa brasileira. Eucinostomus argenteus e Diapterus rhombeus (Gerreidae, apresentaram 48 cromossomos todos acrocêntricos (NF = 48; Strongylura timucu e S. marina (Belonidae apresentaram 48 cromossomos, porém com complexidade cariotípica maior do que apresentada pelos gerreídeos, 10M+2SM+36A (NF = 60 e 4M+44A (NF = 52, respectivamente. A quinta espécie, Mugil curema (Mugilidae, ao contrário das outras quatro espécies aqui analisadas, apresentou apenas 28 cromossomos 20M+4ST+4A (NF = 48. Apesar da tendência em se verificar um cariótipo constituído por 48 cromossomos em teleósteos marinhos, as espécies aqui analisadas apresentam uma diversidade para a macroestrutura cariotípica a ser considerada para a citotaxonomia e evolução desse grupo de vertebrados.

  12. New species of Diplectanum (Monogenoidea: Diplectanidae), and proposal of a new genus of the Dactylogyridae from the gills of gerreid fishes (Teleostei) from Mexico and Panama

    Czech Academy of Sciences Publication Activity Database

    Mendoza-Franco, Edgar F.; Roche, D. G.; Torchin, M. E.


    Roč. 55, č. 3 (2008), 171-179 ISSN 0015-5683 Institutional research plan: CEZ:AV0Z60220518 Keywords : Monogenoidea * Diplectanidae * Dactylogyridae * Diplectanum * Octouncuhaptor * Diplectanum gatunense * Diplectanum mexicanum * Octouncuhaptor eugerrei * Eugerres brasilianus * Panama * Mexico Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.307, year: 2008

  13. New species of Diplectanum (Monogenoidea:Diplectanidae), and proposal of a new genus of the Dactylogyridae from the gills of gerreid fishes (Teleostei) from Mexico and Panama. (United States)

    Franco, Edgar F Mendoza; Roche, Dominique G; Torchin, Mark E


    While investigating the parasites of several marine fishes from the Western Atlantic, the Southern Gulf of Mexico and Central America (Panama), the following monogenoidean species from the gills of gerreid fishes (Gerreidae) were found: Diplec-tanum gatunense sp. n. (Diplectanidae) and Octouncuhaptor eugerrei gen. et sp. n. (Dactylogyridae) in Eugerres brasilianus (Cuvier) from Gatun Lake in the Panama Canal Watershed, and Diplectanum mexicanum sp. n. in Diapterus rhombeus (Cuvier) from the coast of Campeche State, Mexico. New diplectanid species are distinguished from other species of the genus by the general morphology of the copulatory complex and by the shape of the anchors and bars on the haptor. Octouncuhaptor gen. n. is proposed for its new species having slightly overlapping gonads (testis posterodorsal to the ovary), a dextrolateral vaginal aperture, a copulatory complex consisting of a coiled male copulatory organ with counterclockwise rings with the base articulated to the accessory piece, 8 pairs of hooks and the absence of anchors and bars on haptor. Our analysis of morphological features of Diplectanum species on gerreids evidences that these parasites more closely resemble each other than the known species from sciaenids suggesting that split between gerreids and sciaenids resulted in parasite speciation.

  14. A new monozoic tapeworm, Lobulovarium longiovatum n. g., n. sp. (Cestoda: Caryophyllidea), from barbs Puntius spp. (Teleostei: Cyprinidae) in the Indomalayan region

    Czech Academy of Sciences Publication Activity Database

    Oros, Mikuláš; Ash, Anirban; Brabec, Jan; Kar, P. K.; Scholz, Tomáš


    Roč. 83, č. 1 (2012), s. 1-13 ISSN 0165-5752 R&D Projects: GA ČR GD206/09/H026; GA ČR GA524/08/0885; GA ČR GBP505/12/G112 Institutional research plan: CEZ:AV0Z60220518 Keywords : MIXED MODELS * SILURIFORMES * PARASITES * IDENTIFICATION * CATOSTOMIDAE * MORPHOLOGY * CESTOIDEA * REVISION * SOPHORE * PISCES Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.260, year: 2012

  15. A new monozoic tapeworm, Lobulovarium longiovatum n. g., n. sp. (Cestoda: Caryophyllidea), from barbs Puntius spp. (Teleostei: Cyprinidae) in the Indomalayan region. (United States)

    Oros, Mikuláš; Ash, Anirban; Brabec, Jan; Kar, Pradip Kumar; Scholz, Tomáš


    A new caryophyllidean cestode is described from barbs Puntius spp. (Cypriniformes: Cyprinidae), with P. sophore (Hamilton) as its type-host, in the Ganges and Brahmaputra river basins in India and Bangladesh, and a new genus, Lobulovarium n. g., is proposed to accommodate it. The genus belongs to the Lytocestidae because its vitelline follicles are situated in the cortex. It is typified by: (i) a peculiar ovary, which is roughly H-shaped, but with asymmetrical, irregular lobes on its ventral and dorsal sides; (ii) an extensive vitellarium formed by numerous vitelline follicles scattered throughout the cortex; (iii) a long, conical postovarian part of the body with numerous vitelline follicles; (iv) a broadly digitate scolex with a slightly protrusible central cone; (v) a single gonopore (male and female genital ducts open via a single pore and a common genital atrium is absent); and (vi) a small number of testes (90 μm in L. longiovatum), which are spherical (length/width ratio 1:1 versus 2.5-3:1 in the new species), and the presence of vitelline follicles alongside the ovarian lobes (almost completely absent in L. longiovatum).

  16. Biogeography and pattern of gene flow among Barbus species (Teleostei:Cyprinidae) inhabiting the Italian Peninsula and neighbouring Adriatic drainages as revealed by allozyme and mitochondrial sequence data

    Czech Academy of Sciences Publication Activity Database

    Tsigenopoulos, C. S.; Kotlík, Petr; Berrebi, P.


    Roč. 75, - (2002), s. 83-99 ISSN 0024-4066 R&D Projects: GA AV ČR IBS5045111; GA AV ČR KSK6005114 Keywords : allozymes * Barbus * Cyprinidae Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.705, year: 2002

  17. Asexual Reproduction Does Not Apparently Increase the Rate of Chromosomal Evolution: Karyotype Stability in Diploid and Triploid Clonal Hybrid Fish (Cobitis, Cypriniformes, Teleostei). (United States)

    Majtánová, Zuzana; Choleva, Lukáš; Symonová, Radka; Ráb, Petr; Kotusz, Jan; Pekárik, Ladislav; Janko, Karel


    Interspecific hybridization, polyploidization and transitions from sexuality to asexuality considerably affect organismal genomes. Especially the last mentioned process has been assumed to play a significant role in the initiation of chromosomal rearrangements, causing increased rates of karyotype evolution. We used cytogenetic analysis and molecular dating of cladogenetic events to compare the rate of changes of chromosome morphology and karyotype in asexually and sexually reproducing counterparts in European spined loach fish (Cobitis). We studied metaphases of three sexually reproducing species and their diploid and polyploid hybrid clones of different age of origin. The material includes artificial F1 hybrid strains, representatives of lineage originated in Holocene epoch, and also individuals of an oldest known age to date (roughly 0.37 MYA). Thereafter we applied GISH technique as a marker to differentiate parental chromosomal sets in hybrids. Although the sexual species accumulated remarkable chromosomal rearrangements after their speciation, we observed no differences in chromosome numbers and/or morphology among karyotypes of asexual hybrids. These hybrids possess chromosome sets originating from respective parental species with no cytogenetically detectable recombinations, suggesting their integrity even in a long term. The switch to asexual reproduction thus did not provoke any significant acceleration of the rate of chromosomal evolution in Cobitis. Asexual animals described in other case studies reproduce ameiotically, while Cobitis hybrids described here produce eggs likely through modified meiosis. Therefore, our findings indicate that the effect of asexuality on the rate of chromosomal change may be context-dependent rather than universal and related to particular type of asexual reproduction.

  18. Influence of spawning procedure on gametes fertilization success in Salminus hilarii Valenciennes, 1850 (Teleostei: Characidae: Implications for the conservation of this species

    Directory of Open Access Journals (Sweden)

    Renato M. Honji

    Full Text Available Artificial reproduction and gamete fertilization were evaluated in Salminus hilarii wild and domesticated broodstocks. Wild and domesticated broodstocks were artificially induced to reproduction using a carp pituitary treatment. Four groups were considered: Group 1 (G1, fish caught in the wild maintained for three years in the same conditions as the domesticated broodstocks and spawned naturally; Group 2 (G2, broodstock born and raised in captivity and spawned naturally; Group 3 (G3, wild broodstocks, which were manually stripped for gamete collection and dry fertilization; and Group 4 (G4, domesticated males and females, also manually stripped. Oocytes, eggs, and larvae were sampled at different time intervals throughout embryonic development. Yolk sac absorption occurred approximately 24-29 h after hatching. Twenty-six h after hatching, the larvae mouths opened. Cannibalism was identified just 28-30 h after hatching. There was no morphological difference in embryonic development among all groups. The number of released eggs per gram of female was: G1: 83.3 ± 24.5 and G2: 103.8 ± 37.4; however, the fertilization success was lower in G2 (42.0 ± 6.37 % compared with G1 (54.7 ± 3.02% (P = 0.011. Hand-stripping of oocytes was not successful and the fertilization rate was zero. The reproduction of this species in captivity is viable, but it is necessary to improve broodstock management to enhance fertilization rates and obtain better fingerling production for restocking programs.

  19. Asexual Reproduction Does Not Apparently Increase the Rate of Chromosomal Evolution: Karyotype Stability in Diploid and Triploid Clonal Hybrid Fish (Cobitis, Cypriniformes, Teleostei.

    Directory of Open Access Journals (Sweden)

    Zuzana Majtánová

    Full Text Available Interspecific hybridization, polyploidization and transitions from sexuality to asexuality considerably affect organismal genomes. Especially the last mentioned process has been assumed to play a significant role in the initiation of chromosomal rearrangements, causing increased rates of karyotype evolution. We used cytogenetic analysis and molecular dating of cladogenetic events to compare the rate of changes of chromosome morphology and karyotype in asexually and sexually reproducing counterparts in European spined loach fish (Cobitis. We studied metaphases of three sexually reproducing species and their diploid and polyploid hybrid clones of different age of origin. The material includes artificial F1 hybrid strains, representatives of lineage originated in Holocene epoch, and also individuals of an oldest known age to date (roughly 0.37 MYA. Thereafter we applied GISH technique as a marker to differentiate parental chromosomal sets in hybrids. Although the sexual species accumulated remarkable chromosomal rearrangements after their speciation, we observed no differences in chromosome numbers and/or morphology among karyotypes of asexual hybrids. These hybrids possess chromosome sets originating from respective parental species with no cytogenetically detectable recombinations, suggesting their integrity even in a long term. The switch to asexual reproduction thus did not provoke any significant acceleration of the rate of chromosomal evolution in Cobitis. Asexual animals described in other case studies reproduce ameiotically, while Cobitis hybrids described here produce eggs likely through modified meiosis. Therefore, our findings indicate that the effect of asexuality on the rate of chromosomal change may be context-dependent rather than universal and related to particular type of asexual reproduction.

  20. Feeding on protists and particulates by the leptocephali of the worm eels Myrophis spp. (Teleostei: Anguilliformes: Ophichthidae, and the potential energy contribution of large aloricate protozoa

    Directory of Open Access Journals (Sweden)

    John Jeffrey Govoni


    Full Text Available The food sources of the leptocephali of the teleostean superorder Elopomorpha have been controversial, yet observations on the leptocephali of the worm eels, Myrophis spp. (family Ophichthidae collected in the northern Gulf of Mexico indicate active, not passive, feeding. Leptocephali had protists in their alimentary canals. Estimates of the physiological energetics of worm eels indicate that large aloricate protozoa including ciliates could provide substantial energy to these leptocephali toward the end of the premetamorphic and metamorphic stages, given the low energy requirements of metamorphosing leptocephali. Global ocean warming will likely force a shift in oceanic food webs; a shift away from large protozoa toward smaller protists is possible. Such a disruption of the oceanic food webs could further compromise the survival of leptocephali.

  1. Aspects of the biology of the Atlantic Midshipman, Porichthys porosissimus (Teleostei, Batrachoididae: an important by-catch species of shrimp trawling off southern Brazil

    Directory of Open Access Journals (Sweden)

    Marcelo Vianna


    Full Text Available Trawl fishing for pink shrimp (Farfantepenaeus brasiliensis and F. paulensis catches large quantities of by-catch fish, discarded due to their having no commercial vaue. As these species have rarely been studied, the impact of fisheries on these populations is not known. This contribution studies the biology of a species of no commercial value, the Atlantic midshipman Porichthys porosissimus. The last haul /Tom a commercial trawler, operating on the northern coast of São Paulo State and the southern coast of Rio de Janeiro State, was preserved (/Tom being discarded and identified at the species leveI. It was observed that this fishery affects the juvenile population which is intluenced by the seasonal variation of the water masses. Growth parameters were estimated: L∞ = 37.0 cm, K = 0.285 year-1. Instantaneous mortality coefficients were estimated: 2=2.14, M=0.63, F= 1.51, S= 11.8 and E=0.71. Considering the intensive activity of the shrimp trawl tleet operating in this area, the deleterious action of trawling is considered as of high impact. The stock management measures applied for pink shrimp are without effect regarding P. porosissimus. which has its spawning period before the closed season and its recruitment peak after it. The results show overfishing and the need to apply measures to reduce trawling action, such as adequate policies, introduction of selectivity devices and the creation of exclusion zones for trawl fishing.A pesca de arrasto para a captura do camarão-rosa (Fm:fantepenaeus brasi/iensis e F. paulensis captura grande quantidade de peixes considerados fauna acompanhante que são descartados por não possuírem valor comercial. Assim, pouco aparecem em trabalhos de biologia pesqueira com dados de desembarque, sendo a ação pesqueira sobre estas populações pouco conhecida. Neste estudo, um arrasto mensal de um barco de pesca foi desembarcado sem que nada do material capturado fosse descartado. Analisou-se Porichthys porosissimus do qual foram avaliados aspectos biológicos e pesqueiros. Estimou-se, para a espécie: L∞ = 37,0 cm, K = 0,285 ano.l, Rn=180 (x 10-3, 2=2,14, M=0,63, F=1,51, S=11,8 e E=0.71. Embora não intencional, a pesca age principalmente em jovens e ocorre durante o ano todo, sendo intluenciada pela sazonal idade das massas d'água. Considerando a frota operante na área, o efeito do arrasto é considerável, já que a taxa de aproveitamento é nula. As medidas de proteção de estoque aplicadas ao camarão-rosa não são efetivas para P. porosissimus, que apresenta o período de desova anterior à época do defeso e o pico de recrutamento pesqueiro posterior. Os resultados indicam sobrepesca da população estudada sendo necessário medidas de modo a diminuir a ação deletéria do arrasto, como a adequação da legislação, uso de dispositivos de seletividade e a criação de zonas de exclusão de arrasto.

  2. Composição em tamanho dos peixes (Actinopterygii, Teleostei de ribeirões da bacia do rio Tibagi, Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Shibatta Oscar A.


    Full Text Available The standard length of 7610 specimens of 43 species from eight streams of rio Tibagi basin was obtained in order to analyze the means of fish sizes. The higher mean size was observed in Gymnotus carapo Linnaeus, 1758 (165,5 mm and the smaller, in Phalloceros caudimaculatus (Hensel, 1868 (16,25 mm. Some fish like Acestrorhynchus lacustris (Reinhardt, 1874, Leporinus obtusidens (Valenciennes, 1836, Gymnotus carapo Linneus, 1758 and Synbranchus marmoratus Bloch, 1795 can reach big or medium size when adults but were collected only young, evidencing they use some streams in beginning of life. The mean size of total species was 49,81mm, what shows the small size composition of fishes in the streams. The Kolmogov-Smirnov test comparing the mean size of all streams showed significant similar size both in upstream and downstream regions, independent to the different environmental conditions.

  3. Estrutura populacional e biologia reprodutiva de Menticirrhus americanus (Linnaeus, 1758 (Teleostei, Sciaenidae na baía de Ubatuba-Enseada, Santa Catarina, Brasil

    Directory of Open Access Journals (Sweden)

    Matheus Oliveira Freitas


    primeira maturação gonadal (L50 foi estimado em 16,7cm para fêmeas e 15,4cm para machos. O período reprodutivo ocorreu nas estações quentes, e a espécie apresentou desova múltipla. O índice hepatossomático apresentou variação sazonal similar à descrita para o índice gonadossomático, e pode ser considerado bom indicador da desova. O fator de condição não foi um bom indicador do período de desova, mas esteve relacionado com o processo de recuperação e maturação das gônadas. Características da dinâmica populacional mostraram que M. americanus utiliza a área de estudo para reprodução e recrutamento.

  4. Dynamics and cytochemistry of oogenesis in Leporinus striatus Kner (Teleostei, Characiformes, Anostomidae from the Rio Sapucaí, Minas Gerais State, Brazil

    Directory of Open Access Journals (Sweden)

    Helena A.S. Chini


    Full Text Available Oogenesis involves a sequense of transformations which are undergone by female germ cells. These cells change into oogonias and then into mature oocytes. Sexually mature females were collected monthly, during one year, from the Rio Sapucaí, tributary of the Rio Grande, which is part of the Furnas Reservoir system in the state of Minas Gerais. The observed material showed that oogonias were small spherical cells, had a big spherical nucleus, with a single nucleolus, and weakly stained cytoplasm with eosinophilic granules (FG stained, which indicate their protein content. The primary oocytes showed a big basophilic nucleus, with a large peripheral nucleolus, and several smaller nucleoli. They show a reduced cytoplasmic content. The previtellogenic oocytes presented voluminous cytoplasm and nucleus with several small peripheral nucleoli. The oocytes underwent vitellogenesis with the development of the zona radiata and the follicle cells. The zona radiata had two layers, the outer and the inner, which showed its protein content when stained with CM and FG techniques. TB pH 2.5 and pH 4.0 staining showed that oocytes undergoing vitellogenesis presented weakly stained cytoplasm and peripheral cytoplasmic vesicles. The follicle cells that were squamous became cuboidal. In mature oocytes, the yolk granules that filled the cytoplasm became green and blue when stained with FG and CM techniques, indicating their protein content. The perivitclline region showed rosy stained vesicles (TB pH 2.5 and pH 4.0 spread among the weakly stained peripheral vesicles, which seemed to be the cortical alveoli. The zona radiata cells, CM and FG stained, still showed two layers like the oocytes from the previous stage, but thicker.

  5. Small scale distribution patterns and vertical migration of North Sea herring larvae (Clupea harengus, Teleostei: Clupeidea in relation to abiotic and biotic factors

    Directory of Open Access Journals (Sweden)

    Holger Haslob


    Full Text Available The distribution of herring larvae in relation to environmental conditions and the occurrence of possible prey and predator organisms was studied during a 4-day period on a permanent station in the northern North Sea in September 1999. The vertical distribution of herring larvae was sampled in 20-m intervals by means of a multiple-closing net. To resolve the small-scale patchiness of herring larvae and planktonic prey and predator organisms, a towed in-situ video system was used, the Ichthyoplankton Recorder. A diel vertical migration of herring larvae was observed with different intensities depending on their body length. Small larvae ( 16 mm showed the highest abundances in the upper water layers during the day and were concentrated in deeper water layers during the night. The presented results appear to be relevant for individual-based modelling of the fate of larval herring populations.

  6. Use of food resources and resource partitioning among five syntopic species of Hypostomus (Teleostei: Loricariidae in an Atlantic Forest river in southern Brazil

    Directory of Open Access Journals (Sweden)

    Vinicius Abilhoa

    Full Text Available ABSTRACT We analyzed the diet and resource partitioning among five syntopic species of Hypostomus Lacépède, 1803 in the Corumbataí River in southeastern Brazil. The gut contents of 352 individuals were assessed and 21 food items were identified and quantified under an optical microscope. The food items found in the gut contents indicate that these suckermouth loricariids are bottom-dwelling detritivorous/periphytivorous catfishes. PERMANOVA and SIMPER analyses indicated variation in the consumption of some resources, and the contribution of periphytic algae was primarily responsible for such dissimilarity. ECOSIM analyses of dietary overlap showed evidence of resource sharing among all species in the dry and rainy periods. This is most likely the result of the predominance of detritus and autochthonous items such as algae and aquatic immature insects in all gut contents. Our data suggest that trophic resources available in the Corumbataí River are explored and partitioned among Hypostomus species, all specialized in surface-grazing foraging behaviour.

  7. Karyotype differentiation in 19 species of river loach fishes (Nemacheilidae, Teleostei): extensive variability associated with rDNA and heterochromatin distribution and its phylogenetic and ecological interpretation

    Czech Academy of Sciences Publication Activity Database

    Sember, Alexandr; Bohlen, Jörg; Šlechtová, Vendula; Altmanová, M.; Symonová, Radka; Ráb, Petr


    Roč. 15, č. 251 (2015) ISSN 1471-2148 R&D Projects: GA ČR GA206/08/0637 Institutional support: RVO:67985904 Keywords : fish cytotaxonomy * karyotype variability vs. 2n uniformity * FISH Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.406, year: 2015

  8. Characterizing a novel predator–prey relationship between native Diplonychus esakii (Heteroptera: Belostomatidae and invasive Gambusia affinis (Teleostei: Poeciliidae in central China

    Directory of Open Access Journals (Sweden)

    Xu Ouyang


    Full Text Available Abstract A considerable body of the literature considers the potential impact of exotic predators on native prey organisms, while comparatively, few studies have asked whether and how native predators include novel prey types into their diet spectrum. Here, we asked whether the native aquatic heteropteran Diplonychus esakii preys on the highly invasive western mosquitofish (Gambusia affinis, which has been introduced to southern China and threatens native fish species through competition and predation on their fry. We conducted 48-h prey choice experiments under semi-natural conditions. In a ‘no-choice’ experiment (one predator and one potential prey; n = 200, we found the heteropterans to prey more on large-bodied fish, a pattern that was also described for other belostomatids, while prey sex had no effect on capture rates. Moreover, large-bodied heteropterans caught more fish than small-bodied individuals. However, overall capture rates in our study were low (11.5–30% compared to studies on other belostomatids, which explains why subsequent binary prey choice experiments using one predator and two prey—either large and small females or male and female (with smaller sample sizes of n = 20 and 30, respectively—did not confirm the results of our first experiment. Our study exemplifies how a pattern of body size-dependent predation can arise in a novel (not coevolved predator–prey interaction. We tentatively argue that the observed pattern could be driven by intrinsic features of the predator, namely, altered prey preferences with increasing age coupled with a general preference for large-bodied prey, or changing nutritional needs at different developmental stages.

  9. Temporal and spatial patterns on serra, Scomberomorus brasiliensis (Teleostei, Scombridae, catches from the fisheries on the Maranhão coast, Brazil

    Directory of Open Access Journals (Sweden)

    BATISTA V. da


    Full Text Available The displacement pattern of the serra, Scomberomorus brasiliensis, in North-eastern Brazil was analyzed from landing data recorded from the fleet fishing serra. Serra fishery has two seasons: from September to February (demersal species plus serra, and from March to August (almost only large amounts of serra. S. brasiliensis relative abundance increases similarly along the coast from March, but decreases first on the West coast from June. Records indicate that serra is near the coast at least until September/October in Eastern grounds. From October to March (strongest spawning season there is no record of shoals on the coast. We concluded that the Maranhão coast is just a part of the migration circuit of S. brasiliensis that may exceed 300 nautical miles.

  10. Structures and immunolocalization of Na+, K+ -ATPase, Na+ /H+ exchanger 3 and vacuolar-type H+ -ATPase in the gills of blennies (Teleostei: Blenniidae) inhabiting rocky intertidal areas. (United States)

    Uchiyama, M; Komiyama, M; Yoshizawa, H; Shimizu, N; Konno, N; Matsuda, K


    The structure and immunolocalization of the ion transporters Na(+) ,K(+) -ATPase (NKA), Na(+) /H(+) exchanger (NHE3) and vacuolar-type H(+) -ATPase (VHA) were examined in the gills of teleosts of the family Blenniidae, which inhabit rocky shores with vertical zonation in subtropical seas. These features were compared among the following species with different ecologies: the amphibious rockskipper blenny Andamia tetradactylus, the intertidal white-finned blenny Praealticus tanegasimae and the purely marine yaeyama blenny Ecsenius yaeyamaensis. Light and electron microscopic observations indicated that thick gill filaments were arranged close to each other and alternately on two hemibranches of a gill arch in the opercular space of A. tetradactylus. Many mucous cells (MC) and mitochondrion-rich cells (MRC) were present in the interlamellar regions of the gill filament. An immunohistochemical study demonstrated that numerous NKA, NHE3 and some VHA were located predominantly on presumed MRCs of gill filaments and at the base of the lamellae. Analyses using serial (mirror image) sections of the gills indicated that only a few NKA immunoreactive cells (IRC) were colocalized with VHA on some MRCs in the filaments. In the gills of P. tanegasimae, NKA- and NHE3-IRCs were observed in the interlamellar region of the filaments and at the base of the lamellae. VHA-IRCs were located sparsely on the lamellae and filaments. In the gills of E. yaeyamaensis, the lamellae and filaments were thin and straight, respectively. MCs were located at the tip as well as found scattered in the interlamellar region of gill filaments. NKA-, NHE3- and VHA-IRCs were moderately frequently observed in the filaments and rarely on the lamellae. This study shows that the structure and distribution of ion transporters in the gills differ among the three blennid species, presumably reflecting their different ecologies. © 2012 The Authors. Journal of Fish Biology © 2012 The Fisheries Society of the British Isles.

  11. Asexual Reproduction Does Not Apparently Increase the Rate of Chromosomal Evolution: Karyotype Stability in Diploid and Triploid Clonal Hybrid Fish (Cobitis, Cypriniformes, Teleostei)

    Czech Academy of Sciences Publication Activity Database

    Majtánová, Zuzana; Choleva, Lukáš; Symonová, Radka; Ráb, Petr; Kotusz, J.; Pekárik, L.; Janko, Karel


    Roč. 11, č. 1 (2016), e0146872-e0146872 E-ISSN 1932-6203 R&D Projects: GA ČR GAP506/10/1155; GA ČR GPP506/12/P857; GA ČR GA13-12580S Institutional support: RVO:67985904 Keywords : in-situ hybridization * fresh water fish * unisexual salamanders Subject RIV: EG - Zoology Impact factor: 2.806, year: 2016

  12. Diet of two serrasalmin species, Pygocentrus piraya and Serrasalmus brandtii (Teleostei: Characidae, along a stretch of the rio de Contas, Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Márcia Emília de Jesus Trindade

    Full Text Available Serrasalmus brandtii and Pygocentrus piraya are two common piranha species in the Barragem da Pedra Reservoir, rio de Contas. In order to identify the diet composition of the two species, monthly collections were performed at three sites between May 2001 and April 2003, using two gill nets of different mesh sizes cast at the beginning of the day and visited after 6, 12 and 24 h. The qualitative composition of the diet was analyzed by determining the frequency of occurrence. Comparison of the two species showed a higher relative abundance of S. brandtii (151 compared to P. piraya (55. The food items most frequently found in the stomachs of the two species were fins, fish and shrimp. Serrasalmus brandtii showed a greater feeding plasticity than P. piraya.

  13. Multiple nuclear and mitochondrial genotyping identifies emperors and large-eye breams (Teleostei : Lethrinidae) from New Caledonia and reveals new large-eye bream species


    Borsa, Philippe; Collet, Adeline; Carassou, Laure; Ponton, Dominique; Chen, W. J.


    International audience; Species identification is fundamental to address questions about community ecology, biodiversity, conservation and resource management, at any life history stage. Current studies on fish larval ecology of tropical species are hampered by the lack of reliable and effective tools for identifying larvae at the species level. Emperors and large-eye breams comprise fish species from the perciform fish family Lethrinidae. They inhabit coastal and coral-reef habitats of the t...

  14. Redescription of Rhabdochona cotti (Nematoda, Rhabdochonidae) from Cottus caeruleomentum (Teleostei, Cottidae) in Maryland, USA, with remarks on the taxonomy of North American Rhabdochona spp

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Muzzall, P.


    Roč. 52, č. 1 (2007), s. 51-57 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdochona * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.814, year: 2007

  15. Ancyrocephalidae (Monogenea of Lake Tanganyika: I: Four new species of Cichlidogyrus from Ophthalmotilapia ventralis (Teleostei: Cichlidae, the first record of this parasite family in the basin

    Directory of Open Access Journals (Sweden)

    Maarten P. M. Vanhove


    Full Text Available Examination of gill parasites from Ophthalmotilapia ventralis (Boulenger, 1898 in Lake Tanganyika (Africa revealed the presence of four new species of Monogenea, all members of Cichlidogyrus Paperna, 1960 (Ancyrocephalidae. In view of the systematic importance of haptoral structure, the fish host shows a remarkable diversity of morphological groups. Cichlidogyrus vandekerkhovei sp. nov. and C. makasai sp. nov. are especially characterized by the unusual length of the dorsal transverse bar auricles, while C. sturmbaueri sp. nov. is distinguished by the unique shape of the accessory piece of its male copulatory organ. Importantly, C. centesimus sp. nov. displays a number of features new to the genus, namely a spirally coiled thickening at the end of the penis, the absence of an accessory piece in the genital apparatus, and a hitherto unknown uncinuli configuration in the haptor. This is the first record of ancyrocephalid parasites from the Tanganyika basin. Some mechanisms possibly contributing to this yet unknown diversity are discussed, identifying topics deserving further scientific scrutiny.

  16. Mapping of the 18S and 5S ribosomal RNA genes in Astyanax altiparanae Garutti & Britski, 2000 (Teleostei, Characidae from the upper Paraná river basin, Brazil

    Directory of Open Access Journals (Sweden)

    Carlos Alexandre Fernandes


    Full Text Available Fluorescence in situ hybridization (FISH was undertaken in order to determinate the chromosomal distribution pattern of 18S and 5S ribosomal DNAs (rDNA in four populations of the characid fish Astyanax altiparanae from the upper Paraná river basin, Brazil. The 18S rDNA probe FISH revealed numerical and positional variations among specimens from the Keçaba stream compared to specimens of the other populations studied. In contrast to the variable 18S rDNA distribution pattern, highly stable chromosomal positioning of the 5S rDNA sites was observed in the four A. altiparanae populations. Divergence in the distribution pattern of 18S and 5S rDNA sites is also discussed.

  17. †.i.Gonostoma dracula./i. sp. nov. (Teleostei, Gonostomatidae) from the Oligocene deposits of the Central Paratethys (Romania): earliest occurrence of the modern bristlemouths

    Czech Academy of Sciences Publication Activity Database

    Grădianu, I.; Přikryl, Tomáš; Gregorová, R.; Harold, A. S.


    Roč. 92, č. 3 (2017), s. 323-336 ISSN 1214-1119 R&D Projects: GA ČR(CZ) GA16-21523S Institutional support: RVO:67985831 Keywords : Stomiiformes * Gonostomatidae * †Gonostoma dracula sp. nov. * Paratethys * Oligocene * Romania Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 1.175, year: 2016

  18. Photoreactivation rescue and dark repair demonstrated in UV-irradiated embryos of the self-fertilizing fish Rivulus ocellatus marmoratus (Teleostei; Aplocheilidae)

    International Nuclear Information System (INIS)

    Park, E.-H.; Yi, A.-K.


    The effects of photoreactivation (PR) rescue and dark repair on the survival of UV-irradiated embryos of the hermaphroditic fish (Rivulus ocellatus marmoratus) are reported. When UV-irradiated embryos were illuminated by photoreactivating light (PRL) from fluorescent lamps, survival at the hatching stage was markedly increased. The maximum recovery to UV damage was shown by embryos that were exposed to PRL for at least 6 h after UV irradiation. The effect of PRL decreased 30 min after UV irradiation and not PR rescue ws detected beyond 96 h. Treatment with 2 mM caffeine for 48 h after UV irradiation increased the sensitivity of the embryos in the dark. The above results demonstrate that Rivulus embryos have an efficient PR system and a caffeine-sensitive dark repair capacity. (author). 31 refs.; 5 figs

  19. Dynamics and cytochemistry of oogenesis in Astyanax fasciatus (Cuvier (Teleostei, Characiformes, Characidae from Rio Sapucaí, Minas Gerais State, Brazil

    Directory of Open Access Journals (Sweden)

    José Antônio Dias Garcia


    Full Text Available Oogenesis involves a set of transformations which are undergone by female germ cells These cells change into oogonias and then into mature oocytes. Sexually mature female fish were collected monthly, during one year, from the Sapucaí River, a tributary of the Rio Grande, which is part of the Furnas Reservoir in the state of Minas Gerais. During the several stages of maturation, we observed small round oogonias with a large nucleus, a single nucleolus, and weakly stained cytoplasm with eosinophilic granules. The primary oocytes showed a large basophilic nucleus, with a developed peripheral nucleolus and a reduced cytoplasm. The previtellogenic oocytes presented voluminous cytoplasm and nucleus with several small peripheral nucleoli. The oocytes underwent vitellogenesis with the development of the zona radiata and the follicle cells. Their cytochemical reactions indicated that the two layers of the zona radiata of A. fasciatus contained proteins and polysaccharides. The initially squamous follicle cells, became cuboidal. In mature oocytes, the nucleus moved toward the periphery, next to the micropyle, and the yolk granules formed by proteins, fulfilled the cytoplasm. The clear unstained vesicles are likely to be the cortical alveoli in the perivitelline region.

  20. Taxonomic Status of Neoechinorhynchus Agilis (Acanthocephala, Neoechinorhynchidae, with a Description of two New Species of the Genus from the Atlantic and Pacific Mullets (Teleostei, Mugilidae

    Directory of Open Access Journals (Sweden)

    Tkach Ie. V.


    Full Text Available Широкое географическое распространение, богатый список хозяев, а также значительная вариабельность метрических признаков аканто- цефалы Neoechinorhynchus agilis (Rudolphi, 1819 ставит вопрос о таксономическом статусе этого вида. Для проведения сравнительного морфологического анализа был использован типичный материал Рудольфи и ваучерные экземпляры Ямагути, а также собственный материал, собранный в западной части Тихого океана и северо-восточной Атлантике. В результате исследования было обнаружено три вида акантоцефал Neoechinorhynchus, в том числе два вида из Атлантики: N. (N. agilis и N. (H. personatus Tkach, Sarabeev et Shvetsova, sp. n., и один вид из Тихого океана, N. (H. yamagutii Tkach, Sarabeev et Shvetsova, sp. n. Описанные в работе виды хорошо различаются как морфологически, так и метрически. Разделение N. agilis на три вида, два из которых описаны впервые, является основой для дальнейшего пересмотра находок этой акантоцефалы из разных регионов и от разных хозяев.

  1. Taxonomic review of the species of Mugil (Teleostei: Perciformes: Mugilidae) from the Atlantic South Caribbean and South America, with integration of morphological, cytogenetic and molecular data. (United States)

    Menezes, Naércio A; Nirchio, Mauro; De Oliveira, Cláudio; Siccharamirez, Raquel


    Analysis of morphological, molecular and cytological data helped to define and more precisely characterize the species of Mugil from the Atlantic coasts of South Caribbean and South America, allowing a correction of prior misidentifications and distributional ranges. A new species from Venezuela is described and all the species from the area are redescribed. It is demonstrated that the apparent similarity in morphological traits, which contradicted the results from recent molecular studies, is the result of the misuse of traditional morphological characters, and thus both the molecular and cytological data instead are congruent with the morphological differences that are found among mullet species. The presence of Mugil hospes Jordan & Culver in the western south Atlantic is refuted based on the comparison of type material of this species with specimens from this area that also indicated a very significant morphological difference, what on the other hand justifies the recognition of these specimens as Mugil brevirostris (Ribeiro). The distribution of Mugil incilis Hancock is restricted and the similarities among the species formerly depicted in a prior dendrogram is modified following the inclusion of recently obtained molecular data for Mugil curvidens Valenciennes.

  2. Ligophorus pilengas n. sp. (Monogenea: Ancyrocephalidae) from the introduced So-iuy mullet, Mugil soiuy (Teleostei: Mugilidae), in the Sea of Azov and the Black Sea. (United States)

    Sarabeev, Volodimir Leonidovich; Balbuena, Juan Antonio


    The monogenean Ligophorus chabaudi was originally described on the gills of the flathead mullet, Mugil cephalus, and was subsequently reported on the So-iuy mullet, Mugil soiuy. However, the morphology of sclerotized parts and multivariate statistical analyses suggest that the form from the So-iuy mullet represents a new species. This study provides a description of the new species Ligophorus pilengas n. sp. and provides additional morphological data concerning the morphology of the ventral bar that might be useful for the diagnosis of Ligophorus. Ligophorus pilengas n. sp. is the second species of Ligophorus reported on the So-iuy mullet. Zoogeographical records indicate that L. pilengas n. sp. was probably introduced to the Black Sea and the Sea of Azov from the western Pacific Ocean together with its host.

  3. Genetic divergence and phylogenetic relationships in grey mullets (Teleostei: Mugilidae) based on PCR-RFLP analysis of mtDNA segments. (United States)

    Papasotiropoulos, V; Klossa-Kilia, E; Kilias, G; Alahiotis, S


    The genetic differentiation and phylogenetic relationships among five species of the Mugilidae family (Mugil cephalus, Chelon labrosus, Liza aurata, Liza ramada, and Liza saliens) were investigated at the mtDNA level, on samples taken from Messolongi lagoon-Greece. RFLP analysis of three PCR-amplified mtDNA gene segments (12s rRNA, 16s rRNA, and CO I) was used. Ten, eight, and nine restriction enzymes were found to have at least one recognition site at 12s rRNA, 16s rRNA, and CO I genes, respectively. Several fragment patterns were revealed to be species-specific, and thus they could be useful in species taxonomy as diagnostic markers, as well as for further evolutionary studies. Seven different haplotypes were detected. The greatest amount of genetic differentiation was observed at the interspecific level, while little variation was revealed at the intraspecific level. The highest values of nucleotide sequence divergence were observed between M. cephalus and all the other species, while the lowest was found between C. labrosus and L. saliens. Dendrograms obtained by the three different methods (UPGMA, Neighbor-Joining, and Dollo parsimony), were found to exhibit in all cases the same topology. According to this, the most distinct species is M. cephalus, while the other species are clustered in two separate groups, thefirst one containing L. aurata and L. ramada, the other L. saliens and C. labrosus. This last clustering makes the monophyletic origin of the genus Liza questionable.

  4. The translocated Liza haematocheila (Teleostei: Mugilidae) as a new host of four species of Saturnius Manter, 1969 (Digenea: Hemiuridae) within its invasive range in the Black Sea. (United States)

    Pankov, Plamen; Gibson, David I; Kostadinova, Aneta


    This paper presents the first documented record of four species of Saturnius Manter, 1969 in Liza haematocheila (Temminck & Schlegel) in its invasive Pontic range. S. papernai Overstreet, 1977, S. dimitrovi Blasco-Costa, Pankov, Gibson, Balbuena, Raga, Sarabeev & Kostadinova, 2006, S. minutus Blasco-Costa, Pankov, Gibson, Balbuena, Raga, Sarabeev & Kostadinova, 2006 and Saturnius sp. are described and compared with existing data by means of multivariate morphometric analysis. The morphological and morphometric similarities between the specimens of Saturnius sp. from L. haematocheila and a small form of S. papernai from L. aurata indicate the possible existence of another, cryptic species. Although having acquired at least three species of Saturnius since its establishment in the Black Sea region, there is no evidence that a Pacific congener has been introduced with this fish. This is the first report of S. minutus from the Black Sea.

  5. Taxonomic status of Ligophorus mugilinus (Hargis, 1955) (Monogenea: Ancyrocephalidae), with a description of a new species of Ligophorus from Mugil cephalus (Teleostei: Mugilidae) in the Mediterranean Basin. (United States)

    Sarabeev, Volodimir Leonidovich; Balbuena, Juan Antonio; Euzet, Louis


    Ligophorus mugilinus was originally described on the flathead mullet Mugil cephalus from the Gulf of Mexico. The species was later recorded in the Mediterranean Sea on the flathead mullet and in the Caribbean Sea on the white mullet Mugil curema. After examination of the type material and additional specimens of Ligophorus from the northwest Atlantic coast, the Caribbean Sea, and the Mediterranean and Black Sea, we observed morphological differences concerning haptoral and male copulatory structures between L. mugilinus from the northwest Atlantic and the forms from the Mediterranean and Black Seas. Accordingly, the latter specimens are described as a new species, Ligophorus mediterraneus n. sp. A redescription of L. mugilinus, including new morphometric data, is also given. The morphometric analysis of the Caribbean specimens suggested that their ascription to L. mugilinus is uncertain, but additional material is needed to clarify their specific identity. The results of this study, together with previous zoogeographical evidence, indicate that flathead mullets from different seas harbor different species complexes of Ligophorus. Given the coastal habits of the host, it is suggested that open oceans could act as geographical barriers favoring speciation within disjointed flathead mullet populations.

  6. Testing the enemy release hypothesis: abundance and distribution patterns of helminth communities in grey mullets (Teleostei: Mugilidae) reveal the success of invasive species. (United States)

    Sarabeev, Volodimir; Balbuena, Juan Antonio; Morand, Serge


    The abundance and aggregation patterns of helminth communities of two grey mullet hosts, Liza haematocheilus and Mugil cephalus, were studied across 14 localities in Atlantic and Pacific marine areas. The analysis matched parasite communities of (i) L. haematocheilus across its native and introduced populations (Sea of Japan and Sea of Azov, respectively) and (ii) the introduced population of L. haematocheilus with native populations of M. cephalus (Mediterranean, Azov-Black and Japan Seas). The total mean abundance (TMA), as a feature of the infection level in helminth communities, and slope b of the Taylor's power law, as a measure of parasite aggregation at the infra and component-community levels, were estimated and compared between host species and localities using ANOVA. The TMA of the whole helminth community in the introduced population of L. haematocheilus was over 15 times lower than that of the native population, but the difference was less pronounced for carried (monogeneans) than for acquired (adult and larval digeneans) parasite communities. Similar to the abundance pattern, the species distribution in communities from the invasive population of L. haematocheilus was less aggregated than from its native population for endoparasitic helminths, including adult and larval digeneans, while monogeneans showed a similar pattern of distribution in the compared populations of L. haematocheilus. The aggregation level of the whole helminth community, endoparasitic helminths, adult and larval digeneans was lower in the invasive host species in comparison with native ones as shown by differences in the slope b. An important theoretical implication from this study is that the pattern of parasite aggregation may explain the success of invasive species in ecosystems. Because the effects of parasites on host mortality are likely dose-dependent, the proportion of susceptible host individuals in invasive species is expected to be lower, as the helminth distribution in the invasive host was featured by a higher number of uninfected hosts and a shorter distribution tail when compared with native species. Copyright © 2017 Australian Society for Parasitology. Published by Elsevier Ltd. All rights reserved.

  7. Multi-locus analyses of an Antarctic fish species flock (Teleostei, Notothenioidei, Trematominae): Phylogenetic approach and test of the early-radiation event

    International Nuclear Information System (INIS)

    Janko, K.; Musilova, Z.; Marshall, C.; Van Houdt, J.; Couloux, A.; Cruaud, C.; Lecointre, G.


    Clades that have undergone episodes of rapid cladogenesis are challenging from a phylogenetic point of view. They are generally characterised by short or missing internal branches in phylogenetic trees and by conflicting topologies among individual gene trees. This may be the case of the subfamily Trematominae, a group of marine teleosts of coastal Antarctic waters, which is considered to have passed through a period of rapid diversification. Despite much phylogenetic attention, the relationships among Trematominae species remain unclear. In contrast to previous studies that were mostly based on concatenated datasets of mitochondrial and/or single nuclear loci, we applied various single-locus and multi-locus phylogenetic approaches to sequences from 11 loci (eight nuclear) and we also used several methods to assess the hypothesis of a radiation event in Trematominae evolution. Diversification rate analyses support the hypothesis of a period of rapid diversification during Trematominae history and only a few nodes in the hypothetical species tree were consistently resolved with various phylogenetic methods. We detected significant discrepancies among trees from individual genes of these species, most probably resulting from incomplete lineage sorting, suggesting that concatenation of loci is not the most appropriate way to investigate Trematominae species interrelationships. These data also provide information about the possible effects of historic climate changes on the diversification rate of this group of fish. (authors)

  8. Genetic variability of Hypostomus (Teleostei, Loricariidae from the Ribeirão Maringá, a stream of the upper Rio Paraná basin, Brazil

    Directory of Open Access Journals (Sweden)

    Suzana de Paiva


    Full Text Available Hypostomus strigaticeps and two morphotypes of Hypostomus were collected from Ribeirão Maringá, a small tributary of the Rio Pirapó, an effluent of the upper Rio Paraná. The three populations were analyzed by allozyme electrophoresis that allowed the scoring of 25 loci from 14 enzyme systems. Heterozygosity values (He were 0.028 in H. strigaticeps, 0.027 in Hypostomus sp. 1 and zero in Hypostomus sp. 2. Several diagnostic loci and fixed differences were observed for each population at loci Acp-A, Gcdh-A and Mdhp-A. Thus, all populations were genetically distinct, although there were many common alleles. The unbiased genetic identities of Nei (I were estimated as 0.780 for Hypostomus sp. 1 and H. strigaticeps, 0.357 for H. strigaticeps and Hypostomus sp. 2 and 0.322 for Hypostomus sp. 1 and Hypostomus sp. 2. The data indicate that the two morphotypes are distinct species from Hypostomus strigaticeps.

  9. Localization of 18S ribosomal genes in suckermouth armoured catfishes Loricariidae (Teleostei, Siluriformes with discussion on the Ag-NOR evolution

    Directory of Open Access Journals (Sweden)

    Anderson Alves


    Full Text Available The family Loricariidae with about 690 species divided into six subfamilies, is one of the world’s largest fish families. Cytogenetic studies conducted in the family showed that among 90 species analyzed the diploid number ranges from 2n=38 in Ancistrus sp. to 2n=96 in Hemipsilichthys gobio Luetken, 1874. In the present study, fluorescence in situ hybridization (FISH was employed to determine the chromosomal localization of the 18S rDNA gene in four suckermouth armoured catfishes: Kronichthys lacerta (Nichols, 1919, Pareiorhaphis splendens (Bizerril, 1995, Liposarcus multiradiatus (Hancock, 1828 and Hypostomus prope plecostomus (Linnaeus, 1758. All species analyzed showed one chromosome pair with 18S rDNA sequences, as observed in the previous Ag-NORs analyses. The presence of size and numerical polymorphism was observed and discussed, with proposing a hypothesis of the Ag-NOR evolution in Loricariidae.

  10. Karyotypic diversity and evolutionary trends in the Neotropical catfish genus Hypostomus Lacépède, 1803 (Teleostei, Siluriformes, Loricariidae

    Directory of Open Access Journals (Sweden)

    Anderson Alves


    Full Text Available The family Loricariidae with 813 nominal species is one of the largest fish families of the world. Hypostominae, its more complex subfamily, was recently divided into five tribes. The tribe Hypostomini is composed of a single genus, Hypostomus Lacépède, 1803, which exhibits the largest karyotypic diversity in the family Loricariidae. With the main objective of contributing to a better understanding of the relationship and the patterns of evolution among the karyotypes of Hypostomus species, cytogenetic studies were conducted in six species of the genus from Brazil and Venezuela. The results show a great chromosome variety with diploid numbers ranging from 2n=68 to 2n=76, with a clear predominance of acrocentric chromosomes. The Ag-NORs are located in terminal position in all species analyzed. Three species have single Ag-NORs (Hypostomus albopunctatus (Regan, 1908, H. prope plecostomus (Linnaeus, 1758, and H. prope paulinus (Ihering, 1905 and three have multiple Ag-NORs (H. ancistroides (Ihering, 1911, H. prope iheringi (Regan, 1908, and H. strigaticeps (Regan, 1908. In the process of karyotype evolution of the group, the main type of chromosome rearrangements was possibly centric fissions, which may have been facilitated by the putative tetraploid origin of Hypostomus species. The relationship between the karyotype changes and the evolution in the genus is discussed.

  11. Influence of season, environment and feeding habits on the enzymatic activity of peptidase and β-glucosidase in the gastrointestinal tract of two Siluriformes fishes (Teleostei

    Directory of Open Access Journals (Sweden)

    Silvana Duarte


    Full Text Available The enzymatic activities involved in the digestion of proteins and carbohydrates were compared among three organs of the digestive track of two Siluriformes fish species, and between two areas: a reservoir, and an area downriver of it. Our aim was to test the hypothesis that the digestive organs of species with varied feeding habits have different enzymatic activities, and that the enzymatic activity differs among seasons and environmental conditions. The iliophagous/herbivorous species Hypostomus auroguttatus Kner, 1854 had higher trypsin-like, chymotrypsin-like peptidase and β-glucosidase activity in the intestine when compared with the omnivorous species Pimelodus maculatus Lacepède, 1803, whereas the latter had more hepatic trypsin-like activity than the former. The peak of activity of the three enzymes in H. auroguttatus was recorded in the winter and spring. On the other hand, P. maculatus tended to have the more prominent peptidase and β-glucosidase activity in the summer, and the smallest in the winter. The intestine of H. auroguttatus had higher enzymatic (trypsin, chymotrypsin and β-glucosidase activity than the stomach and the liver. For P. maculatus, the highest β-glucosidase activity was found in the liver. The enzymatic activity of H. aurogutattus did not differ between lotic and lentic systems, whereas P. maculatus had comparatively higher stomach and hepatic trypsin levels and hepatic chymotrypsin-like activities in the reservoir than down in the river. These findings indicate that, in H. auroguttatus, most digestive activity occurs in the intestine, which is long and adapted for the digestion of bottom-river vegetable matter and detritus. The seasons and the type of the system (lentic vs. lotic seem to affect the enzymatic activity for these two species differently, a likely consequence of their different lifestyles.

  12. Karyotype description of possible new species of the Hypostomus ancistroides complex (Teleostei: Loricariidae and other Hypostominae - doi: 10.4025/actascibiolsci.v34i2.9318

    Directory of Open Access Journals (Sweden)

    Horácio Ferreira Júlio Júnior


    Full Text Available Cytogenetic analyses were performed in four species of the Hypostominae subfamily, three from Hypostomus (Hypostomini genus and Rhinelepis aspera (Rhinelepini. Three populations of Hypostomus ancistroides were analyzed, which had 2n=68 chromosomes, but presented different karyotype formulas. Hypostomus regani and H. strigaticeps, both from Ivaí river, showed 2n=72 chromosomes with two distinct cytotypes. In turn, R. aspera of the upper Paraná river basin presented 2n=54 chromosome. Multiple Nucleolar Organizer Regions (NORs have been evidenced by silver nitrate staining in species of Hypostomus and single NOR in R. aspera. The observed variation in the chromosome number and the marked variability in karyotype formulas and NORs reveal a certain amount of karyotype variation in the genus Hypostomus suggesting the probable existence of cryptic species with independent chromosome traits. Therefore, our data can be of great value in discriminating species and understanding their chromosomal evolution.

  13. Description of karyotype in Hypostomus regani (Ihering, 1905 (Teleostei, Loricariidae from the Piumhi river in Brazil with comments on karyotype variation found in Hypostomus

    Directory of Open Access Journals (Sweden)

    Ernani de Oliveira Mendes-Neto


    Full Text Available The paper represents a comparative cytogenetic analysis of three populations of Hypostomus regani in Brazil. Two populations belong to the Upper Paraná River Basin and the third one, the karyotype of which is described for the first time, was probably introduced into the São Francisco River Basin through transposition from the Piumhi River. Karyotype features of populations of H. regani from the Piracicaba and Tietê River Basins are also discussed. The occurrence of H. regani in the São Francisco River Basin is reported for the first time here. The study also revealed distinct differences in the location of the Ag-NORs between the analyzed populations that enable individuals from the Piumhi River, Mogi-Guaçu River and Tietê River to be distinguished from one another. Thus, the data obtained indicate the possibility of geographic variation fixing different karyotypes even in the same basin of origin.

  14. Multilocus analyses of an Antarctic fish species flock (Teleostei, Notothenioidei, Trematominae): Phylogenetic approach and test of the early-radiation event

    Czech Academy of Sciences Publication Activity Database

    Janko, Karel; Marshall, C.; Musilová, Zuzana; Van Houdt, J.; Couloux, A.; Cruaud, C.; Lecointre, G.


    Roč. 60, č. 3 (2011), s. 305-316 ISSN 1055-7903 R&D Projects: GA AV ČR KJB600450903; GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50450515 Keywords : Species tree versus gene tree * Multilocus phylogeny * Diversification rate Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.609, year: 2011

  15. Gene mapping of 28S and 5S rDNA sites in chromosomes of two Barbus species and their F1 hybrids (Teleostei, Cyprinidae

    Directory of Open Access Journals (Sweden)

    Aneta Spoz


    Chromosomal location of ribosomal DNA sequences is useful for comparative cytogenetic fish studies due to their relatively fast rate of evolution. The results of species from the family Barbinae comparatively presented here for the first time, and they may support further taxonomical studies of the Barbus species.

  16. Molecular evolution of myoglobin in the Tibetan Plateau endemic schizothoracine fish (Cyprinidae, Teleostei) and tissue-specific expression changes under hypoxia. (United States)

    Qi, Delin; Chao, Yan; Zhao, Yongli; Xia, Mingzhe; Wu, Rongrong


    Myoglobin (Mb) is an oxygen-binding hemoprotein that was once thought to be exclusively expressed in oxidative myocytes of skeletal and cardiac muscle where it serves in oxygen storage and facilitates intracellular oxygen diffusion. In this study, we cloned the coding sequence of the Mb gene from four species, representing three groups, of the schizothoracine fish endemic to the Qinghai-Tibetan Plateau (QTP), then conducted molecular evolution analyses. We also investigated tissue expression patterns of Mb and the expression response to moderate and severe hypoxia at the mRNA and protein levels in a representative of the highly specialized schizothoracine fish species, Schizopygopsis pylzovi. Molecular evolution analyses showed that Mb from the highly specialized schizothoracine fish have undergone positive selection and one positively selected residue (81L) was identified, which is located in the F helix, close to or in contact with the heme. We present tentative evidence that the Mb duplication event occurred in the ancestor of the schizothoracine and Cyprininae fish (common carp and goldfish), and that the Mb2 paralog was subsequently lost in the schizothoracine fish. In S. pylzovi, Mb mRNA is expressed in various tissues with the exception of the intestine and gill, but all such tissues, including the liver, muscle, kidney, brain, eye, and skin, expressed very low levels of Mb mRNA (Tibetan Plateau fish.

  17. Quadriacanthus species (Monogenea: Dactylogyridae) from catfishes (Teleostei: Siluriformes) in eastern Africa: new species, new records and first insights into interspecific genetic relationships

    Czech Academy of Sciences Publication Activity Database

    Francová, K.; Seifertová, M.; Blažek, Radim; Gelnar, M.; Mahmoud, Z. N.; Řehulková, E.


    Roč. 10, č. 361 (2017), č. článku 361. ISSN 1756-3305 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Monogenea * Dactylogyridae * Quadriacanthus * Siluriformes * Catfishes * Africa * Lake Turkana * Nile River Basin * New species * DNA Subject RIV: EG - Zoology OBOR OECD: Parasitology Impact factor: 3.080, year: 2016

  18. Heliconema longissimum (Ortlepp, 1923) (Nematoda: Physalopteridae) from Pisodonophis boro (Teleostei: Ophichthidae) in Thailand, with remarks on the taxonomy of the Proleptinae Schulz, 1927. (United States)

    Moravec, Frantisek; Taraschewski, Horst; Anantaphruti, Malinee Thairungroj; Maipanich, Wanna; Laoprasert, Thitiporn


    Physalopterid nematodes identified as Heliconema longissimum (Ortlepp, 1923) were collected from the stomach of rice-paddy eels Pisodonophis boro (Hamilton) (Anguilliformes: Ophichthidae) from two brackish-water localities (mangroves) in Thailand: one in Phan-Nga Province, southwestern Thailand, northeast of Phuket Island, and one in Ranong Province, near the border with Myanmar. Study of the morphology of this hitherto insufficiently known nematode species, including its first SEM examination, enabled a detailed redescription of H. longissimum. Present taxonomic problems in the subfamily Proleptinae Schulz, 1927 are discussed, where a new delimitation of Proleptus Dujardin, 1845, Heliconema Travassos, 1919 and Paraleptus Wu, 1927 is proposed based on the cephalic dentation. H. minnanensis [sic] Damin & Heqing, 2001 is transferred to Paraleptus Wu, 1927 as P. minnanensis (Damin & Heqing, 2001) n. comb. and Paraleptus chiloscyllii Yin & Zhang, 1983 transferred by Damin & Heqing (2001) to Heliconema, is retained in Paraleptus. H. ahiri Karve, 1941 is considered a junior synonym of H. longissimum (Ortlepp, 1923). The present finding of H. longissimum in Pisodonophis boro represents the first host record and the first record of this nematode from Thailand.

  19. Morphology of the jaw, suspensorial, and opercle musculature of Beloniformes and related species (Teleostei: Acanthopterygii), with a special reference to the m. adductor mandibulae complex. (United States)

    Werneburg, Ingmar


    The taxon Beloniformes represents a heterogeneous group of teleost fishes that show an extraordinary diversity of jaw morphology. I present new anatomical descriptions of the jaw musculature in six selected beloniforms and four closely related species. A reduction of the external jaw adductor (A1) and a changed morphology of the intramandibular musculature were found in many Beloniformes. This might be correlated with the progressively reduced mobility of the upper and lower jaw bones. The needlefishes and sauries, which are characterised by extremely elongated and stiffened jaws, show several derived characters, which in combination enable the capture of fish at high velocity. The ricefishes are characterised by several derived and many plesiomorphic characters that make broad scale comparisons difficult. Soft tissue characters are highly diverse among hemiramphids and flying fishes reflecting the uncertainty about their phylogenetic position and interrelationship. The morphological findings presented herein may help to interpret future phylogenetic analyses using cranial musculature in Beloniformes.

  20. Morphology of the jaw, suspensorial, and opercle musculature of Beloniformes and related species (Teleostei: Acanthopterygii, with a special reference to the m. adductor mandibulae complex

    Directory of Open Access Journals (Sweden)

    Ingmar Werneburg


    Full Text Available The taxon Beloniformes represents a heterogeneous group of teleost fishes that show an extraordinary diversity of jaw morphology. I present new anatomical descriptions of the jaw musculature in six selected beloniforms and four closely related species. A reduction of the external jaw adductor (A1 and a changed morphology of the intramandibular musculature were found in many Beloniformes. This might be correlated with the progressively reduced mobility of the upper and lower jaw bones. The needlefishes and sauries, which are characterised by extremely elongated and stiffened jaws, show several derived characters, which in combination enable the capture of fish at high velocity. The ricefishes are characterised by several derived and many plesiomorphic characters that make broad scale comparisons difficult. Soft tissue characters are highly diverse among hemiramphids and flying fishes reflecting the uncertainty about their phylogenetic position and interrelationship. The morphological findings presented herein may help to interpret future phylogenetic analyses using cranial musculature in Beloniformes.

  1. A new species of freshwater eel-tailed catfish of the genus Tandanus (Teleostei: Plotosidae) from coastal rivers of mid-northern New South Wales, Australia (United States)

    Welsh, Stuart A.; Jerry, Dean R.; Burrows, Damien; Rourke, Meaghan L.


    Tandanus bellingerensis, new species, is described based on specimens from four river drainages (Bellinger, Macleay, Hastings, and Manning rivers) of the mid-northern coast of New South Wales, Australia. Previously, three species were recognized in the genus Tandanus: T. tropicanus of the wet tropics region of northeast Queensland, T. tandanus of the Murray-Darling drainage and coastal streams of central-southern Queensland and New South Wales, and T. bostocki of southwestern Western Australia. The new species is distinguished from all congeners by a combination of the following morphologic characters: a high count of rays in the continuous caudodorsal and anal fins (range 153–169, mode 159), a high count of gill rakers on the first arch (range 35–39, mode 36), and strongly recurved posterior serrae of the pectoral-fin spine. Additionally, results from previously conducted genetic studies corroborate morphologic and taxonomic distinctness of the new species.

  2. Response of mucous cells of the gills of traíra (Hoplias malabaricus and jeju (Hoplerythrinus unitaeniatus (Teleostei: Erythrinidae to hypo- and hyper-osmotic ion stress

    Directory of Open Access Journals (Sweden)

    Sandro Estevan Moron

    Full Text Available The mucous cells (MC of traíra, Hoplias malabaricus, and jeju, Hoplerythrinus unitaeniatus, two ecologically distinct erythrinid species, were analyzed in fish exposed to deionized (DW and high ion concentration (NaCl and Ca2+ water (HIW during 15 days to evaluate the MC responses to ion challenge. MCs are localized in the leading and trailing edge and, interlamellar region of the gill filament epithelium but, in H. unitaeniatus, they are also found in the breathing or lamellar epithelium. MC density is lower in H. malabaricus, the exclusively water-breathing fish, than in H. unitaeniatus, a facultative air-breathing fish. The transference to DW or HIW did not change the MC density and surface area, excepting in H. malabaricus, in the first day of exposure to DW. A single MC containing three types of glycoproteins (neutral, acidic and sulphated was identified in the gill epithelium of both, H. malabaricus and H. unitaeniatus. The amount (based on the intensity of histochemistry reaction of these glycoproteins differed between the species and were altered after exposure to DW and HIW showing little adjustments in the amount of mucosubstances in the MC of H. malabaricus and reduction of acidic and sulphated glycoproteins in H. unitaeniatus. The decreasing of these glycoproteins in H. unitaeniatus reduced the mucus protection against desiccation of gill tissue when change the ion concentration in water.

  3. Distinguishing between incomplete lineage sorting and genomic introgressions: complete fixation of allospecific mitochondrial DNA in a sexually reproducing fish (Cobitis; Teleostei, despite clonal reproduction of hybrids.

    Directory of Open Access Journals (Sweden)

    Lukas Choleva

    Full Text Available Distinguishing between hybrid introgression and incomplete lineage sorting causing incongruence among gene trees in that they exhibit topological differences requires application of statistical approaches that are based on biologically relevant models. Such study is especially challenging in hybrid systems, where usual vectors mediating interspecific gene transfers--hybrids with Mendelian heredity--are absent or unknown. Here we study a complex of hybridizing species, which are known to produce clonal hybrids, to discover how one of the species, Cobitis tanaitica, has achieved a pattern of mito-nuclear mosaic genome over the whole geographic range. We appplied three distinct methods, including the method using solely the information on gene tree topologies, and found that the contrasting mito-nuclear signal might not have resulted from the retention of ancestral polymorphism. Instead, we found two signs of hybridization events related to C. tanaitica; one concerning nuclear gene flow and the other suggested mitochondrial capture. Interestingly, clonal inheritance (gynogenesis of contemporary hybrids prevents genomic introgressions and non-clonal hybrids are either absent or too rare to be detected among European Cobitis. Our analyses therefore suggest that introgressive hybridizations are rather old episodes, mediated by previously existing hybrids whose inheritance was not entirely clonal. Cobitis complex thus supports the view that the type of resulting hybrids depends on a level of genomic divergence between sexual species.

  4. Distinguishing between Incomplete Lineage Sorting and Genomic Introgressions: Complete Fixation of Allospecific Mitochondrial DNA in a Sexually Reproducing Fish (Cobitis; Teleostei), despite Clonal Reproduction of Hybrids

    Czech Academy of Sciences Publication Activity Database

    Choleva, Lukáš; Musilová, Zuzana; Kohoutová-Šedivá, Alena; Pačes, Jan; Ráb, Petr; Janko, Karel


    Roč. 9, č. 6 (2014), e80641-e80641 E-ISSN 1932-6203 R&D Projects: GA ČR GAP506/10/1155; GA ČR GPP506/12/P857 Institutional support: RVO:67985904 Keywords : Cobitis * gene flow * coalescence * incomplete lineage sorting * asexual * gynogenesis Subject RIV: EG - Zoology Impact factor: 3.234, year: 2014

  5. Effects of climatic and geological processes during the pleistocene on the evolutionary history of the northern cavefish, Amblyopsis spelaea (teleostei: amblyopsidae). (United States)

    Niemiller, Matthew L; McCandless, James R; Reynolds, R Graham; Caddle, James; Near, Thomas J; Tillquist, Christopher R; Pearson, William D; Fitzpatrick, Benjamin M


    Climatic and geological processes associated with glaciation cycles during the Pleistocene have been implicated in influencing patterns of genetic variation and promoting speciation of temperate flora and fauna. However, determining the factors promoting divergence and speciation is often difficult in many groups because of our limited understanding of potential vicariant barriers and connectivity between populations. Pleistocene glacial cycles are thought to have significantly influenced the distribution and diversity of subterranean invertebrates; however, impacts on subterranean aquatic vertebrates are less clear. We employed several hypothesis-driven approaches to assess the impacts of Pleistocene climatic and geological changes on the Northern Cavefish, Amblyopsis spelaea, whose current distribution occurs near the southern extent of glacial advances in North America. Our results show that the modern Ohio River has been a significant barrier to dispersal and is correlated with patterns of genetic divergence. We infer that populations were isolated in two refugia located north and south of the Ohio River during the most recent two glacial cycles with evidence of demographic expansion in the northern isolate. Finally, we conclude that climatic and geological processes have resulted in the formation of cryptic forms and advocate recognition of two distinct phylogenetic lineages currently recognized as A. spelaea. © 2012 The Author(s). Evolution© 2012 The Society for the Study of Evolution.

  6. Redescripción de Hemibrycon orcesi Böhlke, 1958 y H. polyodon (Gunther, 1864 (Teleostei, Characidae, incluye clave para las especies de Hemibrycon en Ecuador

    Directory of Open Access Journals (Sweden)

    Román-Valencia, C.


    Full Text Available Redescription of Hemibrycon orcesi Böhlke, 1958 and H. polyodon (Günther, 1864 (Pisces, Characidae, with a key for the species of Hemibrycon from Ecuador. Hemibrycon orcesi is readily distinguished from its congeners by its 13 to 16 teeth on maxilla, base of caudal fin scaled, 34 to 36 scales on lateral line with pores and 17 to 18 branched anal fin rays. H. polyodon is distinguished from its congeners by simple and branched dorsal fin rays of equal length and shape of humeral spot.

  7. Genetic, comparative genomic, and expression analyses of the Mc1r locus in the polychromatic Midas cichlid fish (Teleostei, Cichlidae Amphilophus sp.) species group. (United States)

    Henning, Frederico; Renz, Adina Josepha; Fukamachi, Shoji; Meyer, Axel


    Natural populations of the Midas cichlid species in several different crater lakes in Nicaragua exhibit a conspicuous color polymorphism. Most individuals are dark and the remaining have a gold coloration. The color morphs mate assortatively and sympatric population differentiation has been shown based on neutral molecular data. We investigated the color polymorphism using segregation analysis and a candidate gene approach. The segregation patterns observed in a mapping cross between a gold and a dark individual were consistent with a single dominant gene as a cause of the gold phenotype. This suggests that a simple genetic architecture underlies some of the speciation events in the Midas cichlids. We compared the expression levels of several candidate color genes Mc1r, Ednrb1, Slc45a2, and Tfap1a between the color morphs. Mc1r was found to be up regulated in the gold morph. Given its widespread association in color evolution and role on melanin synthesis, the Mc1r locus was further investigated using sequences derived from a genomic library. Comparative analysis revealed conserved synteny in relation to the majority of teleosts and highlighted several previously unidentified conserved non-coding elements (CNEs) in the upstream and downstream regions in the vicinity of Mc1r. The identification of the CNEs regions allowed the comparison of sequences from gold and dark specimens of natural populations. No polymorphisms were found between in the population sample and Mc1r showed no linkage to the gold phenotype in the mapping cross, demonstrating that it is not causally related to the color polymorphism in the Midas cichlid.

  8. Anticipation of Artemia sp. supply in the larviculture of the barber goby Elacatinus figaro (Gobiidae: Teleostei influenced growth, metamorphosis and alkaline protease activity

    Directory of Open Access Journals (Sweden)

    Maria Fernanda da Silva-Souza


    Full Text Available The barber goby Elacatinus figaro is considered endangered due to overexploitation by the ornamental industry. Farming marine ornamental fishes, especially the threatened ones, can be one of the measures to minimize the pressure on the natural stocks. Among the priority issues for their production is the determination of the most appropriate feeding management. The feeding protocol commonly used in the larviculture of barber goby, when the start of Artemia sp. offer occurred at the 18th DAH (days after hatching (treatment T18, was modified, by anticipating brine shrimp supply in 6 days (treatment T12. Alkaline proteases activity, growth and metamorphosis of larvae were evaluated in both protocols. Juveniles at T12 showed higher weight (0.04 ± 0.001 g and lower activity of total alkaline proteases (1.3 ± 0.2 mU mg-1 protein compared to T18 (0.02 ± 0.001 g; 2.8 ± 0.4 mU mg-1 protein, respectively. With anticipation of brine shrimp, the commencing and end of larval transformation was observed earlier (at 24 and 34 DAH, respectively in comparison to those with the supply of Artemia sp. at 18 DAH (27 and 41 DAH, respectively. Thus, the Artemia sp. anticipation was beneficial during the larviculture of the barber goby, considering that larvae reached metamorphosis earlier.

  9. Ancyrocephalidae (Monogenea) of Lake Tanganyika: does the Cichlidogyrus parasite fauna of Interochromis loocki (Teleostei, Cichlidae) reflect its host’s phylogenetic affinities?

    NARCIS (Netherlands)

    Pariselle, A.; Van Steenberge, M.; Snoeks, J.; Volckaert, F.A.M.; Huyse, T.; Vanhove, M.P.M.


    The faunal diversity of Lake Tanganyika, with its fish species flocks and its importance as a cradle and reservoir of ancient fish lineages seeding other radiations, has generated a considerable scientific interest in the fields of evolution and biodiversity. The Tropheini, an endemic Tanganyikan

  10. Population structure and reproduction of Deuterodon langei travassos, 1957 (Teleostei, Characidae in a neotropical stream basin from the Atlantic Forest, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Jean Ricardo Simões Vitule


    Full Text Available Aspects of the biology of D. langei were studied at different sites along a longitudinal gradient formed by the Ribeirão stream basin, a Neotropical stream of the Atlantic Forest, southern Brazil. Differences were observed in population structure and reproduction along the longitudinal gradient and during the study period. Juvenile fishes occurred in high abundance, mainly in the downstream site after the rainy months. Adults occurred mainly in the intermediate and upstream sites. During their life cycle, adults optimise their reproductive strategy by concentrating the reproductive period with total spawn in a short time interval before summer rains dragged the juvenile, larval forms and/or eggs downstream. The downstream site was characterized by a wide range of microhabitats (ex. submerged grass and shallow flooded area. Thus, the species used different portions of the basin in distinct stages of its life, being ecologically adapted to variation patterns in its temporal and physical environments.Aspectos da biologia de D. langei foram estudados em diferentes locais da bacia do rio Ribeirão, um riacho litorâneo da Floresta Atlântica do sudeste do Brasil. Foram observadas diferenças na estrutura da população e na reprodução, ao longo do gradiente longitudinal da bacia e do período de estudo. Os peixes juvenis ocorreram em grande abundância, principalmente no trecho a jusante da bacia, após os meses mais chuvosos. Adultos ocorreram principalmente nos trechos intermediários e a montante. Não houve diferença significativa na relação sexual entre os locais amostrados, estações do ano, meses e classes de comprimento. O comprimento médio de primeira maturação (L50 foi o mesmo para machos e fêmeas, entre 6,1 e 7,0 cm de comprimento total (Lt. O período reprodutivo foi curto (entre o final da primavera e início do verão, antes dos meses mais chuvosos, com desova total. O Índice de Atividade Reprodutiva (IAR indicou que D. langei reproduz em toda a bacia, porém a atividade reprodutiva é mais intensa nos trechos mais a montante da bacia. O período chuvoso e as chuvas torrenciais se mostraram fatores abióticos muito importantes para a dinâmica da população. Durante seu ciclo de vida os adultos maximizam sua estratégia reprodutiva concentrando o período reprodutivo, com desova total em um curto espaço de tempo antes das chuvas de verão que carregam juvenis, formas larvais e/ou ovos para as regiões a jusante onde existe uma ampla quantidade de micro-ambientes (gramíneas submersas e áreas rasas e calmas. Desta forma a espécie estudada utilizou diferentes porções da bacia em distintos estágios de seu ciclo de vida, demonstrando estar ecologicamente adaptada às variações temporais e físicas do ambiente.

  11. New data on the morphology of Comephoronema oschmarini (Nematoda, Cystidicolidae), a little-known gastrointestinal parasite of Lota lota (Teleostei) in Palaearctic Eurasia

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Hanzelová, V.; Gerdeaux, D.


    Roč. 52, č. 2 (2007), s. 135-141 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Grant - others:Vedecká grantová agentúra Ministerstva školstva Slovenskej republiky a Slovenskej akadémie vied(SK) VEGA2/7192/27 Institutional research plan: CEZ:AV0Z60220518 Keywords : Comephoronema * Lota * France Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.814, year: 2007

  12. Phylogeny and biogeographic history of the cyprinid fish genus Carassius (Teleostei: Cyprinidae) with focus on natural and anthropogenic arrivals in Europe

    Czech Academy of Sciences Publication Activity Database

    Rylková, K.; Kalous, L.; Bohlen, Jörg; Lamatsch, D.K.; Petrtýl, M.


    Roč. 380, č. 383 (2013), s. 13-20 ISSN 0044-8486 R&D Projects: GA ČR GA206/09/1154 Institutional research plan: CEZ:AV0Z5045916 Institutional support: RVO:67985904 Keywords : Carassius auratus complex * Cytochrome b * Distribution Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.828, year: 2013

  13. Morphometric and molecular characterisation of specimens of Lepidapedon Stafford, 1904 (Digenea: Lepidapedidae) from the deep-sea fish Mora moro (Risso) (Teleostei: Moridae) in the western Mediterranean

    Czech Academy of Sciences Publication Activity Database

    Dallarés, S.; Georgieva, Simona; Kostadinova, Aneta; Carrasson, M.; Gibson, D. I.; Pérez-del-Olmo, A.


    Roč. 85, č. 3 (2013), s. 243-253 ISSN 0165-5752 R&D Projects: GA ČR GAP505/10/1562; GA ČR GBP505/12/G112 Grant - others:GAJU(CZ) 04-135/2010/P Institutional support: RVO:60077344 Keywords : Northern Atlantic * Lepocrediidae Digenea * genus Subject RIV: EA - Cell Biology Impact factor: 1.035, year: 2013

  14. Differential expression of myogenic regulatory factor MyoD in pacu skeletal muscle (Piaractus mesopotamicus Holmberg 1887: Serrasalminae, Characidae, Teleostei) during juvenile and adult growth phases. (United States)

    de Almeida, Fernanda Losi Alves; Carvalho, Robson Francisco; Pinhal, Danillo; Padovani, Carlos Roberto; Martins, Cesar; Dal Pai-Silva, Maeli


    Skeletal muscle is the edible part of the fish. It grows by hypertrophy and hyperplasia, events regulated by differential expression of myogenic regulatory factors (MRFs). The study of muscle growth mechanisms in fish is very important in fish farming development. Pacu (Piaractus mesopotamicus) is one of the most important food species farmed in Brazil and has been extensively used in Brazilian aquaculture programs. The aim of this study was to analyze hyperplasia and hypertrophy and the MRF MyoD expression pattern in skeletal muscle of pacu (P. mesopotamicus) during juvenile and adult growth stages. Juvenile (n=5) and adult (n=5) fish were anaesthetized, sacrificed, and weight (g) and total length (cm) determined. White dorsal region muscle samples were collected and immersed in liquid nitrogen. Transverse sections (10 microm thick) were stained with Haematoxilin-Eosin (HE) for morphological and morphometric analysis. Smallest fiber diameter from 100 muscle fibers per animal was calculated in each growth phase. These fibers were grouped into three classes (50 microm) to evaluate hypertrophy and hyperplasia in white skeletal muscle. MyoD gene expression was determined by semi-quantitative RT-PCR. PCR products were cloned and sequenced. Juvenile and adult pacu skeletal muscle had similar morphology. The large number of fish confirms active hyperplasia. In adult fish, most fibers were over 50 microm diameter and denote more intense muscle fiber hypertrophy. The MyoD mRNA level in juveniles was higher than in adults. A consensus partial sequence for MyoD gene (338 base pairs) was obtained. The Pacu MyoD nucleotide sequence displayed high similarity among several vertebrates, including teleosts. The differential MyoD gene expression observed in pacu white muscle is possibly related to differences in growth patterns during the phases analyzed, with hyperplasia predominant in juveniles and hypertrophy in adult fish. These results should provide a foundation for understanding the molecular control of skeletal muscle growth in economically important Brazilian species, with a view to improving production quality.

  15. Otocinclus cocama, a new uniquely colored loricariid catfish from Peru (Teleostei: Siluriformes, with comments on the impact of taxonomic revisions to the discovery of new taxa

    Directory of Open Access Journals (Sweden)

    Roberto E. Reis

    Full Text Available A new, uniquely colored species of the loricariid catfish genus Otocinclus, O. cocama is described from a tributary to the lower río Ucayali in northern Peru. The new species is distinguished from other Otocinclus species by two putatively autapomorphic features, the distinct color pattern, consisting of vertically elongated blotches spanning from the dorsal midline to the ventral border of flanks, and by a complete lateral line. The phylogenetic relationships of the new species are investigated and it is apparently more closely related to a clade formed by O. huaorani, O. bororo, O. mariae, and O. mura. Comments on the impact of taxonomic revisions for the discovery and description of previously undetected biodiversity are also presented.

  16. Contributions to the morphological variation of the common gudgeon, Gobio gobio complex (Teleostei: Cyprinidae), in the upper Vistula drainage (southeast Poland)

    Czech Academy of Sciences Publication Activity Database

    Nowak, M.; Mendel, Jan; Szczerbik, P.; Klaczak, A.; Mikolajczyk, T.; Ozga, K.; Falowska, B.; Popek, W.


    Roč. 19, č. 1 (2011), s. 37-49 ISSN 1230-6428 R&D Projects: GA ČR GP206/09/P608 Institutional research plan: CEZ:AV0Z60930519 Keywords : Gobioninae * traditional morphometrics * Vistula Subject RIV: EG - Zoology

  17. Higher and lower-level relationships of the deep-sea fish order Alepocephaliformes (Teleostei: Otocephala) inferred from whole mitogenome sequences

    DEFF Research Database (Denmark)

    Poulsen, Jan Yde; Møller, Peter Rask; Lavoué, Sébastien


    , Cypriniformes, Characiformes, Siluriformes and Gymnotiformes). The disputed family Bathylaconidae was found to be an artificial assemblage of the two genera Bathylaco and Herwigia, with the former as the sister group of the family Alepocephalidae and the latter nested within Alepocephalidae. Platytroctidae...

  18. Two new species of Hyphessobrycon (Teleostei: Characidae from upper rio Tapajós basin on Chapada dos Parecis, central Brazil

    Directory of Open Access Journals (Sweden)

    Tiago Pinto Carvalho

    Full Text Available Two new species of Hyphessobrycon are described from the upper rio Tapajós basin, Mato Grosso, Brazil. Hyphessobrycon melanostichos is distinguished from its congeners by the combination of a conspicuous longitudinal broad black band beginning on the posterior margin of orbit and reaching the tip of middle caudal fin rays, a distinct vertically elongate humeral spot, and 16 to 18 branched anal-fin rays. Hyphessobrycon notidanos is distinguished from its congeners by the combination of an elongate dorsal fin in mature males, a vertically elongate humeral spot, 2-4 maxillary teeth, iii,8 dorsal-fin rays, and 16 to 21 branched anal-fin rays.

  19. Delimiting the origin of a B chromosome by FISH mapping, chromosome painting and DNA sequence analysis in Astyanax paranae (Teleostei, Characiformes.

    Directory of Open Access Journals (Sweden)

    Duílio M Z de A Silva

    Full Text Available Supernumerary (B chromosomes have been shown to contain a wide variety of repetitive sequences. For this reason, fluorescent in situ hybridisation (FISH is a useful tool for ascertaining the origin of these genomic elements, especially when combined with painting from microdissected B chromosomes. In order to investigate the origin of B chromosomes in the fish species Astyanax paranae, these two approaches were used along with PCR amplification of specific DNA sequences obtained from the B chromosomes and its comparison with those residing in the A chromosomes. Remarkably, chromosome painting with the one-arm metacentric B chromosome probe showed hybridization signals on entire B chromosome, while FISH mapping revealed the presence of H1 histone and 18S rDNA genes symmetrically placed in both arms of the B chromosome. These results support the hypothesis that the B chromosome of A. paranae is an isochromosome. Additionally, the chromosome pairs Nos. 2 or 23 are considered the possible B chromosome ancestors since both contain syntenic H1 and 18S rRNA sequences. The analysis of DNA sequence fragments of the histone and rRNA genes obtained from the microdissected B chromosomes showed high similarity with those obtained from 0B individuals, which supports the intraspecific origin of B chromosomes in A. paranae. Finally, the population hereby analysed showed a female-biased B chromosome presence suggesting that B chromosomes in this species could influence sex determinism.

  20. Hepatocyte nuclear structure and subcellular distribution of copper in zebrafish Brachydanio rerio and roach Rutilus rutilus (Teleostei, Cyprinidae) exposed to copper sulphate

    Energy Technology Data Exchange (ETDEWEB)

    Paris-Palacios, Severine [Universite de Reims Champagne-Ardenne (URCA), UFR Sciences Exactes et Naturelles, Laboratoire d' Eco-Toxicologie, Institut International de Recherche sur les Ions Metalliques, B.P. 1039-51687 Reims cedex 2 (France)]. E-mail:; Biagianti-Risbourg, Sylvie [Universite de Reims Champagne-Ardenne (URCA), UFR Sciences Exactes et Naturelles, Laboratoire d' Eco-Toxicologie, Institut International de Recherche sur les Ions Metalliques, B.P. 1039-51687 Reims cedex 2 (France)]. E-mail:


    Copper is a trace element essential to life, but also a heavy metal with toxic effect clearly demonstrated. Cu induced perturbations in fish liver are well documented but the variability of the reported results is large. In this study two cyprinids, zebrafish and roach, were exposed to copper. Reported histocytological changes are either adaptative or degenerative depending on fish species, concentration of metal, and duration of exposure. Hepatic subcellular distribution of copper was determined by X-ray microanalysis in control and Cu-exposed roach and zebrafish. Sublethal copper sulphate contamination induced the development of a particular nucleolar alteration forming a network or honeycomb like structure in liver. This perturbation is observable in almost all the hepatocytes of zebrafish and roach exposed to copper for a minimum of 4 days of exposure. It seemed to concern more precisely the pars fibrosa. X-ray microanalysis showed that the appearance of network nucleolus was in relation to a Cu accumulation. Cu deposit was well located in the network as pars granulosa and nucloplasm showed very lower metal concentrations. The origin and consequence of network structure in nucleolus was discussed.

  1. Karyotypic diversity in four species of the genus Gymnotus Linnaeus, 1758 (Teleostei, Gymnotiformes, Gymnotidae: physical mapping of ribosomal genes and telomeric sequences

    Directory of Open Access Journals (Sweden)

    Priscilla Scacchetti


    Full Text Available Conventional (Giemsa, C-Banding, Ag-NORs, CMA3 and molecular (5S rDNA, 18S rDNA, telomeric sequences cytogenetic studies were carried out in specimens of ten distinct fish populations of the genus Gymnotus (G. sylvius Albert and Fernandes-Matioli, 1999, G. inaequilabiatus Valenciennes, 1839, G. pantherinus Steindachner, 1908, and G. cf. carapo Linnaeus, 1758 from different Brazilian hydrographic basins. G. sylvius presented a diploid number of 40 chromosomes (22m+12sm+6st, G. pantherinus presented 52 chromosomes (32m+18sm+2st, while G. inaequilabiatus (42m+10sm+2a and G. cf. carapo (38m+12sm+4st presented 54 chromosomes. The C-banding technique revealed centromeric marks in all chromosomes of all species. Besides that, conspicuous blocks of heterochromatin were found interstitially on the chromosomes of G. inaequilabiatus, G. cf. carapo, and G. pantherinus. All four species showed single nucleolus organizing regions confirmed by results obtained through Ag-NORs and FISH experiments using 18S rDNA probes, which showed the NORs localized on the first chromosome pair in G. inaequilabiatus, G. cf. carapo, and G. pantherinus, and on pair 2 in G. sylvius. CMA3 staining revealed additional unrelated NORs marks in G. sylvius and G. pantherinus. The 5S rDNA probes revealed signals on one pair in G. sylvius and two pairs in G. pantherinus; G. inaequilabiatus had about seventeen pairs marked, and G. cf. carapo had about fifteen pairs marked. It is considered that the high amount of heterochromatin identified in the chromosomes of G. inaequilabiatus and G. cf. carapo could have facilitated the dispersion of 5S rDNA in these species. Interstitial signals were detected on the first metacentric pair of G. sylvius by telomeric probes (TTAGGGn indicating the possible occurrence of chromosomal fusions in this species. The present study reveals valuable cytotaxonomic markers for this group and allows a more precise evaluation of the processes involved in the karyotype differentiation and the interrelationships among different species of the genus Gymnotus.

  2. Gonadal Morphogenesis and Sex Differentiation in Intraovarian Embryos of the Viviparous Fish Zoarces viviparus (Teleostei, Perciformes, Zoarcidae): A Histological and Ultrastructural Study

    DEFF Research Database (Denmark)

    Rasmussen, Tina H.; Jespersen, Åse; Korsgaard, Bodil


    undifferentiated paired bilobed gonad contains primordial germ cells. In the female embryos, ovarian differentiation, initiated 14 days posthatch (dph), is characterized by the initial formation of the endoovarian cavity of the single ovary as well as by the presence of some early meiotic oocytes in a chromatin-nucleolus...

  3. Tracking the evolutionary pathway of sex chromosomes among fishes: characterizing the unique XX/XY1Y2 system in Hoplias malabaricus (Teleostei, Characiformes)

    Czech Academy of Sciences Publication Activity Database

    de Oliveira, E. A.; Sember, Alexandr; Bertollo, L.A.C.; Yano, C. F.; Ezaz, T.; Moreira-Filho, O.; Hatanaka, T.; Trifonov, V.; Liehr, T.; Al-Rikabi, A. B. H.; Ráb, Petr; Pains, H.; de Bello Cioffi, M.


    Roč. 127, č. 1 (2018), s. 115-128 ISSN 0009-5915 R&D Projects: GA MŠk EF15_003/0000460 Institutional support: RVO:67985904 Keywords : fish cytogenetics * male-specific region * whole chromosome painting Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 4.414, year: 2016

  4. A new Synbranchus (Teleostei: Synbranchiformes: Synbranchidae from ilha de Marajó, Pará, Brazil, with notes on its reproductive biology and larval development

    Directory of Open Access Journals (Sweden)

    Sandra E. Favorito

    Full Text Available Synbranchus lampreia, new species, is described from rio Goiapi, Marajó Island, Pará, northern Brazil. It differs from the other two described species of the genus by its color pattern, which consists of large roundish black blotches scattered over a light brown or yellowish ground pigmentation and presence of inconspicuous brown small spots distributed among the large dark spots. The species is further distinguished from S. marmoratus by a higher number of vertebrae and from S. madeira by a shorter postanal length. Information about reproductive aspects is provided and larval stages are described and illustrated.

  5. Ultrastructural and molecular characterization of Glugea serranus n. sp., a microsporidian infecting the blacktail comber, Serranus atricauda (Teleostei: Serranidae), in the Madeira Archipelago (Portugal). (United States)

    Casal, Graça; Rocha, Sónia; Costa, Graça; Al-Quraishy, Saleh; Azevedo, Carlos


    A new microsporidian infecting the connective tissue of the coelomic cavity of the blacktail comber Serranus atricauda, in the Madeira Archipelago (Portugal), is described on the basis of morphological, ultrastructural, and molecular features. The microsporidian formed large whitish xenomas adhering to the peritoneal visceral organs of the host. Each xenoma consisted of a single hypertrophic cell, in the cytoplasm of which mature spores proliferated within parasitophorous vacuoles surrounded by numerous collagen fibers. Mature spores were ellipsoidal and uninucleated, measuring an average of 6.5 ± 0.5 μm in length and 3.4 ± 0.6 μm in width. The anchoring disk of the polar filament was subterminal, laterally shifted from the anterior pole of the spore. The isofilar polar filament coiled in 18-19 turns, forming two rows that surrounded the posterior vacuole. The latter occupied about one third of the spore length. The polaroplast surrounding the apical and uncoiled portion of the polar filament displayed two distinct regions: a lamellar region and an electron-dense globule. Molecular analysis of the rRNA genes, including the internal transcribed spacer region, and phylogenetic analysis using maximum likelihood and neighbor joining demonstrated that this microsporidian parasite clustered with some Glugea species. Based on the differences found both at the morphological and molecular levels, to other members of the genus Glugea, the microsporidian infecting the blacktail comber is considered a new species, thus named Glugea serranus n. sp.

  6. The gynogenetic reproduction of diploid and triploid hybrid spined loaches (Cobitis: Teleostei), and their ability to establish successful clonal lineages - on the evolution of polyploidy in asexual vertebrates

    Czech Academy of Sciences Publication Activity Database

    Janko, Karel; Bohlen, Jörg; Lamatsch, D.; Flajšhans, Martin; Epplen, J. T.; Ráb, Petr; Kotlík, Petr; Šlechtová, Věra


    Roč. 131, - (2007), s. 185-194 ISSN 0016-6707 R&D Projects: GA ČR GP206/05/P586 Grant - others:EU Marie Curie Research amd Training Network(EU) MCRTN-CT-2004-512492; German Research Foundation(DE) SFB 567 Institutional research plan: CEZ:AV0Z50450515 Keywords : asexual reproduction * evolution of polyploidy * hybridisation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.396, year: 2007

  7. Phylogeny of the Neotropical cichlid fish tribe Cichlasomatini (Teleostei: Cichlidae) based on morphological and molecular data, with the description of a new genus

    Czech Academy of Sciences Publication Activity Database

    Musilová, Zuzana; Říčan, Oldřich; Novák, J.


    Roč. 47, č. 3 (2009), s. 234-247 ISSN 0947-5745 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50450515 Keywords : Cichlasomatini * And inoacara * Aequidens Subject RIV: EH - Ecology, Behaviour Impact factor: 1.850, year: 2009

  8. Phylogenetic analysis of molecular and morphological data highlights uncertainty in the relationships of fossil and living species of Elopomorpha (Actinopterygii: Teleostei). (United States)

    Dornburg, Alex; Friedman, Matt; Near, Thomas J


    Elopomorpha is one of the three main clades of living teleost fishes and includes a range of disparate lineages including eels, tarpons, bonefishes, and halosaurs. Elopomorphs were among the first groups of fishes investigated using Hennigian phylogenetic methods and continue to be the object of intense phylogenetic scrutiny due to their economic significance, diversity, and crucial evolutionary status as the sister group of all other teleosts. While portions of the phylogenetic backbone for Elopomorpha are consistent between studies, the relationships among Albula, Pterothrissus, Notacanthiformes, and Anguilliformes remain contentious and difficult to evaluate. This lack of phylogenetic resolution is problematic as fossil lineages are often described and placed taxonomically based on an assumed sister group relationship between Albula and Pterothrissus. In addition, phylogenetic studies using morphological data that sample elopomorph fossil lineages often do not include notacanthiform or anguilliform lineages, potentially introducing a bias toward interpreting fossils as members of the common stem of Pterothrissus and Albula. Here we provide a phylogenetic analysis of DNA sequences sampled from multiple nuclear genes that include representative taxa from Albula, Pterothrissus, Notacanthiformes and Anguilliformes. We integrate our molecular dataset with a morphological character matrix that spans both living and fossil elopomorph lineages. Our results reveal substantial uncertainty in the placement of Pterothrissus as well as all sampled fossil lineages, questioning the stability of the taxonomy of fossil Elopomorpha. However, despite topological uncertainty, our integration of fossil lineages into a Bayesian time calibrated framework provides divergence time estimates for the clade that are consistent with previously published age estimates based on the elopomorph fossil record and molecular estimates resulting from traditional node-dating methods. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. The phylogenetic intrarelationships of spiny-rayed fishes (Acanthomorpha, Teleostei, Actinopterygii: fossil taxa increase the congruence of morphology with molecular data

    Directory of Open Access Journals (Sweden)

    Donald Davesne


    Full Text Available Acanthomorpha (spiny-rayed fishes is a clade of teleosts that includes more than 15 000 extant species. Their deep phylogenetic intrarelationships, first reconstructed using morphological characters, have been extensively revised with molecular data. Moreover, the deep branches of the acanthomorph tree are still largely unresolved, with strong disagreement between studies. Here, we review the historical propositions for acanthomorph deep intrarelationships and attempt to resolve their earliest branching patterns using a new morphological data matrix compiling and revising characters from previous studies. The taxon sampling we use constitutes a first attempt to test all previous hypotheses (molecular and morphological alike with morphological data only. Our sampling also includes Late Cretaceous fossil taxa, which yield new character state combinations that are absent in extant taxa. Analysis of the complete morphological data matrix yields a new topology that shows remarkable congruence with the well-supported molecular results. Lampridiformes (oarfishes and allies are the sister to all other acanthomorphs. Gadiformes (cods and allies and Zeiformes (dories form a clade with Percopsiformes (trout-perches and the enigmatic Polymixia (beardfish and Stylephorus (tube-eye. Ophidiiformes (cusk-eels and allies and Batrachoidiformes (toadfishes are nested within Percomorpha, the clade that includes most of modern acanthomorph diversity. These results provide morphological synapomorphies and independent corroboration of clades previously only recovered from molecular data, thereby suggesting the emergence of a congruent picture of acanthomorph deep intrarelationships. Fossil taxa play a critical role in achieving this congruence, since a very different topology is found when they are excluded from the analysis.

  10. The morphology of Ichthyophonus sp. in their mugilid hosts (Pisces: Teleostei) and following cultivation in vitro. A light and electron microscopy study. (United States)

    Franco-Sierra, A; Alvarez-Pellitero, P


    The morphology of Ichthyophonus sp., a parasite of Mugil capito and Liza saliens, was investigated by light and transmission electron microscopy. The most frequent stage found in the fish hosts was the multinucleate spore, though germinating stages, hyphae, and endospores were also found. Different development patterns were observed in the media assayed for in vitro culture. Optimal growth and development were obtained in Eagle's minimum essential medium (MEM) supplemented with 10% fetal bovine serum at pH 7. Ultrastructural features of multinucleate spores, both in the fish host and in culture, were a fibrillar thick wall and an electron-lucent matrix, with large glycogen granules, some electron-dense bodies, large vacuoles, lipid inclusions, and endoplasmic reticulum mainly appearing among the nuclei. Mitochondria with scarce tubulovesicular cristae were observed in the different stages, mainly near the wall and the germinating sites. Condensed heterochromatin was rarely seen. A nucleus-associated organelle (NAO) was frequently observed, and dictyosome cisternae and vesicles appeared in its vicinity.

  11. First record of Arapaima gigas (Schinz, 1822) (Teleostei: Osteoglossomorpha), the "pirarucu", in the upper Paraná River basin, Southeast Brazil


    Carvalho, Fernando; Casatti, Lilian; Manzotti, Angelo; Ravazzi, Délcero


    Arapaima gigas (Schinz), the "pirarucu", is one of largest freshwater fish of the Neotropical region, naturally occurring in the Amazon, Essequibo, and Orinoco river basins. Herein, it is first recorded from the Grande River, in the upper Paraná River basin. This record is based on the finding of one dead specimen on the left margin of the Grande River, and in situ observation of juveniles and adults in the river.

  12. Caracterização genética do pirarucu Arapaima gigas (Cuvier) (Teleostei, Osteoglossidae) da bacia Tocantins-Araguaia, estado do Mato Grosso.


    Débora Karla Silvestre Marques


    Os Osteoglossiformes são representados na América do Sul pelos gêneros Arapaima e Osteoglossum, que ocorrem particularmente na região Amazônica, nas bacias Amazônica e Tocantins-Araguaia. Os estudos genéticos neste grupo são praticamente inexistentes, evidenciando a necessidade de informações para programas de conservação. A espécie Arapaima gigas da bacia hidrográfica Tocantins-Araguaia apresentou um 2n=56 cromossomos, com fórmula cariotípica 28M/SM+28ST/ A. A marcação por nitrato de p...

  13. Feast to famine: The effects of food quality and quantity on the gut structure and function of a detritivorous catfish (Teleostei: Loricariidae). (United States)

    German, Donovan P; Neuberger, Daniel T; Callahan, Meaghan N; Lizardo, Norma R; Evans, David H


    The gastrointestinal (GI) tract and associated organs are some of the most metabolically active tissues in an animal. Hence, when facing food shortages or poor food quality, an animal may reduce the size and function of their GI tract to conserve energy. We investigated the effects of prolonged starvation and varying food quality on the structure and function of the GI tract in a detritivorous catfish, Pterygoplichthys disjunctivus, native to the Amazonian basin, which experiences seasonal variation in food availability. After 150 days of starvation or consumption of a wood-diet too low in quality to meet their energetic needs, the fish reduced the surface area of their intestines by 70 and 78%, respectively, and reduced the microvilli surface area by 52 and 27%, respectively, in comparison to wild-caught fish consuming their natural diet and those raised in the laboratory on a high-quality algal diet. Intake and dietary quality did not affect the patterns of digestive enzyme activity along the guts of the fish, and the fish on the low-quality diet had similar mass-specific digestive enzyme activities to wild-caught fish, but lower summed activity when considering the mass of the gut. Overall, P. disjunctivus can endure prolonged starvation and low food quality by down-regulating the size of its GI tract. Copyright 2009 Elsevier Inc. All rights reserved.

  14. First insights into the diversity of gill monogeneans of 'Gnathochromis' and Limnochromis (Teleostei, Cichlidae) in Burundi: do the parasites mirror host ecology and phylogenetic history?

    Czech Academy of Sciences Publication Activity Database

    Kmentová, N.; Gelnar, M.; Koblmüller, Stephan; Vanhove, M. P. M.


    Roč. 4, e1629 (2016), e1629 ISSN 2167-8359 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Cichlidogyrus * Ectoparasites * Lake Tanganyika * Limnochromini * Tropheini Subject RIV: EG - Zoology Impact factor: 2.177, year: 2016

  15. Anatomia funcional e morfometria dos intestinos e dos cecos pilóricos do teleostei (pisces de água doce Brycon orbignyanus (Valenciennes, 1849

    Directory of Open Access Journals (Sweden)

    Seixas Filho José Teixeira de


    Full Text Available O objetivo do presente trabalho foi estudar a anatomia funcional e a morfometria comparativas nos intestinos médio e posterior e nos cecos pilóricos da piracanjuba (Brycon orbignyanus Valenciennes, 1849 (Characiformes, Characidae, Bryconinae. Foram conduzidos estudos anatomofuncionais e morfométricos nos intestinos médio e posterior e nos cecos pilóricos dessa espécie com hábito alimentar onívoro. Constatou-se, por meio destes estudos, que o padrão de enrolamento das alças intestinais em arranjo em N apresentou, na segunda classe de tamanho, freqüentes variações no intestino médio, mas foi compatível com os de outras espécies de hábitos alimentares similares. Os estudos da morfometria mostraram que o comprimento total do intestino e das alças intestinais e seus calibres, provavelmente, exercem função específica na absorção dos nutrientes. As relações entre o arranjo das pregas da mucosa e a velocidade de transporte do alimento no intestino médio sugerem que os padrões transversal e oblíquo retardam o avanço do alimento em sentido aboral, possibilitando maior período digestivo e melhor aproveitamento dos nutrientes, contribuindo para a preparação do bolo fecal. O comprimento e o calibre dos cecos pilóricos aumentam com o desenvolvimento do peixe, e o seu padrão de mucosa possui características anatômicas semelhantes às do intestino.

  16. Infrapopulations of Gyliauchen volubilis Nagaty, 1956 (Trematoda: Gyliauchenidae in the rabbitfish Siganus rivulatus (Teleostei: Siganidae from the Saudi coast of the Red Sea

    Directory of Open Access Journals (Sweden)

    Al-Jahdali M.O.


    Full Text Available In hermaphroditic helminth parasites, infrapopulation size or mating group size mostly affects some processes acting within the infrapopulation. Here, 30 natural infrapopulations (12-154 individuals of the intestinal trematode Gyliauchen volubilis Nagaty, 1956 from the fish Siganus rivulatus consisting of newly excysted juveniles, immature and mature worms were found distributed in a well-defined fundamental niche (anterior 40 % of the intestine. In small infrapopulations, all stages of the parasite were alive. In larger infrapopulations, differential mortality was only and consistently observed among newly excysted juveniles, and gradually increased to include most or all juveniles in the largest infrapopulations. Among mature worms, the mean worm length seemed unaffected by the infrapopulation size. However, the ratio mean testis size-mean ovary size, a reliable indicator of resource allocation to the male function and of opportunities for crossfertilization, significantly increased with mating group size. In small infrapopulations, all stages of the parasite were scattered along the niche, and never seen in mating pairs (possibly reproduced by selffertilization. In larger infrapopulations, newly excysted juveniles and immature worms were scattered along the anterior two thirds of the niche, while mature worms were constantly found aggregated in its posterior third (narrow microhabitat, where some were arranged in mating pairs. The probability of mating reciprocally or unilaterally was dependent on body size. The mean number of uterine eggs per worm significantly decreased and their mean sizes significantly increased with mating group size. The results are statistically significant and suggest that infrapopulation self-regulation is greatly associated with its size.

  17. Life history and habitat preference in the Darling hardyhead, Craterocephalus amniculus (Teleostei, Atherinidae) in the northern Murray-Darling Basin, Australia

    DEFF Research Database (Denmark)

    Moy, Karl G.; Wilson, G. Glenn; Ellison, Tanya L.


    and spatial variation in diet, and habitat selection in this species across multiple sites and years in the upper Macintyre River, northern New South Wales. Preserved specimens from a separate study were used to obtain information on diet and size structure. Size structures suggested a single annual spawning...... most of the diet while over half the gut contents at the downstream site was unidentified detritus. Preference was shown for pool habitats with a sand or cobble substrate, increased channel depth and width and distance from the bank, and reduced flow velocity. Overhanging exotic riparian vegetation...

  18. Southern limits of distribution of the intertidal gobies Chaenogobius annularis and C. gulosus support the existence of a biogeographic boundary in southern Japan (Teleostei, Perciformes, Gobiidae

    Directory of Open Access Journals (Sweden)

    Atsunobu Murase


    Full Text Available Understanding the distributional patterns of individual animal groups with respect to coastal topology and the local physical environment provides essential foundational frameworks for marine zoogeography. In the northwestern Pacific waters of Japan, the distributional pattern of some cool-temperate species of marine fishes suggests the existence of a biogeographic boundary corresponding to a long sandy shore on the eastern coast of Kyushu, southern Japan. The existence of this hypothetical biogeographic boundary was tested by mapping the southern distributional limit of two species of cool-temperate intertidal gobies, Chaenogobius annularis and C. gulosus, which are endemic to East Asia and common in rock pools within their range in the Japanese Archipelago. Distribution and abundance were assessed by survey of museum collections from south-east Kyushu (i.e., the entire coasts of Kagoshima and Miyazaki prefectures; and a quantitative survey of the abundance of these gobies in rock pools at various sites around the hypothesized boundary on the eastern coast of Kyushu, including the subtropical Tanega-shima Island. The museum collection survey showed different distribution patterns between the two species: C. annularis was distributed along the entire coasts of south-east Kyushu including subtropical islands, whereas C. gulosus was distributed along these coasts, including one site on a subtropical island, except for an area south of the hypothesized boundary on the eastern coast of Kyushu. The density and occurrence rates of C. annularis in rock pools decreased with latitude, it being absent from a subtropical island, and C. gulosus was not detected from sites south of the hypothesized boundary. The qualitative survey showed that the southernmost records of C. annularis and C. gulosus were the adjacent subtropical islands (Yaku-shima and Tanega-shima islands respectively, although the quantitative survey suggested that their normal range of distribution was limited to the southern part of the Kyushu mainland. A combination of qualitative and quantitative survey methods in the present study highlighted that the southernmost record of a certain species may not necessarily indicate the true limit of its distribution. The distribution of C. gulosus supports the existence of the hypothetical biogeographic boundary, and the different distribution patterns of the two species may be caused by differences in their early life histories.

  19. Ontogenetic, spatial and temporal variations in the feeding ecology of Deuterodon langei Travassos, 1957 (Teleostei: Characidae in a Neotropical stream from the Atlantic rainforest, southern Brazil

    Directory of Open Access Journals (Sweden)

    Jean R. S. Vitule

    Full Text Available Information related to the diet of one species always contributes to the knowledge of its bionomy and the functioning of the ecosystem in which the species lives. Therefore, understanding the feeding ecology of one fish population and its ontogenetic, spatial and temporal aspects help to understand the structure of fish assemblages and river communities. Knowledge of this structure is essential for habitat management and biodiversity conservation. The feeding ecology of Deuterodon langei Travassos, 1957 was studied through analyses of diet composition, sharing of resources, feeding strategy and contribution of food items to the width of its niche. The analysis included an assessment of ontogenetic, spatial and seasonal variations. The species was considered omnivorous with great plasticity caused by seasonal variation in food availability throughout the river basin, but mainly through ontogeny. The diet of smaller individuals revealed a predominance of insects and other arthropods, while the diet of larger specimens showed allochthonous plant items as the main components. The low intestinal quotient (IQ values for the smaller individuals were accounted for their mainly insectivorous diet. The greater relative length of the intestine can account for the greater plasticity of the adult diet, enabling them to use diet items of larger size and more difficult digestion, such as plant items. Therefore, shifts in feeding ecology during growth are confirmed in this omnivorous tropical river fish, strengthening the concept that, when comparing food habits among species, fish size must be taken into account. This study also provides needed information regarding the feeding ecology of fishes intrinsically associated with the Atlantic rainforest, one of the most threatened and biodiverse ecosystems of the planet.

  20. Revision of Hastatobythites and Saccogaster (Teleostei, Bythitidae) with three new species and a new genus

    DEFF Research Database (Denmark)

    Nielsen, Jørgen; Schwarzhans, Werner; Cohen, Daniel M.


    Material of three similar and probably related genera of the viviparous ophidiiform family, Bythitidae, has been studied. The monotypic Hastatobythites is only known from the original two specimens; re-examination of the paratype and information of the holotype clearly demonstrates the validity o...... rakers, size of gill opening, thickness of skin, head pores, otolith morphology, color marks on head, neuromasts on head and head morphometrics, fin ray counts....

  1. Hepatocyte nuclear structure and subcellular distribution of copper in zebrafish Brachydanio rerio and roach Rutilus rutilus (Teleostei, Cyprinidae) exposed to copper sulphate

    International Nuclear Information System (INIS)

    Paris-Palacios, Severine; Biagianti-Risbourg, Sylvie


    Copper is a trace element essential to life, but also a heavy metal with toxic effect clearly demonstrated. Cu induced perturbations in fish liver are well documented but the variability of the reported results is large. In this study two cyprinids, zebrafish and roach, were exposed to copper. Reported histocytological changes are either adaptative or degenerative depending on fish species, concentration of metal, and duration of exposure. Hepatic subcellular distribution of copper was determined by X-ray microanalysis in control and Cu-exposed roach and zebrafish. Sublethal copper sulphate contamination induced the development of a particular nucleolar alteration forming a network or honeycomb like structure in liver. This perturbation is observable in almost all the hepatocytes of zebrafish and roach exposed to copper for a minimum of 4 days of exposure. It seemed to concern more precisely the pars fibrosa. X-ray microanalysis showed that the appearance of network nucleolus was in relation to a Cu accumulation. Cu deposit was well located in the network as pars granulosa and nucloplasm showed very lower metal concentrations. The origin and consequence of network structure in nucleolus was discussed

  2. Comparison of the oropharyngeal cavity in the Starksiini (Teleostei: Blenniiformes: Labrisomidae): taste buds and teeth, including a comparison with closely-related genera. (United States)

    Fishelson, Lev; Baldwin, Carole C; Hastings, Philip A


    The present study describes the distribution of taste buds and teeth in the oropharyngeal cavity of 13 species of adult (18-60 mm SL) Starksiini fishes inhabiting subtidal waters of the Neotropical region. Four types of taste buds described previously in other fish groups were observed within the oropharyngeal cavity, of which type I, situated on prominent protruding papillae, is the most common. The number of taste buds in this cavity varies considerably, ranging from ca. 202 in Starksia lepicoelia to ca. 770 in S. sluiteri. In all the studied species, taste buds are more numerous on the posterior (160-396) than on the anterior (42-294) part of the oropharyngeal cavity. The presence of different numbers of taste buds in different Starksiini species of the same standard length suggests that numbers of taste buds are not directly correlated with size and may be species-specific. Teeth are found on the premaxilla, dentary, vomer, palatine (in some species) and the upper and lower pharyngeal jaws (third pharyngobranchials and fifth ceratobranchials, respectively); the form and number of teeth and taste buds on each of these sites differs among the various species of Starksiini and between them and closely related species of the labrisomid tribes Labrisomini, Mnierpini, and Paraclinini. The results thus suggest potential systematic value in certain features of the oropharyngeal cavity for blenniiform fishes. It is also shown that benthic-feeding omnivorous fishes have higher densities of taste buds than piscivorous fishes. A possible correlation among numbers of taste buds, their positions in the oropharyngeal cavity, and other parameters is discussed. Copyright © 2012 Wiley Periodicals, Inc.

  3. Andinoacara blombergi, a new species from the río Esmeraldas basin in Ecuador and a review of A. rivulatus (Teleostei: Cichlidae)


    Wijkmark Nicklas, Kullander, Sven O.; Barriga Ramiro


    Andinocara blombergi, nueva especie, es descrito del río Esmeraldas, cuenca hidrográfica ubicada al noroeste del Ecuador. Se diferencia de la especie similar A. rivulatus (Günther, 1860) por tener 25 escamas vs. 24 escamas presentes en la escala de la línea E1, promedios merísticos ligeramente superiores, cabeza menos ancha y menor espacio interorbital. Andinocara rivulatus se redescribe en base a especímenes de la cuenca del río Guayas, Túmbes y Zarumilla, drenajes del Ecuador y Perú. Aequid...

  4. Assessing diet composition of seahorses in the wild using a non destructive method: Hippocampus reidi (Teleostei: Syngnathidae as a study-case

    Directory of Open Access Journals (Sweden)

    André Luiz da Costa Castro

    Full Text Available This paper presents the results of the first analysis of the natural diet of Hippocampus reidi, one of the most sought after seahorse species in the international aquarium trade. Its main goals were to investigate food items and prey categories consumed by the species, and to discuss feeding strategy and inter and intra-individual components of niche breadth. Data were gathered from October 2005 to September 2006 at the Mamanguape estuary, State of Paraíba, NE Brazil. Food items from seahorses anaesthetized with clove oil were obtained by using a modified version of the flushing method, and were counted and identified to the lowest possible taxonomic level. Specimens were marked and had their height, sex, life and reproductive stage recorded, and then returned to the same place where they were found for the further assessment of anaesthetization/gut flushing on seahorses. Food items were analyzed using frequency of occurrence, relative abundance, index of preponderance and prey-specific abundance using the points method. The graphic method of Amundsen et al. (1996 was used to interpret the feeding strategy and contribution to niche breadth. Nematodes and crustaceans were the most important items found, the latter item usually being the most commonly found in the gut contents of syngnathids. No significant differences in diet composition were found between reproductive stages, however, a higher proportion of large items were consumed by the larger seahorses. The feeding strategy and niche breadth analysis suggests that H. reidi has a generalist feeding strategy, with high variation between phenotypes. Our results suggest that the anaesthetization-flushing technique has the potential to be a useful tool in seahorse research.

  5. Redescription of Neoechinorhynchus (Neoechinorhynchus) golvani Salgado-Maldonado, 1978 (Acanthocephala: Neoechinorhynchidae) and description of a new species from freshwater cichlids (Teleostei: Cichlidae) in Mexico. (United States)

    Salgado-Maldonado, Guillermo


    A redescription of Neoechinorhynchus (Neoechinorhynchus) golvani Salgado-Maldonado (An Inst Biol Univ Nal Autón Méx, Ser Zool 49:35-47, 1978) is presented, based on adult specimens collected from the type host Paraneetroplus fenestratus from the type location, the Lago de Catemaco lake, Veracruz state, Mexico, and its presence is recorded in other cichlids. Detailed studies of N. (N.) golvani using light microscopy revealed some taxonomically important, previously unreported features, such as the size and shape of fully developed adult males and females, and the structure of the eggs. Morphological variability in N. (N.) golvani is described. Based on these data, the geographic distribution of this species is documented. Neoechinorhynchus (Neoechinorhynchus) panucensis n. sp. is described from Herichthys labridens (Pellegrin), Amatitlania nigrofasciata (Günther), and Herichthys cyanoguttatus Baird and Girard (all of them Cichlidae), collected in the Río Atlapexco, a tributary to the upper Río Panuco basin, Hidalgo State, Mexico. This new species stand up alone because of its minute proboscis (♂ 50 × 60, ♀ 42-55 (48.5) × 48-63 (57.7)) and anterior hooks (♂ 27-30 (28.8) × 3-5 (4), ♀ 28-32 (30) × 5 (5)). A key to the species of Neoechinorhynchus recorded from freshwater fishes in Central and South America is included.

  6. A review of the Pseudobarbus afer (Peters, 1864 species complex (Teleostei, Cyprinidae in the eastern Cape Fold Ecoregion of South Africa

    Directory of Open Access Journals (Sweden)

    Albert Chakona


    Full Text Available The Eastern Cape redfin, Pseudobarbus afer, has long been considered to be a single widespread and variable species occurring in multiple isolated river systems in the Cape Fold Ecoregion (CFE at the southern tip of Africa. Mitochondrial cytochrome b and control region sequence data of individuals from populations currently assigned to P. afer across the species’ distribution range revealed existence of four deeply divergent taxonomic units: (i the Mandela lineage confined to the Sundays, Swartkops and Baakens river systems, (ii the Krom lineage endemic to the Krom River system, (iii the St Francis lineage occurring in the Gamtoos and adjacent river systems, and (iv the Forest lineage occurring in several coastal river systems from the Tsitsikamma to the Klein Brak River system. The Forest lineage is closely related to P. phlegethon from the Olifants River system on the west coast of South Africa, suggesting that it does not belong to P. afer s.l. Herein we focus on the three lineages within the P. afer s.l. complex and provide new diagnosis for P. afer s.s (Mandela lineage, revalidate P. senticeps (Krom lineage as a distinct species, and describe a new species P. swartzi (St Francis lineage. The three species exhibit subtle differences, which explains why they were previously considered to represent a single variable and widespread species. Pseudobarbus senticeps differs from both P. afer and P. swartzi by having fewer (i.e. larger scales (25–33, mode 29 lateral line scale series; 10–12, mode 11 circumpeduncular scales and presence of a lateral stripe which terminates in a conspicuous triangular blotch at the base of the caudal fin. Long barbels which reach or surpass the vertical through the posterior edge of the eye further separate P. senticeps from P. afer s.s. which possesses simple short barbels which do not reach the vertical through the posterior margin of the eye. Pseudobarbus afer s.s differs from P. swartzi sp. n. by possession of fewer scale rows along the lateral line (29–35, mode 32 vs 34–37, mode 36 in P. swartzi, fewer scales around the caudal peduncle (12–16, mode 12 vs 13–17, mode 16 in P. swartzi and a distinct mesh or net-like pigmentation pattern on latero-ventral scales.

  7. Morfologia e hábitos alimentares de duas espécies de Engraulidae (Teleostei, Clupeiformes na Baía de Sepetiba, Rio de Janeiro Morphology and feeding habits of two engraulid fish (Teleostei, Clupeiformes in the Baía de Sepetiba, Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Sandra Sergipensel


    Full Text Available Foram estudados as hábitos alimentares dos peixes engraulídeos Anchoa januaria e Cetengraulis edentulus na Baía de Sepetiba, Rio de Janeiro, de julho de 1983 a julho de 1985. Os itens alimentares e as estruturas morfológicas relacionadas à alimentação indicaram que a área superficial dos rastros branquiais de A. januaria e C. edentulus é mais eficiente para a filtração dos alimentos, do que as distâncias entre os mesmos. Estas estruturas morfológicas possibilitam uma seletividade no tamanho dos itens alimentares, resultando em formas distintata de obtenção do alimento, entre as duas espécies. A. januaria seleciona o zooplâncton, por captura dos itens alimentares, enquanto C. edentuluss é um fitoplanctófago filtrador. Anchoa januaria tem hábitos alimentares diurnos e explgra diferentes estratos da coluna d'água durante os períodos frio e quente.Feeding habits of the engraulidid flsh - Anchoa januaria and Cetengraulis edentullus were studied in the Baía de Sepetiba, Rio de Janeiro, from July 1983 to July 1985. Dietary items and morphological structures "blted to feeding indicate that the surface structures of branchial rays of A. januaria and C. edentulus are more useful for food filtration than the distance between them. Those morphological structures provide a separation of the size of dietary items, thw resoltins in different forms of feeding behaviors between two species. A. januaria is a selective zooplanktivore, picking up food items, whereas C. edentulus is a filtering phytaplanktivore. Anchoa januaria is a diurnal feeder and exploits different layers in the water column during the warm and cold seasons.

  8. Development of fingerlings of Piracanjuba (Brycon orbignyannus, Vallencienes (1849 (Teleostei: characidae in tanks fertilized with organic manures/ Desenvolvimento de juvenis de Piracanjuba (Brycon orbignyannus, Vallencienes (1849 (Teleostei: characidae em tanques experimentais fertilizados com adubação orgânica

    Directory of Open Access Journals (Sweden)

    Carmino Hayashi


    Full Text Available The objective of this paper was to study the development of Piracanjuba (Brycon orbignyanus in tanks under differents organic fertilizers. The experiment, entirely randomized, was accomplished in 16 tanks of 1000 liters, fertilized with manures of bovine (BOV, pigs (SUI, chickens (FRG and others without fertilizer (SAO, using 15 fish/m3 with an initial average weight and length of 10,87+0,31 g e 9,78+0,07 cm. After 30 days, the experiment showed a uniform development of the fish and high survival rate in thestudied density. The treatments presented significant statistical differences (PO objetivo deste trabalho foi estudar o desenvolvimento de juvenis de Piracanjuba (Brycon orbignyanus, em tanques com adubações orgânicas. O experimento, inteiramente casualizado, foi realizado em 16 tanques de 1000 litros, adubados com estercos de bovinos (BOV, suínos (SUI, frangos de corte (FRG e outros sem adubação (SAO, utilizando 15 peixes/m3 com peso e comprimento médios iniciais de 10,87+0,31 g e 9,78+0,07 cm. Após 30 dias, o experimento mostrou um desenvolvimento uniforme dos peixes e alta taxa de sobrevivência na densidade estudada. Os tratamentos apresentaram diferenças estatisticamente significativas (p < 0,05 para ganho de peso e crescimento diário, com exceção dos tratamentos BOV e SUI quando comparados entre si. A temperatura e o oxigênio dissolvido foram os fatores abióticos que exerceram maior influência sobre a biota aquática, afetando o desenvolvimento dos peixes. Entre o fitoplâncton houve maior abundância de organismos nanoplanctônicos favorecendo o desenvolvimento do zooplâncton, destacando-se as clorófitas, com o gênero Scenedesmus, e as cianofíceas, com o gênero Microcystis, e entre o zooplâncton, a maior abundância foi de rotíferos dos gêneros Brachionus e Keratella, seguido por copépodas. O tratamento adubado com esterco de frangos possibilitou um maior desenvolvimento da comunidade planctônica, e melhores resultados quanto ao desenvolvimento dos peixes, demonstrando a importância do alimento natural na sua dieta.

  9. Hyphessobrycon taphorni y H. eschwartzae (Teleostei: Characidae dos nuevas especies de peces de la cuenca del río Madre de Dios, Perú Hyphessobrycon taphorni and H. eschwartzae (Teleostei: Characidae two new species of fish in the basin of Madre de Dios river, Peru

    Directory of Open Access Journals (Sweden)

    Carlos A. García-Alzate


    Full Text Available Hyphessobrycon con 129 especies válidas, es un género de peces que presenta una gran diversidad de especies dentro de la ictiofauna neotropical, alcanza su mayor diversidad en la cuenca del Amazonas con alrededor del 70% de estas especies, es altamente apetecido por los acuaristas por su belleza y colorido y aún se están conociendo nuevas especies. Las medidas de los ejemplares se tomaron punto a punto con calibrador digital. Observaciones de las estructuras óseas y de cartílago se hicieron sobre muestras clareadas y teñidas (C&T. Las relaciones morfométricas entre especies fueron exploradas mediante un análisis de componentes principales (ACP en 21 variables. Se des- criben dos especies nuevas, Hyphessobrycon taphorni y H. eschwartzae de la cuenca del río Madre de Dios, Perú. Hyphessobrycon taphorni sp. n. puede distinguirse por: el número de radios de la aleta dorsal (iii, 8, cuatro a cinco escamas con poros en la línea lateral, uno a dos dientes en la fila externa del premaxilar, siete a ocho dientes en la fila interna del premaxilar, por la longitud del pedúnculo caudal (11.4-16.4% LE, por el número de escamas laterales (28- 29; excepto en H. loretoensis con 29-30 y por la ausencia de una mancha humeral (vs. presencia, se diferencia de H. loretoensis por el número de escamas entre la línea lateral y la aleta anal (cuatro vs. tres y los dientes del maxilar (dos vs. tres a cuatro, y se distingue de H. agulha por el número de radios ramificados en las aletas pectorales (11- 12 vs. 9-10. Hyphessobrycon eschwartzae sp. n. puede distinguirse por el número de radios simples en la aleta anal (iv, por 13 a 15 dientes en el dentario; 6 dientes en la fila interna del premaxilar; tres dientes en la fila externa del premaxilar (excepto en H. heterorhabdus y H. loretoensis con tres a cuatro, se diferencia de H. loretoensis por el número: de escamas con poros en la línea lateral (siete vs. nueve a diez; escamas entre la línea lateral y la aleta dorsal (cinco vs. tres a cuatro, se diferencia de H. agulha por el número de escamas: laterales (30-31 vs. 33-34, predorsales (9 vs. 10, dientes en el maxilar (cuatro vs. cero a uno por presentar en vida una banda lateral roja por encima de la banda oscura que se extiende desde la parte posterior del opérculo hasta el pedúnculo caudal (vs. ausencia, y por la presencia de ganchos óseos en machos maduros solo en la aleta anal (vs. todas las aletas incluye la caudal.Hyphessobrycon with 129 valid species, is a genus of fish that has a great diversity of species in the Neotropical ichthyofauna, reaches its greatest diversity in the Amazon basin with about 70% of these species, is highly desired by hobbyists because of their beauty and color, and are still meeting new species. We analyzed specimens from the Departamento de Ictiología, Museo de Historia Natural de la Universidad Mayor de San Marcos, Lima, Perú (MUSM; and measurements of the specimens were taken point to point with digital calipers. Observations of bone and cartilage structures were made on cleared and stained (C&S samples. The morphometric relationships between species using 21 variables were explored using a principal component analysis (PCA. Here we describe two new species, Hyphessobrycon taphorni and H. eschwartzae from the Madre de Dios River drainage, Peru. Hyphessobrycon taphorni sp. n. can be distinguished by the number of dorsal-fin rays (iii, 8, by the number of: pored lateral-line scales (4-5, teeth in the outer premaxillary row (1-2, teeth in the inner premaxillary row (7-8, by: the caudal-peduncle length (11.4-16.4% SL, number of lateral scales (28-29, except from H. loretoensis which has 29-30 and absence of a humeral spot (vs. present, it differs from H. loretoensis by the number of: scales between the lateral line and the anal fin origin (4 vs. 3 and maxillary teeth (2 vs. 3-4, and it differs from H. agulha by the number of branched pectoral-fin rays (11-12 vs. 9-10. Hyphessobrycon eschwartzae sp. n. is distinguished by the number of: simple anal-fin rays (iv, teeth on the dentary (13-15, teeth in the inner premaxillary row (6, teeth in the outer premaxillary row (3, except from H. heterorhabdus and H. loretoensis which have 3-4; it differs from H. loretoensis by the number of: pored lateral-line scales (7 vs. 9-10, scales between the lateral line and the dorsal-fin origin (5 vs. 3-4; it differs from H. agulha in the number of lateral scales (30-31 vs. 33-34, by the number of: predorsal scales (9 vs. 10, maxillary teeth (4 vs. 0-1; in having in life a red lateral stripe above the dark lateral stripe that extends from the posterior part of the opercle to the caudal peduncle (vs. absent and by the presence of bony hooks in mature males only on the anal fin (vs. hooks on all fins, including the caudal.

  10. Desarrollo de la sagitta en juveniles y adultos de Odontesthes argentinensis (Valenciennes, 1835 y O. bonariensis (Valenciennes, 1835 de la provincia de Buenos Aires, Argentina (Teleostei: Atheriniformes Development of the sagitta in young and adults of Odontesthes argentinensis (Valenciennes, 1835 and Odontesthes bonariensis (Valenciennes, 1835 from Buenos Aires province, Argentina (Teleostei: Atheriniformes

    Directory of Open Access Journals (Sweden)



    Full Text Available Se describió el desarrollo del otolito Sagitta de juveniles y adultos de Odontesthes argentinensis procedentes de Punta Rasa (36°22' S y Miramar (38°16' S y de Odontesthes bonariensis de la Laguna de Chascomús (35° 36' S. Se estudió, la morfología de las sagittae de ambas especies, analizando cuatro grupos morfológicos para O. argentinensis (I: 75-120 mm, II: 130-220 mm, III: 230-270 y IV: 280-320 mm y tres grupos morfológicos para O. bonariensis (I: 80-120 mm, II: 130-220 y III: 230-320 mm. Las características morfológicas comunes a la sagitta, de ambas especies, en los grupos estudiados son: presencia de sulcus, depresión areal dorsal en la cara medial, cara lateral con estrías y la presencia de un punto culminante en el borde dorsal. En la sagitta de O. argentinensis, la depresión areal dorsal se inicia ligada a la cauda, característica que permitió distinguir claramente entre otolitos de juveniles de ambas especies. A partir del estado adulto, la depresión areal dorsal se halla separada de la cauda en las dos especies y el análisis estadístico evidenció un crecimiento discontinuo. Se hallaron diferencias morfológicas entre pares de sagitta de un mismo individuo en cuanto a la forma del ostium, presencia de cisura, rostro y punto culminante, aunque no se halló significancia morfométricaThe development of the otolith sagitta was described in young and adults of two silverside species. Odontesthes argentinensis was collected from Punta Rasa (36°22' S and Miramar (38°16' S and, Odontesthes bonariensis collected from Laguna de Chascomús (35°36' S. Sagitta morphology was studied in both species, analyzing four morphological groups of O. argentinensis (I: 75-120 mm, II: 130-220 mm, III: 230-270 mm and IV: 280-320 mm and three morphological groups of O. bonariensis (I: 80-120 mm, II: 130-220 mm and III: 230-320 mm. The morphological features of the sagitta shared by both species are: sulcus present, dorsal areal depression on the medial face, lateral face with striations and the presence of the culminant point on the dorsal margin. The dorsal areal depression of O. argentinensis begins in contact with the cauda. This feature easily identifies the sagittae of young in both species. The dorsal areal depression is separated from the cauda in adults of both species, and the statistical analysis showed a discontinuous growth. Morphological differences were found between pairs of sagittae of the same specimen relating to the shape of the ostium, presence of an anterior excisure, rostrum and the culminant point, but no significant morphometric difference was found

  11. The genus Basilichthys (Teleostei: Atherinopsidae revisited along its Chilean distribution range (21° to 40° S using variation in morphologyand mtDNA El género Basilichthys (Teleostei: Atherinopsidae analizado a lo largo de su distribución en Chile (21° a 40° S, utilizando rasgos morfológicos y variabilidad del ADN mitocondrial

    Directory of Open Access Journals (Sweden)



    Full Text Available There is still doubt as to the number of species of the freshwater Chilean ichthyofauna, 64 % of which have conservation problems. One of the groups is that of the silversides of the genus Basilichthys. Three morphological species of this genus have been described in Chile with disjoint distributions: Basilichthys semotilus, B. microlepidotus and B. australis; the latter two overlap in distribution only in the Aconcagua River and are not easily distinguishable by morphological and meristic characters. In order to evaluate the efficacy of identification of these species by molecular techniques, we analyzed the sequence of 9 % of the mitochondrial DNA (Control Region and COI of individuals from the Loa River (21°41' S to the Valdivia River (39°50' S, adding meristic features for B. microlepidotus and B. australis in order to study population variation to clarify the taxonomy of the native species of the genus. The phylogenetic analysis showed that the individuals of Basilichthys semotilus form an haplogroup separated from the other species of the genus; however, B. australis and B. microlepidotus form a monophyletic group that shares the most common haplotypes. An analysis of meristic information showed no statistically significant differences in the number of lateral line scales or number of rays in the fins between B. microlepidotus and B. australis. These results do not support the current classification for the latter two species; there appears to be one group in the extreme north of the country (Basilichthys semotilus and a second group in central Chile which should be called B. microlepidotus. This information will be useful to review the conservation status of the Chilean fauna.Si bien aún existen dudas sobre el número de especies descritas en el país, se reconoce que el 64 % de la ictiofauna dulceacuícola chilena se encuentra en alguna categoría de peligro de conservación. Uno de los grupos categorizados como vulnerable y en peligro de extinción es el de los pejerreyes del género Basilichthys. A lo largo Chile, este género posee tres especies morfológicas con distribución disjunta: Basilichthys semotilus, B. microlepidotus y B. australis. Las dos últimas sobreponen su distribución en el río Aconcagua y no son fácilmente diferenciables morfológicamente. Para evaluar la eficacia en la identificación de estas especies al utilizar marcadores moleculares, se analizó el 9 % del ADN mitocondrial (Región Control y COI de organismos obtenidos desde el río Loa (21°41' S al río Valdivia (39°50' S y adicionando un análisis merístico en organismos pertenecientes a las especies B. microlepidotus y B. australis. El análisis filogenético muestra que los individuos de B. semotilus forman un haplogrupo separado de las otras especies del género, sin embargo, B. australis y B. microlepidotus serían parte de un mismo grupo monofilético. Un segundo análisis, el cual incluye información merística, no muestra diferencias estadísticas significativas en la cantidad de escamas de la línea lateral, y número de rayos en las aletas entre B. microlepidotus y B. australis. Estos resultados no sustentan la clasificación actual, separando claramente un grupo presente en el extremo norte del país (B. semotilus y un segundo grupo en Chile central el cual debería ser llamado B. microlepidotus. Esta información será importante para revisar el estado de conservación de la ictiofauna chilena.

  12. Morfologia e crescimento do músculo estriado esquelético no pirarucu Arapaima gigas Cuvier, 1817 (Teleostei, Arapaimidae - DOI: 10.4025/actascibiolsci.v30i2.3640 Morphology and skeletal muscle growth in pirarucu Arapaima gigas Cuvier, 1817 (Teleostei, Arapaimidae - DOI: 10.4025/actascibiolsci.v30i3.3640

    Directory of Open Access Journals (Sweden)

    Maeli Dal Pai Silva


    Full Text Available O objetivo deste trabalho foi avaliar as características morfológicas e de crescimento do músculo estriado esquelético no pirarucu (Arapaima gigas. Foram utilizados animais em duas fases de crescimento: alevinos, com 50 dias de idade, e juvenis, com um ano de idade. Após eutanásia dos animais, fragmentos musculares das regiões dorsal, lateral cranial e lateral caudal foram coletados e congelados em nitrogênio líquido. Cortes histológicos (10 µm foram submetidos às colorações HE e Tricrômico de Gomori, para a análise morfológica, e NADH-TR, para a análise do metabolismo oxidativo das fibras musculares. Foi calculado o menor diâmetro das fibras musculares brancas nas regiões dorsal e lateral cranial. A musculatura dorsal branca mostrou-se mais desenvolvida e, na musculatura lateral, observaram-se compartimentos distintos: superficial vermelho e profundo branco. Nos alevinos, o crescimento muscular ocorreu predominantemente por hiperplasia das fibras e, nos juvenis, predominou o crescimento muscular por hipertrofia.The aim of this work was to evaluate the morphological and growth characteristics of skeletal muscle tissue in pirarucu (Arapaima gigas using alevins (50 days old and juveniles (1 year old. Muscle samples were collected from dorsal, lateral cranial, and lateral caudal regions, and then frozen in liquid nitrogen. Histological frozen sections (10 µm were stained with HE and Gomori Trichrome for morphological analysis, and NADH-TR to evaluate muscle fiber oxidative metabolism. Morphometric analysis samples were obtained from dorsal and lateral cranial regions, and smallest diameter white fibers were measured. White dorsal muscle was thicker and two muscle fiber compartments were identified in the lateral cranial region: red (superficial and white (deep muscle. Hyperplasia muscle growth predominated in alevins and hypertrophy in juveniles.

  13. A second glucagon in the pancreatic islets of the daddy sculpin Cottus scorpius. (United States)

    Cutfield, S M; Cutfield, J F


    The peptide hormone glucagon has been isolated from the islet tissue (Brockmann bodies) of the teleost Cottus scorpius (daddy sculpin) and sequenced. The sequence is HSEGTSNDYSKYLEDRKAQDFVQWLMNN differing at four positions from the glucagon found earlier in the same species by Conlon and coworkers (1987b, Eur. J. Biochem, 164, 117-122). Thus sculpin, in common with anglerfish, possesses two distinct glucagons. Comparative sequence data are presented as a phylogenetic tree.

  14. Spraguea lophii (Microsporidia) parasitizing blackbellied angler (Lophius budegassa) and angler (L. piscatorius) in European Atlantic waters (United States)

    Landa, Jorge; Cañás, Lucía


    Blackbellied angler (Lophius budegassa) and angler (L. piscatorius) are two important commercial species in the Bay of Biscay and the European fisheries infected by the microsporidian parasite Spraguea lophii. Samplings of both anglerfish were performed from a nine year time-series (2006-2014) from commercial fleet and bottom research surveys operating in southern Bay of Biscay and Galician waters (ICES Div. VIIIc and IXa2), Celtic Sea (Div. VIIh), south-western Ireland (Div. VIIj and VIIk), western Ireland and Porcupine Bank (Div. VIIb and VIIc). Length and sex of fish and presence or absence of the parasite were recorded. The prevalence by Spraguea was used to analyse the infection level. The role of each variable (fish length, fish sex, geographical area and year) and the interactions among them on the Spraguea prevalence were analyzed by using a binomial GLM. Area and fish length had a more relevant effect on the infestation of both anglerfish, while the impact of the year and fish sex was less evident. The Spraguea prevalence by area ranged between 11% and 52% in L. budegassa and between 39% and 66% in L. piscatorius. This is the first study in which the prevalence of this parasite in L. budegassa is analyzed in several areas and inter-annually compared. A non-linear relationship with a sharp increment of the prevalence with fish length was obtained in both anglerfish. The results were compared with those from the scarce previous studies and discussed.

  15. Errata. Notes on development of the Oligocene trachinid Trachinus minutus (Jonet, 1958). (Palaeontographica, Abteilung A: Palaozoologie - Stratigraphie (2017) 308:1 DOI: 10.1127/pala/308/2017/69)

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš


    Roč. 308, 4/6 (2017), s. 177-177 ISSN 0375-0442 R&D Projects: GA ČR GP13-19250P Institutional support: RVO:67985831 Keywords : Erratum * Teleostei * osteology * ontogeny * Oligocene Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.615, year: 2016

  16. Fish remains from Miocene beds of Višnja vas near Vojnik, Slovenia

    Directory of Open Access Journals (Sweden)

    Aleš Šoster


    Full Text Available This paper discusses fossil teeth of sharks (Elasmobranchii, Neoselachii and porgies (Teleostei, Sparidae fromthe Miocene glauconite sandstones of Vi{nja vas near Vojnik. The remains of fish teeth, mostly tooth crowns, belongto cartilaginous fishes of the genera Notorynchus, Carcharias, Carcharoides, Isurus and Cosmopolitodus and to abony fish genus Pagrus.

  17. Notes on development of the Oligocene trachinid .i.Trachinus minutus./i. (Jonet, 1958)

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš


    Roč. 308, 1-3 (2017), s. 69-87 ISSN 0375-0442 R&D Projects: GA ČR(CZ) GP13-19250P Institutional support: RVO:67985831 Keywords : Teleostei * osteology * ontogeny * Oligocene * Europe Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 1.615, year: 2016

  18. Reduced host-specificity in a parasite infecting non-littoral Lake Tanganyika cichlids evidenced by intraspecific morphological and genetic diversity

    Czech Academy of Sciences Publication Activity Database

    Kmentová, N.; Gelnar, M.; Mendlová, M.; Van Steenberge, M.; Koblmüller, Stephan; Vanhove, M. P. M.


    Roč. 6, č. 39605 (2016), č. článku 39605. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Monogenean parasites * Ancyrocephalidae * adaptive radiation * statistical tests * population growth * DNA polymorphism * fish families * Teleostei * phylogeny Subject RIV: EG - Zoology Impact factor: 4.259, year: 2016


    Czech Academy of Sciences Publication Activity Database

    Mendoza-Franco, Edgar F.; Scholz, Tomáš; Rozkošná, Petra


    Roč. 96, č. 3 (2010), s. 491-498 ISSN 0022-3395 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : NEOTROPICAL MONOGENEA * ANCYROCEPHALINAE * PROPOSAL * GILLS * TREMATODES * TELEOSTEI Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.208, year: 2010

  20. Factors determining parasite community richness and species composition in black snook Centropomus nigrescens (Centropomidae) from coastal lagoons in Guerrero, Mexico

    Czech Academy of Sciences Publication Activity Database

    Violante-González, J.; Mendoza-Franco, Edgar F.; Rojas-Herrera, A.; Guerrero, S.G.


    Roč. 107, č. 1 (2010), 59-66 ISSN 0932-0113 Institutional research plan: CEZ:AV0Z60220518 Keywords : TRES-PALOS LAGOON * HELMINTH COMMUNITIES * PACIFIC COAST * BALTIC SEA * FISHES * SIMILARITY * COLONIZATION * TELEOSTEI * BRAZIL * GILLS Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.812, year: 2010

  1. African Journal of Aquatic Science - Vol 38 (2013)

    African Journals Online (AJOL)

    Mitochondrial and nuclear DNA reveals a complete lineage sorti ng of Glossogobius callidus (Teleostei: Gobiidae) in southern Africa · EMAIL FULL TEXT ... Determining the minimum effective dose of rotenone for eradication of alien smallmouth bass Micropterus dolomieu from a South African river · EMAIL FULL TEXT ...

  2. Schistura puncticeps, a new species of loach from Myanmar (Cypriniformes: Nemacheilidae)

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Šlechtová, Vendula


    Roč. 24, č. 1 (2013), s. 85-92 ISSN 0936-9902 R&D Projects: GA ČR GA206/08/0637 Institutional research plan: CEZ:AV0Z50450515 Keywords : Teleostei Nemacheilidae * basin Subject RIV: EG - Zoology Impact factor: 2.275, year: 2013

  3. Fish fauna of the Camp dels Ninots locality (Pliocene; Caldes de Malavella, province of Girona, Spain) - first results with notes on palaeoecology and taphonomy

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Gómez de Soler, B.; Oms, O.; Roubach, S.; Blain, H-A.; Agustí, J.


    Roč. 28, č. 3 (2016), s. 347-357 ISSN 0891-2963 Institutional support: RVO:67985831 Keywords : Camp dels Ninots * Cyprinidae * maar lake * NE Spain * Pliocene * Teleostei Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.556, year: 2016

  4. African Zoology - Vol 17, No 1 (1982)

    African Journals Online (AJOL)

    The biology and taxonomic status of an estuarine population of Pranesus pinguis (Lacépède) (Teleostei: Atherinidae) in south east Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M.A.J. Harman, S.J.M. Blaber, D.P. Cyrus, 15-23 ...

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 719 ... African Journal of Aquatic Science. ... Vol 32, No 2 (2007), Algal communities associated with aquatic macrophytes ... index to Clarias gariepinus (Teleostei: Clariidae) in the Vaal River system, South Africa, Abstract ... Vol 40, No 2 (2015), Benthic macroinvertebrate assemblages in mangroves and open ...

  6. Synopsis of fossil fish fauna from the Hermanowa locality (Rupelian; Central Paratethys; Poland): current state of knowledge

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Kania, I.; Krzemiński, W.


    Roč. 109, č. 3 (2016), s. 429-443 ISSN 1661-8726 R&D Projects: GA ČR GP13-19250P Institutional support: RVO:67985831 Keywords : fish * Teleostei * Elasmobranchii * Paleogene * Oligocene * Paratethys Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.533, year: 2016

  7. African Journal of Aquatic Science - Vol 30, No 2 (2005)

    African Journals Online (AJOL)

    Fish migrations in two seasonal streams in Zimbabwe · EMAIL FULL TEXT EMAIL FULL TEXT ... The predatory impact of invasive alien smallmouth bass, Micropterus dolomieu ... Assessing the true status of the fish species Labeo cylindricus (Peters 1868) (Teleostei: ... Aquaculture: Farming Aquatic Animals and Plants

  8. The barbs of Lake Tana, Ethiopia : morphological diversity and its implications for taxonomy, trophic resource partitioning, and fisheries

    NARCIS (Netherlands)

    Nagelkerke, L.


    The rediscovery of a unique species flock of cyprinid fish, its taxonomy and its feeding-biology are described. Fourteen species of barbs (Barbus spp, Cyprinidae, Teleostei) were found in highland (1800 m) Lake Tana, in northwestern Ethiopia. Lake Tana is

  9. Two Procamallanus (Spirocamallanus) species (Nematoda: Camallanidae) from freshwater fishes in the Lower Congo River

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Jirků, Miloslav


    Roč. 60, č. 2 (2015), s. 226-233 ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : parasitic nematode * new species * redescription * Synodontis * Parachanna * Teleostei * Africa Subject RIV: EG - Zoology Impact factor: 1.293, year: 2015

  10. Gonadotropin-dependent oocyte maturational competence requires activation of the protein kinase A pathway and synthesis of RNA and protein in ovarian follicles of Nibe, Nibea mitsukurii (Teleostei, Sciaenidae) (United States)

    Yoshizaki, G.; Shusa, M.; Takeuchi, T.; Patino, R.


    Luteinizing hormone- (LH)-dependent ovarian follicle maturation has been recently described in two stages for teleost fishes. The oocyte's ability to respond to the steroidal maturation-inducing hormone (MIH), also known as oocyte maturational competence (OMC), is acquired during the first stage; whereas the MIH-dependent resumption of meiosis occurs during the second stage. However, studies directly addressing OMC have been performed with a limited number of species and therefore the general relevance of the two-stage model and its mechanisms remain uncertain. In this study, we examined the hormonal regulation of OMC and its basic transduction mechanisms in ovarian follicles of the sciaenid teleost, Nibe (Nibea mitsukurii). Exposure to MIH [17,20??-dihydroxy-4-pregnen-3-one or 17,20??,21-trihydroxy-4-pregnen-3-one] stimulated germinal vesicle breakdown (index of meiotic resumption) in full-grown follicles primed with human chorionic gonadotropin (HCG, an LH-like gonadotropin) but not in those pre-cultured in plain incubation medium. The induction of OMC by HCG was mimicked by protein kinase A (PKA) activators (forskolin and dibutyryl cyclic AMP), and blocked by specific inhibitors of PKA (H89 and H8) as well as inhibitors of RNA (actinomycin D) and protein (cycloheximide) synthesis. Forskolin-induced OMC was also inhibited by actinomycin D and cycloheximide. A strong activator of protein kinase C, PMA, inhibited HCG-dependent OMC. In conclusion, OMC in Nibe ovarian follicles is gonadotropin-dependent and requires activation of the PKA pathway followed by gene transcription and translation events. These observations are consistent with the two-stage model of ovarian follicle maturation proposed for other teleosts, and suggest that Nibe can be used as new model species for mechanistic studies of ovarian follicle differentiation and maturation in fishes.

  11. Impact of acute cadmium exposure on the trunk lateral line neuromasts and consequences on the 'C-start' response behaviour of the sea bass (Dicentrarchus labrax L.; Teleostei, Moronidae)

    International Nuclear Information System (INIS)

    Faucher, Karine; Fichet, Denis; Miramand, Pierre; Lagardere, Jean Paul


    Behavioural responses of sea bass Dicentrarchus labrax were investigated after exposure to cadmium ions in laboratory-controlled conditions. The aim of this study was to discover whether environmental exposure to cadmium ions inactivates fish lateral line system neuromasts, and to determine the behavioural consequences of such a sensory blockage. For this, fish escape behaviour in response to an artificial water jet was recorded using a 25-frames s -1 analog video camera before and after cadmium exposure. Experimental set up was tested with fish whose lateral line system was artificially inactivated by antibiotics (gentamicin and streptomycin). Histological analyses with scanning electron microscopy showed antibiotic treatment destroyed lateral line system neuromasts. In addition, these fish did not respond to stimulations provoked by the water jet after antibiotic treatment. Fish escape behaviour was then recorded before and after cadmium exposure at two different concentrations. When fish were exposed to the first concentration of cadmium tested (0.5 μg l -1 , which represents the maximal cadmium concentration encountered in contaminated estuaries), no alteration in neuromast tissue was observed. In addition, before cadmium exposure, fish responded positively in 98.41 ± 4.95% of lateral line system stimulations (escape behaviour in response to the water jet). After cadmium exposure, no behavioural modification could be detected: the fish responded positively in 95.16 ± 9.79% of stimulations (χ 2 = 2.464, p = 0.116). In contrast, the high cadmium concentration used (5 μg l -1 , which represents 10 times the concentration occurring in highly polluted estuarine areas) involved severe neuromast tissue damage. Just after such cadmium exposure, fish showed only 41.67 ± 35.36% of positive responses to their lateral line system stimulations, while they responded positively in 95.93 ± 9.10% of stimulations under control conditions (χ 2 = 24.562, p 2 = 2.876, p = 0.090). This study shows that although 5 μg l -1 cadmium is able to damage lateral line system neuromasts and causes fish behavioural alterations, fish exposed to 0.5 μg l -1 cadmium displayed neither tissue neuromast nor behavioural modification

  12. Allozyme analysis of the four species of Hypostomus (Teleostei: Loricariidae from the Ivaí river, upper Paraná river basin, Brazil - doi: 10.4025/actascibiolsci.v35i4.16355

    Directory of Open Access Journals (Sweden)

    Suzana de Paiva


    Full Text Available Allozyme electrophoresis analysis were performed in four species of Hypostomus (Loricariidae, H. albopunctatus, H. hermanni, H. regani, e Hypostomus sp. 1/NUP 5612 from the Ivaí river, a tributary of the upper Paraná river. The study of 14 loci revealed diagnostic characters and exclusive alleles in a low frequency. The heterozygosity ranged from 0.000 in H. albopunctatus to 0.199 in H. hermanni, which was higher than the heterozygosity in other samples of Hypostomus in literature, as well as in other fish groups. Hypostomus albopunctatus and H. regani revealed higher similarity (I = 0.804, while H. hermanni and Hypostomus sp. 1/NUP 5612 showed the least genetic identity (I = 0.569. All samples were genetically distinguished, despite there were several shared alleles. The FST value was 0.671, showing a high genetic differentiation among the samples. Hypostomus sp. 1/NUP 5612 was genetically distinguished from the three congeners by the loci Adh-A and G3pdh-B and by present rare exclusive alleles in other six enzymatic systems.

  13. Ligophorus species (Monogenea: Ancyrocephalidae) from Mugil cephalus (Teleostei: Mugilidae) off Morocco with the description of a new species and remarks about the use of Ligophorus spp. as biological markers of host populations. (United States)

    El Hafidi, Fouzia; Rkhami, Ouafae Berrada; de Buron, Isaure; Durand, Jean-Dominique; Pariselle, Antoine


    Gill monogenean species of Ligophorus Euzet et Suriano, 1977 were studied from the teleost Mugil cephalus Linneaus (Mugilidae) from the Mediterranean and Atlantic coasts of Morocco. We report the presence of L. mediterraneus from both the Mediterranean and Atlantic coast and L. cephali and L. maroccanus sp. n. from the Atlantic coast only. The latter species, which is described herein as new, resembles L. guanduensis but differs from this species mainly in having a shorter penis compared to the accessory piece, a proportionally longer extremity of the accessory piece and a less developed heel. The utility of Ligophorus spp. as markers of cryptic species of the complex M. cephalus is discussed in the context of species diversity and geographical distribution of these monogeneans on this host around the world. Presence of different species of Ligophorus on M. cephalus sensu stricto from the Atlantic and Mediterranean coast of Morocco demonstrates the usefulness of these species as fine resolution markers of genetic populations of their host, which are known to inhabit those coasts.

  14. Saturnius minutus n. sp. and S. dimitrovi n. sp. (Digenea: Hemiuridae) from Mugil cephalus L. (Teleostei: Mugilidae), with a multivariate morphological analysis of the Mediterranean species of Saturnius Manter, 1969. (United States)

    Blasco-Costa, I; Pankov, P; Gibson, D I; Balbuena, J A; Raga, J A; Sarabeev, V L; Kostadinova, A


    Three species of the bunocotyline genus Saturnius Manter, 1969 are described from the stomach lining of mugilid fishes of the Mediterranean and Black Seas. Two of the species are new: S. minutus n. sp. occurs in Mugil cephalus off the Mediterranean coast of Spain; and S. dimitrovi n. sp., a parasite of M. cephalus off the Bulgarian Black Sea coast and the Spanish Mediterranean coast, was originally described as S. papernai by Dimitrov et al. (1998). In addition, S. papernai Overstreet, 1977 is redescribed from M. cephalus off the Spanish Mediterranean coast and from Liza aurata and L. saliens off the Bulgarian Black Sea coast. The three species are distinguished morphometrically using univariate and multivariate analyses. These results were verified using Linear Discriminant Analysis which correctly allocated all specimens to their species designations based on morphology (i.e. 100% successful classification rate) and assigned almost all specimens to the correct population (locality). The following variables were selected for optimal separation between samples: the length of the forebody, ventral sucker and posterior testis, the length and width of the posteriormost pseudosegment, and the width of the muscular flange at ventral sucker level.

  15. Primer registro para el sur del Perú de Rhynchoconger nitens (Jordan & Bollman 1890) (Teleostei: Congridae). ¿Un caso de dispersión larvaria relacionada con El Niño?


    Béarez, Philippe; Treviño, Hugo; Zambrano, Martín


    Se registra por primera vez en el sur del Perú (Ilo, Moquegua) un ejemplar de Rhynchoconger nitens, pequeño congrio de la familia Congridae. Para explicar su presencia en 18° de latitud sur, se propone una hipótesis de migración larvaria durante un fenómeno de El Niño A specimen of Rhyncoconger nitens, a small congrid, is recorded for the first time from Ilo (Moquegua, Peru). To explain its presence at 18° of south latitude, a hypothesis of larval migration during an El Niño is proposed...

  16. Effects of parental number and duration of the breeding period on the effective population size and genetic diversity of a captive population of the endangered Tokyo bitterling Tanakia tanago (Teleostei: Cyprinidae). (United States)

    Kubota, Hitoshi; Watanabe, Katsutoshi


    The maintenance of genetic diversity is one of the chief concerns in the captive breeding of endangered species. Using microsatellite and mtDNA markers, we examined the effects of two key variables (parental number and duration of breeding period) on effective population size (N(e) ) and genetic diversity of offspring in an experimental breeding program for the endangered Tokyo bitterling, Tanakia tanago. Average heterozygosity and number of alleles of offspring estimated from microsatellite data increased with parental number in a breeding aquarium, and exhibited higher values for a long breeding period treatment (9 weeks) compared with a short breeding period (3 weeks). Haplotype diversity in mtDNA of offspring decreased with the reduction in parental number, and this tendency was greater for the short breeding period treatment. Genetic estimates of N(e) obtained with two single-sample estimation methods were consistently higher for the long breeding period treatment with the same number of parental fish. Average N(e) /N ratios were ranged from 0.5 to 1.4, and were high especially in the long breeding period with small and medium parental number treatments. Our results suggest that the spawning intervals of females and alternative mating behaviors of males influence the effective size and genetic diversity of offspring in bitterling. To maintain the genetic diversity of captive T. tanago, we recommend that captive breeding programs should be conducted for a sufficiently long period with an optimal level of parental density, as well as using an adequate number of parents. © 2011 Wiley Periodicals, Inc.

  17. Genetic variability in Oligosarcus paranensis (Teleostei: Characiformes from the São Francisco river, Ivaí river basin – Paraná State, Brazil - doi: 10.4025/actascibiolsci.v35i3.14179

    Directory of Open Access Journals (Sweden)

    Michele Rocha dos Santos


    Full Text Available The genetic variability of Oligosarcus paranensis was estimated from a population collected in São Francisco river, Prudentópolis county in Paraná State (Brazil using the electrophoresis in starch gel technique. Eleven enzymatic systems were analyzed: Aspartate aminotransaminase (AAT; E. C. 2.6.1, Alcohol dehydrogenase (ADH; E. C., Esterase (EST; E. C., Glucose-6-phosphate isomerase (GPI; E. C., Glycerol-3-Phosphate dehydrogenase (G3PDH; E. C. 1.1.1, Isocitrate dehydrogenase (IDH; E. C., L-lactate dehydrogenase (LDH; E. C., Malate dehydrogenase (MDH; E. C. , Malate dehydrogenase NADP (ME; E. C., Phosphoglucomutase (PGM; E. C. and Sorbitol dehydrogenase (SORB; E.C. Twenty loci were identified through 15% corn starch gel electrophoresis of which nine (45% were polymorphic. The average expected heterozygosity was estimated as 0.1229 ± 0.1728, and the observed was 0.0586 ± 0.1069, indicating high genetic variability. The average value of FIS = 0.5145 indicates homozygote excess.  

  18. Effects of orally administered chemotherapeutics (quinine, salinomycin) against Henneguya sp. Thelohán, 1892 (Myxozoa: Myxobolidae), a gill parasite in the tapir fish Gnathonemus petersii Günther, 1862 (Teleostei). (United States)

    Dohle, Angelika; Schmahl, Günter; Raether, Wolfgang; Schmidt, Hartmut; Ritter, Günter


    When given orally, quinine or salinomycin cause irreversible damage to the plasmodial developmental stages of Henneguya sp., a gill parasite in the tapir fish Gnathonemus petersii. Naturally infected tapir fish measured 75-169 mm in total length and their total weight ranged over 4.3-11.7 g. The fish bore 7-77 plasmodia in their gill arches. Medicinal food containing either quinine (5 g/1000 g food) or salinomycin (0.075 g/1000 g food) was given once a day to naturally infected fish in a food chain via water fleas ( Daphnia spp) for a period of 3, 6, or 9 days. From the monitored feeding of the tapir fish and weight determinations of the water fleas, it was calculated that gross uptake was 18.5 micro g/kg body weight fish daily for pure salinomycin and was 1.25 mg/kg body weight daily for quinine. After the end of the experiments, the fish were sacrificed and the plasmodia were carefully prepared from the gill arches and processed for transmission electron microscopy. As seen by ultrastructure investigations, for both substances the grade of damage in the parasites correlated positively with the period of application. When quinine was given for a 3-day period, the trophozoite ecto- and endoplasm exerted numerous vacuoles, caused by the drug, and the presporogonous and the pansporoblastic stages were malformed. Following a 6-day period, numerous abortive polar capsules were found in the trophozoite cytoplasm. To a large extent, the limiting membranes of the polaroblasts and valvogenic cells were destroyed. In addition, deep clefts between the polaroblasts, the valvogenic cells and between the two sporoblasts were observed. Following a 9-day treatment, all damage increased and, in addition, generative cells and two-cell stages were no longer detectable. As a first sign for the effects of salinomycin, following a 3-day treatment, a shrinking of the whole plasmodia occurred and the sutures in the pansporoblasts were enlarged. The polar capsules were malformed and the zonar structures of the polar filament were no longer detectable. The sporoplasmosomes were more electron-pale than those of the control samples. After a 9-day treatment, the pansporoblasts were completely destroyed. Under the experimental conditions chosen, both compounds were very well tolerated by the fishes.

  19. Superposición de la dieta del pez león Pterois volitans (Teleostei: Scorpaenidae) con la de peces nativos de nivel trófico similar en Cuba


    Pantoja Echevarría, Laura María; Chevalier Monteagudo, Pedro P.; Cabrera Guerra, Delmis; Corrada Wong, Raúl Igor; Cobián Rojas, Dorka; Caballero Aragón, Hansel; García Rodríguez, Alain; Fernández Osoria, Ramón Alexis


    RESUMEN El pez león, originario del Indo Pacífico, ha protagonizado una de las invasiones de peces marinos más rápida de la historia en el Atlántico occidental tropical y subtropical. Sus poblaciones representan una amenaza para los peces nativos de nivel trófico similar en la competencia por los recursos alimentarios. Con la finalidad de comparar sus dietas, se capturaron 899 peces león y 377 peces nativos pertenecientes a las familias Haemulidae, Holocentridae, Serranidae y Lutjanidae en tr...

  20. SEM study of the oral cavity of members of the Kyphosidae and Girellidae (Pisces, Teleostei), with remarks on Crenidens (Sparidae), focusing on teeth and taste bud numbers and distribution. (United States)

    Fishelson, Lev; Golani, Daniel; Diamant, Ariel


    The present study compares dental morphology and taste bud distribution in the oral cavity of four species of the teleost family Kyphosidae, five species of Girellidae and one species of Sparidae. Some of these species are predominantly herbivorous, while others are omnivorous with a high portion of invertebrates in their diets. All the kyphosids feature one row of frontal cusped teeth on their jaws and areas of miniature teeth on the tongue and palate; the girellid species feature 2-5 rows of denticulate teeth, and no teeth inside the oral cavity. The total number of taste buds in the oral cavity is higher in Girella spp. than in the kyphosids, and their number is species-specific, not correlated with fish size. For example, Kyphosus bigibbus of 500mm standard length bears 1780 taste buds, while the kyphosid Neoscorpis lithophilus of 80mm bears 3460. The maximum number of taste buds, 7900, is found in Girella punctata of 60mm standard length, and the minimum number, 1320, in Kyphosus vaigiensis of 175mm. The higher number of taste buds appears to characterize species that possess a more diversified diet. The present study contributes to our understanding of the differences between the two families Kyphosidae and Girellidae. In particular, it relates the eco-morphological adaptations to the type of diet consumed by the various species. Copyright © 2014. Published by Elsevier GmbH.

  1. Comparative sequence analysis of the complete set of 40S ribosomal proteins in the Senegalese sole (Solea senegalensis Kaup) and Atlantic halibut (Hippoglossus hippoglossus L.) (Teleostei: Pleuronectiformes): phylogeny and tissue- and development-specific expression. (United States)

    Manchado, Manuel; Infante, Carlos; Asensio, Esther; Cañavate, Jose Pedro; Douglas, Susan E


    Ribosomal proteins (RPs) are key components of ribosomes, the cellular organelle responsible for protein biosynthesis in cells. Their levels can vary as a function of organism growth and development; however, some RPs have been associated with other cellular processes or extraribosomal functions. Their high representation in cDNA libraries has resulted in the increase of RP sequences available from different organisms and their proposal as appropriate molecular markers for phylogenetic analysis. The development of large-scale genomics of Senegalese sole (Solea senegalensis) and Atlantic halibut (Hippoglossus hippoglossus), two commercially important flatfish species, has made possible the identification and systematic analysis of the complete set of RP sequences for the small (40S) ribosome subunit. Amino acid sequence comparisons showed a high similarity both between these two flatfish species and with respect to other fish and human. EST analysis revealed the existence of two and four RPS27 genes in Senegalese sole and Atlantic halibut, respectively. Phylogenetic analysis clustered RPS27 in two separate clades with their fish and mammalian counterparts. Steady-state transcript levels for eight RPs (RPS2, RPS3a, RPS15, RPS27-1, RPS27-2, RPS27a, RPS28, and RPS29) in sole were quantitated during larval development and in tissues, using a real-time PCR approach. All eight RPs exhibited different expression patterns in tissues with the lowest levels in brain. On the contrary, RP transcripts increased co-ordinately after first larval feeding reducing progressively during the metamorphic process. The genomic resources and knowledge developed in this survey will provide new insights into the evolution of Pleuronectiformes. Expression data will contribute to a better understanding of RP functions in fish, especially the mechanisms that govern growth and development in larvae, with implications in aquaculture.

  2. Comparative sequence analysis of the complete set of 40S ribosomal proteins in the Senegalese sole (Solea senegalensis Kaup and Atlantic halibut (Hippoglossus hippoglossus L. (Teleostei: Pleuronectiformes: phylogeny and tissue- and development-specific expression

    Directory of Open Access Journals (Sweden)

    Cañavate Jose


    Full Text Available Abstract Background Ribosomal proteins (RPs are key components of ribosomes, the cellular organelle responsible for protein biosynthesis in cells. Their levels can vary as a function of organism growth and development; however, some RPs have been associated with other cellular processes or extraribosomal functions. Their high representation in cDNA libraries has resulted in the increase of RP sequences available from different organisms and their proposal as appropriate molecular markers for phylogenetic analysis. Results The development of large-scale genomics of Senegalese sole (Solea senegalensis and Atlantic halibut (Hippoglossus hippoglossus, two commercially important flatfish species, has made possible the identification and systematic analysis of the complete set of RP sequences for the small (40S ribosome subunit. Amino acid sequence comparisons showed a high similarity both between these two flatfish species and with respect to other fish and human. EST analysis revealed the existence of two and four RPS27 genes in Senegalese sole and Atlantic halibut, respectively. Phylogenetic analysis clustered RPS27 in two separate clades with their fish and mammalian counterparts. Steady-state transcript levels for eight RPs (RPS2, RPS3a, RPS15, RPS27-1, RPS27-2, RPS27a, RPS28, and RPS29 in sole were quantitated during larval development and in tissues, using a real-time PCR approach. All eight RPs exhibited different expression patterns in tissues with the lowest levels in brain. On the contrary, RP transcripts increased co-ordinately after first larval feeding reducing progressively during the metamorphic process. Conclusion The genomic resources and knowledge developed in this survey will provide new insights into the evolution of Pleuronectiformes. Expression data will contribute to a better understanding of RP functions in fish, especially the mechanisms that govern growth and development in larvae, with implications in aquaculture.

  3. Morphology and expression of genes related to skeletal muscle growth in juveniles of pirarucu (Arapaima gigas, Arapaimatidae, Teleostei - doi: 10.4025/actascianimsci.v35i3.18219

    Directory of Open Access Journals (Sweden)

    Warlen Pereira Piedade


    Full Text Available Skeletal muscle growth in the pirarucu (Arapaima gigas is highly interesting to fish farmers because it provides information about how the mechanism in muscle mass increase, characteristic of the species, is regulated. Pirarucu has specific muscle growth that highlights the species’s significance and commercial value. Current research evaluates the morphology and the growth-related gene expression in the red and white skeletal muscles of the pirarucu. Muscle samples were collected from the lateral anterior region and frozen in liquid nitrogen. Histological sections were performed and stained by HE for morphological analysis. Red and white muscle samples were used to determine MyoD, myogenin, and myostatin genes expression by Real-time Polymerase Chain Reaction. Although MyoD and myogenin were not statistically different in the two types of muscles, myostatin was significantly higher in the white rather than in the red muscle. Results show the muscle growth characteristics of the species and may be helpful for improving aquaculture management programs.  

  4. Remarkable phylogenetic resolution of the most complex clade of Cyprinidae (Teleostei: Cypriniformes): a proof of concept of homology assessment and partitioning sequence data integrated with mixed model Bayesian analyses. (United States)

    Tao, Wenjing; Mayden, Richard L; He, Shunping


    Despite many efforts to resolve evolutionary relationships among major clades of Cyprinidae, some nodes have been especially problematic and remain unresolved. In this study, we employ four nuclear gene fragments (3.3kb) to infer interrelationships of the Cyprinidae. A reconstruction of the phylogenetic relationships within the family using maximum parsimony, maximum likelihood, and Bayesian analyses is presented. Among the taxa within the monophyletic Cyprinidae, Rasborinae is the basal-most lineage; Cyprinine is sister to Leuciscine. The monophyly for the subfamilies Gobioninae, Leuciscinae and Acheilognathinae were resolved with high nodal support. Although our results do not completely resolve relationships within Cyprinidae, this study presents novel and significant findings having major implications for a highly diverse and enigmatic clade of East-Asian cyprinids. Within this monophyletic group five closely-related subgroups are identified. Tinca tinca, one of the most phylogenetically enigmatic genera in the family, is strongly supported as having evolutionary affinities with this East-Asian clade; an established yet remarkable association because of the natural variation in phenotypes and generalized ecological niches occupied by these taxa. Our results clearly argue that the choice of partitioning strategies has significant impacts on the phylogenetic reconstructions, especially when multiple genes are being considered. The most highly partitioned model (partitioned by codon positions within genes) extracts the strongest phylogenetic signals and performs better than any other partitioning schemes supported by the strongest 2Δln Bayes factor. Future studies should include higher levels of taxon sampling and partitioned, model-based analyses. Copyright © 2012 Elsevier Inc. All rights reserved.

  5. Light organ symbioses in fishes. (United States)

    Haygood, M G


    Most bioluminescent fishes are self-luminescent, but a substantial minority of bioluminescent teleosts produce light that is due to symbiotic luminous bacteria housed in elaborate light organs. The majority of symbiotically bioluminescent fishes (ten families in five orders) harbors common free-living species of marine luminous bacteria: Photobacterium phosphoreum, P. leiognathi, and P. fischeri (= Vibrio fischeri). Others, associated with the beryciform family Anomalopidae and nine families in the lophiiform suborder Ceratioidei, have apparently obligate symbionts that have recently been identified by small subunit (16S) rRNA analysis as new groups within the genus Vibrio. This article summarizes what is currently known about relationships between light organ symbionts and their hosts, including characteristics of light organ environments, physiology of light organ symbionts, and the evolution of light organ symbionts and their associations.

  6. Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius). (United States)

    Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L


    The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.

  7. Loaches and the environment in two provinces in Northern Vietnam

    Czech Academy of Sciences Publication Activity Database

    Petrtýl, M.; Bohlen, Jörg; Kalous, L.; Bui, A.T.; Chaloupková, P.


    Roč. 60, č. 4 (2011), 368-374 ISSN 0139-7893 R&D Projects: GA ČR GA206/05/2556; GA ČR GA206/08/0637 Grant - others:MZe(CZ) 29/Mze/B/08-10 Institutional research plan: CEZ:AV0Z50450515 Keywords : biodiversity * conservation * Teleostei Subject RIV: EG - Zoology Impact factor: 0.554, year: 2011

  8. Contribuição ao conhecimento da ictiofauna do Manguezal de Cacha Pregos, Ilha de Itaparica, Baía de Todos os Santos, Bahia Contribution to knowledge of ichthyofauna of Mangrove Cacha Pregos, Itaparica island, Todos os Santos bay, Bahia

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Duarte Lopes


    Full Text Available A check-list of fishes collected in a mangrove in Cacha Pregos, south of ltaparic Island, State of Bahia, Brazil (about 13o07'S,38o48'W from 1988-1989 and 1991-1992 is presented. Fifteen orders, 46 families and 85 species (Teleostei except one Chondrichthyes were identified, represented specimens whose adults live in different marine ecossystems.


    Czech Academy of Sciences Publication Activity Database

    Mendoza-Palmero, Carlos Alonso; Scholz, Tomáš


    Roč. 97, č. 4 (2011), s. 586-592 ISSN 0022-3395 R&D Projects: GA MŠk LC522; GA ČR GD206/09/H026 Institutional research plan: CEZ:AV0Z60220518 Keywords : BRAZIL * ANCYROCEPHALINAE * TELEOSTEI * FISHES * GILLS Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.405, year: 2011

  10. Caracterização dos ovarios e do desenvolvimento ovocitario, e da recuperação ovariana pos-parto do platy (Xiphophorus maculatus) (Teleostei, Poeciliidae) em condições laboratoriais controladas e sob ação do hormonio de crescimento


    Laercio dos Anjos Benjamin


    Resumo: Os poecilídeos são peixes ovovivíparos de ampla utilização na piscicultura ornamental. Apesar disso, pouco se conhece sobre aspectos reprodutivos dessas espécies. O estudo das características histológicas e ultra-estruturais dos ovócitos constitui etapa básica e primordial para se estabelecer a biologia reprodutiva das diferentes espécies de peixes, essencial para a compreensão da fertilização, desenvolvimento inicial do embrião e crescimento das larvas. Como o sucesso da criação de p...

  11. Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius). (United States)

    Conlon, J M; Falkmer, S; Thim, L


    Three peptides isolated from the Brockmann bodies of the daddy sculpin, a teleostean fish, have been identified as fragments of one or more proglucagons. The peptide L Q D A E D S S R F D A D D T L A G E A R E L S T P K represents the NH2 terminus of proglucagon (residues 1-27), H S E G T F S N D Y S K Y L E T R R A Q D F V Q W L K N S represents glucagon and H A D G T F T S D V S S Y L N D Q A I K D F V A K L K S G K V represents the glucagon-like peptide at the COOH terminus of the precursor. The fast-atom bombardment mass spectra of the three peptides were consistent with the proposed structures and demonstrated that further posttranslational modifications of the peptides had not taken place. Sculpin glucagon is identical to anglerfish glucagon II but sculpin proglucagon(1-27) and glucagon-like peptide show stronger homology to the corresponding regions of anglerfish proglucagon I than to proglucagon II. The structures of the peptides are suggestive of the action of trypsin-like and carboxypeptidase-B-like enzymes at the site of pairs of basic amino acid residues in proglucagon. The presence of a COOH-terminal lysyl group in proglucagon(1-27) may indicate, however, that the penultimate prolyl residue partially inhibits the action of the carboxypeptidase-B-like activity.

  12. Feeding of guitarfish Rhinobatos percellens (Walbaum, 1972 (Elasmobranchii, Rhinobatidae, the target of artisanal fishery in Southern Brazil

    Directory of Open Access Journals (Sweden)

    Hugo Bornatowski


    Full Text Available Rhinobatos percellens is one of three species of Rhinobatidae found on Brazilian shores and is one of the most abundant species on the shallow continental shelf of Paraná and Santa Catarina States. Specimens caught by artisanal fishery between July/2001 and March/2003 by fishing communities located on the frontier between two southern Brazilian States (Paraná and Santa Catarina had their stomach contents analyzed. According to the Alimentary Index (IAi, Decapoda (69% and Teleostei (22% were the main items consumed. Polychaeta, a common prey consumed by several benthonic fishes, was poorly represented in the feeding of R. percellens. This fact may be related to the availability of prey in the environment, or to the size of the guitarfish analyzed (ontogeny. Seasonal variance of main preys (with higher IAi was observed: Dendrobranchiata and Pleocyemata displayed higher percentages in spring and autumn, Teleostei in the winter and Brachyura during the summer.Rhinobatos percellens é uma das três espécies de Rhinobatidae encontrada na costa brasileira e uma das espécies de elasmobrânquio mais abundante na plataforma continental dos estados do Paraná e Santa Catarina. Indivíduos capturados pela pesca artesanal entre Julho/2001 e Março/2003 nas comunidades pesqueiras localizadas entre o Paraná e Santa Catarina tiveram seus conteúdos estomacais analisados. O Índice de Importância Alimentar (IAi mostrou que as principais presas consumidas foram Decapoda (69% e Teleostei (22%. Polychaeta, principal presa ingerida por várias espécies de peixes bentônicos foi pouco expressiva na alimentação de R. percellens. Essa diferença pode estar relacionada com a disponibilidade de presas no ambiente ou com o tamanho das raias analisadas (ontogenia. De acordo com análises sazonais, observou-se que os camarões Dendrobranchiata e Pleocyemata foram as principais presas consumidas durante a primavera e outono, Teleostei durante o inverno e Brachyura

  13. Atlas of marine bony fish otoliths (sagittae of Southeastern-Southern Brazil Part V: Perciformes (Sparidae, Sciaenidae, Polynemidae, Mullidae, Kyphosidae, Chaetodontidae, Mugilidae, Scaridae, Percophidae, Pinguipedidae, Blenniidae, Gobiidae, Ephippidae, Sphyraenidae, Gempylidae, Trichiuridae, Scombridae, Ariommatidae, Stromateidae and Caproidae

    Directory of Open Access Journals (Sweden)

    Cesar Santificetur

    Full Text Available ABSTRACT This publication is part of a series prepared with the purpose to constitute an Atlas of Teleostei Otoliths for the Southeastern-Southern Brazilian area. Here we present the results of 15 morphological features and six shape indices for 33 Perciformes species of 20 families. Whenever available in out collection, three otoliths of each species were illustrated and photographed. The frequency of occurrence of each feature was calculated inside and among total length classes being the differences analyzed through multiple χ2 tests (significance level 0.05. Based on otoliths measurements, six shape indices values were obtained being the minimum, maximum, mean and standard deviations values presented.

  14. Species complexes and phylogenetic lineages of Hoferellus (Myxozoa, Cnidaria) including revision of the genus: A problematic case for taxonomy

    Czech Academy of Sciences Publication Activity Database

    Alama-Bermejo, Gema; Jirků, Miloslav; Kodádková, Alena; Pecková, Hana; Fiala, Ivan; Holzer, Astrid S.


    Roč. 9, JAN 11 (2016), č. článku 13. ISSN 1756-3305 R&D Projects: GA ČR GBP505/12/G112; GA ČR GAP506/10/2330; GA ČR(CZ) GP14-28784P Grant - others:AV ČR(CZ) M200961205 Institutional support: RVO:60077344 Keywords : Amphibia * Anura * fish * Carassius * Cyprinus carpio * ITS cloning * mode of attachment * Teleostei * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 3.080, year: 2016

  15. Atlas of marine bony fish otoliths (Sagittae of Southeastern - Southern Brazil Part I: Gadiformes (Macrouridae, Moridae, Bregmacerotidae, Phycidae and Merlucciidae; Part II: Perciformes (Carangidae, Sciaenidae, Scombridae and Serranidae

    Directory of Open Access Journals (Sweden)

    Carmen Lucia Del Bianco Rossi-Wongtschowski


    Full Text Available The drawings, detailed pictures, precise descriptions and measurements that characterize otoliths must be made available for studies in various areas, including taxonomy, phylogeny, ecology, fisheries, paleontology, diversity, predator-prey relationships and modeling. The Collection of Teleostei Fish Otoliths of Southeastern-Southern Brazil (COSS-Brasil of IOUSP contains 45,000 pairs of otoliths from 210 species. This publication is the first in a series that will constitute an atlas of Teleostei otoliths for southeastern-southern Brazil and presents the results of the morphologic and morphometric analyses of 11 Gadiformes and 36 Perciformes species by means of the most commonly used features, measurements and indices. Three otoliths of each species were illustrated and photographed whenever possible. The frequency of occurrence was calculated for each characteristic by total length classes (TL, and the ontogenetic differences were analyzed (multiple χ2 test; significance 0.05. Morphometric analyses were conducted for each characteristic per total length (TL class and for the whole sample, and the ontogenetic differences were analyzed.

  16. Fish Ecology and Evolution in the World's Oxygen Minimum Zones and Implications of a Warming Ocean (United States)

    Gallo, N.; Navarro, E. C.; Yazzie, A. T.; Barry, J. P.; Levin, L. A.


    Predicting how demersal fish communities will respond as hypoxic areas expand with climate change requires an understanding of how existing oxygen gradients influence the abundance, diversity, and trophic ecology of demersal fish communities. A literature review of studies from continental margins with oxygen minimum zones in the Pacific, Atlantic, and Indian Ocean, is combined with new data from research cruises to the Gulf of California and the US West Coast, to examine how hypoxic areas influence the structure and function of demersal fish communities. Oxygen minimum zones (OMZs) are deep-sea environments where organisms experience chronic hypoxic and suboxic conditions and have persisted over much longer timescales than coastal eutrophication-induced hypoxic zones, allowing for the evolution of adaptations to low oxygen conditions. While coastal studies have found that fish are one of the most hypoxia-intolerant groups, representative demersal fish species in the orders Cottiformes, Scorpaeniformes, Pleuronectiformes, Gobiiformes, Perciformes, Lophiiformes, Carcharhiniformes, Ophidiiformes, Myxiniformes, and Gadiformes have evolved to exploit physiologically extreme OMZ environments and are important components of the benthic community. In OMZs, certain fish species are some of the most hypoxia-tolerant members of the megafauna community, present even under extremely low oxygen conditions (< 5 µmol/kg) where most invertebrates are absent, though these communities are typically characterized by single-species dominance. To explore differences in the trophic ecology of these "hypoxia-tolerant" fish communities, stable isotope and gut content analysis are used to compare the Southern California Bight OMZ core fish community to the hypoxia-intolerant upper slope fish community. Results show that fish living in the OMZ core have significantly enriched δ13C and δ15N signatures and feed on different prey items.

  17. Studies on proinsulin and proglucagon biosynthesis and conversion at the subcellular level: I. Fractionation procedure and characterization of the subcellular fractions (United States)

    Noe, BD; Baste, CA; Bauer, GE


    Anglerfish islets were homogenized in 0.25 M sucrose and separated into seven separate subcellular fractions by differential and discontinuous density gradient centrifugation. The objective was to isolate microsomes and secretory granules in a highly purified state. The fractions were characterized by electron microscopy and chemical analyses. Each fraction was assayed for its content of protein, RNA, DNA, immunoreactive insulin (IRI), and immunoreactive glucagon (IRG). Ultrastructural examination showed that two of the seven subcellular fractions contain primarily mitochondria, and that two others consist almost exclusively of secretory granules. A fifth fraction contains rough and smooth microsomal vesicles. The remaining two fractions are the cell supernate and the nuclei and cell debris. The content of DNA and RNA in all fractions is consistent with the observed ultrastructure. More than 82 percent of the total cellular IRI and 89(percent) of the total cellular IRG are found in the fractions of secretory granules. The combined fractions of secretory granules and microsomes consistently yield >93 percent of the total IRG. These results indicate that the fractionation procedure employed yields fractions of microsomes and secretory granules that contain nearly all the immunoassayable insulin and glucagons found in whole islet tissue. These fractions are thus considered suitable for study of proinsulin and proglucagon biosynthesis and their metabolic conversion at the subcellular level. PMID:328517

  18. Trophic structure in the Gulf of Lions marine ecosystem (north-western Mediterranean Sea) and fishing impacts (United States)

    Bănaru, D.; Mellon-Duval, C.; Roos, D.; Bigot, J.-L.; Souplet, A.; Jadaud, A.; Beaubrun, P.; Fromentin, J.-M.


    The Gulf of Lions ecosystem was described using the Ecopath mass-balance model to characterise its structure and functioning and to examine the effects of the multispecific fisheries operating in this area. The model is composed of 40 compartments, including 1 group of seabirds, 2 groups of cetaceans, 18 groups of fish, 12 groups of invertebrates, 5 groups of primary producers, detritus and discards. Input data were based on several recurrent scientific surveys, two alternative datasets for fishing data, stock assessment outputs, stomach content analyses and published information. Results showed that the functional groups were organised into five trophic levels with the highest one represented by dolphins, anglerfish, Atlantic bluefin tuna, European hake and European conger. European pilchard and European anchovy dominated in terms of fish biomass and catch. Other fish with high biomass such as Atlantic mackerel and blue whiting were highly important in the food web. Seabirds, dolphins and cuttlefish-squids represented keystone species. Important coupled pelagic-demersal-benthic interactions were described. The 7 different fisheries analysed were operating at mean trophic levels situated between 2.6 for small artisanal boats, and 4.1 for purse seines (> 24 m) targeting large pelagic fish, indicating an intensively exploited ecosystem. Large trawlers (24-40 m) had the highest impact on most of the groups considered; while purse seines (12-24 m) targeting small pelagic fish had the lowest impact. Preliminary results highlighted the importance of data sources for further ecosystem and fisheries analyses and management scenarios.

  19. Photobiology of the deep twilight zone and beyond (United States)

    Waterman, Talbot H.


    Photobiology in the twilight zone of the deep sea depends on faint light of two, or possibly three, origins: sunlight, bioluminescence and some visible radiation near the bottom associated with hydrothermal vents. The deep twilight zone also contains two quite distinct ecosystems: the vast open ocean pelagic regime far from the shore and the bottom as well as the far less expansive benthic regime with quite different characteristic animals that live on, in or near the sea bo10 Most of the whole ocean's benthic regime with a mean depth over 3000m is well below the twilight zone, which eliminates sunlight as a light source there. Many of the most familiar deepsea animals with their spectacular arrays of dennal light organs and remarkable eyes are from the pelagic 19, 25 The less familiar benthic fishes and crustaceans sometimes have curious internal light organs powered by bacteria13 and occasional incredibly modified eyes.30 With the exception of those on the fishing rods of most female deepsea anglerfish, where the light is produced by symbiotic bacteria, all the numerous light organs of pelagic deepsea fishes are generally believed to manage their own chemiluminescence independent of luminous bacteria.17

  20. Phylogenetic relationships of hexaploid large-sized barbs (genus Labeobarbus, Cyprinidae) based on mtDNA data. (United States)

    Tsigenopoulos, Costas S; Kasapidis, Panagiotis; Berrebi, Patrick


    The phylogenetic relationships among species of the Labeobarbus genus (Teleostei, Cyprinidae) which comprises large body-sized hexaploid taxa were inferred using complete cytochrome b mitochondrial gene sequences. Molecular data suggest two main evolutionary groups which roughly correspond to a Northern (Middle East and Northwest Africa) and a sub-Saharan lineage. The splitting of the African hexaploids from their Asian ancestors and their subsequent diversification on the African continent occurred in the Late Miocene, a period in which other cyprinins also invaded Africa and radiated in the Mediterranean region. Finally, systematic implications of these results to the taxonomic validity of genera or subgenera such as Varicorhinus, Kosswigobarbus, Carasobarbus and Capoeta are further discussed. Copyright 2010 Elsevier Inc. All rights reserved.

  1. Atlas of marine bony fish otoliths (sagittae of Southeastern-Southern Brazil Part VI: Albuliformes, Anguiliformes, Osmeriformes, Stomiiformes, Aulopiformes, Myctophiformes, Ophidiiformes, Polimixiiformes, Batrachoidiformes and Lophiformes

    Directory of Open Access Journals (Sweden)

    Marcella Bockis Giaretta

    Full Text Available ABSTRACT This publication is part of a series that will constitute an Atlas of Teleostei Otoliths of the Southeastern-Southern Brazilian region. In this article, we present the results of sagittae's morphologic and morphometric analyses from fishes remaining to the orders: Albuliformes (one species, Anguiliformes (four, Osmeriformes (one, Stomiiformes (one, Aulopiformes (five, Myctophiformes (nine, Ophidiiformes (three, Polimixiiformes (one, Batrachoidiformes (one and Lophiformes (three. Features, measurements and indices were analyzed according to methodology used in anterior series. Whenever possible three otoliths of each species have been illustrated and photographed. The frequency of occurrence of each characteristic was calculated by total length classes (TL and differences within and among them have been analyzed applying multiple χ² test (significance 0.05.

  2. Mechanistic basis of otolith formation during teleost inner ear development. (United States)

    Wu, David; Freund, Jonathan B; Fraser, Scott E; Vermot, Julien


    Otoliths, which are connected to stereociliary bundles in the inner ear, serve as inertial sensors for balance. In teleostei, otolith development is critically dependent on flow forces generated by beating cilia; however, the mechanism by which flow controls otolith formation remains unclear. Here, we have developed a noninvasive flow probe using optical tweezers and a viscous flow model in order to demonstrate how the observed hydrodynamics influence otolith assembly. We show that rotational flow stirs and suppresses precursor agglomeration in the core of the cilia-driven vortex. The velocity field correlates with the shape of the otolith and we provide evidence that hydrodynamics is actively involved in controlling otolith morphogenesis. An implication of this hydrodynamic effect is that otolith self-assembly is mediated by the balance between Brownian motion and cilia-driven flow. More generally, this flow feature highlights an alternative biological strategy for controlling particle localization in solution. Copyright © 2011 Elsevier Inc. All rights reserved.

  3. The complete mitochondrial genome of the threatened Neotropical catfish Lophiosilurus alexandri (Silurifomes: Pseudopimelodidae and phylogenomic analysis indicate monophyly of Pimelodoidea

    Directory of Open Access Journals (Sweden)

    Daniel Cardoso Carvalho

    Full Text Available Abstract Lophiosilurus alexandri is an endemic catfish from the São Francisco River Basin (Brazil popularly known as pacamã, which has economic potential for aquaculture farming. The mitochondrial genome was sequenced for the threatened Neotropical catfish L. alexandri. Assembly into scaffolds using MIRA and MITObim software produced the whole, circularized mitochondrial genome, which comprises 16,445 bp and presents the typical gene arrangement of Teleostei mitochondria. A phylogenomic analysis was performed after the concatenation of all proteins obtained from whole mitogenomes of 20 Siluriformes and two outgroups. The results confirmed the monophyly of nine families of catfishes and also clustered L. alexandri as a sister group to the family Pimelodidae, thus confirming the monophyly of the superfamily Pimelodoidea. This is the first mitochondrial phylogenomics study for Pimelodoidea and the first mitogenome described for the Pseudopimelodidae family, representing an important resource for phylogeography, evolutionary biology, and conservation genetics studies in Neotropical fishes.

  4. Morphology of gills of the seawater fish Cathorops spixii (Agassiz (Ariidae by scanning and transmission electron microscopy

    Directory of Open Access Journals (Sweden)

    Daura R. Eiras-Stofella


    Full Text Available Gills of the seawater fish Cathorops spixii (Agassiz, 1829 were submitted to routine processing for observation in scanning and transmission electron microscopy. The wrinkled surface of the gill filaments showed well-defined cellular ultrastructures. Microridges on cellular surface were projected over all gill structures, including respiratory lamellae. Chloride cells were usually at primary lamellae. Some rodlet cells were found. Mucous secretory cells were uncommon at all parts of the gill arches. The pharyngeal region of the gill arches showed a lot of taste buds but no spines. There were small and strong rakers. Such morphology is indicative of fishes that swallow small food but do not have filtering habits. At the ultrastructural level the gills of C. spixii presented the typical morphological pattern of Teleostei fishes.

  5. İzmir Körfezi İhtiyoplanktonu (1974-2005 Türleri.

    Directory of Open Access Journals (Sweden)

    Tülin Çoker


    Full Text Available İzmir Körfezi Türkiye Denizleri içinde ihtiyoplankton (balık yumurta larva incelemeleri açısından en yoğun çalışılmış körfezdir. İlk ayrıntılı çalışma 1974 yılında başlamış olup, 2005 yılında bu çalışmalar halen devam etmektedir. Saptanabilen türlerin yumurta, prelarva ve postlarval dönemleri ile ilgili tespitler körfez bölümlerine göre dağılımları boyları verilerek belirtilmiş, böylelikle çeşitli çalışmalar sonucu belirlenen toplam tür çeşitliliği ve türlerin körfez bölümlerine göre dağılımları ortaya konmuştur. Körfezde 1974-2005 yılları arasında toplam; 15 ordoya ait 186 (ordo, fam, tür düzeyinde yumurta, prelarva ve postlarva örneklenmiş; 2 ordo, 7 familya, 17 genus, 144 tür düzeyinde toplam 170 ilk kayıt verilmiştir. İzmir Körfezi ihtiyoplanktonu 48 familya ile temsil edilmiştir; Anguilliformes (Congridae, Nettastomiidae, Clupeiformes (Clupeidae, Engraulidae, Stomiiformes (Sternoptychidae, Photichthyidae, Stomiidae, Synodontidae, Aulophiformes (Paralepididae, Myctophiformes (Myctophidae, Lampridiformes (Regalecidae, Merlucciidae, Gadidae, Ophidiiformes (Ophiididae, Carapidae, Lophiiformes (Lophiidae, Atheriniformes (Atherinidae,Cyprinodontiformes (Belonidae, Syngnathiformes (Syngnathidae, Scorpaeniformes (Scorpaenidae, Triglidae, Percomorphı (Moronidae, Serranidae, Carangidae, Pomatomidae, Coryphaenidae, Sparidae, Centracanthidae, Sciaenidae, Mullidae, Cepolidae, Mugilidae, Labridae, Ammodytidae, Trachinidae, Uranoscopidae, Tripterygiidae, Blenniidae, Callionymidae, Gobiidae, Sphyraenidae, Trichiuridae, Scombridae, Centrolophidae, Pleuronectiformes (Scophthalmidae, Bothidae, Pleuronectidae, Soleidae. İç Körfez (6 ordo, 19 familya, Orta Körfez (8 ordo, 25 familya, Dış Körfez I (8 ordo, 30 familya, Dış Körfez II (8 ordo, 30 familya, Dış Körfez III’de (11 ordo, 39 familya’ya ait türler belirlenmiştir

  6. The fish and fisheries of Jones Bank and the wider Celtic Sea (United States)

    Martinez, I.; Ellis, J. R.; Scott, B.; Tidd, A.


    The Celtic Sea is a diverse fishing ground that supports important commercial fisheries for a range of demersal fish, large and small-bodied pelagic fish and a variety of cephalopods and other shellfish. A regional overview of the main commercial fish stocks of the Celtic Sea and of the fish that occur in the vicinity of Jones Bank are provided through analyses of landings data from English and Welsh vessels, and from scientific trawl surveys. Dedicated smaller scale sampling via trawl surveys combined with baited cameras on and around the Jones Bank were also analysed to investigate the importance of sandbank habitats with attention paid to the differences in the species occurring on the top of the bank in comparison to adjacent off-bank habitats. Official landing statistics for UK (English and Welsh) vessels indicated that the predominant commercial demersal species in ICES Divisions VIIg,h (in terms of quantities landed) were anglerfish, megrim, pollack and skates (Rajidae). There were, however, regional differences in the distribution of fish and fisheries, and the area surrounding Jones Bank (ICES Rectangles 28E1 and 28E2) supports fisheries for megrim, anglerfish, skates, hake, ling and turbot, with otter trawl, gillnet and beam trawl the main gears used. Recent survey data collected with GOV (Grande Ouverture Verticale) trawl from the Celtic Sea (ICES Divisions VIIe-h, 2007-2010) were used to highlight the broad scale distribution of the main fish assemblages in the Celtic Sea. Analyses of the fish and cephalopod catches from these surveys indicated that there were four broad assemblages in the area, including (i) a region around the Cornwall (which will also be partly influenced by the necessity to use rockhopper ground gear on these rough grounds), (ii) the shallower regions of the north-western Celtic Sea (including parts of the Bristol Channel), (iii) the deeper parts of the outer shelf and (iv) the central Celtic Sea. These data also provided

  7. Deep-water fisheries at the Atlantic Frontier (United States)

    Gordon, J. D. M.


    The deep sea is often thought of as a cold, dark and uniform environment with a low-fish biomass, much of which is highly adapted for life in a food-poor environment. While this might be true of the pelagic fish living in the water column, it is certainly not true of the demersal fish which live on or close to the bottom on the continental slopes around the British Isles (the Atlantic Frontier). These fish are currently being commercially exploited. There is growing evidence to support the view that success of the demersal fish assemblages depends on the pelagic or benthopelagic food sources that impinge both vertically and horizontally onto the slope. There are several quite separate and distinct deep-water fisheries on the Atlantic Frontier. It is a physical barrier, the Wyville-Thomson Ridge, which results in the most significant division of the fisheries. The Ridge, which has a minimum depth of about 500 m, separates the warmer deep Atlantic waters from the much colder Norwegian Sea water and as a result, the deep-water fisheries to the west of the Hebrides and around the offshore banks are quite different from those of the Faroe-Shetland Channel (West of Shetland). The fisheries to the West of the Hebrides can be further divided by the fishing method used into bottom trawl, semipelagic trawl and longline. The bottom-trawl fisheries extend from the shelf-slope break down to about 1700 m and the target species varies with depth. The smallest vessels in the fleet fish on the upper slope, where an important target species is the anglerfish or monkfish ( Lophius spp.). On the mid-slope the main target species are blue ling ( Molva dypterygia) and roundnose grenadier ( Coryphaenoides rupestris), with bycatches of black scabbardfish ( Aphanopus carbo) and deep-water sharks. On the lower slope orange roughy ( Hoplostethus atlanticus) is an important target species. The major semipelagic trawl fishery is a seasonal fishery on spawning aggregations of blue whiting

  8. Estimation of the carbon footprint of the Galician fishing activity (NW Spain)

    International Nuclear Information System (INIS)

    Iribarren, Diego; Vazquez-Rowe, Ian; Hospido, Almudena; Moreira, Maria Teresa; Feijoo, Gumersindo


    The food production system as a whole is recognized as one of the major contributors to environmental impacts. Accordingly, food production, processing, transport and consumption account for a relevant portion of the greenhouse gas (GHG) emissions associated with any country. In this context, there is an increasing market demand for climate-relevant information regarding the global warming impact of consumer food products throughout the supply chains. This article deals with the assessment of the carbon footprint of seafood products as a key subgroup in the food sector. Galicia (NW Spain) was selected as a case study. The analysis is based on a representative set of species within the Galician fishing sector, including species obtained from coastal fishing (e.g. horse mackerel, Atlantic mackerel, European pilchard and blue whiting), offshore fishing (e.g. European hake, megrim and anglerfish), deep-sea fishing (skipjack and yellowfin tuna), extensive aquaculture (mussels) and intensive aquaculture (turbot). The carbon footprints associated with the production-related activities of each selected species were quantified following a business-to-business approach on the basis of 1 year of fishing activity. These individual carbon footprints were used to calculate the carbon footprint for each of the different Galician fisheries and culture activities. Finally, the lump sum of the carbon footprints for coastal, offshore and deep-sea fishing and extensive and intensive aquaculture brought about the carbon footprint of the Galician fishing activity (i.e., capture and culture). A benchmark for quantifying and communicating emission reductions was then provided, and opportunities to reduce the GHG emissions associated with the Galician fishing activity could be prioritized.

  9. Estimation of the carbon footprint of the Galician fishing activity (NW Spain). (United States)

    Iribarren, Diego; Vázquez-Rowe, Ian; Hospido, Almudena; Moreira, María Teresa; Feijoo, Gumersindo


    The food production system as a whole is recognized as one of the major contributors to environmental impacts. Accordingly, food production, processing, transport and consumption account for a relevant portion of the greenhouse gas (GHG) emissions associated with any country. In this context, there is an increasing market demand for climate-relevant information regarding the global warming impact of consumer food products throughout the supply chains. This article deals with the assessment of the carbon footprint of seafood products as a key subgroup in the food sector. Galicia (NW Spain) was selected as a case study. The analysis is based on a representative set of species within the Galician fishing sector, including species obtained from coastal fishing (e.g. horse mackerel, Atlantic mackerel, European pilchard and blue whiting), offshore fishing (e.g. European hake, megrim and anglerfish), deep-sea fishing (skipjack and yellowfin tuna), extensive aquaculture (mussels) and intensive aquaculture (turbot). The carbon footprints associated with the production-related activities of each selected species were quantified following a business-to-business approach on the basis of 1year of fishing activity. These individual carbon footprints were used to calculate the carbon footprint for each of the different Galician fisheries and culture activities. Finally, the lump sum of the carbon footprints for coastal, offshore and deep-sea fishing and extensive and intensive aquaculture brought about the carbon footprint of the Galician fishing activity (i.e., capture and culture). A benchmark for quantifying and communicating emission reductions was then provided, and opportunities to reduce the GHG emissions associated with the Galician fishing activity could be prioritized. Copyright © 2010 Elsevier B.V. All rights reserved.


    Directory of Open Access Journals (Sweden)

    Bram Setyadji


    Full Text Available Hasil tangkap sampingan (HTS hampir terdapat pada semua jenis perikanan tangkap di Indonesia, termasuk pada perikanan rawai tuna di Samudera Hindia. Kebanyakan jenis HTS merupakan spesies yang tidak diinginkan atau jenis ikan target tapi ukurannya di bawah standar yang diinginkan (yuwana atau ikan muda dan pada kasus tertentu merupakan jenis ikan yang terancam keberadaannya (Endangered species. Penelitian ini bertujuan untuk memberikan informasi tentang komposisi hasil tangkap sampingan, laju pancing dan hubungan antara tuna dengan ikan yang berasosiasi dengannya pada area penangkapan yang sama. Pengamatan dilakukan pada bulan Maret – Juli 2010 dengan mengikuti kegiatan operasi penangkapan 2 kapal rawai tuna komersial yang berbasis di Pelabuhan Benoa. Hasil penelitian menunjukkan terdapat 18 jenis hasil tangkap sampingan yang  didominasi dari family Alepisauridae; ikan naga (Alepisaurus sp.; Gempylidae; ikan gindara (oilfish, dan Dasyatidae; pari lumpur (Dasyatis spp.. Jenis ikan lain adalah ikan paruh panjang (billfish, berbagai jenis cucut dan pari, ikan teleostei, serta penyu lekang. Kebanyakan dari hasil tangkap sampingan merupakan by-product yang mempunyai nilai ekonomis tinggi kecuali jenis ikan naga dan pari lumpur yang merupakan discard/buangan.   By-catch products are mostly available in every kind of capture fisheries in Indonesia including tuna longline fisheries in Indian Ocean. Most of these are unwanted species or juvenile target fish, sometimes endangered species. The research intended to reveal the by-catch from tuna fisheries and its relationship between tuna and its associate in the same fishing ground. Surveillance was conducted on March – July, 2010 by following two commercial tuna longliners vessel based in Port of Benoa. The result showed that there were 18 by-catch species that managed to be retrieved and indentified, family Alepisauridae; lancetfish (Alepisaurus sp.; Gempylidae; oilfish (Ruvettus pretiosus, and

  11. Spatial distribution and diet of Cephalopholis fulva (Ephinephelidae at Trindade Island, Brazil

    Directory of Open Access Journals (Sweden)

    Flavio do Nascimento Coelho

    Full Text Available In this study we analyze the population structure and diet of the coney Cephalopholis fulva at Trindade Island, Brazil, through direct observation with SCUBA diving in 11 reef sites around the Island, up to 50 m deep. Diet was based on 77 individuals collected with speargun. Mean population density and biomass were estimated at 29 individuals/100 m² and 13 kg/100 m², respectively. This species is regularly distributed along the costal environments of the Trindade Island, with no significant differences in densities and biomass detected among the different collection habitats (reef crest, reef slope, and reef plateau. However, significantly higher densities were observed micro-habitats with greater structural complexity, which may offer more shelter and food to C. fulva. Four food item groups were identified from the gut contents of C. fulva: Annelida, Crustacea, Teleostei, and Testudinata. It is the first record of predation of the green turtle Chelonia mydas hatchlings by the coney. Trindade Island seems to present the densest concentration of C. fulva in all Brazilian and Caribbean ecosystems inhabited by this species. Scarcity of competitors, predators, and fishing pressure may explain the high densities observed in the Island.

  12. Analysis of food habits of skate Rioraja agassizii (Elasmobranchii, Rajidae from southern Brazil

    Directory of Open Access Journals (Sweden)

    N. S. Motta

    Full Text Available Abstract Catches and exports of skate Rioraja agassizii place this species as “vulnerable to extinction” on the IUCN Red List; therefore, biological and ecological knowledge becomes an important instrument for its conservation control. This study described and quantified the diet composition of R. agassizii by means of stomach analysis contents in the periods 2005-2006 and 2012-2013. We analyzed and quantified stomach contents in terms of abundance (%N, weight (%M, frequency of occurrence (% FO, and index of relative importance (IRI. The results showed differences in the food rates between the periods. However, the groups of food items were the same: Teleostei fish, decapods, and mollusks. In 2005-2006, the diet consisted mainly of shrimp, however, in 2012-2013 it consisted of fish, followed by decapods, especially shrimps. The differences in diets may be attributed to shrimp abundance, which do not characterize a change in the eating habits in 2012-2013, because, in addition to fish, shrimps were also important food sources. The presence of a certain prey is more related to its availability rather than the feeding preference of skate. The amount of ingested items is associated to biological and environmental factors, so that further studies relating diet with capture area, seasonality, depth, and other factors should be conducted.

  13. Do freshwater fishes diversify faster than marine fishes? A test using state-dependent diversification analyses and molecular phylogenetics of new world silversides (atherinopsidae). (United States)

    Bloom, Devin D; Weir, Jason T; Piller, Kyle R; Lovejoy, Nathan R


    Freshwater habitats make up only ∼0.01% of available aquatic habitat and yet harbor 40% of all fish species, whereas marine habitats comprise >99% of available aquatic habitat and have only 60% of fish species. One possible explanation for this pattern is that diversification rates are higher in freshwater habitats than in marine habitats. We investigated diversification in marine and freshwater lineages in the New World silverside fish clade Menidiinae (Teleostei, Atherinopsidae). Using a time-calibrated phylogeny and a state-dependent speciation-extinction framework, we determined the frequency and timing of habitat transitions in Menidiinae and tested for differences in diversification parameters between marine and freshwater lineages. We found that Menidiinae is an ancestrally marine lineage that independently colonized freshwater habitats four times followed by three reversals to the marine environment. Our state-dependent diversification analyses showed that freshwater lineages have higher speciation and extinction rates than marine lineages. Net diversification rates were higher (but not significant) in freshwater than marine environments. The marine lineage-through time (LTT) plot shows constant accumulation, suggesting that ecological limits to clade growth have not slowed diversification in marine lineages. Freshwater lineages exhibited an upturn near the recent in their LTT plot, which is consistent with our estimates of high background extinction rates. All sequence data are currently being archived on Genbank and phylogenetic trees archived on Treebase. © 2013 The Author(s). Evolution © 2013 The Society for the Study of Evolution.

  14. Distribution, population biology, and trophic ecology of the deepwater demersal fish Halosauropsis macrochir (Pisces: Halosauridae on the mid-Atlantic Ridge.

    Directory of Open Access Journals (Sweden)

    Odd Aksel Bergstad

    Full Text Available Halosauropsis macrochir ranked amongst the most abundant and widespread demersal fishes on the mid-Atlantic Ridge of the North Atlantic (Iceland-Azores with greatest abundance at 1700-3500 m. All sizes, ranging from 10-76 cm total length, occurred in the area without any apparent spatial pattern or depth trend. Using otolith sections displaying growth increments assumed to represent annuli, the age range recorded was 2-36 years, but most individuals were <20 years. Length and weight at age data were used to fit growth models. No differences between sexes in length and weight at age were observed. The majority of samples had a surplus of males. Diet analysis showed that H. macrochir feeds on Crustacea, Teleostei, Polychaeta, and Cephalopoda, but few prey could be identified to lower taxonomical levels. The mid-Atlantic Ridge constitutes a major portion of the North Atlantic living space of the abyssal halosaur where it completes its full life cycle, primarily as an actively foraging euryophagous micronekton/epibenthos and infauna feeder, becoming a partial piscivore with increasing size.

  15. Reliable micro-measurement of strontium is the key to cracking the life-history code in the fish otolith

    International Nuclear Information System (INIS)

    Markwitz, A.; Grambole, D.; Herrmann, F.; Trompetter, W.J.; Dioses, T.; Gauldie, R.W.


    The fish otolith is a calcium carbonate (usually aragonite) crystal that grows continuously by accretion over the life of the fish and unlike bone is not continuously re-metabolised. Consequently, the otolith has long been regarded as a potential store of information about the life history of an individual fish, and this information is encoded in the deposition pattern of trace elements in the otolith. The code has been difficult to crack. However, recent developments have show that: (1) Sr is one of the few non-mobile trace elements in the otolith; and (2) the pattern of Sr deposition summarises the effects of environment changes that affect the growth rate of the otolith crystal. The remaining difficulties in cracking the chemical code in the otolith have hinged about making reliable micro-measurements of the stable Sr content at spatial resolutions of 10 μm or less; this interval represents about 4-6 days of otolith growth in most species of fish. This paper describes high beam resolution 2 μm linear measurements, and 6 μm square measurements over narrow windows of about 300 μm square, and links these micro-measures to macro-measures of 2D maps of the entire surface of sections of otoliths up to 5 mm square at beam resolutions of 25 μm square. The otoliths used in this study are from the Jurel, or Peruvian Jack mackerel, Trachurus murphyi (Carangidae: Teleostei)

  16. Growth and Histopathological Effects of Chronic Exposition of Marine Pejerrey Odontesthes argentinensis Larvae to Petroleum Water-Soluble Fraction (WSF)

    Energy Technology Data Exchange (ETDEWEB)

    Gusmao, Emeline Pereira; Rodrigues, Ricardo Vieira; Moreira, Caue Bonucci [Programa de Pos-Graduacao em Aquicultura, Laboratorio de Piscicultura Estuarina e Marinha, Universidade Federal do Rio Grande, Rio Grande (Brazil); Romano, Luis Alberto; Sampaio, Luis Andre [Laboratorio de Piscicultura Estuarina e Marinha, Instituto de Oceanografia, Universidade Federal do Rio Grande, Rio Grande (Brazil); Miranda-Filho, Kleber Campos [Escola de Veterinaria, Departamento de Zootecnia, Laboratorio de Aquacultura, Universidade Federal de Minas Gerais, Belo Horizonte (Brazil)], e-mail:


    The water-soluble fraction (WSF) of petroleum contains a mixture of polycyclic aromatic hydrocarbons, volatile hydrocarbons, phenols, and heterocyclic compounds, considered deleterious to aquatic biota. Marine 'pejerrey' Odontesthes argentinensis (Teleostei: Atherinopsidae) has a great commercial importance in local fisheries and a high potential for aquaculture. The aim of this study was to evaluate the histopathological effects in 'pejerrey' larvae exposed to different concentrations of petroleum WSF. The chronic toxicity test was conducted with newly hatched larvae exposed for 21 days to sublethal concentrations of WSF (2.5, 5, 10, and 20 % of WSF), plus one control. Survival and growth were significantly lower in the highest concentration. Several histopathological changes were found in the gills (e.g., hyperplasia, aneurysms, edema, and necrosis), kidney (e.g., nuclear alterations, decrease in the hematopoietic cells), and liver (e.g., hypertrophy, karyorrhexis, and karyopyknosis). An index of branchial lesion was proposed to standardize gill lesions to different pollutants.

  17. Why the short face? Developmental disintegration of the neurocranium drives convergent evolution in neotropical electric fishes. (United States)

    Evans, Kory M; Waltz, Brandon; Tagliacollo, Victor; Chakrabarty, Prosanta; Albert, James S


    Convergent evolution is widely viewed as strong evidence for the influence of natural selection on the origin of phenotypic design. However, the emerging evo-devo synthesis has highlighted other processes that may bias and direct phenotypic evolution in the presence of environmental and genetic variation. Developmental biases on the production of phenotypic variation may channel the evolution of convergent forms by limiting the range of phenotypes produced during ontogeny. Here, we study the evolution and convergence of brachycephalic and dolichocephalic skull shapes among 133 species of Neotropical electric fishes (Gymnotiformes: Teleostei) and identify potential developmental biases on phenotypic evolution. We plot the ontogenetic trajectories of neurocranial phenotypes in 17 species and document developmental modularity between the face and braincase regions of the skull. We recover a significant relationship between developmental covariation and relative skull length and a significant relationship between developmental covariation and ontogenetic disparity. We demonstrate that modularity and integration bias the production of phenotypes along the brachycephalic and dolichocephalic skull axis and contribute to multiple, independent evolutionary transformations to highly brachycephalic and dolichocephalic skull morphologies.

  18. The influence of magnetic field on the spatial orientation in zebrafish Danio rerio (Hamilton and roach Rutilus rutilus (L.

    Directory of Open Access Journals (Sweden)

    Anastasia A. Batrakova


    Full Text Available Known, that some teleostei can perceive the geomagnetic field (GMF. However, the information about magnetosensitivity in Cyprinidae fish from artificial and natural habitats is obscure. We have registered preferred directions in Danio rerio (Hamilton from aquaria-cultivated line exposed to the natural GMF, 180 degrees reversal of horizontal GMF component, 180 degrees reversal of vertical GMF component, 180 degrees reversal of both vertical and horizontal GMF components and 90 degrees clockwise turn of horizontal GMF component. We also registered the preferred directions in Rutilus rutilus (L. from Rybinsk reservoir exposed to the natural GMF and 90 degrees clockwise turn of horizontal GMF component. It was found that zebrafish prefer two opposite directions towards east and west in the natural GMF. When the horizontal component of GMF was turned 90 degrees clockwise D. rerio prefer two opposite directions towards north and south. The possible reason of bimodality in zebrafish’s preferred directions distributions is discussed. The only direction towards east-north-east observed in roach under the natural GMF. This direction coincided with the way from the place of capture to the streamflow part of Rybinsk reservoir. And it was changed by south-south-east direction when turned the horizontal component of GMF 90 degrees clockwise. The possible reason of the choosing directions by fish with GMF is discussed.

  19. The role of brain peptides in the reproduction of blue gourami males (Trichogaster trichopterus). (United States)

    Levy, Gal; Degani, Gad


    In all vertebrates, reproduction and growth are closely linked and both are controlled by complex hormonal interactions at the brain-pituitary level. In this study, we focused on the reciprocal interactions between brain peptides that regulate growth and reproductive functions in a teleostei fish (blue gourami Trichogaster trichopterus). An increase in gonadotropin-releasing hormone 1 (GnRH1) gene expression was detected during ontogeny, and this peptide increased growth hormone (GH) and β follicle-stimulating hormone (βFSH) gene expression in pituitary cell culture. However, although no change in gonadotropin-releasing hormone 2 (GnRH2) gene expression during the reproductive cycle or sexual behavior was detected, a stimulatory effect of this peptide on β gonadotropins (βGtH) gene expression was observed. In addition, pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) inhibited GnRH-analog-induced βFSH gene expression, and co-treatment of cells with GnRH-analog and PACAP-38 inhibited GnRH-analog-stimulatory and PACAP-38-inhibitory effects on GH gene expression. These findings together with previous studies were used to create a model summarizing the mechanism of brain peptides (GnRH, PACAP and its related peptide) and the relationship to reproduction and growth through pituitary hormone gene expression during ontogenesis and reproductive stages in blue gourami. © 2013 Wiley Periodicals, Inc.

  20. Effects of acute and chronic exposition on larvae of pejerrey Odontesthes Argentinensis to water soluble fraction (WSF) of crude oil

    Energy Technology Data Exchange (ETDEWEB)

    Gusmao, Emeline P.; Rodrigues, Ricardo V.; Moreira, Caue B.; Seyffert, Bianca; Ignacio, Gabriela; Fillmann, Gilberto; Sampaio, Luis A.; Miranda-Filho, Kleber C. [Fundacao Universidade do Rio Grande (FURG), RS (Brazil)


    Petroleum is considered one of the greatest marine water pollutants, but there have been few studies on the impact of oil on biota. The water-soluble fraction (WSF) of a crude oil contains a mixture of polycyclic aromatic hydrocarbons (PAHs), phenols and heterocyclic compounds. Marine 'pejerrey' Odontesthes argentinensis (Teleostei: Atherinopsidae) is a important commercial species in Brazilian southern region and has great potential for mariculture. The aim of this study was to investigate the lethal and sub-lethal effects of the WSF crude oil exposition on the early life stages of O. argentinensis using acute (96 hours) and chronic (21 days) toxicity tests. Water-soluble fraction of heavy crude oil was prepared using a ratio of one part crude oil to nine parts filtered seawater and mixing for 24 h. Newly hatched larvae and 17 days old larvae were used for the tests, respectively. According to the results, median lethal concentration (LC50) was estimated in 55.0% of the WSF and safe level was estimated in 5.5% of WSF. These data can be used as a tool in environmental conservation studies. Heavy crude oil WSF presented total PAHs of 197.83 ng/mL and total BTEX of 106.1 {mu}g/L. (author)