
Sample records for anemone fulgens

  1. Anemone (United States)

    Hao, Da-Cheng; Gu, Xiaojie; Xiao, Peigen


    The Ranunculaceae genus Anemone (order Ranunculales), comprising more than 150 species, mostly herbs, has long been used in folk medicine and worldwide ethnomedicine. Various medicinal compounds have been found in Anemone plants, especially triterpenoid saponins, some of which have shown anti-cancer activities. Some Anemone compounds and extracts display immunomodulatory, anti-inflammatory, antioxidant, and antimicrobial activities. More than 50 species have ethnopharmacological uses, which provide clues for modern drug discovery. Anemone compounds exert anticancer and other bioactivities via multiple pathways. However, a comprehensive review of the Anemone medicinal resources is lacking. We here summarize the ethnomedical knowledge and recent progress on the chemical and pharmacological diversity of Anemone medicinal plants, as well as the emerging molecular mechanisms and functions of these medicinal compounds. The phylogenetic relationships of Anemone species were reconstructed based on nuclear ITS and chloroplast markers. The molecular phylogeny is largely congruent with the morphology-based classification. Commonly used medicinal herbs are distributed in each subgenus and section, and chemical and biological studies of more unexplored taxa are warranted. Gene expression profiling and relevant "omics" platforms could reveal differential effects of phytometabolites. Genomics, transcriptomics, proteomics, and metabolomics should be highlighted in deciphering novel therapeutic mechanisms and utilities of Anemone phytometabolites.

  2. Amdoparvovirus Infection in Red Pandas ( Ailurus fulgens). (United States)

    Alex, Charles E; Kubiski, Steven V; Li, Linlin; Sadeghi, Mohammadreza; Wack, Raymund F; McCarthy, Megan A; Pesavento, Joseph B; Delwart, Eric; Pesavento, Patricia A


    Aleutian mink disease virus is the type species in the genus Amdoparvovirus, and in mink and other Mustelidae can cause either subclinical disease or fatal chronic immune stimulation and immune complex disease. The authors describe a novel amdoparvovirus in the endangered red panda ( Ailurus fulgens), discovered using viral metagenomics. The authors analyzed the prevalence, tissue distribution, and disease association by PCR, in situ hybridization, electron microscopy, and histology in a group of 6 red pandas from a single zoological collection. The study incorporates a fecal shedding survey and analysis of tissues from 4 necropsied animals over a 12-year span. The tentatively named red panda amdoparvovirus (RpAPV) was detected in the feces and/or tissues of all animals tested. At necropsy of 1 geriatric animal, infection was associated with pyogranulomatous peritonitis, pancreatitis, and myocarditis. Other animals had detectable low-level viral nucleic acid in lymph nodes and both oral and intestinal epithelium at the time of necropsy. Full-length genome sequences of RpAPV strains from 2 animals had 12% sequence divergence, demonstrating genetic diversity even among in-contact animals. RpAPV is a persistent infection in this cohort of red pandas, and has variable clinical expression.

  3. Anemone medicinal plants: ethnopharmacology, phytochemistry and biology

    Directory of Open Access Journals (Sweden)

    Da-Cheng Hao


    Full Text Available The Ranunculaceae genus Anemone (order Ranunculales, comprising more than 150 species, mostly herbs, has long been used in folk medicine and worldwide ethnomedicine. Various medicinal compounds have been found in Anemone plants, especially triterpenoid saponins, some of which have shown anti-cancer activities. Some Anemone compounds and extracts display immunomodulatory, anti-inflammatory, antioxidant, and antimicrobial activities. More than 50 species have ethnopharmacological uses, which provide clues for modern drug discovery. Anemone compounds exert anticancer and other bioactivities via multiple pathways. However, a comprehensive review of the Anemone medicinal resources is lacking. We here summarize the ethnomedical knowledge and recent progress on the chemical and pharmacological diversity of Anemone medicinal plants, as well as the emerging molecular mechanisms and functions of these medicinal compounds. The phylogenetic relationships of Anemone species were reconstructed based on nuclear ITS and chloroplast markers. The molecular phylogeny is largely congruent with the morphology-based classification. Commonly used medicinal herbs are distributed in each subgenus and section, and chemical and biological studies of more unexplored taxa are warranted. Gene expression profiling and relevant “omics” platforms could reveal differential effects of phytometabolites. Genomics, transcriptomics, proteomics, and metabolomics should be highlighted in deciphering novel therapeutic mechanisms and utilities of Anemone phytometabolites.

  4. Genetic assessment of captive red panda (Ailurus fulgens) population


    Kumar, Arun; Rai, Upashna; Roka, Bhupen; Jha, Alankar K.; Reddy, P. Anuradha


    Red panda (Ailurus fulgens) is threatened across its range by detrimental human activities and rapid habitat changes necessitating captive breeding programs in various zoos globally to save this flagship species from extinction. One of the ultimate aims of ex situ conservation is reintroduction of endangered animals into their natural habitats while maintaining 90?% of the founder genetic diversity. Advances in molecular genetics and microsatellite genotyping techniques make it possible to ac...

  5. Survival of sea anemones in Bunder C fuel

    Energy Technology Data Exchange (ETDEWEB)

    Wicksten, M.K.


    Sea anemones (Anthopleura elegantissima) can withstand submersion in Bunker C fuel oil for up to 1 h without visible adverse effects. The wet, mucus-covered tissues of the sea anemones may repel oil. During recovery, the sea anemones expand the column, evert the tentacles and reattach. A dahlia anemone (Tealia lofotensis) withstood immersion in oil for 15 min. The ability to withstand immersion in oil may confer an ecological advantage to sea anemones in contaminated areas. 5 references, 8 figures, 1 tables.

  6. Non-invasive monitoring of reproductive and stress hormones in the endangered red panda (Ailurus fulgens fulgens). (United States)

    Beaulah Budithi, Neema Raja; Kumar, Vinod; Yalla, Suneel Kumar; Rai, Upashna; Umapathy, Govindhaswamy


    The red panda (Ailurus fulgens fulgens) is classified as endangered due to its declining population, habitat fragmentation and poaching. Efforts are being made to breed them in captivity as part of nationwide conservation breeding program. This study aimed to standardize Enzyme immunoassays (EIAs) to monitor reproductive (Progesterone metabolite, Testosterone) and stress hormone (Cortisol) in red panda. For this purpose, we collected 1471 faecal samples from four females and one male over a period of one year from Padmaja Naidu Himalayan Zoological Park, Darjeeling, India. HPLC confirmed the presence of immunoreactive 5α-pregnan-3α-ol-20-one, testosterone and cortisol metabolites in faecal samples. Using 5α-pregnan-3α-ol-20-one EIA, we were able to monitor reproduction and detect pregnancy in one of the females, which successfully conceived and delivered during the study period. We were also able to monitor testosterone and cortisol in faecal samples of the red panda. Faecal testosterone levels were found in higher concentration in breeding season than in non-breeding season. Faecal cortisol concentrations showed a negative relationship with ambient temperature and peaked during winter months in all animals. Standardization of EIAs and faecal hormone monitoring would facilitate red panda conservation breeding programs in India and elsewhere. Copyright © 2016 Elsevier B.V. All rights reserved.


    Makungu, Modesta; du Plessis, Wencke M; Barrows, Michelle; Groenewald, Hermanus B; Koeppel, Katja N


    The red panda ( Ailurus fulgens) is classified as an endangered species by the International Union for Conservation of Nature and Natural Resources. The aim of this study was to describe the normal radiographic abdominal anatomy in red pandas to provide guidance for clinical use. Radiography of the abdomen was performed in nine captive red pandas during their annual health examinations. Seven of nine animals had six lumbar vertebrae. The sacrum consisted mainly (8/9) of three fused segments. Hypaxial muscles were easily seen in animals weighing 5 kg and above. The pylorus was located to the right of the midline and cranially to the fundus in 8/9 individuals. Bunching of small intestine in the right central abdomen occurred in animals weighing 6 kg and above. The spleen was prominent. Knowledge of the normal radiographic abdominal anatomy of red pandas is important in the diagnosis of diseases and in routine health examinations.

  8. Genetic assessment of captive red panda (Ailurus fulgens) population. (United States)

    Kumar, Arun; Rai, Upashna; Roka, Bhupen; Jha, Alankar K; Reddy, P Anuradha


    Red panda (Ailurus fulgens) is threatened across its range by detrimental human activities and rapid habitat changes necessitating captive breeding programs in various zoos globally to save this flagship species from extinction. One of the ultimate aims of ex situ conservation is reintroduction of endangered animals into their natural habitats while maintaining 90 % of the founder genetic diversity. Advances in molecular genetics and microsatellite genotyping techniques make it possible to accurately estimate genetic diversity of captive animals of unknown ancestry. Here we assess genetic diversity of the red panda population in Padmaja Naidu Himalayan Zoological Park, Darjeeling, which plays a pivotal role in ex situ conservation of red panda in India. We generated microsatellite genotypes of fifteen red pandas with a set of fourteen loci. This population is genetically diverse with 68 % observed heterozygosity (H O ) and mean inbreeding (F IS ) coefficient of 0.05. However population viability analysis reveals that this population has a very low survival probability (<2 %) and will rapidly loose its genetic diversity to 37 % mainly due to small population size and skewed male-biased sex ratio. Regular supplementation with a pair of adult individuals every five years will increase survival probability and genetic diversity to 99 and 61 % respectively and will also support future harvesting of individuals for reintroduction into the wild and exchange with other zoos.

  9. Beheersing en bestrijding van Botrytis cinerea en van Penicillium in Euphorbia fulgens

    NARCIS (Netherlands)

    Wubben, J.P.; Hazendonk, A.; Bosker, I.; Slootweg, C.; Hoope, ten M.


    De bloeiwijze van Euphorbia fulgens kent twee belangrijke schimmelbelagers, die problemen in de teelt veroorzaken: Botrytis cinerea en Penicillium. B. cinerea geeft schade in de vorm van smet of pokken, die op de bloemblaadjes verschijnen. Dit zijn kleine donkerbruine/zwarte plekjes van ongeveer 1

  10. Sources of nutrition in intertidal sea anemones from the south ...

    African Journals Online (AJOL)


    Mar 6, 1996 ... input of energy (Tytler & Spencer Davies 1984). In nutrient- poor tropical environments these zooxanthellae often supply. 100% or more of the host's daily metabolic carbon require- ments (Tsuchida & Potts 1994). In temperate regions, how- ever, anemones rely more on captured prey. Sea anemones.


    Makungu, Modesta; du Plessis, Wencke M; Barrows, Michelle; Groenewald, Hermanus B; Koeppel, Katja N


    The red panda ( Ailurus fulgens ) is classified as an endangered species by the International Union for Conservation of Nature and Natural Resources. The natural distribution of the red panda is in the Himalayas and southern China. Thoracic diseases such as dirofilariasis, hypertrophic cardiomyopathy, tracheal obstruction, lung worm infestation, and pneumonia have been reported in the red panda. The aim of this study was to describe the normal radiographic thoracic anatomy of captive red pandas as a species-specific reference for routine health examinations and clinical cases. Right lateral (RL) and dorsoventral (DV) inspiratory phase views of the thorax were obtained in 11 adult captive red pandas. Measurements were made and ratios calculated to establish reference ranges for the mean vertebral heart score on the RL (8.34 ± 0.25) and DV (8.78 ± 0.34) views and the mean ratios of the caudal vena cava diameter to the vertebral body length above tracheal bifurcation (0.67 ± 0.05) and tracheal diameter to the width of the third rib (2.75 ± 0.24). The majority of animals (10/11) had 14 thoracic vertebrae, except for one animal that had 15 thoracic vertebrae. Rudimentary clavicles were seen in 3/11 animals. The ovoid, oblique cardiac silhouette was more horizontally positioned and elongated in older animals. A redundant aortic arch was seen in the oldest animal. The trachea was seen with mineralized cartilage rings in all animals. The carina was clearly seen in the majority of animals (10/11). Variations exist in the normal radiographic thoracic anatomy of different species. Knowledge of the normal radiographic thoracic anatomy of the red panda should prove useful for routine health examinations and in the diagnosis of thoracic diseases.

  12. Boxer crabs induce asexual reproduction of their associated sea anemones by splitting and intraspecific theft. (United States)

    Schnytzer, Yisrael; Giman, Yaniv; Karplus, Ilan; Achituv, Yair


    Crabs of the genus Lybia have the remarkable habit of holding a sea anemone in each of their claws. This partnership appears to be obligate, at least on the part of the crab. The present study focuses on Lybia leptochelis from the Red Sea holding anemones of the genus Alicia (family Aliciidae). These anemones have not been found free living, only in association with L. leptochelis . In an attempt to understand how the crabs acquire them, we conducted a series of behavioral experiments and molecular analyses. Laboratory observations showed that the removal of one anemone from a crab induces a "splitting" behavior, whereby the crab tears the remaining anemone into two similar parts, resulting in a complete anemone in each claw after regeneration. Furthermore, when two crabs, one holding anemones and one lacking them, are confronted, the crabs fight, almost always leading to the "theft" of a complete anemone or anemone fragment by the crab without them. Following this, crabs "split" their lone anemone into two. Individuals of Alicia sp. removed from freshly collected L. leptochelis were used for DNA analysis. By employing AFLP (Fluorescence Amplified Fragments Length Polymorphism) it was shown that each pair of anemones from a given crab is genetically identical. Furthermore, there is genetic identity between most pairs of anemone held by different crabs, with the others showing slight genetic differences. This is a unique case in which one animal induces asexual reproduction of another, consequently also affecting its genetic diversity.

  13. Boxer crabs induce asexual reproduction of their associated sea anemones by splitting and intraspecific theft

    Directory of Open Access Journals (Sweden)

    Yisrael Schnytzer


    Full Text Available Crabs of the genus Lybia have the remarkable habit of holding a sea anemone in each of their claws. This partnership appears to be obligate, at least on the part of the crab. The present study focuses on Lybia leptochelis from the Red Sea holding anemones of the genus Alicia (family Aliciidae. These anemones have not been found free living, only in association with L. leptochelis. In an attempt to understand how the crabs acquire them, we conducted a series of behavioral experiments and molecular analyses. Laboratory observations showed that the removal of one anemone from a crab induces a “splitting” behavior, whereby the crab tears the remaining anemone into two similar parts, resulting in a complete anemone in each claw after regeneration. Furthermore, when two crabs, one holding anemones and one lacking them, are confronted, the crabs fight, almost always leading to the “theft” of a complete anemone or anemone fragment by the crab without them. Following this, crabs “split” their lone anemone into two. Individuals of Alicia sp. removed from freshly collected L. leptochelis were used for DNA analysis. By employing AFLP (Fluorescence Amplified Fragments Length Polymorphism it was shown that each pair of anemones from a given crab is genetically identical. Furthermore, there is genetic identity between most pairs of anemone held by different crabs, with the others showing slight genetic differences. This is a unique case in which one animal induces asexual reproduction of another, consequently also affecting its genetic diversity.

  14. Sea Anemones: Quiet Achievers in the Field of Peptide Toxins

    Directory of Open Access Journals (Sweden)

    Peter J. Prentis


    Full Text Available Sea anemones have been understudied as a source of peptide and protein toxins, with relatively few examined as a source of new pharmacological tools or therapeutic leads. This is surprising given the success of some anemone peptides that have been tested, such as the potassium channel blocker from Stichodactyla helianthus known as ShK. An analogue of this peptide, ShK-186, which is now known as dalazatide, has successfully completed Phase 1 clinical trials and is about to enter Phase 2 trials for the treatment of autoimmune diseases. One of the impediments to the exploitation of sea anemone toxins in the pharmaceutical industry has been the difficulty associated with their high-throughput discovery and isolation. Recent developments in multiple ‘omic’ technologies, including genomics, transcriptomics and proteomics, coupled with advanced bioinformatics, have opened the way for large-scale discovery of novel sea anemone toxins from a range of species. Many of these toxins will be useful pharmacological tools and some will hopefully prove to be valuable therapeutic leads.

  15. First observations of attempted nudibranch predation by sea anemones

    NARCIS (Netherlands)

    Meij, van der S.E.T.; Reijnen, B.T.


    On two separate occasions during fieldwork in Semporna (eastern Sabah, Malaysia), sea anemones of the family Edwardsiidae were observed attempting to feed on the nudibranch species Nembrotha lineolata and Phyllidia ocellata. These are the first in situ observations of nudibranch predation by sea

  16. Transmission of a heterologous clade C Symbiodinium in a model anemone infection system via asexual reproduction

    Directory of Open Access Journals (Sweden)

    Wan-Nan U. Chen


    Full Text Available Anemones of genus Exaiptasia are used as model organisms for the study of cnidarian-dinoflagellate (genus Symbiodinium endosymbiosis. However, while most reef-building corals harbor Symbiodinium of clade C, Exaiptasia spp. anemones mainly harbor clade B Symbiodinium (ITS2 type B1 populations. In this study, we reveal for the first time that bleached Exaiptasia pallida anemones can establish a symbiotic relationship with a clade C Symbiodinium (ITS2 type C1. We further found that anemones can transmit the exogenously supplied clade C Symbiodinium cells to their offspring by asexual reproduction (pedal laceration. In order to corroborate the establishment of stable symbiosis, we used microscopic techniques and genetic analyses to examine several generations of anemones, and the results of these endeavors confirmed the sustainability of the system. These findings provide a framework for understanding the differences in infection dynamics between homologous and heterologous dinoflagellate types using a model anemone infection system.

  17. Juvenile Thalassoma amblycephalum Bleeker (Labridae, Teleostei) dwelling among the tentacles of sea anemones

    DEFF Research Database (Denmark)

    Arvedlund, Michael; Iwao, Kenji; Brolund, Thea Marie


    each) of the juvenile wrasse Thalassoma amblycephalum dwelling among the tentacles of the two sea anemones Entacmaea quadricolor (clonal type), and Heteractis magnifica at a coral reef in southern Japan during 16 months in daylight hours. There are only two past records of this facultative association....... amblycephalum dwelling among the tentacles of sea anemones are cleanerfish with an unusual client, in that they appear to clean mucus and, or, necrotic tissue from the sea anemone host....

  18. Sea anemone Radianthus macrodactylus--a new source of palytoxin. (United States)

    Mahnir, V M; Kozlovskaya, E P; Kalinovsky, A I


    A very potent non-protein toxin was isolated from the sea anemone Radianthus macrodactylus with the use of chromatography on polytetrafluoroethylene, CM-Sephadex C-25 and by cation and anion exchange HPLC. The toxin was identified as palytoxin by u.v.-, i.r.- and 500 MHz 1H NMR spectroscopy. Its LD50 was 0.74 +/- 0.29 micrograms/kg by i.v. injection into mice. So far, palytoxin has been associated with zoanthids only. The toxin caused the loss of haemoglobin from erythrocytes but only in about 2 hr after the beginning of incubation, which is characteristic for palytoxin from zoanthids. Sea anemone palytoxin was divided into major and minor components by HPLC. The latter proved to be a product of degradation of palytoxin.

  19. Nutrient enrichment coupled with sedimentation favors sea anemones over corals.

    Directory of Open Access Journals (Sweden)

    Pi-Jen Liu

    Full Text Available Fine sediments, which account for the majority of total fluvial sediment flux, have been suggested to degrade coral reefs on a global scale. Furthermore, sediment impacts can be exacerbated by extreme rainfall events associated with global climate change and anthropogenic nutrient enrichment. We report the findings from a series of mesocosm experiments exploring the effects of short-term sedimentation and nutrient enrichment on the interactions between the hard coral Acropora muricata, the sea anemone Mesactinia ganesis, and the green macroalga Codium edule. Mesocosms were manipulated to simulate either unimpacted reefs or reefs exposed to elevated levels of fine sediments for 10 or 14 days to simulate the effects of heavy rainfall. The first and second experiments were aimed to examine the effects of inorganic and organic sediments, respectively. The third experiment was designed to examine the interactive effects of nutrient enrichment and elevated sediment loads. Neither inorganic nor organic sediment loadings significantly affected the physiological performance of the coral, but, importantly, did reduce its ability to compete with other organisms. Photosynthetic efficiencies of both the green macroalga and the sea anemone increased in response to both sediment loadings when they were simultaneously exposed to nutrient enrichment. While organic sediment loading increased the nitrogen content of the green macroalga in the first experiment, inorganic sediment loading increased its phosphorus content in the second experiment. The coral mortality due to sea anemones attack was significantly greater upon exposure to enriched levels of organic sediments and nutrients. Our findings suggest that the combined effects of short-term sedimentation and nutrient enrichment could cause replacement of corals by sea anemones on certain coral reefs.

  20. Sea Anemone (Cnidaria, Anthozoa, Actiniaria Toxins: An Overview

    Directory of Open Access Journals (Sweden)

    Agostinho Antunes


    Full Text Available The Cnidaria phylum includes organisms that are among the most venomous animals. The Anthozoa class includes sea anemones, hard corals, soft corals and sea pens. The composition of cnidarian venoms is not known in detail, but they appear to contain a variety of compounds. Currently around 250 of those compounds have been identified (peptides, proteins, enzymes and proteinase inhibitors and non-proteinaceous substances (purines, quaternary ammonium compounds, biogenic amines and betaines, but very few genes encoding toxins were described and only a few related protein three-dimensional structures are available. Toxins are used for prey acquisition, but also to deter potential predators (with neurotoxicity and cardiotoxicity effects and even to fight territorial disputes. Cnidaria toxins have been identified on the nematocysts located on the tentacles, acrorhagi and acontia, and in the mucous coat that covers the animal body. Sea anemone toxins comprise mainly proteins and peptides that are cytolytic or neurotoxic with its potency varying with the structure and site of action and are efficient in targeting different animals, such as insects, crustaceans and vertebrates. Sea anemones toxins include voltage-gated Na+ and K+ channels toxins, acid-sensing ion channel toxins, Cytolysins, toxins with Kunitz-type protease inhibitors activity and toxins with Phospholipase A2 activity. In this review we assessed the phylogentic relationships of sea anemone toxins, characterized such toxins, the genes encoding them and the toxins three-dimensional structures, further providing a state-of-the-art description of the procedures involved in the isolation and purification of bioactive toxins.

  1. Effects of livestock on occurrence of the Vulnerable red panda Ailurus fulgens in Rara National Park, Nepal


    Sharma, Hari Prasad; Belant, Jerrold L.; Swenson, Jon


    The Vulnerable red panda Ailurus fulgens is endemic to the Himalayas. Anthropogenic activities, including deforestation, have degraded the species’ habitat but the effects of livestock have not been examined. We assessed the effects of illegal livestock activity on the presence of the red panda in Rara National Park, Nepal. The probability of detecting red panda faecal pellets decreased with livestock occurrence but not with elevation or aspect. The presence of bamboo ...

  2. Parasitic anemone infects the invasive ctenophore Mnemiopsis leidyi in the North East Atlantic

    DEFF Research Database (Denmark)

    Selander, Erik; Møller, Lene Friis; Sundberg, Per


    We report of the first finding of parasitic sea anemone larvae infecting the invasive ctenophore Mnemiopsis leidyi in the North East Atlantic. Parasitic anemone larvae are common in the native habitat of Mnemiopsis, but have not previously been reported from any of the locations where Mnemiopsis...

  3. Predation on transmission stages reduces parasitism: sea anemones consume transmission stages of a barnacle parasite. (United States)

    Fong, Caitlin R; Kuris, Armand M


    While parasites serve as prey, it is unclear how the spatial distribution of parasite predators provides transmission control and influences patterns of parasitism. Because many of its organisms are sessile, the rocky intertidal zone is a valuable but little used system to understand spatial patterns of parasitism and elucidate the underlying mechanisms driving these patterns. Sea anemones and barnacles are important space competitors in the rocky intertidal zone along the Pacific coast of North America. Anemones are voracious, indiscriminate predators; thus, they may intercept infectious stages of parasites before they reach a host. We investigate whether a sea anemone protects an associated barnacle from parasitism by Hemioniscus balani, an isopod parasitic castrator. At Coal Oil Point, Santa Barbara, California USA, 29% of barnacles were within 1 cm from an anemone at the surveyed tidal height. Barnacles associated with anemones had reduced parasite prevalence and higher reproductive productivity than those remote from sea anemones. In the laboratory, anemones readily consumed the transmission stage of the parasite. Hence, anemone consumption of parasite transmission stages may provide a mechanism by which community context regulates parasite prevalence at a local scale. Our results suggest predation may be an important process providing parasite transmission control.

  4. First record of the sea anemone Metridium senile from South Africa

    African Journals Online (AJOL)

    oral discs fringed by abundant, feathery tentacles - features inconsistent with any previously known anemone from the region. We subsequently photographed and collected several individuals from the Alfred Basin. Fully extended anemones were salmon pink in colour, with a column approximately. 100 mm in height and ...

  5. Reinterpretation of some tentacular structures in actinodendronid and thalassianthid sea anemones (Cnidaria: Actiniaria)

    NARCIS (Netherlands)

    Ardelean, A.


    The oral disc of an actinodendronid sea anemone is drawn out into a variable number of highly branched tentacular structures that make the anemone resemble a tree. These tentacular structures have been considered either lobes or branched tentacles. The term lobe has been applied to various

  6. Taxonomic, Spatial and Temporal Patterns of Bleaching in Anemones Inhabited by Anemonefishes

    KAUST Repository

    Hobbs, Jean-Paul A.


    Background:Rising sea temperatures are causing significant destruction to coral reef ecosystems due to coral mortality from thermally-induced bleaching (loss of symbiotic algae and/or their photosynthetic pigments). Although bleaching has been intensively studied in corals, little is known about the causes and consequences of bleaching in other tropical symbiotic organisms.Methodology/Principal Findings:This study used underwater visual surveys to investigate bleaching in the 10 species of anemones that host anemonefishes. Bleaching was confirmed in seven anemone species (with anecdotal reports of bleaching in the other three species) at 10 of 19 survey locations spanning the Indo-Pacific and Red Sea, indicating that anemone bleaching is taxonomically and geographically widespread. In total, bleaching was observed in 490 of the 13,896 surveyed anemones (3.5%); however, this percentage was much higher (19-100%) during five major bleaching events that were associated with periods of elevated water temperatures and coral bleaching. There was considerable spatial variation in anemone bleaching during most of these events, suggesting that certain sites and deeper waters might act as refuges. Susceptibility to bleaching varied between species, and in some species, bleaching caused reductions in size and abundance.Conclusions/Significance:Anemones are long-lived with low natural mortality, which makes them particularly vulnerable to predicted increases in severity and frequency of bleaching events. Population viability will be severely compromised if anemones and their symbionts cannot acclimate or adapt to rising sea temperatures. Anemone bleaching also has negative effects to other species, particularly those that have an obligate relationship with anemones. These effects include reductions in abundance and reproductive output of anemonefishes. Therefore, the future of these iconic and commercially valuable coral reef fishes is inextricably linked to the ability of host

  7. Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis

    Directory of Open Access Journals (Sweden)

    Deleury Emeline


    Full Text Available Abstract Background Coral reef ecosystems are renowned for their diversity and beauty. Their immense ecological success is due to a symbiotic association between cnidarian hosts and unicellular dinoflagellate algae, known as zooxanthellae. These algae are photosynthetic and the cnidarian-zooxanthellae association is based on nutritional exchanges. Maintenance of such an intimate cellular partnership involves many crosstalks between the partners. To better characterize symbiotic relationships between a cnidarian host and its dinoflagellate symbionts, we conducted a large-scale EST study on a symbiotic sea anemone, Anemonia viridis, in which the two tissue layers (epiderm and gastroderm can be easily separated. Results A single cDNA library was constructed from symbiotic tissue of sea anemones A. viridis in various environmental conditions (both normal and stressed. We generated 39,939 high quality ESTs, which were assembled into 14,504 unique sequences (UniSeqs. Sequences were analysed and sorted according to their putative origin (animal, algal or bacterial. We identified many new repeated elements in the 3'UTR of most animal genes, suggesting that these elements potentially have a biological role, especially with respect to gene expression regulation. We identified genes of animal origin that have no homolog in the non-symbiotic starlet sea anemone Nematostella vectensis genome, but in other symbiotic cnidarians, and may therefore be involved in the symbiosis relationship in A. viridis. Comparison of protein domain occurrence in A. viridis with that in N. vectensis demonstrated an increase in abundance of some molecular functions, such as protein binding or antioxidant activity, suggesting that these functions are essential for the symbiotic state and may be specific adaptations. Conclusion This large dataset of sequences provides a valuable resource for future studies on symbiotic interactions in Cnidaria. The comparison with the closest

  8. Thoracic limb morphology of the red panda (Ailurus fulgens evidenced by osteology and radiography

    Directory of Open Access Journals (Sweden)

    Modesta Makungu


    Full Text Available The red panda (Ailurus fulgens is distributed primarily in the Himalayas and southern China. It is classified as a vulnerable species by the International Union for Conservation of Nature. The aim of this study was to describe the normal osteology and radiographic anatomy of the thoracic limb of the red panda. Radiography of the right thoracic limb was performed in seven captive adult red pandas. Radiographic findings were correlated with bone specimens from three adult animals. The scapula was wide craniocaudally and presented with a large area for the origin of the teres major muscle. The square-shaped major tubercle did not extend proximal to the head of the humerus. The medial epicondyle was prominent. A supracondylar foramen was present. The radial tuberosity and sesamoid bone for the abductor digiti I longus were prominent. The accessory carpal bone was directed palmarolaterally. Metacarpal bones were widely spread. The thoracic limb morphology of the red panda evidenced by osteology and radiography indicated flexibility of the thoracic limb joints and well-developed flexor and supinator muscles, which are important in arboreal quadrupedal locomotion. Knowledge gained during this study may prove useful in identifying skeletal material or remains and diagnosing musculoskeletal diseases and injuries of the thoracic limb.

  9. Thoracic limb morphology of the red panda (Ailurus fulgens evidenced by osteology and radiography

    Directory of Open Access Journals (Sweden)

    Modesta Makungu


    Full Text Available The red panda (Ailurus fulgens is distributed primarily in the Himalayas and southern China. It is classified as a vulnerable species by the International Union for Conservation of Nature. The aim of this study was to describe the normal osteology and radiographic anatomy of the thoracic limb of the red panda. Radiography of the right thoracic limb was performed in seven captive adult red pandas. Radiographic findings were correlated with bone specimens from three adult animals. The scapula was wide craniocaudally and presented with a large area for the origin of the teres major muscle. The square-shaped major tubercle did not extend proximal to the head of the humerus. The medial epicondyle was prominent. A supracondylar foramen was present. The radial tuberosity and sesamoid bone for the abductor digiti I longus were prominent. The accessory carpal bone was directed palmarolaterally. Metacarpal bones were widely spread. The thoracic limb morphology of the red panda evidenced by osteology and radiography indicated flexibility of the thoracic limb joints and well-developed flexor and supinator muscles, which are important in arboreal quadrupedal locomotion. Knowledge gained during this study may prove useful in identifying skeletal material or remains and diagnosing musculoskeletal diseases and injuries of the thoracic limb.

  10. Thoracic limb morphology of the red panda (Ailurus fulgens) evidenced by osteology and radiography. (United States)

    Makungu, Modesta; Groenewald, Hermanus B; Du Plessis, Wencke M; Barrows, Michelle; Koeppel, Katja N


    The red panda (Ailurus fulgens) is distributed primarily in the Himalayas and southern China. It is classified as a vulnerable species by the International Union for Conservation of Nature. The aim of this study was to describe the normal osteology and radiographic anatomy of the thoracic limb of the red panda. Radiography of the right thoracic limb was performed in seven captive adult red pandas. Radiographic findings were correlated with bone specimens from three adult animals. The scapula was wide craniocaudally and presented with a large area for the origin of the teres major muscle. The square-shaped major tubercle did not extend proximal to the head of the humerus. The medial epicondyle was prominent. A supracondylar foramen was present. The radial tuberosity and sesamoid bone for the abductor digiti I longus were prominent. The accessory carpal bone was directed palmarolaterally. Metacarpal bones were widely spread. The thoracic limb morphology of the red panda evidenced by osteology and radiography indicated flexibility of the thoracic limb joints and well-developed flexor and supinator muscles, which are important in arboreal quadrupedal locomotion. Knowledge gained during this study may prove useful in identifying skeletal material or remains and diagnosing musculoskeletal diseases and injuries of the thoracic limb.

  11. Evaluation of safety and protective effects of Potentilla fulgens root extract in experimentally induced diarrhoea in mice

    Directory of Open Access Journals (Sweden)

    V. Tangpu


    Methods: The protective effects of P. fulgens root extract was investigated against experimentally induced diarrhoea in mice, using four experimental models, i.e. measurement of faecal output, castor oil model, prostaglandin E2 (PGE2 enteropooling assay and gastrointestinal transit test. The safety assessment of root extract was done in mice on the basis of general signs and symptoms of toxicity, food water intake and mortality of animals following their treatment with various doses of extract (100 and ndash;3200 mg/kg. In addition, the serum glutamate oxaloacetate transaminase (SGOT, serum glutamate pyruvate transaminase (SGPT, cholesterol and total protein of experimental mice were also monitored to assess the toxicity of root extract. Results: In the safety assessment studies, P. fulgens root extract did not showed any visible signs of toxicity, but mortality was observed in a single animal at 3200 mg/kg dose of extract. The extract also did not showed any adverse effects on the studied serum parameters of experimental animals. In the antidiarrhoeal tests, administration of 800 mg/kg dose of extract to mice showed 50% protection from diarrhoea evoked by castor oil. In addition, the extract also showed 29.27% reduction in PGE2-induced intestinal secretion as compared to 30.31% recorded for loperamide, a standard anti-diarrhoeal drug. Conclusions: The results of this study indicate that P. fulgens root extract possesses significant anti-diarrhoeal properties. Therefore, the roots of this plant can be an effective traditional medicine for the protection from diarrhoea. [J Intercult Ethnopharmacol 2014; 3(3.000: 103-108

  12. Molecular cloning of a peptidylglycine alpha-hydroxylating monooxygenase from sea anemones

    DEFF Research Database (Denmark)

    Hauser, F; Williamson, M; Grimmelikhuijzen, C J


    conserved regions of PHM, we have now cloned a PHM from the sea anemone Calliactis parasitica showing 42% amino acid sequence identity with rat PHM. Among the conserved (identical) amino acid residues are five histidine and one methionine residue, which bind two Cu2+ atoms that are essential for PHM...... activity. No cDNA coding for PAL could be identified, suggesting that sea anemone PAL is coded for by a gene that is different from the sea anemone PHM gene, a situation similar to the one found in insects. This is the first report on the molecular cloning of a cnidarian PHM. Udgivelsesdato: 1997-Dec-18...

  13. DNA extraction from sea anemone (Cnidaria: Actiniaria tissues for molecular analyses

    Directory of Open Access Journals (Sweden)

    Pinto S.M.


    Full Text Available A specific DNA extraction method for sea anemones is described in which extraction of total DNA from eight species of sea anemones and one species of corallimorpharian was achieved by changing the standard extraction protocols. DNA extraction from sea anemone tissue is made more difficult both by the tissue consistency and the presence of symbiotic zooxanthellae. The technique described here is an efficient way to avoid problems of DNA contamination and obtain large amounts of purified and integral DNA which can be used in different kinds of molecular analyses.

  14. New records of Decapod Crustaceans (Decapoda: Pontoniinae and Inachidae associated with sea anemones in Turkish waters

    Directory of Open Access Journals (Sweden)

    Z. DURIS


    Full Text Available Three anemone-associated decapod crustaceans, two shrimp species, Periclimenes amethysteus and P. aegylios (Caridea: Palaemonidae: Pontoniinae, and the crab Inachus phalangium (Brachyura: Inachidae, all collected from the Dardanelles, are reported for the first time from Turkish coasts. Another inachid crab, Macropodia czernjawskii is also reported for the first time to occur in association with the sea anemone, Anemonia viridis. Periclimenes scriptus was the fifth decapod species recorded associated with sea anemones within the present study, and while this species has already been reported from Turkish waters, this is the first time it is recorded from the Dardanelles (the Turkish Straits System.

  15. Ring sea anemones, an overview (Cnidaria, Anthozoa, Actiniaria

    Directory of Open Access Journals (Sweden)

    Ocaña, Óscar


    Full Text Available The present observations represent a new record of species of Actiniaria that are able to attach to a gorgonian branch by surrounding it with a solid piece of tissue junction and a significant reduction of the coelenteron. Ring sea anemones are provisionally placed in the Actinostolidae. They seem to be more common at depths between 85 and 1500 m., and according to our observations they are specialized to exclusively colonize on some species of gorgonians or pennatulaceans. Parasitism best describes the relationship between ring sea anemones and their hosts. We recognize five different species of ring sea anemones, one described by Hiles (1899 as Peronanthus verrucellae, and the others named by us provisionally as Peronanthus sp1, sp2, sp3 & sp4. The strategy displayed by ring sea anemones has several advantages, such as placement economy (see above, a better attachment against any current action, exploitation of food resources inaccessible to most other Actiniarians, and it allows them avoidance of habitat competition. The impossibility to colonize any other substrate but a certain group of gorgonians and a reduction of the gastric cavity are the main disadvantages detected in the ring sea anemones’ way of life. Apparently, this group of sea anemones is widespread through the Pacific Ocean.

    Un nuevo grupo de especies de actiniarios que desarrollan un nuevo sistema para afianzarse alrededor de los ejes de gorgonias y pennatuláceos es estudiado por nosotros en el presente trabajo. Se trata de un anillo de tejido que rodea los ejes y queda perfectamente sellado por medio de uniones del tejido produciendo una reducción del celenterón. Anémonas anillo es como las hemos denominado y provisionalmente han sido incluidas dentro de la familia Actinostolidae. Parece que son comunes en profundidades comprendidas entre los 85 y los 1500 metros, colonizando solamente determinadas especies de gorgonias y de pennatuláceos. El

  16. Life history of the terrestrial snail Ovachlamys fulgens (Stylommatophora: Helicarionidae under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Zaidett Barrientos


    Full Text Available Aspects of the biology of Ovachlamys fulgens (Gude 1900 were studied under laboratory conditions in Costa Rica for 16 months. The lifespan of this snail in captivity was about nine months (N= 22 and it could lay viable eggs without mating (N= 40. Oviposition began 42 days after eclosion, when shell diameter averaged 5.12 mm (N= 24. Clutches had about three eggs each (N= 252. One clutch was laid daily over periods of one to four days, with intervals of one to two days (N= 252. Age, shell diameter and clutch size were positively correlated (N= 1097 as were shell diameter of adult, egg diameter and shell diameter of the offspring (N= 136. Oviposition took place between crevices of the soil and in the leaf litter. Eggs had a soft egg shell and were laid semi-hydrated; they hydrated by absorbing water from the surroundings (N= 21. This strategy may be the evolutionary compromise between a mechanical limitation (small body size and the advantage of producing bigger eggs with a larger amount of nutritive substances. At room temperature (mean = 21°C egg eclosion took place in 14 days (N= 67 and in 11 days at 28 °C (N= 32. Egg shell dissolution was not uniform (N= 107, it began in a local area, that usually was the side on which it rested (N= 46. The fact that eggs with and without an embryo (N= 5 underwent the same process of egg shell's calcium dissolution suggested a chemical mechanism. Embryos did not induce the process, but accelerated it. Egg viability was decreased by the tannins of the surrounding leaf litter (N= 50. Juveniles could feed on leaves of Persea americana (Lauraceae (N= 299.Durante 16 meses se estudió en laboratorio la biología básica de Ovachlamys fulgens en Costa Rica. Esta especie se reprodujo sin copular (N= 40 y su longevidad fue de nueve meses (N= 22. La oviposición inició a los 42 días de haber eclosionado y con 5.12 mm de diámetro de concha (N= 24. Los huevos fueron depositados en camadas diarias de alrededor de tres

  17. Metabolic rate of the red panda, Ailurus fulgens, a dietary bamboo specialist.

    Directory of Open Access Journals (Sweden)

    Yuxiang Fei

    Full Text Available The red panda (Ailurus fulgens has a similar diet, primarily bamboo, and shares the same habitat as the giant panda, Ailuropoda melanoleuca. There are considerable efforts underway to understand the ecology of the red panda and to increase its populations in natural reserves. Yet it is difficult to design an effective strategy for red panda reintroduction if we do not understand its basic biology. Here we report the resting metabolic rate of the red panda and find that it is higher than previously measured on animals from a zoo. The resting metabolic rate was 0.290 ml/g/h (range 0.204-0.342 in summer and 0.361 ml/g/h in winter (range 0.331-0.406, with a statistically significant difference due to season and test temperature. Temperatures in summer were probably within the thermal neutral zone for metabolism but winter temperatures were below the thermal neutral zone. There was no difference in metabolic rate between male and female red pandas and no difference due to mass. Our values for metabolic rate were much higher than those measured by McNab for 2 red pandas from a zoo. The larger sample size (17, more natural conditions at the Panda Base and improved accuracy of the metabolic instruments provided more accurate metabolism measurements. Contrary to our expectations based on their low quality bamboo diet, the metabolic rates of red pandas were similar to mammals of the same size. Based on their metabolic rates red pandas would not be limited by their food supply in natural reserves.

  18. Mitochondrial phylogeography and subspecific variation in the red panda (Ailurus fulgens): implications for conservation. (United States)

    Li, Ming; Wei, Fuwen; Goossens, Benoît; Feng, Zuojian; Tamate, Hidetoshi B; Bruford, Michael W; Funk, Stephan M


    The red panda (Ailurus fulgens) is an endangered species and its present distribution is restricted to isolated mountain ranges in western China (Sichuan, Yunnan, and Tibet provinces) and the Himalayan Mountains chain of Nepal, India, Bhutan, and Burma. To examine the evolutionary history across its current range, and to assess the genetic divergence among current subspecies and population structure among different geographic locations, we sequenced mitochondrial DNA from the control region (CR) and cytochrome (cyt) b gene for 41 individuals in Sichuan, Yunnan, Tibet of China, and Burma. 25 CR haplotypes (10 for cyt b) were identified from 11 geographic locations. Only three haplotypes were shared among sample localities, including one among current subspecies. Nine haplotypes were shared with the study of Su et al. [Mol. Biol. Evol. 18 (2001) 1070]. CR haplotype diversity was high (0.95+/-0.02) and nucleotide diversity among all haplotypes was relatively low (0.018+/-0.009). Phylogenetic confirmed trees show a shallow pattern with very little structure or statistical robustness. The application of two coalescent-based tests for population growth allowed us to interpret this phylogeny as the result of a recent population expansion. Analysis of molecular variance and nested clade analysis failed to detect significant geographic structure in both data sets. The lack of significant differentiation between subspecies does not indicate the presence of evolutionary significant units. We suggest that the present population structure has resulted from habitat fragmentation and expansion from glacial refugia. Due to its habitat requirements it is likely that the red panda has undergone bottlenecks and population expansions several times in the recent past. The present population may exhibit a pattern reminiscent of a relatively recent population expansion.

  19. Metabolic rate of the red panda, Ailurus fulgens, a dietary bamboo specialist (United States)

    Fei, Yuxiang; Hou, Rong; Paladino, Frank V.; Qi, Dunwu; Zhang, Zhihe


    The red panda (Ailurus fulgens) has a similar diet, primarily bamboo, and shares the same habitat as the giant panda, Ailuropoda melanoleuca. There are considerable efforts underway to understand the ecology of the red panda and to increase its populations in natural reserves. Yet it is difficult to design an effective strategy for red panda reintroduction if we do not understand its basic biology. Here we report the resting metabolic rate of the red panda and find that it is higher than previously measured on animals from a zoo. The resting metabolic rate was 0.290 ml/g/h (range 0.204–0.342) in summer and 0.361 ml/g/h in winter (range 0.331–0.406), with a statistically significant difference due to season and test temperature. Temperatures in summer were probably within the thermal neutral zone for metabolism but winter temperatures were below the thermal neutral zone. There was no difference in metabolic rate between male and female red pandas and no difference due to mass. Our values for metabolic rate were much higher than those measured by McNab for 2 red pandas from a zoo. The larger sample size (17), more natural conditions at the Panda Base and improved accuracy of the metabolic instruments provided more accurate metabolism measurements. Contrary to our expectations based on their low quality bamboo diet, the metabolic rates of red pandas were similar to mammals of the same size. Based on their metabolic rates red pandas would not be limited by their food supply in natural reserves. PMID:28306740

  20. Metabolic rate of the red panda, Ailurus fulgens, a dietary bamboo specialist. (United States)

    Fei, Yuxiang; Hou, Rong; Spotila, James R; Paladino, Frank V; Qi, Dunwu; Zhang, Zhihe


    The red panda (Ailurus fulgens) has a similar diet, primarily bamboo, and shares the same habitat as the giant panda, Ailuropoda melanoleuca. There are considerable efforts underway to understand the ecology of the red panda and to increase its populations in natural reserves. Yet it is difficult to design an effective strategy for red panda reintroduction if we do not understand its basic biology. Here we report the resting metabolic rate of the red panda and find that it is higher than previously measured on animals from a zoo. The resting metabolic rate was 0.290 ml/g/h (range 0.204-0.342) in summer and 0.361 ml/g/h in winter (range 0.331-0.406), with a statistically significant difference due to season and test temperature. Temperatures in summer were probably within the thermal neutral zone for metabolism but winter temperatures were below the thermal neutral zone. There was no difference in metabolic rate between male and female red pandas and no difference due to mass. Our values for metabolic rate were much higher than those measured by McNab for 2 red pandas from a zoo. The larger sample size (17), more natural conditions at the Panda Base and improved accuracy of the metabolic instruments provided more accurate metabolism measurements. Contrary to our expectations based on their low quality bamboo diet, the metabolic rates of red pandas were similar to mammals of the same size. Based on their metabolic rates red pandas would not be limited by their food supply in natural reserves.

  1. Sea anemones (Cnidaria, Anthozoa, Actiniaria from coral reefs in the southern Gulf of Mexico

    Directory of Open Access Journals (Sweden)

    Ricardo González-Muñoz


    Full Text Available Seven sea anemone species from coral reefs in the southern Gulf of Mexico are taxonomically diagnosed and images from living specimens including external and internal features, and cnidae are provided. Furthermore, the known distribution ranges from another 10 species are extended. No species records of sea anemones have been previously published in the primary scientific literature for coral reefs in the southern Gulf of Mexico and thus, this study represents the first inventory for the local actiniarian fauna.

  2. Neurotoxin localization to ectodermal gland cells uncovers an alternative mechanism of venom delivery in sea anemones. (United States)

    Moran, Yehu; Genikhovich, Grigory; Gordon, Dalia; Wienkoop, Stefanie; Zenkert, Claudia; Ozbek, Suat; Technau, Ulrich; Gurevitz, Michael


    Jellyfish, hydras, corals and sea anemones (phylum Cnidaria) are known for their venomous stinging cells, nematocytes, used for prey and defence. Here we show, however, that the potent Type I neurotoxin of the sea anemone Nematostella vectensis, Nv1, is confined to ectodermal gland cells rather than nematocytes. We demonstrate massive Nv1 secretion upon encounter with a crustacean prey. Concomitant discharge of nematocysts probably pierces the prey, expediting toxin penetration. Toxin efficiency in sea water is further demonstrated by the rapid paralysis of fish or crustacean larvae upon application of recombinant Nv1 into their medium. Analysis of other anemone species reveals that in Anthopleura elegantissima, Type I neurotoxins also appear in gland cells, whereas in the common species Anemonia viridis, Type I toxins are localized to both nematocytes and ectodermal gland cells. The nematocyte-based and gland cell-based envenomation mechanisms may reflect substantial differences in the ecology and feeding habits of sea anemone species. Overall, the immunolocalization of neurotoxins to gland cells changes the common view in the literature that sea anemone neurotoxins are produced and delivered only by stinging nematocytes, and raises the possibility that this toxin-secretion mechanism is an ancestral evolutionary state of the venom delivery machinery in sea anemones.

  3. Continuous Drug Release by Sea Anemone Nematostella vectensis Stinging Microcapsules (United States)

    Tal, Yossi; Ayalon, Ari; Sharaev, Agnesa; Kazir, Zoya; Brekhman, Vera; Lotan, Tamar


    Transdermal delivery is an attractive option for drug delivery. Nevertheless, the skin is a tough barrier and only a limited number of drugs can be delivered through it. The most difficult to deliver are hydrophilic drugs. The stinging mechanism of the cnidarians is a sophisticated injection system consisting of microcapsular nematocysts, which utilize built-in high osmotic pressures to inject a submicron tubule that penetrates and delivers their contents to the prey. Here we show, for the first time, that the nematocysts of the starlet sea anemone Nematostella vectensis can be isolated and incorporated into a topical formulation for continuous drug delivery. We demonstrate quantitative delivery of nicotinamide and lidocaine hydrochloride as a function of microcapsular dose or drug exposure. We also show how the released submicron tubules can be exploited as a skin penetration enhancer prior to and independently of drug application. The microcapsules are non-irritant and may offer an attractive alternative for hydrophilic transdermal drug delivery. PMID:24473172

  4. The use of the gonadotropin-releasing hormone analog deslorelin for short-term contraception in red pandas (Ailurus fulgens). (United States)

    Koeppel, Katja N; Barrows, Michelle; Visser, Katherine


    Red pandas (Ailurus fulgens) are threatened with extinction owing to habitat loss, exacerbated by their unique ecology and low fecundity. Regional breeding programs manage captive red panda populations. Recommendations not to breed may be made for various reasons, including genetic overrepresentation of certain individuals. No recommendations have been published on the use of contraception for red pandas. This article discusses the use of the GnRH analog deslorelin as a reversible method of contraception in both male and female pandas. The mean time from last contraception to conception was 3 years with a 4.6-mg deslorelin implant. The average dose of GnRH implant received was 1.09 mg/kg (range, 0.88-1.32). Males returned to breeding sooner than females. No reproductive side effects were noted with up to three consecutive annual GnRH implants. Copyright © 2014 Elsevier Inc. All rights reserved.

  5. Prevalence of intestinal parasitic infections in free-ranging Red Panda Ailurus fulgens Cuvier, 1825 (Mammalia: Carnivora: Ailuridae in Nepal

    Directory of Open Access Journals (Sweden)

    Sonam Tashi Lama


    Full Text Available The Red Panda Ailurus fulgens is a small carnivore that is adapted to a mainly herbivorous diet.  The present study was conducted to investigate the prevalence of parasitic infections in a free-ranging population of Red Pandas in a community forest in Nepal.  A total of 23 faecal samples were collected and examined.  Protozoa infections were the most common and cestode infections occurred the least.  Our findings suggest that parasites might be a significant problem for the health of the Red Pandas in the study area.  Molecular methods should be used to further investigate the taxonomic position of the parasites and their role in threatening the resilience of Red Panda populations in Nepal.  

  6. Cadherin-23 may be dynamic in hair bundles of the model sea anemone Nematostella vectensis.

    Directory of Open Access Journals (Sweden)

    Pei-Ciao Tang

    Full Text Available Cadherin 23 (CDH23, a component of tip links in hair cells of vertebrate animals, is essential to mechanotransduction by hair cells in the inner ear. A homolog of CDH23 occurs in hair bundles of sea anemones. Anemone hair bundles are located on the tentacles where they detect the swimming movements of nearby prey. The anemone CDH23 is predicted to be a large polypeptide featuring a short exoplasmic C-terminal domain that is unique to sea anemones. Experimentally masking this domain with antibodies or mimicking this domain with free peptide rapidly disrupts mechanotransduction and morphology of anemone hair bundles. The loss of normal morphology is accompanied, or followed by a decrease in F-actin in stereocilia of the hair bundles. These effects were observed at very low concentrations of the reagents, 0.1-10 nM, and within minutes of exposure. The results presented herein suggest that: (1 the interaction between CDH23 and molecular partners on stereocilia of hair bundles is dynamic and; (2 the interaction is crucial for normal mechanotransduction and morphology of hair bundles.

  7. Masquerade, mimicry and crypsis of the polymorphic sea anemone Phyllodiscus semoni and its aggregations in South Sulawesi

    NARCIS (Netherlands)

    Hoeksema, B.; Crowther, A.L.


    Phyllodiscus semoni is a morphologically variable sea anemone species from the Indo-Pacific with morphotypes ranging from upright and branched to low-lying and rounded. The apparent camouflage strategies of this sea anemone allow it to resemble other species or objects in its environment, such as

  8. An assemblage of the host anemone Heteractis magnifica in the northern Res Sea, and distribution of the resident anemonefish

    DEFF Research Database (Denmark)

    Brolund, Thea Marie; Tychsen, Anders; Nielsen, Lis Engdahl


    correlated with depth. The shallow waters of the anemone assemblage contained few mainly small, solitary actinians. There seemed to be a tendency for solitary actinians to cluster once they reached a certain size-range. The resident anemone¢shes Amphiprion bicinctus and Dascyllus trimaculatus were present...

  9. Rising starlet: the starlet sea anemone, Nematostella vectensis. (United States)

    Darling, John A; Reitzel, Adam R; Burton, Patrick M; Mazza, Maureen E; Ryan, Joseph F; Sullivan, James C; Finnerty, John R


    In recent years, a handful of model systems from the basal metazoan phylum Cnidaria have emerged to challenge long-held views on the evolution of animal complexity. The most-recent, and in many ways most-promising addition to this group is the starlet sea anemone, Nematostella vectensis. The remarkable amenability of this species to laboratory manipulation has already made it a productive system for exploring cnidarian development, and a proliferation of molecular and genomic tools, including the currently ongoing Nematostella genome project, further enhances the promise of this species. In addition, the facility with which Nematostella populations can be investigated within their natural ecological context suggests that this model may be profitably expanded to address important questions in molecular and evolutionary ecology. In this review, we explore the traits that make Nematostella exceptionally attractive as a model organism, summarize recent research demonstrating the utility of Nematostella in several different contexts, and highlight a number of developments likely to further increase that utility in the near future.

  10. Pore formation by actinoporins, cytolysins from sea anemones. (United States)

    Rojko, Nejc; Dalla Serra, Mauro; Maček, Peter; Anderluh, Gregor


    Actinoporins (APs) from sea anemones are ~20 kDa pore forming toxins with a β-sandwich structure flanked by two α-helices. The molecular mechanism of APs pore formation is composed of several well-defined steps. APs bind to membrane by interfacial binding site composed of several aromatic amino acid residues that allow binding to phosphatidylcholine and specific recognition of sphingomyelin. Subsequently, the N-terminal α-helix from the β-sandwich has to be inserted into the lipid/water interphase in order to form a functional pore. Functional studies and single molecule imaging revealed that only several monomers, 3-4, oligomerise to form a functional pore. In this model the α-helices and surrounding lipid molecules build toroidal pore. In agreement, AP pores are transient and electrically heterogeneous. On the contrary, crystallized oligomers of actinoporin fragaceatoxin C were found to be composed of eight monomers with no lipids present between the adjacent α-helices. This article is part of a Special Issue entitled: Pore-Forming Toxins edited by Maur Dalla Serra and Franco Gambale. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Differential accumulation of heavy metals in the sea anemone Anthopleura elegantissima as a function of symbiotic state

    Energy Technology Data Exchange (ETDEWEB)

    Mitchelmore, Carys L.; Alan Verde, E.; Ringwood, Amy H.; Weis, Virginia M


    The accumulation of metals by the North American Pacific Coast temperate sea anemone Anthopleura elegantissima, and its dinoflagellate-algal symbiont Symbiodinium muscatinei was examined following laboratory metal exposures. Both, naturally occurring symbiotic and symbiont-free (aposymbiotic) anemones were used in this study to investigate differences in metal uptake due to the symbiotic state of the animal. The effects of metal exposures on the anemone-algal symbiosis were determined using measures of algal cell density and mitotic index (MI). Anemones were exposed to either cadmium, copper, nickel or zinc chloride (0, 10, 100 {mu}g l{sup -1} for Cd, Cu and Ni; 0, 100, 1000 {mu}g l{sup -1} for Zn) for 42 days followed by a 42-day recovery period in ambient seawater. Anemones were analyzed for metal content using inductively coupled plasma mass spectroscopy (ICP-MS) at various time points during the study. Symbiotic anemones accumulated Cd, Ni and Zn to a greater extent than aposymbiotic anemones. A dramatically different pattern of Cu accumulation was observed, with aposymbiotic anemones accumulating higher levels than symbiotic anemones. Following recovery in ambient seawater, all tissue metal levels were reduced to near pre-exposure control levels in most cases. No changes in algal cell density or MI were observed in symbiotic anemone tentacle clips at any dose or time point in the Cd and Cu exposures. However, significant reductions in algal cell densities were observed in the Ni-exposed and some Zn-exposed animals, although levels returned to control values following recovery. There were no changes in mitotic index (MI) following Ni or Zn exposures. These results demonstrate that the extent of heavy metal accumulation depends upon cnidarian symbiotic state and the heavy metal in question.

  12. Molecular cloning of a peptidylglycine alpha-hydroxylating monooxygenase from sea anemones

    DEFF Research Database (Denmark)

    Hauser, F; Williamson, M; Grimmelikhuijzen, C J


    sequentially, peptidyl-glycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). In mammals both enzymatic activities are contained within a bifunctional protein that is coded for by a single gene. Using PCR and degenerated oligonucleotides derived from...... conserved regions of PHM, we have now cloned a PHM from the sea anemone Calliactis parasitica showing 42% amino acid sequence identity with rat PHM. Among the conserved (identical) amino acid residues are five histidine and one methionine residue, which bind two Cu2+ atoms that are essential for PHM...... activity. No cDNA coding for PAL could be identified, suggesting that sea anemone PAL is coded for by a gene that is different from the sea anemone PHM gene, a situation similar to the one found in insects. This is the first report on the molecular cloning of a cnidarian PHM. Udgivelsesdato: 1997-Dec-18...

  13. Phylogenetic relationships among deep-sea and chemosynthetic sea anemones: actinoscyphiidae and actinostolidae (Actiniaria: Mesomyaria.

    Directory of Open Access Journals (Sweden)

    Estefanía Rodríguez

    Full Text Available Sea anemones (Cnidaria, Actiniaria are present in all marine ecosystems, including chemosynthetic environments. The high level of endemicity of sea anemones in chemosynthetic environments and the taxonomic confusion in many of the groups to which these animals belong makes their systematic relationships obscure. We use five molecular markers to explore the phylogenetic relationships of the superfamily Mesomyaria, which includes most of the species that live in chemosynthetic, deep-sea, and polar sea habitats and to test the monophyly of the recently defined clades Actinostolina and Chemosynthina. We found that sea anemones of chemosynthetic environments derive from at least two different lineages: one lineage including acontiate deep-sea taxa and the other primarily encompassing shallow-water taxa.

  14. Defensin-neurotoxin dyad in a basally branching metazoan sea anemone. (United States)

    Kim, Chan-Hee; Lee, Ye Jin; Go, Hye-Jin; Oh, Hye Young; Lee, Tae Kwan; Park, Ji Been; Park, Nam Gyu


    Recent studies suggest that vertebrate and invertebrate defensins have evolved from two independent ancestors, and that both defensins could share origins with animal toxins. Here, we purified novel sea anemone neurotoxin (BDS)-like antimicrobial peptides (AMPs)-Crassicorin-I and its putative homolog (Crassicorin-II)-from the pharynx extract of an anthozoan sea anemone (Urticina crassicornis). Based on structural analyses and cDNA cloning, mature Crassicorin-I represents a cationic AMP likely generated from a precursor and comprising 40 amino acid residues, including six cysteines forming three intramolecular disulfide bonds. Recombinant Crassicorin-I produced in a heterologous bacterial-expression system displayed antimicrobial activity against both a gram-positive bacterium (Bacillus subtilis) and gram-negative bacteria (Escherichia coli and Salmonella enterica). The Crassicorin-I transcript was upregulated by immune challenge, suggesting its involvement in defense mechanisms against infectious pathogens in sea anemone. Sequence alignment and three-dimensional molecular modeling revealed that Crassicorin-I exhibits high degrees of structural similarity to sea anemone neurotoxins that share β-defensin fold which is found in vertebrate defensins and invertebrate big-defensins. Consistent with its structural similarity to neurotoxins, Crassicorin-I exhibited paralytic activity toward a crustacean. These findings motivated our investigation and subsequent discovery of antimicrobial activity from other known sea anemone neurotoxins, such as APETx1 and ShK. Collectively, our work signified that Crassicorin-I is the first AMP identified from a sea anemone and provided evidence of a functional linkage between AMPs and neurotoxins in a basally branching metazoan. © 2017 Federation of European Biochemical Societies.

  15. Genomic organization of a receptor from sea anemones, structurally and evolutionary related to glycoprotein hormone receptors from mamals

    DEFF Research Database (Denmark)

    Vibede, N; Hauser, Frank; Williamson, M


    Abstract Cnidarians (e.g., sea anemones and corals) are the lowest animal group having a nervous system. Previously, we cloned a receptor from sea anemones that showed a strong structural similarity to the glycoprotein hormone (TSH, FSH, LH/CG) receptors from mammals. Here, we determine the genomic...... organization of this sea anemone receptor. The receptor gene contains eight introns that are all localized within a region coding for the large extracellular N terminus. These introns occur at the same positions and have the same intron phasing as eight introns in the genes coding for the mammalian...

  16. Prospects of isolated microspore culture for haploid production in Anemone coronaria L.

    NARCIS (Netherlands)

    Paladines, R.; Jurado, D.; Riksen-Bruinsma, T.; Quiñones, A.M.


    The aim of this study was to establish a procedure to obtain haploid plants from microspore cultures of Anemone coronaria L., an important ornamental crop known worldwide due to its commercial value in the cut flower industry. Microspores were isolated from two genotypes of A. coronaria: ‘Blue’

  17. A Taxonomic Note on the Misidentification of Anemone tschernjaewii Regel. in Kashmir Himalaya

    Directory of Open Access Journals (Sweden)

    Aijaz Hassan Ganie


    Full Text Available The correct identification of Anemone tschernjaewii Regel. previously misidentified as A. biflora DC. in the Kashmir Himalaya, India is reported. In this brief report, a detailed taxonomic description and photo-plates of its diagnostic morphological and anatomical characters are provided to validate this plant record for the region and to facilitate its easier field identification.

  18. The anatomy, terminology, and homology of acrorhagi and pseudoacrorhagi in sea anemones

    NARCIS (Netherlands)

    Daly, M.


    The morphology of the column margin is an especially important feature in the taxonomy and biology of members of the sea anemone family Actiniidae. Despite the importance of marginal structures, their anatomy and the terminology describing them is poorly delimited. Consequently, homologies of the

  19. The formation of a nanocarbon from lignocellulose with a sea anemone appearance

    NARCIS (Netherlands)

    Zabeti, M.; Mojet, Barbara; Seshan, Kulathuiyer


    A filamentous carbon nanomaterial having morphology, elemental compositions and growth conditions similar to those of a sea anemone was formed during pyrolysis of lignocellulose in the presence of water and sodium. We call the material “carbon nano-anemones” (CNAs). Well known carbon nano

  20. Serosurvey of ex situ giant pandas (Ailuropoda melanoleuca) and red pandas (Ailurus fulgens) in China with implications for species conservation. (United States)

    Loeffler, I Kati; Howard, JoGayle; Montali, Richard J; Hayek, Lee-Ann; Dubovi, Edward; Zhang, Zhihe; Yan, Qigui; Guo, Wanzhu; Wildt, David E


    Conservation strategies for the giant panda (Ailuropoda melanoleuca) include the development of a self-sustaining ex situ population. This study examined the potential significance of infectious pathogens in giant pandas ex situ. Serologic antibody titers against canine distemper virus (CDV), canine parvovirus (CPV), canine adenovirus (CAV), canine coronavirus (CCV), canine herpesvirus, canine parainfluenza virus (CPIV), Toxoplasma gondii, Neospora caninum, and Leptospira interrogans were measured in 44 samples taken from 19 giant pandas between 1998 and 2003 at the Chengdu Research Base of Giant Panda Breeding in Sichuan, China. Seroassays also included samples obtained in 2003 from eight red pandas (Ailurus fulgens) housed at the same institution. All individuals had been vaccinated with a Chinese canine vaccine that included modified live CDV, CPV, CAV, CCV, and CPIV. Positive antibody titers were found only against CDV, CPV, and T. gondii. Sera were negative for antibodies against the other six pathogens. Results indicate that the quality of the vaccine may not be reliable and that it should not be considered protective or safe in giant pandas and red pandas. Positive antibody titers against T. gondii were found in seven of the 19 giant pandas. The clinical, subclinical, or epidemiologic significance of infection with these pathogens via natural exposure or from modified live vaccines in giant pandas is unknown. Research in this area is imperative to sustaining a viable population of giant pandas and other endangered species.

  1. Bio-synthesis of silver nanoparticles using Potentilla fulgens Wall. ex Hook. and its therapeutic evaluation as anticancer and antimicrobial agent

    Energy Technology Data Exchange (ETDEWEB)

    Mittal, Amit Kumar [Department of Pharmaceutical Technology Biotechnology, National Institute of Pharmaceutical Education and Research, Sector-67, S.A.S. Nagar, 160062 Punjab (India); Tripathy, Debabrata [Department of Biotechnology and Bioinformatics, North Eastern Hill University, Shillong, 793002 Meghalaya (India); Choudhary, Alka [Department of Natural Products, National Institute of Pharmaceutical Education and Research, Sector-67, S.A.S. Nagar, 160062 Punjab (India); Aili, Pavan Kumar [Department of Pharmaceutical Technology Biotechnology, National Institute of Pharmaceutical Education and Research, Sector-67, S.A.S. Nagar, 160062 Punjab (India); Chatterjee, Anupam [Department of Biotechnology and Bioinformatics, North Eastern Hill University, Shillong, 793002 Meghalaya (India); Singh, Inder Pal [Department of Natural Products, National Institute of Pharmaceutical Education and Research, Sector-67, S.A.S. Nagar, 160062 Punjab (India); Banerjee, Uttam Chand, E-mail: [Department of Pharmaceutical Technology Biotechnology, National Institute of Pharmaceutical Education and Research, Sector-67, S.A.S. Nagar, 160062 Punjab (India)


    The present study aims to develop an easy and eco-friendly method for the synthesis of silver nanoparticles using extracts from the medicinal plant, Potentilla fulgens and evaluation of its anticancer and antimicrobial properties. The various parts of P. fulgens were screened and the root extract was found to have the highest potential for the synthesis of nanoparticles. The root extracts were able to quickly reduce Ag{sup +} to Ag{sup 0} and stabilized the nanoparticles. The synthesis of nanoparticles was confirmed by UV–Visible spectrophotometry and further characterized using Zeta sizer, Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), transmission electron microscope (TEM) and X-ray diffraction (XRD). Electron microscopic study showed that the size of the nanoparticle was in the range of 10 to 15 nm and spherical in shape. The studies of phytochemical analysis of nanoparticles indicated that the adsorbed components on the surface of nanoparticles were mainly flavonoid in nature. Furthermore, nanoparticles were evaluated as cytotoxic against various cancer cell lines and 0.2 to 12 μg/mL nanoparticles showed good toxicity. The IC{sub 50} value of nanoparticles was found to be 4.91 and 8.23 μg/mL against MCF-7 and U-87 cell lines, respectively. Additionally, the apoptotic effect of synthesized nanoparticles on normal and cancer cells was studied using trypan blue assay and flow-cytometric analysis. The results indicate the synthesized nanoparticle ability to kill cancer cells compared to normal cells. The nanoparticles also exhibited comparable antimicrobial activity against both Gram-positive and Gram-negative bacteria. - Highlights: • Bio-synthesis of AgNPs using a medicinal plant Potentilla fulgens Wall. ex Hook. • Optimization of NP synthesis and its characterization using various techniques • Determination of therapeutic potential in terms of anticancer and antimicrobial properties • To know the mechanistic

  2. Bio-synthesis of silver nanoparticles using Potentilla fulgens Wall. ex Hook. and its therapeutic evaluation as anticancer and antimicrobial agent

    International Nuclear Information System (INIS)

    Mittal, Amit Kumar; Tripathy, Debabrata; Choudhary, Alka; Aili, Pavan Kumar; Chatterjee, Anupam; Singh, Inder Pal; Banerjee, Uttam Chand


    The present study aims to develop an easy and eco-friendly method for the synthesis of silver nanoparticles using extracts from the medicinal plant, Potentilla fulgens and evaluation of its anticancer and antimicrobial properties. The various parts of P. fulgens were screened and the root extract was found to have the highest potential for the synthesis of nanoparticles. The root extracts were able to quickly reduce Ag + to Ag 0 and stabilized the nanoparticles. The synthesis of nanoparticles was confirmed by UV–Visible spectrophotometry and further characterized using Zeta sizer, Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), transmission electron microscope (TEM) and X-ray diffraction (XRD). Electron microscopic study showed that the size of the nanoparticle was in the range of 10 to 15 nm and spherical in shape. The studies of phytochemical analysis of nanoparticles indicated that the adsorbed components on the surface of nanoparticles were mainly flavonoid in nature. Furthermore, nanoparticles were evaluated as cytotoxic against various cancer cell lines and 0.2 to 12 μg/mL nanoparticles showed good toxicity. The IC 50 value of nanoparticles was found to be 4.91 and 8.23 μg/mL against MCF-7 and U-87 cell lines, respectively. Additionally, the apoptotic effect of synthesized nanoparticles on normal and cancer cells was studied using trypan blue assay and flow-cytometric analysis. The results indicate the synthesized nanoparticle ability to kill cancer cells compared to normal cells. The nanoparticles also exhibited comparable antimicrobial activity against both Gram-positive and Gram-negative bacteria. - Highlights: • Bio-synthesis of AgNPs using a medicinal plant Potentilla fulgens Wall. ex Hook. • Optimization of NP synthesis and its characterization using various techniques • Determination of therapeutic potential in terms of anticancer and antimicrobial properties • To know the mechanistic apoptosis effect of

  3. Evolution of the Cytolytic Pore-Forming Proteins (Actinoporins) in Sea Anemones


    Macrander, Jason; Daly, Marymegan


    Sea anemones (Cnidaria, Anthozoa, and Actiniaria) use toxic peptides to incapacitate and immobilize prey and to deter potential predators. Their toxin arsenal is complex, targeting a variety of functionally important protein complexes and macromolecules involved in cellular homeostasis. Among these, actinoporins are one of the better characterized toxins; these venom proteins form a pore in cellular membranes containing sphingomyelin. We used a combined bioinformatic and phylogenetic approach...

  4. Changes in zooxanthellae density, morphology, and mitotic index in hermatypic corals and anemones exposed to cyanide. (United States)

    Cervino, J M; Hayes, R L; Honovich, M; Goreau, T J; Jones, S; Rubec, P J


    Sodium cyanide (NaCN) is widely used for the capture of reef fish throughout Southeast Asia and causes extensive fish mortality, but the effect of NaCN on reef corals remains debated. To document the impact of cyanide exposure on corals, the species Acropora millepora, Goniopora sp., Favites abdita, Trachyphyllia geoffrio, Plerogyra sp., Heliofungia actinformis, Euphyllia divisa, and Scarophyton sp., and the sea anemone Aiptasia pallida were exposed to varying concentrations of cyanide for varying time periods. Corals were exposed to 50, 100, 300, and 600 mg/l of cyanide ion (CN(-)) for 1-2 min (in seawater, the CN(-) forms hydrocyanic acid). These concentrations are much lower than those reportedly used by fish collectors. Exposed corals and anemones immediately retracted their tentacles and mesenterial filaments, and discharged copious amounts of mucus containing zooxanthellae. Gel electrophoreses techniques found changes in protein expression in both zooxanthellae and host tissue. Corals and anemones exposed to cyanide showed an immediate increase in mitotic cell division of their zooxenthellae, and a decrease in zooxanthellae density. In contrast, zooxanthellae cell division and density remained constant in controls. Histopathological changes included gastrodermal disruption, mesogleal degradation, and increased mucus in coral tissues. Zooxanthellae showed pigment loss, swelling, and deformation. Mortality occurred at all exposure levels. Exposed specimens experienced an increase in the ratio of gram-negative to gram-positive bacteria on the coral surface. The results demonstrate that exposure cyanide causes mortality to corals and anemones, even when applied at lower levels than that used by fish collectors. Even brief exposure to cyanide caused slow-acting and long-term damage to corals and their zooxanthellae.

  5. Digestion rates of prey eaten by intertidal sea anemones from the ...

    African Journals Online (AJOL)

    portunid crabs (Crustacea: Decapoda: Portunidae) . .I. Erp. At/ar. B",/, &01 52: IOl113. lAMER. W.E. 1986. Physiologicanemone Antltoplellnl elf!gantissillw 1. Prey capture_ absorption efficiency and grO\\\\'th. ,\\1or BioI. 92: 299 314. IAR. 1.1 r. 1984. Biostatistical Analysis. 2nd ed. Prentice Hall.

  6. Fisiology Adaptation of Sandy Anemone (Heteractis Malu) Exposed to Elevated Temperatures: Laboratory Condition


    Zamani, Neviaty Putri


    Sandy anemone (Heteractis malu), belongs to Phylum Cnidaria, physiologically is very close to coral stone, which was a major component of coral reef ecosystems. As coral stone, Heteractis malu also has symbiotic algae (Zooxanthella). Physiologically, the alga symbiotic relationship of coral stone is almost similar with Heteractis malu. Maintaining Heteractis malu in the laboratory is relativly easier compared to that of coral stone. Advantages of the Heteractis malu vs. stone coral, its body ...

  7. Large anthropogenic impacts on a charismatic small carnivore: Insights from distribution surveys of red panda Ailurus fulgens in Nepal.

    Directory of Open Access Journals (Sweden)

    Saroj Panthi

    Full Text Available Protected areas are key to preserving biodiversity and maintaining ecosystem services. However, their ability to ensure long-term survival of threatened andendangered species varies across countries, regions and landscapes. Distribution surveys can beparticularly important for assessing the value of protected areas, and gauging their efficacy incatering to species-specific requirements. We assessed the conservation value of one such reserve for a charismatic yet globally endangered species, the red panda Ailurus fulgens,in the light of on-going land-use transformation in Nepal. We conducted field surveys forindirect signs of red pandas along forest trails in 25-km2 sampling grid cells (n = 54 of Dhorpatan Hunting Reserve, and confronted a set of ecological hypotheses to the data using hierarchical occupancy models. We estimated overall occupancy at Ψ(SE = 0.41 (0.007, with relatively high site-level detectability [p = 0.93 (SE = 0.001]. Our results show that despitebeing a subsistence form of small-scale resource use, extraction of bamboo and livestock grazing negatively affected panda occurrence, albeit at different intensities. The amount of bamboo cover,rather than the overall proportion of forest cover, had greater influence on the panda occurrence. Despite availability of bamboo cover, areas with bamboo extraction and anthropogenic disturbances were less likely to be occupied by pandas. Together, these results suggest that long-term persistence of red pandas in this reserve and elsewhere across the species' range will require preventing commercial extractionof bamboo, coupled with case-specific regulation of anthropogenic exploitation of red panda habitats.

  8. Genetic structuring and recent demographic history of red pandas (Ailurus fulgens) inferred from microsatellite and mitochondrial DNA. (United States)

    Hu, Yibo; Guo, Yu; Qi, Dunwu; Zhan, Xiangjiang; Wu, Hua; Bruford, Michael W; Wei, Fuwen


    Clarification of the genetic structure and population history of a species can shed light on the impacts of landscapes, historical climate change and contemporary human activities and thus enables evidence-based conservation decisions for endangered organisms. The red panda (Ailurus fulgens) is an endangered species distributing at the edge of the Qinghai-Tibetan Plateau and is currently subject to habitat loss, fragmentation and population decline, thus representing a good model to test the influences of the above-mentioned factors on a plateau edge species. We combined nine microsatellite loci and 551 bp of mitochondrial control region (mtDNA CR) to explore the genetic structure and demographic history of this species. A total of 123 individuals were sampled from 23 locations across five populations. High levels of genetic variation were identified for both mtDNA and microsatellites. Phylogeographic analyses indicated little geographic structure, suggesting historically wide gene flow. However, microsatellite-based Bayesian clustering clearly identified three groups (Qionglai-Liangshan, Xiaoxiangling and Gaoligong-Tibet). A significant isolation-by-distance pattern was detected only after removing Xiaoxiangling. For mtDNA data, there was no statistical support for a historical population expansion or contraction for the whole sample or any population except Xiaoxiangling where a signal of contraction was detected. However, Bayesian simulations of population history using microsatellite data did pinpoint population declines for Qionglai, Xiaoxiangling and Gaoligong, demonstrating significant influences of human activity on demography. The unique history of the Xiaoxiangling population plays a critical role in shaping the genetic structure of this species, and large-scale habitat loss and fragmentation is hampering gene flow among populations. The implications of our findings for the biogeography of the Qinghai-Tibetan Plateau, subspecies classification and

  9. Large anthropogenic impacts on a charismatic small carnivore: Insights from distribution surveys of red panda Ailurus fulgens in Nepal. (United States)

    Panthi, Saroj; Khanal, Gopal; Acharya, Krishna Prasad; Aryal, Achyut; Srivathsa, Arjun


    Protected areas are key to preserving biodiversity and maintaining ecosystem services. However, their ability to ensure long-term survival of threatened andendangered species varies across countries, regions and landscapes. Distribution surveys can beparticularly important for assessing the value of protected areas, and gauging their efficacy incatering to species-specific requirements. We assessed the conservation value of one such reserve for a charismatic yet globally endangered species, the red panda Ailurus fulgens,in the light of on-going land-use transformation in Nepal. We conducted field surveys forindirect signs of red pandas along forest trails in 25-km2 sampling grid cells (n = 54) of Dhorpatan Hunting Reserve, and confronted a set of ecological hypotheses to the data using hierarchical occupancy models. We estimated overall occupancy at Ψ(SE) = 0.41 (0.007), with relatively high site-level detectability [p = 0.93 (SE = 0.001)]. Our results show that despitebeing a subsistence form of small-scale resource use, extraction of bamboo and livestock grazing negatively affected panda occurrence, albeit at different intensities. The amount of bamboo cover,rather than the overall proportion of forest cover, had greater influence on the panda occurrence. Despite availability of bamboo cover, areas with bamboo extraction and anthropogenic disturbances were less likely to be occupied by pandas. Together, these results suggest that long-term persistence of red pandas in this reserve and elsewhere across the species' range will require preventing commercial extractionof bamboo, coupled with case-specific regulation of anthropogenic exploitation of red panda habitats.

  10. First report of Enterocytozoon bieneusi from giant pandas (Ailuropoda melanoleuca) and red pandas (Ailurus fulgens) in China. (United States)

    Tian, Ge-Ru; Zhao, Guang-Hui; Du, Shuai-Zhi; Hu, Xiong-Feng; Wang, Hui-Bao; Zhang, Long-Xian; Yu, San-Ke


    Enterocytozoon bieneusi is an emerging and opportunistic enteric pathogen triggering diarrhea and enteric disease in humans and animals. Despite extensive research on this pathogen, the prevalence and genotypes of E. bieneusi infection in precious wild animals of giant and red pandas have not been reported. In the present study, 82 faecal specimens were collected from 46 giant pandas (Ailuropoda melanoleuca) and 36 red pandas (Ailurus fulgens) in the northwest of China. By PCR and sequencing of the internal transcribed spacer (ITS) region of the ribosomal RNA (rRNA) gene of E. bieneusi, an overall infection rate of 10.98% (9/82) was observed in pandas, with 8.70% (4/46) for giant pandas, and 13.89% (5/36) for red pandas. Two ITS genotypes were identified: the novel genotype I-like (n=4) and genotype EbpC (n=5). Multilocus sequence typing (MLST) employing three microsatellites (MS1, MS3 and MS7) and one minisatellite (MS4) showed that nine, six, six and nine positive products were amplified and sequenced successfully at four respective loci. A phylogenetic analysis based on a neighbor-joining tree of the ITS gene sequences of E. bieneusi indicated that the genotype EbpC fell into 1d of group 1 of zoonotic potential, and the novel genotype I-like was clustered into group 2. The present study firstly indicated the presence of E. bieneusi in giant and red pandas, and these results suggested that integrated strategies should be implemented to effectively protect pandas and humans from infecting E. bieneusi in China. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. The Antitumor Effects of Triterpenoid Saponins from the Anemone flaccida and the Underlying Mechanism

    Directory of Open Access Journals (Sweden)

    Lin-Tao Han


    Full Text Available Anemone flaccida Fr. Schmidt, a family of ancient hopanoids, have been used as traditional Asian herbs for the treatments of inflammation and convulsant diseases. Previous study on HeLa cells suggested that triterpenoid saponins from Anemone flaccida Fr. Schmidt may have potential antitumor effect due to their apoptotic activities. Here, we confirmed the apoptotic activities of the following five triterpenoid saponins: glycoside St-I4a (1, glycoside St-J (2, anhuienoside E (3, hedera saponin B (4, and flaccidoside II (5 on human BEL-7402 and HepG2 hepatoma cell lines, as well as the model of HeLa cells treated with lipopolysaccharide (LPS. We found that COX-2/PGE2 signaling pathway, which plays key roles in the development of cancer, is involved in the antitumor activities of these saponins. These data provide the evidence that triterpenoid saponins can induce apoptosis via COX-2/PGE2 pathway, implying a preventive role of saponins from Anemone flaccida in tumor.

  12. Evolution of the Cytolytic Pore-Forming Proteins (Actinoporins in Sea Anemones

    Directory of Open Access Journals (Sweden)

    Jason Macrander


    Full Text Available Sea anemones (Cnidaria, Anthozoa, and Actiniaria use toxic peptides to incapacitate and immobilize prey and to deter potential predators. Their toxin arsenal is complex, targeting a variety of functionally important protein complexes and macromolecules involved in cellular homeostasis. Among these, actinoporins are one of the better characterized toxins; these venom proteins form a pore in cellular membranes containing sphingomyelin. We used a combined bioinformatic and phylogenetic approach to investigate how actinoporins have evolved across three superfamilies of sea anemones (Actinioidea, Metridioidea, and Actinostoloidea. Our analysis identified 90 candidate actinoporins across 20 species. We also found clusters of six actinoporin-like genes in five species of sea anemone (Nematostella vectensis, Stomphia coccinea, Epiactis japonica, Heteractis crispa, and Diadumene leucolena; these actinoporin-like sequences resembled actinoporins but have a higher sequence similarity with toxins from fungi, cone snails, and Hydra. Comparative analysis of the candidate actinoporins highlighted variable and conserved regions within actinoporins that may pertain to functional variation. Although multiple residues are involved in initiating sphingomyelin recognition and membrane binding, there is a high rate of replacement for a specific tryptophan with leucine (W112L and other hydrophobic residues. Residues thought to be involved with oligomerization were variable, while those forming the phosphocholine (POC binding site and the N-terminal region involved with cell membrane penetration were highly conserved.

  13. Evolution of the Cytolytic Pore-Forming Proteins (Actinoporins) in Sea Anemones. (United States)

    Macrander, Jason; Daly, Marymegan


    Sea anemones (Cnidaria, Anthozoa, and Actiniaria) use toxic peptides to incapacitate and immobilize prey and to deter potential predators. Their toxin arsenal is complex, targeting a variety of functionally important protein complexes and macromolecules involved in cellular homeostasis. Among these, actinoporins are one of the better characterized toxins; these venom proteins form a pore in cellular membranes containing sphingomyelin. We used a combined bioinformatic and phylogenetic approach to investigate how actinoporins have evolved across three superfamilies of sea anemones (Actinioidea, Metridioidea, and Actinostoloidea). Our analysis identified 90 candidate actinoporins across 20 species. We also found clusters of six actinoporin-like genes in five species of sea anemone ( Nematostella vectensis , Stomphia coccinea , Epiactis japonica , Heteractis crispa , and Diadumene leucolena ); these actinoporin-like sequences resembled actinoporins but have a higher sequence similarity with toxins from fungi, cone snails, and Hydra . Comparative analysis of the candidate actinoporins highlighted variable and conserved regions within actinoporins that may pertain to functional variation. Although multiple residues are involved in initiating sphingomyelin recognition and membrane binding, there is a high rate of replacement for a specific tryptophan with leucine (W112L) and other hydrophobic residues. Residues thought to be involved with oligomerization were variable, while those forming the phosphocholine (POC) binding site and the N-terminal region involved with cell membrane penetration were highly conserved.

  14. Broad-scale Population Genetics of the Host Sea Anemone, Heteractis magnifica

    KAUST Repository

    Emms, Madeleine


    Broad-scale population genetics can reveal population structure across an organism’s entire range, which can enable us to determine the most efficient population-wide management strategy depending on levels of connectivity. Genetic variation and differences in genetic diversity on small-scales have been reported in anemones, but nothing is known about their broad-scale population structure, including that of “host” anemone species, which are increasingly being targeted in the aquarium trade. In this study, microsatellite markers were used as a tool to determine the population structure of a sessile, host anemone species, Heteractis magnifica, across the Indo-Pacific region. In addition, two rDNA markers were used to identify Symbiodinium from the samples, and phylogenetic analyses were used to measure diversity and geographic distribution of Symbiodinium across the region. Significant population structure was identified in H. magnifica across the Indo-Pacific, with at least three genetic breaks, possibly the result of factors such as geographic distance, geographic isolation and environmental variation. Symbiodinium associations were also affected by environmental variation and supported the geographic isolation of some regions. These results suggests that management of H. magnifica must be implemented on a local scale, due to the lack of connectivity between clusters. This study also provides further evidence for the combined effects of geographic distance and environmental distance in explaining genetic variance.

  15. Isolation of pyroGlu-Gly-Arg-Phe-NH2 (Antho-RFamide), a neuropeptide from sea anemones

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Ebbesen, Ditte Graff


    A radioimmunoassay has been developed for peptides containing the carboxyl-terminal sequence Arg-Phe-NH2 (RFamide). Using this radioimmunoassay and applying cation-exchange chromatography and HPLC, we have isolated an RFamide peptide from acetic acid extracts of the sea anemone Anthopleura...... elegantissima. Three different methods established that the structure of the Anthopleura RFamide peptide (Antho-RFamide) is pyroGlu-Gly-Arg-Phe-NH2. Comparison of synthetic and natural Antho-RFamide and their enzymatic breakdown products on six different HPLC columns confirmed the structure of the sea anemone...... peptide. Using synthetic Antho-RFamide as a standard in our radioimmunoassay, we measured high concentrations (3.2 nmol/g wet weight) of this peptide in extracts of Anthopleura. It is proposed that Antho-RFamide is a transmitter at neuromuscular synapses in sea anemones....

  16. Isolation of pyroGlu-Gly-Arg-Phe-NH2 (Antho-RFamide), a neuropeptide from sea anemones

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Ebbesen, Ditte Graff


    A radioimmunoassay has been developed for peptides containing the carboxyl-terminal sequence Arg-Phe-NH2 (RFamide). Using this radioimmunoassay and applying cation-exchange chromatography and HPLC, we have isolated an RFamide peptide from acetic acid extracts of the sea anemone Anthopleura elegan...... peptide. Using synthetic Antho-RFamide as a standard in our radioimmunoassay, we measured high concentrations (3.2 nmol/g wet weight) of this peptide in extracts of Anthopleura. It is proposed that Antho-RFamide is a transmitter at neuromuscular synapses in sea anemones....

  17. Increased cell proliferation and mucocyte density in the sea anemone Aiptasia pallida recovering from bleaching.

    Directory of Open Access Journals (Sweden)

    David Fransolet

    Full Text Available Recovery of coral after bleaching episodes is a critical period for the health of the reef ecosystem. While events such as symbiont (genus Symbiodinium shifting/shuffling or tissue apoptosis have been demonstrated to occur following bleaching, little is known concerning tissue recovery or cell proliferation. Here, we studied the sea anemone Aiptasia pallida exposed to a transient elevation of water temperature combined with high illumination (33°C and 1900 µmol photons x m(-2 x s(-1 for 30 h. Following such treatment bleached anemones showed a significant reduction of their Symbiodinium density. Cell proliferation in the ectodermis and gastrodermis was determined by assessing the densities of cells labeled with a thymidine analogue (EdU. Cell proliferation significantly increased during the first day following stress in both tissue types. This increased cell proliferation returned to pre-stress values after one week. Although cell proliferation was higher in the ectodermis in absence of stress, it was relatively more pronounced in the gastrodermis of stressed anemones. In addition, the ratio of ectodermal mucocytes significantly increased three weeks after induced stress. These results suggest that thermal/photic stress coupled with the loss of the symbionts is able to enhance cell proliferation in both gastrodermis and ectodermis of cnidarians. While new cells formed in the gastrodermis are likely to host new Symbiodinium, the fate of new cells in the ectodermis was only partially revealed. Some new ectodermal cells may, in part, contribute to the increased number of mucocytes which could eventually help strengthen the heterotrophic state until restoration of the symbiosis.

  18. Extraction of Anticoagulant Compound from Persian Gulf sea anemone Stichodactyla haddoni

    Directory of Open Access Journals (Sweden)

    Mahdeah Tahmasebi


    Full Text Available Background: The marine environment is anexceptional reservoir of bioactive natural products, many of them exhibit structural/chemical features that not found in terrestrial natural products.Glycosaminoglycans are one of this various bioactive compounds. Heparin, as a well known glycosaminoglycan, is a sulfated glycosaminoglycan that has natural anticoagulant properties. Heparin and heparin-like compounds are used as anticoagulants in many aspects of medicine. However, for two main reasons: 1. Contamination in heparin samples obtained from pig intestine or bovine lung pathogens and other pathogens, 2 .resource for use of heparin is limited and there are a lot of requirements for new compounds from natural resources. According to GAGs importance and widespread using of heparin in medicine, in the present study, GAGs compounds extracted from sea anemones and anticoagulant properties of the human blood is investigated. Materials and Methods: GAGs compound was extracted by using cetylpyridinium chloride. Anticoagulation activity of extracted GAGs (the extracted tentacle was tested in human blood plasma, using manual procedures, and assay system, prothrombin time (PT and activated partial thromboplastin time (APTT. Results: In this study the amount of the crude GAGs was 24 mg per gram of tentacle dry weight. The results ofanticoagulant activity extracted on human blood plasma showed that these compounds prolonged clotting time compared to the control. In APTT and PT assay of the extracted GAGs from the sea anemone also clotting time prolonged in compared to the control. Conclusion: The results demonstrated that anticoagulant compounds existed in the tentacle of the sea anemone, and although their effects is weaker than the heparin, but they can be substituted for heparin, at least in laboratory conditions.

  19. Population dynamics and spatial distribution of the terrestrial snail Ovachlamys fulgens (Stylommatophora: Helicarionidae in a tropical environment

    Directory of Open Access Journals (Sweden)

    Zaidett Barrientos


    Full Text Available The introduced snail Ovachlamys fulgens (Stylommatophora: Helicarionidae occurs on cultivated land habitats in Costa Rica, where its macrodistribution seems to be limited by annual mean temperature (20 - 27.6°C and annual precipitation (1 530 - 3 034 and 3 420 - 8 000 mm, with no more than six dry months. This species can be found in litter and on vegetation up to 70 cm tall. Random quadrat field sampling was done in leaf litter and understory plants every three months for a total of five dates in Central Costa Rica. At least 150 plots of 25x25 cm were analyzed on each date. Abundance of living specimens and eggs was positively correlated with (1 litter abundance and depth, (2 litter and soil humidity, (3 relative humidity and (4 early morning temperature (6:30 AM, and negatively correlated with temperature later in the morning (10:00 AM. Besides these factors, living snail abundance was correlated with thickness of the herbaceous vegetation and with the occurrence of Yucca elephantiphes (in litter and understory. Egg abundance was also correlated with the sampling date, apparently because of changes in humidity. The correlation pattern of shell abundance was opposite to that of living specimens. Population size and number of empty shells throughout the year parallel the rainfall pattern. Reproduction takes place between May and November (wet season; and up to 92% of the specimens can be found aestivating between December and April (dry season. Clutch size averages three eggs. The maximum density of living specimens was reached in December (43.41 ind/m² and the minimum in March (8.30 ind/m². Shells decompose in an average of five months.El caracol introducido Ovachlamys fulgens (Stylommatophora: Helicarionidae habita regiones cultivadas de Costa Rica y su distribución está limitada por temperaturas anuales entre 20 y 27.6ºC y precipitaciones anuales entre 1530-3034 y 3420-8000 mm con no más de seis meses secos. Esta especie habita en la

  20. The isolation of a toxin from the dahlia sea anemone, Tealia felina L. (United States)

    Elliott, R C; Konya, R S; Vickneshwara, K


    Gel chromatography with Dyematrex blue B gel and ion exchange chromatography with a methylcellulose cation exchange column have been used to isolate a toxin present in partially purified saline extracts of the dahlia sea anemone Tealia felina. Toxin activity was assessed by its histaminolytic activity. A ten-fold increase in activity per mg protein was achieved in these two steps. Final purification on a Sephacryl column yielded an apparently pure protein with a molecular weight of 7800. The amino acid composition of this compound was determined.

  1. Comparative effects of dissolved copper and copper oxide nanoparticle exposure to the sea anemone, Exaiptasia pallida

    Energy Technology Data Exchange (ETDEWEB)

    Siddiqui, Samreen; Goddard, Russell H.; Bielmyer-Fraser, Gretchen K., E-mail:


    Highlights: • Differences between CuO NP and CuCl{sub 2} exposure were characterized. • Copper accumulation in E. pallida was concentration-dependent. • E. pallida exposed to CuCl{sub 2} accumulated higher copper tissue burdens. • The oxidative stress response was greater in E. pallida exposed to CuO NP. • Both forms of copper inhibited CA activity in E. pallida. - Abstract: Increasing use of metal oxide nanoparticles (NP) by various industries has resulted in substantial output of these NP into aquatic systems. At elevated concentrations, NP may interact with and potentially affect aquatic organisms. Environmental implications of increased NP use are largely unknown, particularly in marine systems. This research investigated and compared the effects of copper oxide (CuO) NP and dissolved copper, as copper chloride (CuCl{sub 2}), on the sea anemone, Exaiptasia pallida. Sea anemones were collected over 21 days and tissue copper accumulation and activities of the enzymes: catalase, glutathione peroxidase, glutathione reductase, and carbonic anhydrase were quantified. The size and shape of CuO NP were observed using a ecanning electron microscope (SEM) and the presence of copper was confirmed by using Oxford energy dispersive spectroscopy systems (EDS/EDX). E. pallida accumulated copper in their tissues in a concentration- and time-dependent manner, with the animals exposed to CuCl{sub 2} accumulating higher tissue copper burdens than those exposed to CuO NP. As a consequence of increased copper exposure, as CuO NP or CuCl{sub 2}, anemones increased activities of all of the antioxidant enzymes measured to some degree, and decreased the activity of carbonic anhydrase. Anemones exposed to CuO NP generally had higher anti-oxidant enzyme activities than those exposed to the same concentrations of CuCl{sub 2}. This study is useful in discerning differences between CuO NP and dissolved copper exposure and the findings have implications for exposure of aquatic

  2. A taxonomic review of the dry-fruited species of Anemone (Ranunculaceae in southern Africa

    Directory of Open Access Journals (Sweden)

    J. C. Manning


    Full Text Available The three dry-fruited species of Anemone sect. Pulsatilloides subsect. Alchemillifoliae (Ranunculaceae from southern Africa are reviewed, with full descriptions and nomenclature, including complete synonomy, taxonomic history with nomenclatural corrections, ecological notes, and distribution. A. tenuifolia (L.f. DC. from the Cape Floristic Region is segregated as ser. Pinnatifoliae from the two summer rainfall species, A. caffra (Eckl. & Zeyh. Harv. and A. fanninnii Harv. ex Masters, which remain in ser. Alchemillifoliae, emphasising the strong vegetative differences between the two series.

  3. Indole Alkaloids from the Sea Anemone Heteractis aurora and Homarine from Octopus cyanea. (United States)

    Shaker, Kamel H; Göhl, Matthias; Müller, Tobias; Seifert, Karlheinz


    The two new indole alkaloids 2-amino-1,5-dihydro-5-(1H-indol-3-ylmethyl)-4H-imidazol-4-one (1), 2-amino-5-[(6-bromo-1H-indol-3-yl)methyl]-3,5-dihydro-3-methyl-4H-imidazol-4-one (2), and auramine (3) have been isolated from the sea anemone Heteractis aurora. Both indole alkaloids were synthesized for the confirmation of the structures. Homarine (4), along with uracil (5), hypoxanthine (6), and inosine (7) have been obtained from Octopus cyanea. Copyright © 2015 Verlag Helvetica Chimica Acta AG, Zürich.

  4. Three New Indole Diterpenoids from the Sea-Anemone-Derived Fungus Penicillium sp. AS-79. (United States)

    Hu, Xue-Yi; Meng, Ling-Hong; Li, Xin; Yang, Sui-Qun; Li, Xiao-Ming; Wang, Bin-Gui


    Three new indolediterpenoids, namely, 22-hydroxylshearinine F ( 1 ), 6-hydroxylpaspalinine ( 2 ), and 7- O -acetylemindole SB ( 3 ), along with eight related known analogs ( 4 - 11 ), were isolated from the sea-anemone-derived fungus Penicillium sp. AS-79. The structures and relative configurations of these compounds were determined by a detailed interpretation of the spectroscopic data, and their absolute configurations were determined by ECD calculations ( 1 and 2 ) and single-crystal X-ray diffraction ( 3 ). Some of these compounds exhibited prominent activity against aquatic and human pathogenic microbes.

  5. Cascading effects of thermally-induced anemone bleaching on associated anemonefish hormonal stress response and reproduction. (United States)

    Beldade, Ricardo; Blandin, Agathe; O'Donnell, Rory; Mills, Suzanne C


    Organisms can behaviorally, physiologically, and morphologically adjust to environmental variation via integrative hormonal mechanisms, ultimately allowing animals to cope with environmental change. The stress response to environmental and social changes commonly promotes survival at the expense of reproduction. However, despite climate change impacts on population declines and diversity loss, few studies have attributed hormonal stress responses, or their regulatory effects, to climate change in the wild. Here, we report hormonal and fitness responses of individual wild fish to a recent large-scale sea warming event that caused widespread bleaching on coral reefs. This 14-month monitoring study shows a strong correlation between anemone bleaching (zooxanthellae loss), anemonefish stress response, and reproductive hormones that decreased fecundity by 73%. These findings suggest that hormone stress responses play a crucial role in changes to population demography following climate change and plasticity in hormonal responsiveness may be a key mechanism enabling individual acclimation to climate change.Elevated temperatures can cause anemones to bleach, with unknown effects on their associated symbiotic fish. Here, Beldade and colleagues show that climate-induced bleaching alters anemonefish hormonal stress response, resulting in decreased reproductive hormones and severely impacted reproduction.

  6. Responses of the sea anemone, Exaiptasia pallida, to ocean acidification conditions and zinc or nickel exposure. (United States)

    Duckworth, Christina G; Picariello, Codie R; Thomason, Rachel K; Patel, Krina S; Bielmyer-Fraser, Gretchen K


    Ocean acidification, caused by increasing atmospheric carbon dioxide (CO 2 ), is a growing concern in marine environments. Land-based sources of pollution, such as metals, have also been a noted problem; however, little research has addressed the combined exposure of both pollutants to coral reef organisms. In this study we examined tissue metal accumulation and physiological effects (activity of anti-oxidant enzymes, catalase and glutathione reductase) in the sea anemone, Exaiptasia pallida after exposure to increased CO 2 , as well as zinc (Zn) or nickel (Ni). After exposure to four concentrations (nominal values=control, 10, 50, 100μg/L) of Zn or Ni over 7days, both metals accumulated in the tissues of E. pallida in a concentration-dependent manner. Anemones exposed to elevated CO 2 (1000ppm) accumulated significant tissue burdens of Zn or Ni faster (by 48h) than those exposed to the same metal concentrations at ambient CO 2 . No differences were observed in catalase activity due to Zn exposure; however, 50μg/L Ni caused a significant increase in catalase activity at ambient CO 2 . No significant effect on catalase activity from CO 2 exposure alone was observed. Glutathione reductase activity was affected by increased Zn or Ni exposure and those effects were influenced by increased CO 2 . Results of this study provide insight into the toxic mechanisms and environmental implications of CO 2 and Zn or Ni exposure to the cnidarian E. pallida. Copyright © 2016 Elsevier B.V. All rights reserved.

  7. New Kunitz-Type HCRG Polypeptides from the Sea Anemone Heteractis crispa

    Directory of Open Access Journals (Sweden)

    Irina Gladkikh


    Full Text Available Sea anemones are a rich source of Kunitz-type polypeptides that possess not only protease inhibitor activity, but also Kv channels toxicity, analgesic, antihistamine, and anti-inflammatory activities. Two Kunitz-type inhibitors belonging to a new Heteractis crispa RG (HCRG polypeptide subfamily have been isolated from the sea anemone Heteractis crispa. The amino acid sequences of HCRG1 and HCRG2 identified using the Edman degradation method share up to 95% of their identity with the representatives of the HCGS polypeptide multigene subfamily derived from H. crispa cDNA. Polypeptides are characterized by positively charged Arg at the N-terminus as well as P1 Lys residue at their canonical binding loop, identical to those of bovine pancreatic trypsin inhibitor (BPTI. These polypeptides are shown by our current evidence to be more potent inhibitors of trypsin than the known representatives of the HCGS subfamily with P1Thr. The kinetic and thermodynamic characteristics of the intermolecular interactions between inhibitors and serine proteases were determined by the surface plasmon resonance (SPR method. Residues functionally important for polypeptide binding to trypsin were revealed using molecular modeling methods. Furthermore, HCRG1 and HCRG2 possess anti-inflammatory activity, reducing tumor necrosis factor-α (TNF-α and interleukin 6 (IL-6 secretions, as well as proIL-1β expression in lipopolysaccharide (LPS-activated macrophages. However, there was no effect on nitric oxide (NO generation.

  8. Sphingolipid Metabolism of a Sea Anemone Is Altered by the Presence of Dinoflagellate Symbionts. (United States)

    Kitchen, Sheila A; Poole, Angela Z; Weis, Virginia M


    In host-microbe interactions, signaling lipids function in interpartner communication during both the establishment and maintenance of associations. Previous evidence suggests that sphingolipids play a role in the mutualistic cnidarian-Symbiodinium symbiosis. Exogenously applied sphingolipids have been shown to alter this partnership, though endogenous host regulation of sphingolipids by the sphingosine rheostat under different symbiotic conditions has not been characterized. The rheostat regulates levels of pro-survival sphingosine-1-phosphate (S1P) and pro-apoptotic sphingosine (Sph) through catalytic activities of sphingosine kinase (SPHK) and S1P phosphatase (SGPP). The role of the rheostat in recognition and establishment of cnidarian-Symbiodinium symbiosis was investigated in the sea anemone Aiptasia pallida by measuring gene expression, protein levels, and sphingolipid metabolites in symbiotic, aposymbiotic, and newly recolonized anemones. Comparison of two host populations showed that symbiotic animals from one population had lower SGPP gene expression and Sph lipid concentrations compared to aposymbiotic animals, while the other population had higher S1P concentrations than their aposymbiotic counterparts. In both populations, the host rheostat trended toward host cell survival in the presence of symbionts. Furthermore, upregulation of both rheostat enzymes on the first day of host recolonization by symbionts suggests a role for the rheostat in host-symbiont recognition during symbiosis onset. Collectively, these data suggest a regulatory role of sphingolipid signaling in cnidarian-Symbiodinium symbiosis and symbiont uptake.

  9. Conditions of the occurrence of Anemone sylvestris in a kettle hole in north-eastern Poland

    Directory of Open Access Journals (Sweden)

    Anna J. Kwiatkowska-Falińska


    Full Text Available The research, in 2004, was focused on the whole population of Anemone sylvestris (Snowdrop Windflower present in the area of a kettle hole (0.8 km2 in north-eastern Poland (52°50’00’’N; 23°11’20’’E. The location of 56 clumps of generative specimens was surveyed. They numbered from several to approx. 1500 specimens. The number of generative specimens in this population exceeded 10 000. On account of this, it is a unique stand of A. sylvestris in Poland. The relationship between the occurrence of the Snowdrop Windflower and the presence of kame hills and ridges has been proven. Low slopes of kame with an inclination of 10-20o, and a north-eastern or eastern exposition has been found as the local ecological optimum for this species. Research carried out in 1970-2001 on 5 permanent plots (25 m2 each has shown that: 1 Anemone sylvestris is an essential element of xerothermic grasslands of the order Festucetalia valesiacae; 2 the species suddenly withdraws from the parts of land on which woody species have already reached the shrub layer; 3 the greatest danger for the population of A. sylvestris in this area is the process of secondary succession initiated by the discontinuation of grazing on the kame hills.

  10. New Kunitz-Type HCRG Polypeptides from the Sea Anemone Heteractis crispa. (United States)

    Gladkikh, Irina; Monastyrnaya, Margarita; Zelepuga, Elena; Sintsova, Oksana; Tabakmakher, Valentin; Gnedenko, Oksana; Ivanov, Alexis; Hua, Kuo-Feng; Kozlovskaya, Emma


    Sea anemones are a rich source of Kunitz-type polypeptides that possess not only protease inhibitor activity, but also Kv channels toxicity, analgesic, antihistamine, and anti-inflammatory activities. Two Kunitz-type inhibitors belonging to a new Heteractis crispa RG (HCRG) polypeptide subfamily have been isolated from the sea anemone Heteractis crispa. The amino acid sequences of HCRG1 and HCRG2 identified using the Edman degradation method share up to 95% of their identity with the representatives of the HCGS polypeptide multigene subfamily derived from H. crispa cDNA. Polypeptides are characterized by positively charged Arg at the N-terminus as well as P1 Lys residue at their canonical binding loop, identical to those of bovine pancreatic trypsin inhibitor (BPTI). These polypeptides are shown by our current evidence to be more potent inhibitors of trypsin than the known representatives of the HCGS subfamily with P1Thr. The kinetic and thermodynamic characteristics of the intermolecular interactions between inhibitors and serine proteases were determined by the surface plasmon resonance (SPR) method. Residues functionally important for polypeptide binding to trypsin were revealed using molecular modeling methods. Furthermore, HCRG1 and HCRG2 possess anti-inflammatory activity, reducing tumor necrosis factor-α (TNF-α) and interleukin 6 (IL-6) secretions, as well as proIL-1β expression in lipopolysaccharide (LPS)-activated macrophages. However, there was no effect on nitric oxide (NO) generation.

  11. Decapod crustaceans associated with the snakelock anemone Anemonia sulcata. Living there or just passing by?

    Directory of Open Access Journals (Sweden)

    Ricardo Calado


    Full Text Available The present work identifies the decapod crustaceans that associate with Anemonia sulcata on the southwestern Atlantic coast of Portugal and characterises their host use pattern. It determines whether the anemone is monopolised by any species, resulting in the exclusion of conspecifics or other decapods and, under laboratory conditions, it evaluates the degree of association between each species and A. sulcata. From all sampled anemones, 79% harboured at least 1 decapod crustacean, with the majority displaying either one or two specimens (32 and 24%, respectively. The most abundant species were the shrimp Periclimenes sagittifer and the crab Inachus phalangium (representing 36 and 31% of collected specimens, respectively, which displayed lasting associations and were commonly recorded among the tentacles of the host. The species Eualus occultus, E. complex cranchii, Clibanarius erythropus, Maja brachydactyla, Pilumnus hirtellus and Polybius (Necora puber displayed short-term associations, were mainly present on the substratum near the base, and avoided the tentacles of A. sulcata. Periclimenes sagittifer and I. phalangium were only recorded alone or in heterosexual pairs, appearing to efficiently defend their host against conspecifics. The majority of recorded species only seem to temporarily associate with A. sulcata, in order to seek protection from predators when other shelters are unavailable.

  12. Bacterial aggregates in the tentacles of the sea anemone Metridium senile (United States)

    Schuett, Christian; Doepke, Hilke; Grathoff, Annette; Gedde, Michael


    This paper provides first information on organ-like bacterial aggregates in the tentacles of the sea anemone Metridium senile. The specimens were collected from waters near Helgoland (German Bight, North Sea) and the Orkney Islands. Tentacles were prepared for morphological inspection by light and scanning electron microscopy as well as for the phylogenetic analysis of endocytic bacteria. Bacterial aggregates are located in caverns of the tentacles’ epidermis. The aggregates are enwrapped in thin envelopes, which contain coccoid and/or rod-shaped tightly packed bacteria of different division states. Most of the bacterial cells are connected by fine filamentous structures. The phylogenetic determination is based on the sequence data of the 16S rDNA derived from tentacle material. Sequence analysis revealed three different subgroups of intratentacular proteobacteria. The dominant band, detected in all of the samples tested, showed a close relationship (98%) to a gram-negative Endozoicimonas elysicola. Two bands, only detected in tentacles of M. senile from Helgoland were assigned to Pseudomonas saccherophilia (99%), a knallgas bacterium, and to Ralstonia pickettii (100%). The bacteria represent a specific bacterial community. Their DGGE profiles do not correspond to the profiles of the planktonic bacteria generated from seawater close to the habitats of the anemones. The allocation of DNA sequences to the different morphotypes, their isolation, culturing and the elucidation of the physiological functions of intratentacular bacteria are in progress.


    Chadwick, Nanette E


    Corallimorpharians are sessile cnidarians that are morphologically similar to the actiniarian sea anemones and scleractinian corals. This study describes for the first time the behavioral mechanism and effects of aggression by a corallimorpharian. Polyps of the temperate clonal corallimorpharian Corynactis californica extruded their mesenteries and associated filaments onto members of certain species of sea anemones and corals. They did not exhibit this behavior intraspecifically, and members of different clones of C. californica remained expanded upon contact. In contrast, members of four species of corals and zoanthids responded to contact with C. californica by contracting their tentacles, and members of three sea anemone species bent or moved away, detached from the substrate, or attacked using their aggressive structures. When interspecific contact was prolonged, individuals of C. californica extruded filaments onto, and killed polyps of, the sea anemones Anthopleura elegantissima and Metridium senile within 3 weeks, and the corals Astrangia lajollaensis and Balanophyllia elegans within 4-10 months under laboratory conditions. The use of extruded mesenterial filaments by C. californica to attack members of other anthozoan species is similar to the aggressive behavior exhibited by many scleractinian reef corals. Field observations suggest that C. californica may use this agonistic behavior during interspecific competition for space on hard marine substrate.

  14. An assemblage of the host anemone Heteractis magnifica in the northern Red Sea, and distribution of the resident anemonefish

    DEFF Research Database (Denmark)

    Brolund, Thea Marie; Tychsen, Anders; Nielsen, Lis Engdahl


    correlated with depth. The shallow waters of the anemone assemblage contained few mainly small, solitary actinians. There seemed to be a tendency for solitary actinians to cluster once they reached a certain size-range. The resident anemonefishes Amphiprion bicinctus and Dascyllus trimaculatus were present...

  15. Study the antimicrobial activity of six marine sponges and three parts of sea anemone on Candida albicans

    Directory of Open Access Journals (Sweden)

    Homa Hamayeli


    Full Text Available Objective: To evaluate the antifungal and inhibitory activity of six different species of marine sponges and one species of sea anemone that were collected from the Persian Gulf on the growth of Candida albicans (C. albicans. Methods: Sea anemone and six different sponges were gathered from the Persian Gulf and extracted by methanol macerated with dichloromethane solvents. The activity of each extracts against C. albicans was determined by paper disc diffusion and agar well diffusion methods. Also, minimum inhibitory concentration and minimal bactericidal concentration of each extract were determined. Results: The finding of current research confirmed that all sponge extracts had sufficient inhibitory effect against C. albicans but the extracts of sponge type 2 and 5 had the best inhibitory effect on C. albicans and their zones of inhibition were 45 mm and 38 mm, respectively. The tentacle of sea anemone had the best inhibitory effect against C. albicans compared to other part of the body and its zone of inhibition was 41 mm. Besides, the sponge type 5 extracts had the best minimum inhibitory concentration and minimal bactericidal concentration values with 6.25 and 12.5 mg/mL, respectively. Conclusions: It could be concluded that the crude extracts of six different sponges and sea anemone have high potential to produce broad spectral antifungal activity with minimal concentration against different pathogenic fungi.

  16. Trace element profiles of the sea anemone Anemonia viridis living nearby a natural CO2 vent. (United States)

    Horwitz, Rael; Borell, Esther M; Fine, Maoz; Shaked, Yeala


    Ocean acidification (OA) is not an isolated threat, but acts in concert with other impacts on ecosystems and species. Coastal marine invertebrates will have to face the synergistic interactions of OA with other global and local stressors. One local factor, common in coastal environments, is trace element contamination. CO2 vent sites are extensively studied in the context of OA and are often considered analogous to the oceans in the next few decades. The CO2 vent found at Levante Bay (Vulcano, NE Sicily, Italy) also releases high concentrations of trace elements to its surrounding seawater, and is therefore a unique site to examine the effects of long-term exposure of nearby organisms to high pCO2 and trace element enrichment in situ. The sea anemone Anemonia viridis is prevalent next to the Vulcano vent and does not show signs of trace element poisoning/stress. The aim of our study was to compare A. viridis trace element profiles and compartmentalization between high pCO2 and control environments. Rather than examining whole anemone tissue, we analyzed two different body compartments-the pedal disc and the tentacles, and also examined the distribution of trace elements in the tentacles between the animal and the symbiotic algae. We found dramatic changes in trace element tissue concentrations between the high pCO2/high trace element and control sites, with strong accumulation of iron, lead, copper and cobalt, but decreased concentrations of cadmium, zinc and arsenic proximate to the vent. The pedal disc contained substantially more trace elements than the anemone's tentacles, suggesting the pedal disc may serve as a detoxification/storage site for excess trace elements. Within the tentacles, the various trace elements displayed different partitioning patterns between animal tissue and algal symbionts. At both sites iron was found primarily in the algae, whereas cadmium, zinc and arsenic were primarily found in the animal tissue. Our data suggests that A. viridis

  17. Development and characterization of new polymorphic microsatellite markers in four sea anemones: Entacmaea quadricolor, Heteractis magnifica, Stichodactyla gigantea, and Stichodactyla mertensii

    KAUST Repository

    Gatins, Remy


    Relatively few studies have investigated the genetic population structure of sea anemones. This is particularly true for sea anemones that host some of the most iconic fishes on coral reefs, the anemonefishes. One of the main reasons for this knowledge gap is the lack of appropriate genetic markers. We developed and characterized a total of 47 novel polymorphic microsatellite markers for four host sea anemone species from the Indo-Pacific: Entacmaea quadricolor (n = 16 microsatellite markers), Heteractis magnifica (n = 8), Stichodactyla mertensii (n = 13), and Stichodactyla gigantea (n = 10). Here, we report genetic diversity statistics from two different sampling locations for each anemone species. Overall, we found that most markers were highly polymorphic. On average, we found a mean of seven alleles per locus. Observed and expected heterozygosities displayed high variation among loci, ranging from 0.033 to 0.980 and from 0.038 to 0.927, respectively. Only four loci showed deviations of Hardy–Weinberg equilibrium in both populations and were identified as having null alleles. Additionally, two pairs of loci were identified to be in linkage disequilibrium in only one population. Host anemones are highly sought after in the marine aquarium trade and are susceptible to thermal bleaching. Although most studies focus on their obligate symbionts (the anemonefish), genetic analyses of host sea anemones can expand our understanding of the biology, connectivity, and population structure of these organisms and potentially help develop conservation strategies that will aid both the host and its symbionts.

  18. Analgesic and CNS Depressant Activities of Sea Anemone Heteractis aurora Nematocyst Toxin. (United States)

    Thangaraj, Sengapillai; Bragadeeswaran, Subramanian; Srikumaran, Natarajah; Suguna, Anbukkarasu


    Marine organisms are the excellent sources for biologically active compounds. Cnidarian venoms are potentially valuable materials used for biomedical research and drug development. The present work was carried out to analyse haemolytic, analgesic and CNS depressant activity of sea anemone Heteractis aurora. In haemolytic assay, among the five different RBC blood cells, the chicken blood exhibited maximum hemolytic activity of 64 Hemolytic Unit (HU). The maximum Analgesic Ratio (AR) of 5 recorded at 15 and 30 min interval and minimum was recorded after 45, 60 and 120 min time intervals. In jumping response activity, the maximum of 5 AR recorded at 15, 30 & 45 min and minimum was recorded at 90 & 120 min time intervals. The maximum decrease of depressant activity of 45.07% was determined in CNS depressant activity. Anti-inflammatory activity showed significant inhibition by crude extract of Heteractis aurora.

  19. Dangerous reef aquaristics: Palytoxin of a brown encrusting anemone causes toxic corneal reactions. (United States)

    Ruiz, Yasmin; Fuchs, Joan; Beuschel, Ralf; Tschopp, Markus; Goldblum, David


    Although frequently observed in domestic saltwater aquariums, literature on exposure to palytoxin (PTX) of encrusting anemones (Zoanthidea) kept in aquariums is rare. Handling these animals for propagation purposes or during cleaning work can lead to dermal, ocular or respiratory contact with the PTX generated by some Zoanthids. The present study describes a case of ocular exposure to liquid from a Zoanthid, which led to corneal ulcers. The patient also suffered from systemic symptoms of dyspnea and shivering and a suspected rhabdomyolysis, which required monitoring in the Intensive Care Unit. After symptomatic treatment provided insufficient results, the corneal ulcers improved with an amniotic membrane transplantation. A review of the literature regarding ocular exposures to this diverse order of Hexacorallia reveals that severe and systemic symptoms can develop with minimal contact. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Edwardsiella andrillae, a New Species of Sea Anemone from Antarctic Ice (United States)

    Daly, Marymegan; Rack, Frank; Zook, Robert


    Exploration of the lower surface of the Ross Ice Shelf in Antarctica by the Submersible Capable of under-Ice Navigation and Imaging (SCINI) remotely operated vehicle discovered a new species of sea anemone living in this previously undocumented ecosystem. This discovery was a significant outcome of the Coulman High Project’s geophysical and environmental fieldwork in 2010-2011 as part of the ANDRILL (ANtarctic geologic DRILLing) program. Edwardsiella andrillae n. sp., lives with most of its column in the ice shelf, with only the tentacle crown extending into the seawater below. In addition to being the only Antarctic representative of the genus, Edwardsiella andrillae is distinguished from all other species of the genus in the number of tentacles and in the size and distribution of cnidae. The anatomy and histology of Edwardsiella andrillae present no features that explain how this animal withstands the challenges of life in such an unusual habitat. PMID:24349517

  1. Laboratory-Cultured Strains of the Sea Anemone Exaiptasia Reveal Distinct Bacterial Communities

    KAUST Repository

    Herrera Sarrias, Marcela


    Exaiptasia is a laboratory sea anemone model system for stony corals. Two clonal strains are commonly used, referred to as H2 and CC7, that originate from two genetically distinct lineages and that differ in their Symbiodinium specificity. However, little is known about their other microbial associations. Here, we examined and compared the taxonomic composition of the bacterial assemblages of these two symbiotic Exaiptasia strains, both of which have been cultured in the laboratory long-term under identical conditions. We found distinct bacterial microbiota for each strain, indicating the presence of host-specific microbial consortia. Putative differences in the bacterial functional profiles (i.e., enrichment and depletion of various metabolic processes) based on taxonomic inference were also detected, further suggesting functional differences of the microbiomes associated with these lineages. Our study contributes to the current knowledge of the Exaiptasia holobiont by comparing the bacterial diversity of two commonly used strains as models for coral research.

  2. Edwardsiella andrillae, a new species of sea anemone from Antarctic ice.

    Directory of Open Access Journals (Sweden)

    Marymegan Daly

    Full Text Available Exploration of the lower surface of the Ross Ice Shelf in Antarctica by the Submersible Capable of under-Ice Navigation and Imaging (SCINI remotely operated vehicle discovered a new species of sea anemone living in this previously undocumented ecosystem. This discovery was a significant outcome of the Coulman High Project's geophysical and environmental fieldwork in 2010-2011 as part of the ANDRILL (ANtarctic geologic DRILLing program. Edwardsiella andrillae n. sp., lives with most of its column in the ice shelf, with only the tentacle crown extending into the seawater below. In addition to being the only Antarctic representative of the genus, Edwardsiella andrillae is distinguished from all other species of the genus in the number of tentacles and in the size and distribution of cnidae. The anatomy and histology of Edwardsiella andrillae present no features that explain how this animal withstands the challenges of life in such an unusual habitat.

  3. Daily cycle in oxygen consumption by the sea anemone Nematostella vectensis Stephenson

    Directory of Open Access Journals (Sweden)

    Amy E. Maas


    Full Text Available In bilaterian animals, the circadian clock is intimately involved in regulating energetic metabolism. Although cnidarians exhibit diel behavioral rhythms including cycles in locomotor activity, tentacle extension and spawning, daily cycles in cnidarian metabolism have not been described. To explore a possible circadian metabolic cycle, we maintained the anemone Nematostella vectensis in a 12 h light/dark cycle, a reversed light cycle, or in constant darkness. Oxygen consumption rates were measured at intervals using an optical oxygen meter. Respiration rates responded to entrainment with higher rates during light periods. During a second experiment with higher temporal resolution, respiration rates peaked late in the light period. The diel pattern could be detected after six days in constant darkness. Together, our results suggest that respiration rates in Nematostella exhibit a daily cycle that may be under circadian control and that the cycle in respiration rate is not driven by the previously described nocturnal increase in locomotor activity in this species.

  4. Characterization of circadian behavior in the starlet sea anemone, Nematostella vectensis.

    Directory of Open Access Journals (Sweden)

    William D Hendricks

    Full Text Available Although much is known about how circadian systems control daily cycles in the physiology and behavior of Drosophila and several vertebrate models, marine invertebrates have often been overlooked in circadian rhythms research. This study focuses on the starlet sea anemone, Nematostella vectensis, a species that has received increasing attention within the scientific community for its potential as a model research organism. The recently sequenced genome of N. vectensis makes it an especially attractive model for exploring the molecular evolution of circadian behavior. Critical behavioral data needed to correlate gene expression patterns to specific behaviors are currently lacking in N. vectensis.To detect the presence of behavioral oscillations in N. vectensis, locomotor activity was evaluated using an automated system in an environmentally controlled chamber. Animals exposed to a 24 hr photoperiod (12 hr light: 12 hr dark exhibited locomotor behavior that was both rhythmic and predominantly nocturnal. The activity peak occurred in the early half of the night with a 2-fold increase in locomotion. Upon transfer to constant lighting conditions (constant light or constant dark, an approximately 24 hr rhythm persisted in most animals, suggesting that the rhythm is controlled by an endogenous circadian mechanism. Fourier analysis revealed the presence of multiple peaks in some animals suggesting additional rhythmic components could be present. In particular, an approximately 12 hr oscillation was often observed. The nocturnal increase in generalized locomotion corresponded to a 24 hr oscillation in animal elongation.These data confirm the presence of a light-entrainable circadian clock in Nematostella vectensis. Additional components observed in some individuals indicate that an endogenous clock of approximately 12 hr frequency may also be present. By describing rhythmic locomotor behavior in N. vectensis, we have made important progress in developing

  5. Evidence for two populations of hair bundles in the sea anemone, Nematostella vectensis. (United States)

    Menard, Shelcie S; Watson, Glen M


    Cytochalasin D (CD) was employed to disrupt F-actin within stereocilia of anemone hair bundles. CD treatment decreases the abundance of hair bundles (by 85%) while significantly impairing predation. The remaining hair bundles are 'CD-resistant.' Surprisingly, the morphology and F-actin content of resistant hair bundles are comparable to those of untreated controls. However, the resistant hair bundles fail to respond normally to the N-acetylated sugar, NANA, by elongating. Instead, they remain at resting length. Immediately after CD treatment, when only CD-resistant hair bundles are present, nematocyst discharge is normal into targets touched to tentacles in the absence of vibrations (i.e., baseline) but fails to increase normally in the presence of nearby vibrations at 56Hz, a key frequency. After CD treatment, the abundance of hair bundles recovers to control levels within three hours. At 2h after CD treatment, when CD-resistant and CD-sensitive hair bundles are both present, but a full-recovery is not yet complete, somewhat enhanced discharge of nematocysts occurs into targets touched to tentacles in the presence of nearby vibrations at 56Hz (at least as compared to the response of CD-treated animals to contact with test probes in the absence of vibrations). Additionally, at 2h after CD-treatment, prey capture recovers to normal. Thus, two populations of hair bundles may be present on tentacles of sea anemones: those that are CD-resistant and those that are CD-sensitive. The functions of these hair bundles may be distinct. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Growth of the Antarctic octocoral Primnoella scotiae and predation by the anemone Dactylanthus antarcticus (United States)

    Peck, Lloyd S.; Brockington, Simon


    Growth rates in Antarctic marine ectotherms have been demonstrated to be slowed by two to five times compared to shallow-water temperate species, with no previous reports for octocorals. Here growth rates were estimated in the single axis, non-branching Antarctic octocoral Primnoella scotiae using repeated in situ length measures covering both summer and winter periods, for tagged colonies from three sites at Signy Island over a two year period. Mean rates of length increase at the different sites ranged from 0.96 mm yr-1 to 55.3 mm yr-1. The fastest individual colony growth rate at any site ranged from 2.55 mm yr-1 to 175.6 mm yr-1. The mean of the fastest growth rates across all sites was 33.0 mm yr-1±14.7 (s.e.). Growth was significantly different between sites, and also between seasons and years. The mean overall increase in diameter of the average sized colony in the study (222.5 mm in axis length) was 0.053 mm yr-1. This is the slowest reported growth rate of any octocoral to date, and is five times slower than growth in most cold water octocorals. During the study it was noted that colonies were being attacked and consumed by the anemone Dactylanthus antarcticus. At one of the sites studied, between 5% and 8% of colonies surveyed were attacked each month. Anemone dispersal was via whole body inflation and drifting to new prey colonies that were attached to using tentacle-like column protuberances.

  7. Ocurrence of the sea anemone Telmatactis panamensis (Verrill, 1869 (Cnidaria: Anthozoa: Actiniaria at Isla del Coco National Park, Costa Rica

    Directory of Open Access Journals (Sweden)

    Fabián H. Acuña


    Full Text Available The sea anemone fauna of Isla del Coco National Park (also known as Cocos Island Nacional Park, Pacific Costa Rica is poorly known. In the present work we report the first occurrence of the species Telmatactis panamensis. Individuals of this sea anemone (n=24 were collected at Chatham Bay intertidal and at 15m depth in Punta Ulloa, in both cases attached to rocks; during the expedition UCR-UNA-COCO-I in April 2010. We provide photographs of live individuals, external anatomy and an inventory of cnidae of the studied specimens. Possibly this species is extended to greater depth as observed by other authors in the Galápagos Islands.

  8. Stylobates birtlesi sp. n., a new species of carcinoecium-forming sea anemone (Cnidaria, Actiniaria, Actiniidae from eastern Australia

    Directory of Open Access Journals (Sweden)

    Andrea Crowther


    Full Text Available We describe a new species of carcinoecium-forming sea anemone, Stylobates birtlesi sp. n., from sites 680-960 m deep in the Coral Sea, off the coast of Queensland, Australia. An anemone of this genus settles on a gastropod shell inhabited by a hermit crab, then covers and extends the shell to produce a chitinous structure termed a carcinoecium. Stylobates birtlesi sp. n. is symbiotic with the hermit crab Sympagurus trispinosus (Balss, 1911. The nature of marginal sphincter muscle and nematocyst size and distribution distinguish Stylobates birtlesi sp. n. from other species in the genus. The four known species are allopatric, each inhabiting a separate ocean basin of the Indo-west Pacific. We also extend the known range of Stylobates loisetteae in the Indian Ocean off the coast of Western Australia.

  9. Morphology of the pelvis and hind limb of the red panda (Ailurus fulgens) evidenced by gross osteology, radiography and computed tomography. (United States)

    Makungu, M; du Plessis, W M; Groenewald, H B; Barrows, M; Koeppel, K N


    The red panda (Ailurus fulgens) is a quadrupedal arboreal animal primarily distributed in the Himalayas and southern China. It is a species commonly kept in zoological collections. This study was carried out to describe the morphology of the pelvis and hind limb of the red panda evidenced by gross osteology, radiography and computed tomography as a reference for clinical use and identification of skeletons. Radiography of the pelvis and right hind limb was performed in nine and seven animals, respectively. Radiographic findings were correlated with bone specimens from three adult animals. Computed tomography of the torso and hind limb was performed in one animal. The pelvic bone had a wide ventromedial surface of the ilium. The trochlea of the femur was wide and shallow. The patella was similar to that seen in feline species. The medial fabella was not seen radiographically in any animal. The cochlea grooves of the tibia were shallow with a poorly defined intermediate ridge. The trochlea of the talus was shallow and presented with an almost flattened medial ridge. The tarsal sesamoid bone was always present. The lateral process of the base of the fifth metatarsal (MT) bone was directed laterally. The MT bones were widely spaced. The morphology of the pelvis and hind limb of the red panda indicated flexibility of the pelvis and hind limb joints as an adaptation to an arboreal quadrupedal lifestyle. © 2014 Blackwell Verlag GmbH.

  10. Reproductive biology of the sea anemone shrimp Periclimenes rathbunae (Caridea, Palaemonidae, Pontoniinae, from the Caribbean coast of Costa Rica

    Directory of Open Access Journals (Sweden)

    Juan Carlos Azofeifa-Solano


    Full Text Available Caridean shrimps are a highly diverse group and many species form symbiotic relationships with different marine invertebrates. Periclimenes rathbunae is a brightly colored shrimp that lives predominantly in association with sea anemones. Information about the reproductive ecology of the species is scarce. Therefore, we collected 70 ovigerous females inhabiting the sun sea anemone Stichodactyla helianthus in coral reefs from the southern Caribbean coast of Costa Rica. Females produced on average 289 ± 120 embryos. The volume of recently-produced embryos was on average 0.038 mm3, and embryo volume increased by 192% during the incubation period. The average embryo mortality during embryogenesis was 24%. The reproductive output was 0.24 ± 0.094, considerably higher than in many other pontoniine shrimps. Females carrying embryos close to hatching showed fully developed ovaries, suggesting consecutive spawning. We assume that the sheltered habitat, living on sea anemones, allows P. rathbunae to allocate more energy in embryo production than most other free-living caridean shrimps. This is the first record of P. rathbunae for Costa Rica.

  11. Abundance of anemone fishes in North Bay Island and mass culture of live food organisms for their larval rearing

    Directory of Open Access Journals (Sweden)

    Rajaram Rajendran


    Full Text Available Understanding the transect survey for abundance of anemone fishes and other living organisms is important to asses reef associated fish diversity in North Bay island. The percentage distribution of 10 different substratum from the disturbed, semi-disturbed and undisturbed areas was recorded during the survey in North Bay islands during November 2009 to April 2010. The survey observations reveal that the fishes were the dominant groups followed by mollusks, lobsters and octopus. There are 5 different anemone fishes were collected during the transect survey and their distribution is more in undisturbed area. We are standardizing the different mass culture techniques for production of phytoplankton and zooplankton for the nutritional source for the anemone fish larvae. Monitoring the water quality parameters and culture the phytoplankton and zooplankton used in different culture media with 2 adjustment studies like with and without salinity adjustment. The results of this experiment indicate that zooplankton was rich in protein and fat content and it will be used as high nutritional source for feeding fish larvae.

  12. Fine-scale population structure of two anemones (Stichodactyla gigantea and Heteractis magnifica) in Kimbe Bay, Papua New Guinea

    KAUST Repository

    Gatins, Remy


    Anemonefish are one of the main groups that have been used over the last decade to empirically measure larval dispersal and connectivity in coral reef populations. A few species of anemones are integral to the life history of these fish, as well as other obligate symbionts, yet the biology and population structure of these anemones remains poorly understood. The aim of this study was to measure the genetic structure of these anemones within and between two reefs in order to assess their reproductive mode and dispersal potential. To do this, we sampled almost exhaustively two anemones species (Stichodactyla gigantea and Heteractis magnifica) at two small islands in Kimbe Bay (Papua New Guinea) separated by approximately 25 km. Both the host anemones and the anemonefish are heavily targeted for the aquarium trade, in addition to the populations being affected by bleaching pressures (Hill and Scott 2012; Hobbs et al. 2013; Saenz- Agudelo et al. 2011; Thomas et al. 2014), therefore understanding their biology is crucial for better management strategies. Panels of microsatellite markers were developed for each species using next generation sequencing tools. Clonality analyses confirm six pairs of identical genotypes for S. gigantea (n=350) and zero for H. magnifica (n=128), indicating presence/absence of asexual reproduction in this region. S. gigantea showed low structure between islands (FST= 0.003, p-value= 0.000), however, even if the majority of the individuals were unrelated (r~0), 81 families that shared 50% of their genetic material formed from two to four members were found. Out of these families, 45% were found with individuals only within Tuare Island, 11% only in Kimbe Island, and 44% were sharing individuals among islands. In comparison, H. magnifica showed no structure (FST= 0.002, p-value= 0.278), mean relatedness indicated the majority of individuals were unrelated, and 31 families were identified. Families again consisted from two to four members and

  13. Trace element profiles of the sea anemone Anemonia viridis living nearby a natural CO2 vent

    Directory of Open Access Journals (Sweden)

    Rael Horwitz


    Full Text Available Ocean acidification (OA is not an isolated threat, but acts in concert with other impacts on ecosystems and species. Coastal marine invertebrates will have to face the synergistic interactions of OA with other global and local stressors. One local factor, common in coastal environments, is trace element contamination. CO2 vent sites are extensively studied in the context of OA and are often considered analogous to the oceans in the next few decades. The CO2 vent found at Levante Bay (Vulcano, NE Sicily, Italy also releases high concentrations of trace elements to its surrounding seawater, and is therefore a unique site to examine the effects of long-term exposure of nearby organisms to high pCO2 and trace element enrichment in situ. The sea anemone Anemonia viridis is prevalent next to the Vulcano vent and does not show signs of trace element poisoning/stress. The aim of our study was to compare A. viridis trace element profiles and compartmentalization between high pCO2 and control environments. Rather than examining whole anemone tissue, we analyzed two different body compartments—the pedal disc and the tentacles, and also examined the distribution of trace elements in the tentacles between the animal and the symbiotic algae. We found dramatic changes in trace element tissue concentrations between the high pCO2/high trace element and control sites, with strong accumulation of iron, lead, copper and cobalt, but decreased concentrations of cadmium, zinc and arsenic proximate to the vent. The pedal disc contained substantially more trace elements than the anemone’s tentacles, suggesting the pedal disc may serve as a detoxification/storage site for excess trace elements. Within the tentacles, the various trace elements displayed different partitioning patterns between animal tissue and algal symbionts. At both sites iron was found primarily in the algae, whereas cadmium, zinc and arsenic were primarily found in the animal tissue. Our data

  14. Prolonged exposure to elevated CO2 promotes growth of the algal symbiont Symbiodinium muscatinei in the intertidal sea anemone Anthopleura elegantissima

    Directory of Open Access Journals (Sweden)

    Trisha Towanda


    Some photosynthetic organisms benefit from elevated levels of carbon dioxide, but studies on the effects of elevated PCO2 on the algal symbionts of animals are very few. This study investigated the impact of hypercapnia on a photosynthetic symbiosis between the anemone Anthopleura elegantissima and its zooxanthella Symbiodinium muscatinei. Anemones were maintained in the laboratory for 1 week at 37 Pa PCO2 and pH 8.1. Clonal pairs were then divided into two groups and maintained for 6 weeks under conditions naturally experienced in their intertidal environment, 45 Pa PCO2, pH 8.1 and 231 Pa PCO2, pH 7.3. Respiration and photosynthesis were measured after the 1-week acclimation period and after 6 weeks in experimental conditions. Density of zooxanthellal cells, zooxanthellal cell size, mitotic index and chlorophyll content were compared between non-clonemate anemones after the 1-week acclimation period and clonal anemones at the end of the experiment. Anemones thrived in hypercapnia. After 6 weeks, A. elegantissima exhibited higher rates of photosynthesis at 45 Pa (4.2 µmol O2 g−1 h−1 and 231 Pa (3.30 µmol O2 g−1 h−1 than at the initial 37 Pa (1.53 µmol O2 g−1 h−1. Likewise, anemones at 231 Pa received more of their respiratory carbon from zooxanthellae (CZAR  = 78.2% than those at 37 Pa (CZAR  = 66.6% but less than anemones at 45 Pa (CZAR  = 137.3%. The mitotic index of zooxanthellae was significantly greater in the hypercapnic anemones than in anemones at lower PCO2. Excess zooxanthellae were expelled by their hosts, and cell densities, cell diameters and chlorophyll contents were not significantly different between the groups. The response of A. elegantissima to hypercapnic acidification reveals the potential adaptation of an intertidal, photosynthetic symbiosis for high PCO2.

  15. Nomenclator Actinologicus seu Indices Ptychodactiariarum, Corallimorphariarum et Actiniarianum comprising indexes of the taxa, synonyms, authors and geographical distributions of the sea anemones of the world included in Professor Oskar Carlgren's 1949 survey

    NARCIS (Netherlands)

    Williams, R.B.


    In 1949, the late Professor Oskar Carlgren of Lund, Sweden, published a bibliographical survey of the sea anemones of the world, comprising 42 families, 201 genera and 848 species. The survey is an essential starting point for any taxonomic or zoogeographical work on sea anemones. However, the

  16. The coronary vasoconstrictor action of extract IV from the dahlia sea anemone Tealia felina L. (United States)

    Konya, R S; Elliott, R C


    Extract IV, a partially purified preparation of the toxin from the sea anemone Tealia felina, produced marked bradycardia and arrhythmias in the rat in vivo. In the Langendorff rat heart preparation perfused at constant pressure extract IV (0.0224 AU/ml) reduced the force of contraction by 81.3 +/- 7.2%, n = 6, and the coronary flow by 82.0 +/- 4.7%, n = 5. When the preparation was perfused at constant flow rate, extract IV (0.072 AU/ml) increased the coronary circulation resistance from 3.76 +/- 1.09 (control) to 36.94 +/- 12.26 mmHg/ml/min. The force of contraction was also markedly reduced. The extract produced bradycardia in preparations perfused at constant pressure but not in those perfused at constant flow rate. The extract did not affect isolated atria preparations. It was concluded that the bradycardia produced in vivo and in preparations perfused in vitro at constant pressure was probably secondary to the coronary vasospasm produced, which could contribute to the cardiotoxicity of the extract.

  17. Characterization of Morphological and Cellular Events Underlying Oral Regeneration in the Sea Anemone, Nematostella vectensis. (United States)

    Amiel, Aldine R; Johnston, Hereroa T; Nedoncelle, Karine; Warner, Jacob F; Ferreira, Solène; Röttinger, Eric


    Cnidarians, the extant sister group to bilateria, are well known for their impressive regenerative capacity. The sea anemone Nematostella vectensis is a well-established system for the study of development and evolution that is receiving increased attention for its regenerative capacity. Nematostella is able to regrow missing body parts within five to six days after its bisection, yet studies describing the morphological, cellular, and molecular events underlying this process are sparse and very heterogeneous in their experimental approaches. In this study, we lay down the basic framework to study oral regeneration in Nematostella vectensis. Using various imaging and staining techniques we characterize in detail the morphological, cellular, and global molecular events that define specific landmarks of this process. Furthermore, we describe in vivo assays to evaluate wound healing success and the initiation of pharynx reformation. Using our described landmarks for regeneration and in vivo assays, we analyze the effects of perturbing either transcription or cellular proliferation on the regenerative process. Interestingly, neither one of these experimental perturbations has major effects on wound closure, although they slightly delay or partially block it. We further show that while the inhibition of transcription blocks regeneration in a very early step, inhibiting cellular proliferation only affects later events such as pharynx reformation and tentacle elongation.

  18. Daily cycle in oxygen consumption by the sea anemone Nematostella vectensis Stephenson. (United States)

    Maas, Amy E; Jones, Ian T; Reitzel, Adam M; Tarrant, Ann M


    In bilaterian animals, the circadian clock is intimately involved in regulating energetic metabolism. Although cnidarians exhibit diel behavioral rhythms including cycles in locomotor activity, tentacle extension and spawning, daily cycles in cnidarian metabolism have not been described. To explore a possible circadian metabolic cycle, we maintained the anemone Nematostella vectensis in a 12 h light/dark cycle, a reversed light cycle, or in constant darkness. Oxygen consumption rates were measured at intervals using an optical oxygen meter. Respiration rates responded to entrainment with higher rates during light periods. During a second experiment with higher temporal resolution, respiration rates peaked late in the light period. The diel pattern could be detected after six days in constant darkness. Together, our results suggest that respiration rates in Nematostella exhibit a daily cycle that may be under circadian control and that the cycle in respiration rate is not driven by the previously described nocturnal increase in locomotor activity in this species. © 2016. Published by The Company of Biologists Ltd.

  19. High in situ repeatability of behaviour indicates animal personality in the beadlet anemone Actinia equina (Cnidaria.

    Directory of Open Access Journals (Sweden)

    Mark Briffa

    Full Text Available 'Animal personality' means that individuals differ from one another in either single behaviours or suites of related behaviours in a way that is consistent over time. It is usually assumed that such consistent individual differences in behaviour are driven by variation in how individuals respond to information about their environment, rather than by differences in external factors such as variation in microhabitat. Since behavioural variation is ubiquitous in nature we might expect 'animal personality' to be present in diverse taxa, including animals with relatively simple nervous systems. We investigated in situ startle responses in a sea anemone, Actinia equina, to determine whether personalities might be present in this example of an animal with a simple nervous system. We found very high levels of repeatability among individuals that were re-identified in the same locations over a three week sampling period. In a subset of the data, where we used tide-pool temperature measurements to control for a key element of variation in microhabitat, these high levels of repeatability remained. Although a range of other consistent differences in micro-habitat features could have contributed to consistent differences between the behaviour of individuals, these data suggest the presence of animal personality in A. equina. Rather than being restricted to certain groups, personality may be a general feature of animals and may be particularly pronounced in species with simple nervous systems.

  20. Diffusion Limitation and Hyperoxic Enhancement of Oxygen Consumption in Zooxanthellate Sea Anemones, Zoanthids, and Corals. (United States)

    Shick, J M


    Depending on their size and morphology, anthozoan polyps and colonies may be diffusion-limited in their oxygen consumption, even under well-stirred, air-saturated conditions. This is indicated by an enhancement of oxygen consumption under steady-state hyperoxic conditions that simulate the levels of O2 produced photosynthetically by zooxanthellae in the hosts' tissues. Such hyperoxia in the tissues of zooxanthellate species negates the effect of the diffusive boundary layer, and increases the rate of oxygen consumption; thus, in many cases, the rate of respiration measured under normoxia in the dark may not be representative of the rate during the day when the zooxanthellae are photosynthesizing and when the supply of oxygen for respiration is in the tissues themselves, not from the environment. These results have implications in respirometric methodology and in calculating the rate of gross photosynthesis in energetic studies. The activity of cytochrome c oxidase is higher in aposymbiotic than in zooxanthellate specimens of the sea anemone Aiptasia pulchella, and this may indicate a compensation for the relative hypoxia in the tissues of the former, enhancing the delivery of oxygen to the mitochondria from the environment.

  1. Germ-layer commitment and axis formation in sea anemone embryonic cell aggregates. (United States)

    Kirillova, Anastasia; Genikhovich, Grigory; Pukhlyakova, Ekaterina; Demilly, Adrien; Kraus, Yulia; Technau, Ulrich


    Robust morphogenetic events are pivotal for animal embryogenesis. However, comparison of the modes of development of different members of a phylum suggests that the spectrum of developmental trajectories accessible for a species might be far broader than can be concluded from the observation of normal development. Here, by using a combination of microsurgery and transgenic reporter gene expression, we show that, facing a new developmental context, the aggregates of dissociated embryonic cells of the sea anemone Nematostella vectensis take an alternative developmental trajectory. The self-organizing aggregates rely on Wnt signals produced by the cells of the original blastopore lip organizer to form body axes but employ morphogenetic events typical for normal development of distantly related cnidarians to re-establish the germ layers. The reaggregated cells show enormous plasticity including the capacity of the ectodermal cells to convert into endoderm. Our results suggest that new developmental trajectories may evolve relatively easily when highly plastic embryonic cells face new constraints. Copyright © 2018 the Author(s). Published by PNAS.

  2. The genome of Aiptasia, a sea anemone model for coral symbiosis

    KAUST Repository

    Baumgarten, Sebastian


    The most diverse marine ecosystems, coral reefs, depend upon a functional symbiosis between a cnidarian animal host (the coral) and intracellular photosynthetic dinoflagellate algae. The molecular and cellular mechanisms underlying this endosymbiosis are not well understood, in part because of the difficulties of experimental work with corals. The small sea anemone Aiptasia provides a tractable laboratory model for investigating these mechanisms. Here we report on the assembly and analysis of the Aiptasia genome, which will provide a foundation for future studies and has revealed several features that may be key to understanding the evolution and function of the endosymbiosis. These features include genomic rearrangements and taxonomically restricted genes that may be functionally related to the symbiosis, aspects of host dependence on alga-derived nutrients, a novel and expanded cnidarian-specific family of putative pattern-recognition receptors that might be involved in the animal–algal interactions, and extensive lineage-specific horizontal gene transfer. Extensive integration of genes of prokaryotic origin, including genes for antimicrobial peptides, presumably reflects an intimate association of the animal–algal pair also with its prokaryotic microbiome.

  3. Optimization of preservation and processing of sea anemones for microbial community analysis using molecular tools. (United States)

    Rocha, Joana; Coelho, Francisco J R C; Peixe, Luísa; Gomes, Newton C M; Calado, Ricardo


    For several years, knowledge on the microbiome associated with marine invertebrates was impaired by the challenges associated with the characterization of bacterial communities. With the advent of culture independent molecular tools it is possible to gain new insights on the diversity and richness of microorganisms associated with marine invertebrates. In the present study, we evaluated if different preservation and processing methodologies (prior to DNA extraction) can affect the bacterial diversity retrieved from snakelocks anemone Anemonia viridis. Denaturing gradient gel electrophoresis (DGGE) community fingerprints were used as proxy to determine the bacterial diversity retrieved (H'). Statistical analyses indicated that preservation significantly affects H'. The best approach to preserve and process A. viridis biomass for bacterial community fingerprint analysis was flash freezing in liquid nitrogen (preservation) followed by the use of a mechanical homogenizer (process), as it consistently yielded higher H'. Alternatively, biomass samples can be processed fresh followed by cell lyses using a mechanical homogenizer or mortar &pestle. The suitability of employing these two alternative procedures was further reinforced by the quantification of the 16S rRNA gene; no significant differences were recorded when comparing these two approaches and the use of liquid nitrogen followed by processing with a mechanical homogenizer.

  4. Interactions between the tropical sea anemone Aiptasia pallida and Serratia marcescens, an opportunistic pathogen of corals. (United States)

    Krediet, Cory J; Meyer, Julie L; Gimbrone, Nicholas; Yanong, Roy; Berzins, Ilze; Alagely, Ali; Castro, Herman; Ritchie, Kim B; Paul, Valerie J; Teplitski, Max


    Coral reefs are under increasing stress caused by global and local environmental changes, which are thought to increase the susceptibility of corals to opportunistic pathogens. In the absence of an easily culturable model animal, the understanding of the mechanisms of disease progression in corals remains fairly limited. In the present study, we tested the susceptibility of the tropical sea anemone Aiptasia pallida to an opportunistic coral pathogen (Serratia marcescens). A. pallida was susceptible to S. marcescens PDL100 and responded to this opportunistic coral pathogen with darkening of the tissues and retraction of tentacles, followed by complete disintegration of polyp tissues. Histological observations revealed loss of zooxanthellae and structural changes in eosinophilic granular cells in response to pathogen infection. A screen of S. marcescens mutants identified a motility and tetrathionate reductase mutants as defective in virulence in the A. pallida infection model. In co-infections with the wild-type strain, the tetrathionate reductase mutant was less fit within the surface mucopolysaccharide layer of the host coral Acropora palmata. © 2014 Society for Applied Microbiology and John Wiley & Sons Ltd.

  5. The sea anemone Bunodactis octoradiata (Anthozoa: Actiniaria from southern Patagonia: morphological study and new records

    Directory of Open Access Journals (Sweden)

    Agustín Garese


    Full Text Available Bunodactis Verril, 1899 comprises at present 19 nominal species of sea anemones. The validity of the genus is under discussion. The description of the species, Bunodactis octoradiata Carlgren, 1899, is insufficient for reliable identification, and although subsequent works have provided additional information on the species, its description still needs to be complemented. Herein we describe B. octoradiata based on histological sections of the internal anatomy, and give a complete and detailed description of the external anatomy. The cnidom is composed of spirocysts, basitrichs and microbasic p-mastigophores; their distribution in the organism, sizes and relative abundances are provided. The presence of zooxanthellae is reported for the first time. Bunodactis octoradiata is distributed in groups that vary from 5.6 to 45 ind./m² in the field. Additionally, our data extends the distribution of the species along the coast of southern Patagonia (47°44'36"-49°15'13"S and 65°50'26"-67°39'45"W.

  6. Genomic organization and splicing variants of a peptidylglycine alpha-hydroxylating monooxygenase from sea anemones

    DEFF Research Database (Denmark)

    Williamson, M; Hauser, F; Grimmelikhuijzen, C J


    the structure of its gene (CP1). CP1 is >12 kb in size and contains 15 exons and 14 introns. The last coding exon (exon 15) contains a stop codon, leaving no room for PAL and, thereby, for a bifunctional PAM enzyme as in mammals. Furthermore, we found a CP1 splicing variant (CP1-B) that contains exon-9 instead...... of PHM are conserved between CP1-A, -B and the PHM part of rat PAM. Furthermore, eight introns in CP1 occur in the same positions and have the same intron phasing as eight introns in the rat PAM gene, showing that the sea anemone PHM is not only structurally, but also evolutionarily related to the PHM......Cnidarians are primitive animals that use neuropeptides as their transmitters. All the numerous cnidarian neuropeptides isolated, so far, have a carboxy-terminal amide group that is essential for their actions. This strongly suggests that alpha-amidating enzymes are essential for the functioning...

  7. Characterization of Morphological and Cellular Events Underlying Oral Regeneration in the Sea Anemone, Nematostella vectensis

    Directory of Open Access Journals (Sweden)

    Aldine R. Amiel


    Full Text Available Cnidarians, the extant sister group to bilateria, are well known for their impressive regenerative capacity. The sea anemone Nematostella vectensis is a well-established system for the study of development and evolution that is receiving increased attention for its regenerative capacity. Nematostella is able to regrow missing body parts within five to six days after its bisection, yet studies describing the morphological, cellular, and molecular events underlying this process are sparse and very heterogeneous in their experimental approaches. In this study, we lay down the basic framework to study oral regeneration in Nematostella vectensis. Using various imaging and staining techniques we characterize in detail the morphological, cellular, and global molecular events that define specific landmarks of this process. Furthermore, we describe in vivo assays to evaluate wound healing success and the initiation of pharynx reformation. Using our described landmarks for regeneration and in vivo assays, we analyze the effects of perturbing either transcription or cellular proliferation on the regenerative process. Interestingly, neither one of these experimental perturbations has major effects on wound closure, although they slightly delay or partially block it. We further show that while the inhibition of transcription blocks regeneration in a very early step, inhibiting cellular proliferation only affects later events such as pharynx reformation and tentacle elongation.

  8. Visible-light-assisted SLCs template synthesis of sea anemone-like Pd/PANI nanocomposites with high electrocatalytic activity for methane oxidation in acidic medium (United States)

    Tan, De-Xin; Wang, Yan-Li


    Sea anemone-like palladium (Pd)/polyaniline (PANI) nanocomposites were synthesized via visible-light-assisted swollen liquid crystals (SLCs) template method. The resulting samples were characterized by transmission electron microscopy (TEM), selected area electron diffraction (SAED), energy dispersive spectrometer (EDS), x-ray diffraction (XRD), field emission scanning electron microscopy (FESEM), ultraviolet-visible (UV–vis) absorption spectroscopy and Fourier transform infrared (FT-IR) spectroscopy, respectively. The electrocatalytic properties of Pd/PANI nanocomposites modified glass carbon electrode (GCE) for methane oxidation were investigated by cycle voltammetry (CV) and chronoamperometry. Those dispersed sea anemone-like Pd/PANI nanocomposites had an average diameter of 320 nm. The obtained Pd nanoparticles with an average diameter of about 45 nm were uniformly distributed in PANI matrix. Sea anemone-like Pd/PANI nanocomposites exhibited excellent electrocatalytic activity and stability for oxidation of methane (CH4).

  9. Molecular cloning of a preprohormone from sea anemones containing numerous copies of a metamorphosis-inducing neuropeptide: a likely role for dipeptidyl aminopeptidase in neuropeptide precursor processing

    DEFF Research Database (Denmark)

    Leviev, I; Grimmelikhuijzen, C J


    the precursor protein for this metamorphosis-inducing neuropeptide from sea anemones. The precursor protein is 514-amino acid residues long and contains 10 copies of the immature, authentic neuropeptide (Gln-Gln-Pro-Gly-Leu-Trp-Gly). All neuropeptide copies are preceded by Xaa-Pro or Xaa-Ala sequences...... a polyp, a medusa, and a planula larva stage. Recently, a neuropeptide, sea anemones that induces metamorphosis in a hydroid planula larva to become a hydropolyp [Leitz, T., Morand, K. & Mann, M. (1994) Dev. Biol. 163, 440-446]. Here, we have cloned...

  10. A new cytolytic protein from the sea anemone Urticina crassicornis that binds to cholesterol- and sphingomyelin-rich membranes. (United States)

    Razpotnik, Andrej; Krizaj, Igor; Kem, William R; Macek, Peter; Turk, Tom


    A new pore-forming cytolytic protein was isolated from the Northern red sea anemone, Urticina crassicornis. Its biochemical properties were characterized and partial N-terminal amino acid sequence was determined. The cytolysin, named UcI, has a molecular mass of around 30kDa and lacks phospholipase A(2) activity. UcI lyses bovine erythrocytes at nanomolar concentrations. Hemolysis is a result of a colloid-osmotic shock caused by the opening of toxin-induced ionic pores and can be prevented by osmotic protectants of size >600Da. The functional radius of an average pore was estimated to be about 0.66nm. A more detailed study of the cytolytic activity of UcI was performed with lipid vesicles and monolayers. The toxin binds to monolayers and efficiently permeabilizes small lipid vesicles composed of sphingomyelin and cholesterol. However, the cytolytic activity is not prevented by preincubation with either pure cholesterol or sphingomyelin dispersions. We conclude that the presence of both sphingomyelin and cholesterol, key components of lipid rafts, greatly enhances toxin binding to membranes and probably facilitates pore formation. Alignment of the toxin partial amino acid sequence with sequences of cytolysins belonging to the actinoporin family reveals no sequence homology. We conclude that partial sequence of UcI resembles only the N-terminal part of UpI, a cytolytic protein isolated from a related sea anemone species, Urticina piscivora. The two proteins most probably belong to a separate family of sea anemone cytolysins that are worthy of further characterization.

  11. Comparative anatomy and histology of developmental and parasitic stages in the life cycle of the lined sea anemone Edwardsiella lineata. (United States)

    Reitzel, Adam M; Daly, Marymegan; Sullivan, James C; Finnerty, John R


    The evolution of parasitism is often accompanied by profound changes to the developmental program. However, relatively few studies have directly examined the developmental evolution of parasitic species from free-living ancestors. The lined sea anemone Edwardsiella lineata is a relatively recently evolved parasite for which closely related free-living outgroups are known, including the starlet sea anemone Nematostella vectensis. The larva of E. lineata parasitizes the ctenophore Mnemiopsis leidyi, and, once embedded in its host, the anemone assumes a novel vermiform body plan. That we might begin to understand how the developmental program of this species has been transformed during the evolution of parasitism, we characterized the gross anatomy, histology, and cnidom of the parasitic stage, post-parasitic larval stage, and adult stage of the E. lineata life cycle. The distinct parasitic stage of the life cycle differs from the post-parasitic larva with respect to overall shape, external ciliation, cnida frequency, and tissue architecture. The parasitic stage and planula both contain holotrichs, a type of cnida not previously reported in Edwardsiidae. The internal morphology of the post-parasitic planula is extremely similar to the adult morphology, with a complete set of mesenterial tissue and musculature despite this stage having little external differentiation. Finally, we observed 2 previously undocumented aspects of asexual reproduction in E. lineata: (1) the parasitic stage undergoes transverse fission via physal pinching, the first report of asexual reproduction in a pre-adult stage in the Edwardsiidae; and (2) the juvenile polyp undergoes transverse fission via polarity reversal, the first time this form of fission has been reported in E. lineata.

  12. Measurements of cnidae from sea anemones (Cnidaria: Actiniaria, II: further studies of differences amongst sample means and their taxonomic relevance

    Directory of Open Access Journals (Sweden)

    R. B. Williams


    Full Text Available Lengths of cnidae, sampled from fresh tissue (tentacles, acontia or column from the sea anemones Metridium senile (Linnaeus, Cereus pedunculatus (Pennant, Sagartia elegans (Dalyell, Sagartia troglodytes (Price, Anthopleura thallia (Gosse and Urticina eques (Gosse, were measured. The mean, mode, median, standard deviation, variance, coefficient of variation, minimum, maximum and range of each sample were calculated. Lengths of nematocysts (basitrichs and microbasic p-mastigophores and spirocysts had normal (Gaussian frequency distributions, and there was no important within-sample variability. A between-sample (same specimen difference was detected between mean lengths of microbasic p-mastigophores from acontia in Sagartia elegans. Intraspecific (between-specimen differences amongst mean lengths of basitrichs from column ectoderm were detected amongst four specimens of Urticina eques, and a difference occurred between the mean lengths of microbasic p-mastigophores from the acontia of two specimens of Sagartia elegans. However, for each of the species U. eques and S. elegans, there was no direct correlation between the sizes of the anemones examined and the mean lengths of their nematocysts. Overall, the results confirm that cnida size, when taken in isolation, is not a reliable taxonomic character for sea anemones. For other purposes, mean cnida measurements may be useful and a rapid sample range test is suggested for analysing differences between them. Methods are also presented for estimating means and standard deviations from data in publications that provide only ranges of cnida sizes and the number of cnidae measured. The present results and conclusions supplement those of Williams (1996, Scientia Marina, 60: 339-351.

  13. Intraspecific competition, stealing and placement of the symbiotic sea anemone Calliactis tricolor by the hermit crab Dardanus pedunculatus


    Giraud, Camille


    The hermit crab Dardanus pedunculatus and the sea anemone Calliactis tricolor engage in a mutualistic relationship in the tropical reef ecosystem of Mo’orea, French Polynesia. This mutualism is shaped by the pressures on D. pedunculatus individuals to acquire actively and compete for C. tricolor in the wild. D. pedunculatus exhibits a consistent trend in behavior when competing for and placing C. tricolor on its gastropod shell. Since C. tricolor seems to be a valuable resource to D. peduncul...

  14. Ecological speciation in anemone-associated snapping shrimps (Alpheus armatus species complex). (United States)

    Hurt, C; Silliman, K; Anker, A; Knowlton, N


    Divergent natural selection driven by competition for limited resources can promote speciation, even in the presence of gene flow. Reproductive isolation is more likely to result from divergent selection when the partitioned resource is closely linked to mating. Obligate symbiosis and host fidelity (mating on or near the host) can provide this link, creating ideal conditions for speciation in the absence of physical barriers to dispersal. Symbiotic organisms often experience competition for hosts, and host fidelity ensures that divergent selection for a specific host or host habitat can lead to speciation and strengthen pre-existing reproductive barriers. Here, we present evidence that diversification of a sympatric species complex occurred despite the potential for gene flow and that partitioning of host resources (both by species and by host habitat) has contributed to this diversification. Four species of snapping shrimps (Alpheus armatus, A. immaculatus, A. polystictus and A. roquensis) are distributed mainly sympatrically in the Caribbean, while the fifth species (A. rudolphi) is restricted to Brazil. All five species are obligate commensals of sea anemones with a high degree of fidelity and ecological specificity for host species and habitat. We analysed sequence data from 10 nuclear genes and the mitochondrial COI gene in 11-16 individuals from each of the Caribbean taxa and from the only available specimen of the Brazilian taxon. Phylogenetic analyses support morphology-based species assignments and a well-supported Caribbean clade. The Brazilian A. rudolphi is recovered as an outgroup to the Caribbean taxa. Isolation-migration coalescent analysis provides evidence for historical gene flow among sympatric sister species. Our data suggest that both selection for a novel host and selection for host microhabitat may have promoted diversification of this complex despite gene flow. © 2013 John Wiley & Sons Ltd.

  15. Expansion of tandem repeats in sea anemone Nematostella vectensis proteome: A source for gene novelty?

    Directory of Open Access Journals (Sweden)

    Linial Michal


    Full Text Available Abstract Background The complete proteome of the starlet sea anemone, Nematostella vectensis, provides insights into gene invention dating back to the Cnidarian-Bilaterian ancestor. With the addition of the complete proteomes of Hydra magnipapillata and Monosiga brevicollis, the investigation of proteins having unique features in early metazoan life has become practical. We focused on the properties and the evolutionary trends of tandem repeat (TR sequences in Cnidaria proteomes. Results We found that 11-16% of N. vectensis proteins contain tandem repeats. Most TRs cover 150 amino acid segments that are comprised of basic units of 5-20 amino acids. In total, the N. Vectensis proteome has about 3300 unique TR-units, but only a small fraction of them are shared with H. magnipapillata, M. brevicollis, or mammalian proteomes. The overall abundance of these TRs stands out relative to that of 14 proteomes representing the diversity among eukaryotes and within the metazoan world. TR-units are characterized by a unique composition of amino acids, with cysteine and histidine being over-represented. Structurally, most TR-segments are associated with coiled and disordered regions. Interestingly, 80% of the TR-segments can be read in more than one open reading frame. For over 100 of them, translation of the alternative frames would result in long proteins. Most domain families that are characterized as repeats in eukaryotes are found in the TR-proteomes from Nematostella and Hydra. Conclusions While most TR-proteins have originated from prediction tools and are still awaiting experimental validations, supportive evidence exists for hundreds of TR-units in Nematostella. The existence of TR-proteins in early metazoan life may have served as a robust mode for novel genes with previously overlooked structural and functional characteristics.

  16. Biology of a deep-water sea anemone (Anthozoa: Actiniidae) from eastern Canada: Spawning, development, and growth (United States)

    Mercier, Annie; Baillon, Sandrine; Daly, Marymegan; Macrander, Jason; Hamel, Jean-François


    Knowledge of the general biology and reproductive ecology of deep-water species can help predict their resilience to environmental and anthropogenic disturbances. The present study centers on live specimens of a deep-water sea anemone which were collected at bathyal depths between 1100 and 1400 m and kept in a mesocosm for over 6 years. Morphology and DNA sequencing confirmed that the species belongs to the genus Urticina. Male and female (9-10 cm pedal disk diameter, 90 tentacles) spawned 4 years post collection, in early spring (March). Both sexes released gametes through the mouth. The negatively buoyant oocytes (550-600 μm in diameter) quickly settled on the rocks and soft sediments surrounding the female. Lecithotrophic embryonic and larval development occurred on the substratum. Fully developed planula larvae were detected after 17-21 days. Planulae started to crawl and swim around but remained demersal. Metamorphosis and settlement occurred after 30-35 days, exclusively on hard substrata and preferentially on undersurfaces. Offspring grew slowly, developing 8 tentacles after 5 months and 24 tentacles after 12 months (3-4 mm pedal disk diameter). After 2.6 years of growth, the captive-born sea anemones reached 12-16 mm in pedal disk diameter and possessed 48-54 tentacles.

  17. Characterization of Translationally Controlled Tumour Protein from the Sea Anemone Anemonia viridis and Transcriptome Wide Identification of Cnidarian Homologues

    Directory of Open Access Journals (Sweden)

    Aldo Nicosia


    Full Text Available Gene family encoding translationally controlled tumour protein (TCTP is defined as highly conserved among organisms; however, there is limited knowledge of non-bilateria. In this study, the first TCTP homologue from anthozoan was characterised in the Mediterranean Sea anemone, Anemonia viridis. The release of the genome sequence of Acropora digitifera, Exaiptasia pallida, Nematostella vectensis and Hydra vulgaris enabled a comprehensive study of the molecular evolution of TCTP family among cnidarians. A comparison among TCTP members from Cnidaria and Bilateria showed conserved intron exon organization, evolutionary conserved TCTP signatures and 3D protein structure. The pattern of mRNA expression profile was also defined in A. viridis. These analyses revealed a constitutive mRNA expression especially in tissues with active proliferation. Additionally, the transcriptional profile of A. viridis TCTP (AvTCTP after challenges with different abiotic/biotic stresses showed induction by extreme temperatures, heavy metals exposure and immune stimulation. These results suggest the involvement of AvTCTP in the sea anemone defensome taking part in environmental stress and immune responses.

  18. Experimentally Induced Bleaching in the Sea Anemone Exaiptasia Supports Glucose as a Main Metabolite Associated with Its Symbiosis

    Directory of Open Access Journals (Sweden)

    Víctor Hugo Molina


    Full Text Available Our current understanding of carbon exchange between partners in the Symbiodinium-cnidarian symbioses is still limited, even though studies employing carbon isotopes have made us aware of the metabolic complexity of this exchange. We examined glycerol and glucose metabolism to better understand how photosynthates are exchanged between host and symbiont. The levels of these metabolites were compared between symbiotic and bleached Exaiptasia pallida anemones, assaying enzymes directly involved in their metabolism. We measured a significant decrease of glucose levels in bleached animals but a significant increase in glycerol and G3P pools, suggesting that bleached animals degrade lipids to compensate for the loss of symbionts and seem to rely on symbiotic glucose. The lower glycerol 3-phosphate dehydrogenase but higher glucose 6-phosphate dehydrogenase specific activities measured in bleached animals agree with a metabolic deficit mainly due to the loss of glucose from the ruptured symbiosis. These results corroborate previous observations on carbon translocation from symbiont to host in the sea anemone Exaiptasia, where glucose was proposed as a main translocated metabolite. To better understand photosynthate translocation and its regulation, additional research with other symbiotic cnidarians is needed, in particular, those with calcium carbonate skeletons.

  19. Staining protocol for the histological study of sea anemones (Anthozoa: Actiniaria with recommendations for anesthesia and fixation of specimens

    Directory of Open Access Journals (Sweden)

    Carlos Spano


    Full Text Available Many of the characteristics used in sea anemone taxonomy can only be examined through histological sections. Since there is no standardized procedure for this purpose, various anesthesia and fixation techniques applied to specimens of the intertidal species Anthopleura hermaphroditica and Bunodactis hermafroditica are discussed. Additionally, further modifications are proposed to the Masson's trichrome method according to the results obtained on these species. The combined effect of the short application of menthol crystals, together with small doses of MgCl2 were the most satisfactory anesthetics for maintaining the specimens expanded. The best preparations were obtained from samples fixed for several months in 8% seawater formalin; however, in order to achieve a good differentiation of the tissue, mordanting the samples with Bouin's fixative was necessary. Besides being a fast method, the modified Masson's trichrome gives very good contrasts between the epithelia and the mesoglea, and allows controlling the timing of differentiation during staining. The present paper includes suggestions and precautions and thus offers practical help for the histological study of sea anemones.

  20. Meandrina meandrites and Emblemariopsis diaphana, first record of an association between a stony coral and a fish, similar to anemone/fish relationships

    NARCIS (Netherlands)

    Butter, Maureen E.; Wapstra, Marlies; Dijk, van Eric


    An association is described between a Caribbean stony coral, Meandrina meandrites, and a chaenopsid fish, Emblemariopsis diaphana. Like in anemone/fish associations the coral tentacles provide shelter for the fish. Some observations were made, both in the field and in the laboratory, of the

  1. Locomotory behaviour and functional morphology of Nematostella vectensis (Anthozoa: Actiniaria: Edwardsiidae): a contribution to a comparative study of burrowing behaviour in athenarian sea anemones

    NARCIS (Netherlands)

    Williams, R.B.


    The locomotory behaviour and functional morphology of English populations of a small (<2 cm long), burrowing athenarian sea anemone, Nematostella vectensis Stephenson, 1935 (= N. pellucida Crowell, 1946), which lives in soft mud in salt marshes and creeks, are described. Objectives were to ascertain

  2. An unusual sea anemone from slope depths of the tropical west Pacific: range extension and redescription of Isactinernus quadrilobatus Carlgren, 1918 (Cnidaria: Actiniaria: Actinernidae)

    NARCIS (Netherlands)

    Fautin, D.G.; Hartog, den J.C.


    The sea anemone species Isactinernus quadrilobatus Carlgren, 1918, and Synactinernus flavus Carlgren, 1918, which were described in new monotypic genera from few specimens collected in southern Japan, are synonymized, based on many more specimens from the South Pacific. As well as the geographic

  3. From Sea Anemone to Homo Sapiens: The Evolution of the p53 Family of Genes

    Energy Technology Data Exchange (ETDEWEB)

    Levine, Arnold (Institute for Advanced Study)


    The human genome contains three transcription factors termed p53, p63 and p73 which are related orthologues. The function of the p53 protein is to respond to a wide variety of stresses which can disrupt the fidelity of DNA replication and cell division in somatic cells of the body. These stress signals, such as DNA damage, increase the mutation rate during DNA duplication and so an active p53 protein responds by eliminating clones of cells with mutations employing apoptosis, senescence or cell cycle arrest. In this way the p53 protein acts as a tumor suppressor preventing the mutations that can lead to cancers. The p63 and p73 proteins act in a similar fashion to protect the germ line cells in females (eggs). In addition the p63 protein plays a central role in the formation of epithelial cell layers and p73 plays a critical role in the formation of several structures in the central nervous system. Based upon their amino acid sequences and structural considerations the oldest organisms that contain an ancestor of the p53/p63/p73 gene are the sea anemone or hydra. The present day representatives of these animals contain a p63/p73 like ancestor gene and the protein functions in germ cells of this animal to enforce the fidelity of DNA replication after exposure to ultraviolet light. Thus the structure and functions of this gene family have been preserved for over one billion years of evolution. Other invertebrates such as the worm, the fly and the clam contain a very similar ancestor gene with a similar set of functions. The withdrawal of a food source from a worm results in the p63/p73 mediated apoptosis of the eggs so that new organisms will not be hatched into a poor environment. A similar response is thought to occur in humans. Thus this ancestor gene ensures the fidelity of the next generation of organisms. The first time a clearly distinct new p53 gene arises is in the cartilaginous fish and in the bony fish a separation of the p

  4. For she that hath, to her shall be given…Implications of flowering in Anemone nemorosa L

    DEFF Research Database (Denmark)

    Pontoppidan, Maj-Britt; Petersen, Peter Milan; Philipp, Marianne


    We looked for life-history trade-offs between flowering, vegetative growth and somatic maintenance in the common woodland herb Anemone nemorosa. A. nemorosa forms a horizontal rhizome system consisting of previously formed annual segments and terminated by a flowering or non-flowering shoot....... Resources acquired by the aboveground parts are used for flowering, seed production, storage and growth of the annual segments. Resources stored in the rhizome during the growing period are used for preformation of buds, somatic maintenance between two growing periods and development of aboveground parts...... in the following spring. We hypothesised that the decision to invest in flower buds depends on the amount of resources stored in the recently formed annual segment. We also hypothesised a trade-off between flowering and segment growth and, finally, as a consequence, we expected individual rhizomes to alternate...

  5. Partially Purified Extracts of Sea Anemone Anemonia viridis Affect the Growth and Viability of Selected Tumour Cell Lines

    Directory of Open Access Journals (Sweden)

    Matteo Bulati


    Full Text Available In the last few years, marine species have been investigated for the presence of natural products with anticancer activity. Using reversed phase chromatography, low molecular weight proteins were fractionated from the sea anemone Anemonia viridis. Four different fractions were evaluated for their cytotoxic activity by means of erythrocyte haemolysis test, MTS, and LDH assays. Finally, the antiproliferative activities of three of these fractions were studied on PC3, PLC/PRF/5, and A375 human cancer cell lines. Our analysis revealed that the four fractions showed different protein contents and diverse patterns of activity towards human PBMC and cancer cell lines. Interestingly, fractions III and IV exerted cytotoxic effects on human cells. Conversely, fractions I and II displayed very low toxic effects associated with antiproliferative activities on cancer cell lines.

  6. Genetic tools link long-term demographic and life-history traits of anemonefish to their anemone hosts

    KAUST Repository

    Salles, Océane C.


    The life-history traits and population dynamics of species are increasingly being attributed to the characteristics of their preferred habitats. While coral reef fish are often strongly associated with particular habitats, long-term studies establishing the demographic and life-history consequences of occupying different reef substrata are rare and no studies have monitored individuals in situ over their lifetime and determined the fate of their offspring. Here, we documented a quasi-turnover and local reproductive success for an entire population of orange clownfish (Amphiprion percula) from Kimbe Island, Papua New Guinea, by taking bi-annual samples of DNA over a 10-yr period (2003–2013). We compared demographic and life-history traits of individuals living on two host anemone species, Heteractis magnifica and Stichodactyla gigantea, including female size, adult continued presence (a proxy for relative longevity range), early post-settlement growth, the number of eggs per clutch and ‘local’ reproductive success (defined for each adult as the number of offspring returning to the natal population). Our results indicate that while the relative longevity of adults was similar on both host anemone species, females living in H. magnifica were larger than females in S. gigantea. However, despite females growing larger and producing more eggs on H. magnifica, we found that local reproductive success was significantly higher for clownfish living in S. gigantea. Life-history traits also exhibited local spatial variation, with higher local reproductive success recorded for adults living on S. gigantea on the eastern side of the island. Our findings support a ‘silver-spoon’ hypothesis that predicts individuals that are fortunate enough to recruit into good habitat and location will be rewarded with higher long-term reproductive success and will make a disproportionate contribution to population renewal. © 2016 Springer-Verlag Berlin Heidelberg

  7. Ocurrence of the sea anemone Telmatactis panamensis (Verrill, 1869 (Cnidaria: Anthozoa: Actiniaria at Isla del Coco National Park, Costa Rica

    Directory of Open Access Journals (Sweden)

    Fabián H. Acuña


    Full Text Available The sea anemone fauna of Isla del Coco National Park (also known as Cocos Island Nacional Park, Pacific Costa Rica is poorly known. In the present work we report the first occurrence of the species Telmatactis panamensis. Individuals of this sea anemone (n=24 were collected at Chatham Bay intertidal and at 15m depth in Punta Ulloa, in both cases attached to rocks; during the expedition UCR-UNA-COCO-I in April 2010. We provide photographs of live individuals, external anatomy and an inventory of cnidae of the studied specimens. Possibly this species is extended to greater depth as observed by other authors in the Galápagos Islands.La fauna de anémonas de mar es prácticamente desconocida para el Parque Nacional Isla del Coco (Costa Rica. En el presente trabajo se reporta por primera vez la presencia de la especie Telmatactis panamensis. Individuos de esta anémona de mar fueron colectados en el intermareal de Bahía Chatham y a 15m de profundidad en Punta Ulloa, en ambos casos adheridas a rocas; durante la expedición UCR-UNA-COCO-I en Abril de 2010. Se proveen fotografías de ejemplares vivos, datos de su anatomía externa y un inventario del cnidae de los especímenes estudiados. Posiblemente esta especie se extienda a mayor profundidad, tal como fue observado por otros autores para ejemplares de las Islas Galápagos.

  8. Identification of a new 6-bromo-5,9-eicosadienoic acid from the anemone Condylactis gigantea and the zoanthid Palythoa caribaeorum. (United States)

    Carballeira, N M; Reyes, M


    A new brominated fatty acid, 6-bromo-5,9-eicosadienoic acid [1] was identified in the phospholipids (mainly phosphatidylethanolamine) of the anemone Condylactis gigantea and the zoanthid Palythoa caribaeorum. The delta 5,9 fatty acids, 5,9-octadecadienoic acid, 5,9-eicosadienoic acid, 5,9-docosadienoic acid, and 5,9-tetracosadienoic acid, were also identified in both organisms. Structural elucidation was accomplished by spectroscopic and chemical means. Our results further corroborate that delta 5,9 phospholipid fatty acids are not unique to sponges, as recognized previously, but can be found in other marine invertebrates such as anemones and zoanthids. An improved procedure for the synthesis of picolinyl esters is also described.

  9. New records of the deep-sea anemone Phelliactis callicyclus Riemann-Zurneck, 1973 (Cnidaria, Actiniaria, Hormathiidae) from the Gulf of California, Mexico. (United States)

    Hendrickx, M E; Hinojosa-Corona, A; Ayón-Parente, M


    Specimens of a deep-sea anemone were observed in photographs and video footage taken with the Remotely Operated Vehicle JASON (WHOI Deep Submergence Laboratory) in the Gulf of California, Mexico, in May 2008. Comparison of our material with photographs and description of this species available in literature indicate that the sea anemones filmed during the JASON survey are most likely to represent Phelliactis callicyclus Riemann-Zurneck, 1973. This species has previously been reported from a locality in the Gulf of California near the present record. During the JASON survey, 28 specimens of P. callicyclus were spotted in 27 locations during six dives. The specimens occurred on angular rock outcrops along the escarpments of the transform faults of the Gulf of California, between depths of 993-2543 m and at temperatures ranging from 2.3 to 4.5°C. Based on these new records, Phelliactis callicyclus appears to be widely spread in the Gulf of California.

  10. The gastropod-symbiotic sea anemone genus Isosicyonis Carlgren, 1927 (Actiniaria: Actiniidae: a new species from the Weddell Sea (Antarctica that clarifies the taxonomic position of the genus

    Directory of Open Access Journals (Sweden)

    Estefanía Rodríguez


    Full Text Available A second species of the sea anemone genus Isosicyonis is described and illustrated from 16 specimens collected in the Weddell Sea (Antarctica on the Polarstern cruises ANT XVII/3, ANT XXI/2 and ANT XXIII/8. Isosicyonis striata n. sp. is easily distinguishable externally from the other species of the genus Isosicyonis alba by its pattern: white longitudinal stripes on the column, oral disc, and tentacles. It is also distinguished by internal features including the retractor muscles, parietobasilar muscles, marginal sphincter muscles, number of mesenteries, and cnidae. The genus Isosycionis is currently only known from the Southern Ocean. Both species of Isosicyonis live in association with a gastropod, with a single sea anemone occupying almost the whole shell of its gastropod host. The description of this new species, and our re-examination of Isosicyonis alba, resolves the controversial higher taxonomic position of the genus, confirming its placement within the Endomyaria.

  11. Induction of Apoptosis and Reduction of Endogenous Glutathione Level by the Ethyl-Acetate Soluble Fraction of the Methanol Extract of the Roots of Potentilla fulgens in Cancer Cells.

    Directory of Open Access Journals (Sweden)

    Debabrata Tripathy

    Full Text Available Potentilla fulgens root traditionally used as a folk remedy in Meghalaya, India. However, systematic evaluation of its anticancer efficacy was limited. We investigated the anticancer potentials of the various extracts prepared by partitioning of the methanol extract of the root with the aim to discover major contributing factors from the most effective fractions. Methanol extract of P. fulgens roots (PRE was prepared by maceration which was subsequently fractionated into hexane, ethyl-acetate (EA and n-butanol soluble fractions. Various assays (clonogenic assay, Flow cytometry analysis, western blot, semiquantitative RT-PCR and the level of endogenous glutathione were used to evaluate different parameters, such as Cell survivability, PARP-1 proteolysis, expression pattern of anti-apoptotic and γ-glutamyl-cysteine synthetase heavy subunit (GCSC genes in both MCF-7 and U87 cancer cell lines. Since the EA-fraction showed most efficient growth inhibitory effect, it was further purified and a total of nine compounds and some monomeric and dimeric flavan-3-ols were identified and characterized. Three compounds viz., epicatechin (EC, gallic acid (GA and ursolic acid (UA were taken on the basis of their higher yield and 10 μg/ml of each was mixed together. The concentration used in this study for PRE, EA- and Hex-fraction was 100 μg/ml, which was higher than the IC50 value. Apoptotic cell death in the PRE, EA-fraction and EC+GA+UA treated cancer cell cultures was significantly greater than in normal cells due to suppression of anti-apoptotic protein Bcl2 following treatment. Depletion of glutathione by downregulating GCSC was also observed. Induction of apoptosis and lowering the level of glutathione are considered to be positive activity for an anticancer agent. Therefore, modulation of GSH concentration in tumor cells by PRE and its EA-fraction opened up the possibility of a new therapeutic approach because these plant products are not harmful to

  12. PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer

    Directory of Open Access Journals (Sweden)

    Armando Alexei Rodríguez


    Full Text Available Sea anemones produce proteinaceous toxins for predation and defense, including peptide toxins that act on a large variety of ion channels of pharmacological and biomedical interest. Phymanthus crucifer is commonly found in the Caribbean Sea; however, the chemical structure and biological activity of its toxins remain unknown, with the exception of PhcrTx1, an acid-sensing ion channel (ASIC inhibitor. Therefore, in the present work, we focused on the isolation and characterization of new P. crucifer toxins by chromatographic fractionation, followed by a toxicity screening on crabs, an evaluation of ion channels, and sequence analysis. Five groups of toxic chromatographic fractions were found, and a new paralyzing toxin was purified and named PhcrTx2. The toxin inhibited glutamate-gated currents in snail neurons (maximum inhibition of 35%, IC50 4.7 µM, and displayed little or no influence on voltage-sensitive sodium/potassium channels in snail and rat dorsal root ganglion (DRG neurons, nor on a variety of cloned voltage-gated ion channels. The toxin sequence was fully elucidated by Edman degradation. PhcrTx2 is a new β-defensin-fold peptide that shares a sequence similarity to type 3 potassium channels toxins. However, its low activity on the evaluated ion channels suggests that its molecular target remains unknown. PhcrTx2 is the first known paralyzing toxin in the family Phymanthidae.

  13. How does environment influence fighting? The effects of tidal flow on resource value and fighting costs in sea anemones. (United States)

    Palaoro, Alexandre V; Velasque, Mariana; Santos, Sandro; Briffa, Mark


    An animal's decision to enter into a fight depends on the interaction between perceived resource value (V) and fighting costs (C). Both could be altered by predictable environmental fluctuations. For intertidal marine animals, such as the sea anemone Actinia equina , exposure to high flow during the tidal cycle may increase V by bringing more food. It may also increase C via energy expenditure needed to attach to the substrate. We asked whether simulated tidal cycles would alter decisions in fighting A. equina We exposed some individuals to still water and others to simulated tidal cycles. To gain insights into V, we measured their startle responses before and after exposure to the treatments, before staging dyadic fights. Individuals exposed to flow present shorter startle responses, suggesting that flowing water indicates high V compared with still water. A higher probability of winning against no-flow individuals and longer contests between flow individuals suggests that increased V increases persistence. However, encounters between flow individuals were less likely to escalate, suggesting that C is not directly related to V. Therefore, predictable environmental cycles alter V and C, but in complex ways. © 2017 The Author(s).

  14. Comparative analysis and culturing of the microbial community of Aiptasia pallida, A Sea Anemone Model for Coral Biology

    KAUST Repository

    Binsarhan, Mohammad


    Recent works has highlighted the contribution of microbes to animal function. In this regard, the microbial community associated with corals has become a growing field of research in order to understand how microbes contribute to the host organisms’ response to environmental changes. It has been shown that microbes associated with corals have important functions in the coral holobiont such as immunity and nutrient assimilation. However, corals are notoriously difficult to work with. To this end, the sea anemone Aiptasia is becoming a model organism for coral symbiosis. Given the importance of host-­microbiome interactions, the topic of this thesis is to assess microbial structure of Aiptasia, culture prominent bacterial members, and compare bacterial community structure to corals. Different molecular methods have been applied using 16S rRNA bacterial gene fragments to characterize the microbial composition of Aiptasia. 16S rRNA gene sequence derived from cultured bacteria was compared to 16S rRNA gene sequences retrieved from native Red Sea Aiptasia. Inter-­individual as well as methodological differences were found to account for variance in microbiome composition. However, all approaches showed a highly abundant microbial taxon belonging to the genus Alteromonas in all samples. The Alteromonas species was successfully isolated for further research targeting microbiome selection mechanisms in Aiptasia. Future investigations by using different molecular tools will help to define the functions and relationship between the Aiptasia and its complex microbiome.

  15. Acid-sensing ion channel (ASIC) structure and function: Insights from spider, snake and sea anemone venoms. (United States)

    Cristofori-Armstrong, Ben; Rash, Lachlan D


    Acid-sensing ion channels (ASICs) are proton-activated cation channels that are expressed in a variety of neuronal and non-neuronal tissues. As proton-gated channels, they have been implicated in many pathophysiological conditions where pH is perturbed. Venom derived compounds represent the most potent and selective modulators of ASICs described to date, and thus have been invaluable as pharmacological tools to study ASIC structure, function, and biological roles. There are now ten ASIC modulators described from animal venoms, with those from snakes and spiders favouring ASIC1, while the sea anemones preferentially target ASIC3. Some modulators, such as the prototypical ASIC1 modulator PcTx1 have been studied in great detail, while some of the newer members of the club remain largely unstudied. Here we review the current state of knowledge on venom derived ASIC modulators, with a particular focus on their molecular interaction with ASICs, what they have taught us about channel structure, and what they might still reveal about ASIC function and pathophysiological roles. This article is part of the Special Issue entitled 'Venom-derived Peptides as Pharmacological Tools.' Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Sequence-specific H NMR assignments and secondary structure in the sea anemone polypeptide Stichodactyla helianthus neurotoxin I

    International Nuclear Information System (INIS)

    Fogh, R.H.; Mabbutt, B.C.; Kem, W.R.; Norton, R.S.


    Sequence-specific assignments are reported for the 500-MHz H nuclear magnetic resonance (NMR) spectrum of the 48-residue polypeptide neurotoxin I from the sea anemone Stichodactyla helianthus (Sh I). Spin systems were first identified by using two-dimensional relayed or multiple quantum filtered correlation spectroscopy, double quantum spectroscopy, and spin lock experiments. Specific resonance assignments were then obtained from nuclear Overhauser enhancement (NOE) connectivities between protons from residues adjacent in the amino acid sequence. Of a total of 265 potentially observable resonances, 248 (i.e., 94%) were assigned, arising from 39 completely and 9 partially assigned amino acid spin systems. The secondary structure of Sh I was defined on the basis of the pattern of sequential NOE connectivities. NOEs between protons on separate strands of the polypeptide backbone, and backbone amide exchange rates. Sh I contains a four-stranded antiparallel β-sheet encompassing residues 1-5, 16-24, 30-33, and 40-46, with a β-bulge at residues 17 and 18 and a reverse turn, probably a type II β-turn, involving residues 27-30. No evidence of α-helical structure was found

  17. The making of an embryo in a basal metazoan: Proteomic analysis in the sea anemone Nematostella vectensis. (United States)

    Levitan, Shimrit; Sher, Noa; Brekhman, Vera; Ziv, Tamar; Lubzens, Esther; Lotan, Tamar


    Cnidarians are widely distributed basal metazoans that play an important role in the marine ecosystem. Their genetic diversity and dispersal depends on successful oogenesis, fertilization and embryogenesis. To understand the processes that lead to successful embryogenesis in these basal organisms, we conducted comparative proteomics on the model sea anemone Nematostella vectensis. We examined four developmental stages from oocyte maturation through early embryogenesis, as well as the oocyte jelly sac in which fertilization and embryogenesis take place. Our analysis revealed 37 stage-specifically expressed proteins, including cell cycle, cellular energy related and DNA replication proteins and transcription regulators. Using in situ hybridization, we show that within the mesenteria, two cell types support successful oocyte development and embryogenesis. Large somatic supporting cells synthesize vitellogenin, the most abundant egg yolk protein within the oocyte, whereas mesenteria gland cells synthesize mucin 5B, which was found to be the main component of the jelly sac. These findings shed light on the sexual reproduction program in cnidarians and suggest a high conservation with proteins governing oogenesis in Bilateria. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Studies on the comparison of pollen morphology and viability of four naturally distributed and commercial varieties of anemone coronaria L

    International Nuclear Information System (INIS)

    Candan, F.


    The present study presents a comparison of the pollen morphology and viability of naturally distributed four varieties of Anemone coronaria L. These are A. coronaria var. coccinea (Jord.) Burn, A. coronaria var. rosea (Hanry) Batt, A. coronaria var. cyanea, A. coronaria var. alba Goaty and Pens) and its commercial cultivars. The four varieties were collected from areas near the road side along the Kirkagac-Soma highway in the State of Manisa. The commercial cultivars were obtained from the commercial flower growers in the Urla region of zmir. Pollen viability levels decreased in all commercial cultivars of A. coronaria. The highest reduction in pollen viability was recorded in A. coronaria pink cultivars of de Caen group. The general pollen type is prolate spheroidal in all pure forms, but there are some pollen morphological features which were not observed in the natural ones, although encountered in all commercial cultivars. On the other hand, various non-viable pollen types like wrinkled pollens, with abnormally shaped pollens or pollinia were found in the commercial cultivars. It was concluded that pesticides used to produce more flowers with rapid growth are the major cause for his reduction. Another reason could be the use of tetraploid F1 hybrids of A. coronaria cultivars of de Caen group as commercial samples. (author)

  19. Natural Variation in Responses to Acute Heat and Cold Stress in a Sea Anemone Model System for Coral Bleaching. (United States)

    Bellis, Emily S; Denver, Dee R


    Rising ocean temperatures disrupt the symbiosis between corals and their microalgae, accelerating global decline of coral reef ecosystems. Because of the difficulty of performing laboratory experiments with corals, the sea anemone Aiptasia has emerged as an important model system for molecular studies of coral bleaching and symbiosis. Here, we investigate natural variation in bleaching responses among different genetic lineages of Aiptasia. Both heat- and cold-induced paths to symbiosis breakdown were analyzed. Significant genetic variation in response to acute heat stress was observed, with severe bleaching of two Aiptasia strains from Hawaii but minimal bleaching of strains from the U.S. South Atlantic, including the strain used to generate the Aiptasia reference genome. Both strains from Hawaii hosted Symbiodinium type B1, whereas strains from the U.S. South Atlantic hosted type A4 or B2. In contrast to the results from exposures to acute heat stress, negligible variation was observed in response to a pulsed cold shock despite moderate bleaching across all strains. These results support our hypothesis that bleaching responses to distinct stressors are independent. Our findings emphasize the role of stress regime when predicting adaptive responses of symbiotic cnidarians to changing climates, because genetic variation may exist for some forms of stress-induced bleaching but not others.

  20. Isolation of L-3-phenyllactyl-Leu-Arg-Asn-NH2 (Antho-RNamide), a sea anemone neuropeptide containing an unusual amino-terminal blocking group

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Rinehart, K L; Jacob, E


    Using a radioimmunoassay for the carboxyl-terminal sequence Arg-Asn-NH2, we have purified a peptide from acetic acid extracts of the sea anemone Anthopleura elegantissima. By classical amino acid analyses, mass spectrometry, and 1H NMR spectroscopy, the structure of this peptide was determined as 3......-phenyllactyl-Leu-Arg-Asn-NH2. By using reversed-phase HPLC and a chiral mobile phase, it was shown that the 3-phenyllactyl group had the L configuration. Immunocytochemical staining with antiserum against Arg-Asn-NH2 showed that L-3-phenyllactyl-Leu-Arg-Asn-NH2 (Antho-RNamide) was localized in neurons of sea...

  1. Different visible colors and green fluorescence were obtained from the mutated purple chromoprotein isolated from sea anemone. (United States)

    Chiang, Cheng-Yi; Chen, Yi-Lin; Tsai, Huai-Jen


    Green fluorescent protein (GFP)-like proteins have been studied with the aim of developing fluorescent proteins. Since the property of color variation is understudied, we isolated a novel GFP-like chromoprotein from the carpet anemone Stichodactyla haddoni, termed shCP. Its maximum absorption wavelength peak (λ(max)) is located at 574 nm, resulting in a purple color. The shCP protein consists of 227 amino acids (aa), sharing 96 % identity with the GFP-like chromoprotein of Heteractis crispa. We mutated aa residues to examine any alteration in color. When E63, the first aa of the chromophore, was replaced by serine (E63S), the λ(max) of the mutated protein shCP-E63S was shifted to 560 nm and exhibited a pink color. When Q39, T194, and I196, which reside in the surrounding 5 Å of the chromophore's microenvironment, were mutated, we found that (1) the λ(max) of the mutated protein shCP-Q39S was shifted to 518 nm and exhibited a red color, (2) shCP-T194I exhibited a purple-blue color, and (3) an additional mutation at I196H of the mutated protein shCP-E63L exhibited green fluorescence. In contrast, when the aa located neither at the chromophore nor within its microenvironment were mutated, the resultant proteins shCP-L122H, -E138G, -S137D, -T95I, -D129N, -T194V, -E138Q, -G75E, -I183V, and -I70V never altered their purple color, suggesting that mutations at the shCP chromophore and the surrounding 5 Å microenvironment mostly control changes in color expression or cause fluorescence to develop. Additionally, we found that the cDNAs of shCP and its mutated varieties are faithfully and stably expressed both in Escherichia coli and zebrafish embryos.

  2. Nuclear magnetic resonance study of the solution properties of the polypeptide neurotoxin I from the sea anemone Stichodactyla helianthus

    International Nuclear Information System (INIS)

    Norton, R.S.; Cossins, A.I.; Kem, W.R.


    The solution properties of the polypeptide neurotoxin I from the sea anemone Stichodactyla helianthus (Sh I) have been investigated by high-resolution H nuclear magnetic resonance (NMR) spectroscopy at 300 MHz. The pH dependence of the spectra has been examined over the range 1.1-12.2 at 27 degree C. Individual pK a values have been obtained for the α-ammonium group of Ala-1 (8.6) and the side chains of Glu-8 (3.7), Tyr-36 (10.9), and Tyr-37 (10.8). For the remaining seven carboxyl groups in the molecule, four pK a values can be clearly identified. The five Lys residues titrate in the range 10.5-11, but individual pK a values could not be obtained because of peak overlap. Conformational changes associated with the protonation of carboxylates occur below pH 4, while in the alkaline pH range major unfolding occurs above pH 10. The molecule also unfolds at elevated temperatures. Exchange of the backbone amide protons has been monitored at various values of pH and temperature in the ranges pH 4-5 and 12-27 degree C. Comparison of these properties of Sh I in solution with those of the related polypeptides anthopleurin A and Anemonia sulcata toxins I and II indicates that Sh I is less stable thermally and that there are some significant differences in the ionic interactions that maintain the tertiary structure. The solvent accessibility of aromatic residues has been probed with photochemically induced dynamic nuclear polarization NMR at 360 MHz

  3. Spatial gene expression quantification: a tool for analysis of in situ hybridizations in sea anemone Nematostella vectensis

    Directory of Open Access Journals (Sweden)

    Botman Daniel


    Full Text Available Abstract Background Spatial gene expression quantification is required for modeling gene regulation in developing organisms. The fruit fly Drosophila melanogaster is the model system most widely applied for spatial gene expression analysis due to its unique embryonic properties: the shape does not change significantly during its early cleavage cycles and most genes are differentially expressed along a straight axis. This system of development is quite exceptional in the animal kingdom. In the sea anemone Nematostella vectensis the embryo changes its shape during early development; there are cell divisions and cell movement, like in most other metazoans. Nematostella is an attractive case study for spatial gene expression since its transparent body wall makes it accessible to various imaging techniques. Findings Our new quantification method produces standardized gene expression profiles from raw or annotated Nematostella in situ hybridizations by measuring the expression intensity along its cell layer. The procedure is based on digital morphologies derived from high-resolution fluorescence pictures. Additionally, complete descriptions of nonsymmetric expression patterns have been constructed by transforming the gene expression images into a three-dimensional representation. Conclusions We created a standard format for gene expression data, which enables quantitative analysis of in situ hybridizations from embryos with various shapes in different developmental stages. The obtained expression profiles are suitable as input for optimization of gene regulatory network models, and for correlation analysis of genes from dissimilar Nematostella morphologies. This approach is potentially applicable to many other metazoan model organisms and may also be suitable for processing data from three-dimensional imaging techniques.

  4. Biophysical and biochemical strategies to understand membrane binding and pore formation by sticholysins, pore-forming proteins from a sea anemone. (United States)

    Alvarez, Carlos; Ros, Uris; Valle, Aisel; Pedrera, Lohans; Soto, Carmen; Hervis, Yadira P; Cabezas, Sheila; Valiente, Pedro A; Pazos, Fabiola; Lanio, Maria E


    Actinoporins constitute a unique class of pore-forming toxins found in sea anemones that are able to bind and oligomerize in membranes, leading to cell swelling, impairment of ionic gradients and, eventually, to cell death. In this review we summarize the knowledge generated from the combination of biochemical and biophysical approaches to the study of sticholysins I and II (Sts, StI/II), two actinoporins largely characterized by the Center of Protein Studies at the University of Havana during the last 20 years. These approaches include strategies for understanding the toxin structure-function relationship, the protein-membrane association process leading to pore formation and the interaction of toxin with cells. The rational combination of experimental and theoretical tools have allowed unraveling, at least partially, of the complex mechanisms involved in toxin-membrane interaction and of the molecular pathways triggered upon this interaction. The study of actinoporins is important not only to gain an understanding of their biological roles in anemone venom but also to investigate basic molecular mechanisms of protein insertion into membranes, protein-lipid interactions and the modulation of protein conformation by lipid binding. A deeper knowledge of the basic molecular mechanisms involved in Sts-cell interaction, as described in this review, will support the current investigations conducted by our group which focus on the design of immunotoxins against tumor cells and antigen-releasing systems to cell cytosol as Sts-based vaccine platforms.

  5. Ultrastructural evidence for two-cell and three-cell neural pathways in the tentacle epidermis of the sea anemone Aiptasia pallida. (United States)

    Westfall, Jane A; Elliott, Carol F; Carlin, Ryan W


    Sensory and ganglion cells in the tentacle epidermis of the sea anemone Aiptasia pallida were traced in serial transmission electron micrographs to their synaptic contacts on other cells. Sensory cell synapses were found on spirocytes, muscle cells, and ganglion cells. Ganglion cells, in turn, synapsed on sensory cells, spirocytes, muscle cells, and other neurons and formed en passant axo-axonal synapses. Axonal synapses on nematocytes and gland cells were not traced to their cells of origin, i.e., identified sensory or ganglion cells. Direct synaptic contacts of sensory cells with spirocytes and sensory cells with muscle cells suggest a local two-cell pathway for spirocyst discharge and muscle cell contraction, whereas interjection of a ganglion cell between the sensory and effector cells creates a local three-cell pathway. The network of ganglion cells and their processes allows for a through-conduction system that is interconnected by chemical synapses. Although the sea anemone nervous system is more complex than that of Hydra, it has similar two-cell and three-cell effector pathways that may function in local responses to tentacle contact with food. Copyright 2002 Wiley-Liss, Inc.

  6. Redescription of Oulactis concinnata (Drayton in Dana, 1846) (Cnidaria: Anthozoa: Actiniidae), an actiniid sea anemone from Chile and Perú with special fighting tentacles; with a preliminary revision of the genera with a “frond-like” marginal ruff

    NARCIS (Netherlands)

    Häussermann, V.


    Two species of sea anemones with a conspicuous marginal ruff of frond-like structures encompassing the tentacular crown occur on the Chilean coast. Oulactis concinnata (= Isoulactis chilensis) (Drayton in Dana, 1846) is re-described in detail and further information is provided for Oulactis

  7. Molecular cloning of a novel, putative G protein-coupled receptor from sea anemones structurally related to members of the FSH, TSH, LH/CG receptor family from mammals

    DEFF Research Database (Denmark)

    Nothacker, H P; Grimmelikhuijzen, C J


    hormone (FSH, TSH, LH/CG) receptor family from mammals, including a very large, extracellular N terminus (18-25% sequence identity) and a 7 transmembrane region (44-48% sequence identity). As with the mammalian glycoprotein hormone receptor genes, the sea anemone receptor gene yields transcripts which can...

  8. The role of complement in cnidarian-dinoflagellate symbiosis and immune challenge in the sea anemone Aiptasia pallida

    Directory of Open Access Journals (Sweden)

    Angela ePoole


    Full Text Available The complement system is an innate immune pathway that in vertebrates, is responsible for initial recognition and ultimately phagocytosis and destruction of microbes. Several complement molecules including C3, Factor B, and mannose binding lectin associated serine proteases (MASP have been characterized in invertebrates and while most studies have focused on their conserved role in defense against pathogens, little is known about their role in managing beneficial microbes. The purpose of this study was to (1 characterize complement pathway genes in the symbiotic sea anemone A. pallida, (2 investigate the evolution of complement genes in invertebrates, and (3 examine the potential dual role of complement genes Factor B and MASP in the onset and maintenance of cnidarian-dinoflagellate symbiosis and immune challenge using qPCR based studies. The results demonstrate that A. pallida has multiple Factor B genes (Ap_Bf-1, Ap_Bf-2a, and Ap_Bf-2b and one MASP gene (Ap_MASP. Phylogenetic analysis indicates that the evolutionary history of complement genes is complex, and there have been many gene duplications or gene loss events, even within members of the same phylum. Gene expression analyses revealed a potential role for complement in both onset and maintenance of cnidarian-dinoflagellate symbiosis and immune challenge. Specifically, Ap_Bf-1 and Ap_MASP are significantly upregulated in the light at the onset of symbiosis and in response to challenge with the pathogen Serratia marcescens suggesting that they play a role in the initial recognition of both beneficial and harmful microbes. Ap_Bf-2b in contrast was generally downregulated during the onset and maintenance of symbiosis and in response to challenge with S. marcescens. Therefore the exact role of Ap_Bf-2b in response to microbes remains unclear, but the results suggests that the presence of microbes leads to repressed expression. Together these results indicate functional divergence between Ap

  9. Quantification of dimethyl sulfide (DMS) production in the sea anemone Aiptasia sp. to simulate the sea-to-air flux from coral reefs (United States)

    Franchini, Filippo; Steinke, Michael


    The production of dimethyl sulfide (DMS) is poorly quantified in tropical reef environments but forms an essential process that couples marine and terrestrial sulfur cycles and affects climate. Here we quantified net aqueous DMS production and the concentration of its cellular precursor dimethylsulfoniopropionate (DMSP) in the sea anemone Aiptasia sp., a model organism to study coral-related processes. Bleached anemones did not show net DMS production whereas symbiotic anemones produced DMS concentrations (mean ± standard error) of 160.7 ± 44.22 nmol g-1 dry weight (DW) after 48 h incubation. Symbiotic and bleached individuals showed DMSP concentrations of 32.7 ± 6.00 and 0.6 ± 0.19 µmol g-1 DW, respectively. We applied these findings to a Monte Carlo simulation to demonstrate that net aqueous DMS production accounts for only 20 % of gross aqueous DMS production. Monte Carlo-based estimations of sea-to-air fluxes of gaseous DMS showed that reefs may release 0.1 to 26.3 µmol DMS m-2 coral surface area (CSA) d-1 into the atmosphere with 40 % probability for rates between 0.5 and 1.5 µmol m-2 CSA d-1. These predictions were in agreement with directly quantified fluxes in previous studies. Conversion to a flux normalised to sea surface area (SSA) (range 0.1 to 17.4, with the highest probability for 0.3 to 1.0 µmol DMS m-2 SSA d-1) suggests that coral reefs emit gaseous DMS at lower rates than the average global oceanic DMS flux of 4.6 µmol m-2 SSA d-1 (19.6 Tg sulfur per year). The large difference between simulated gross and quantified net aqueous DMS production in corals suggests that the current and future potential for its production in tropical reefs is critically governed by DMS consumption processes. Hence, more research is required to assess the sensitivity of DMS-consumption pathways to ongoing environmental change in order to address the impact of predicted degradation of coral reefs on DMS production in tropical coastal ecosystems and its impact on

  10. Molecular cloning of a preprohormone from sea anemones containing numerous copies of a metamorphosis-inducing neuropeptide: a likely role for dipeptidyl aminopeptidase in neuropeptide precursor processing

    DEFF Research Database (Denmark)

    Leviev, I; Grimmelikhuijzen, C J


    cleavage sites, and therefore, are also likely to be produced from the precursor. Thus, there are at least 37 closely related neuropeptides localized on the precursor protein, making this precursor one of the most productive preprohormones known so far. This report also shows that unusual processing sites......Neuropeptides are an important group of hormones mediating or modulating neuronal communication. Neuropeptides are especially abundant in evolutionarily "old" nervous systems, such as those of cnidarians, the lowest animal group having a nervous system. Cnidarians often have a life cycle including...... the precursor protein for this metamorphosis-inducing neuropeptide from sea anemones. The precursor protein is 514-amino acid residues long and contains 10 copies of the immature, authentic neuropeptide (Gln-Gln-Pro-Gly-Leu-Trp-Gly). All neuropeptide copies are preceded by Xaa-Pro or Xaa-Ala sequences...

  11. Hidden among sea anemones: the first comprehensive phylogenetic reconstruction of the order Actiniaria (Cnidaria, Anthozoa, Hexacorallia reveals a novel group of hexacorals.

    Directory of Open Access Journals (Sweden)

    Estefanía Rodríguez

    Full Text Available Sea anemones (order Actiniaria are among the most diverse and successful members of the anthozoan subclass Hexacorallia, occupying benthic marine habitats across all depths and latitudes. Actiniaria comprises approximately 1,200 species of solitary and skeleton-less polyps and lacks any anatomical synapomorphy. Although monophyly is anticipated based on higher-level molecular phylogenies of Cnidaria, to date, monophyly has not been explicitly tested and at least some hypotheses on the diversification of Hexacorallia have suggested that actiniarians are para- or poly-phyletic. Published phylogenies have demonstrated the inadequacy of existing morphological-based classifications within Actiniaria. Superfamilial groups and most families and genera that have been rigorously studied are not monophyletic, indicating conflict with the current hierarchical classification. We test the monophyly of Actiniaria using two nuclear and three mitochondrial genes with multiple analytical methods. These analyses are the first to include representatives of all three currently-recognized suborders within Actiniaria. We do not recover Actiniaria as a monophyletic clade: the deep-sea anemone Boloceroides daphneae, previously included within the infraorder Boloceroidaria, is resolved outside of Actiniaria in several of the analyses. We erect a new genus and family for B. daphneae, and rank this taxon incerti ordinis. Based on our comprehensive phylogeny, we propose a new formal higher-level classification for Actiniaria composed of only two suborders, Anenthemonae and Enthemonae. Suborder Anenthemonae includes actiniarians with a unique arrangement of mesenteries (members of Edwardsiidae and former suborder Endocoelantheae. Suborder Enthemonae includes actiniarians with the typical arrangement of mesenteries for actiniarians (members of former suborders Protantheae, Ptychodacteae, and Nynantheae and subgroups therein. We also erect subgroups within these two newly

  12. Structure, folding and stability of a minimal homologue from Anemonia sulcata of the sea anemone potassium channel blocker ShK. (United States)

    Krishnarjuna, Bankala; MacRaild, Christopher A; Sunanda, Punnepalli; Morales, Rodrigo A V; Peigneur, Steve; Macrander, Jason; Yu, Heidi H; Daly, Marymegan; Raghothama, Srinivasarao; Dhawan, Vikas; Chauhan, Satendra; Tytgat, Jan; Pennington, Michael W; Norton, Raymond S


    Peptide toxins elaborated by sea anemones target various ion-channel sub-types. Recent transcriptomic studies of sea anemones have identified several novel candidate peptides, some of which have cysteine frameworks identical to those of previously reported sequences. One such peptide is AsK132958, which was identified in a transcriptomic study of Anemonia sulcata and has a cysteine framework similar to that of ShK from Stichodactyla helianthus, but is six amino acid residues shorter. We have determined the solution structure of this novel peptide using NMR spectroscopy. The disulfide connectivities and structural scaffold of AsK132958 are very similar to those of ShK but the structure is more constrained. Toxicity assays were performed using grass shrimp (Palaemonetes sp) and Artemia nauplii, and patch-clamp electrophysiology assays were performed to assess the activity of AsK132958 against a range of voltage-gated potassium (K V ) channels. AsK132958 showed no activity against grass shrimp, Artemia nauplii, or any of the K V channels tested, owing partly to the absence of a functional Lys-Tyr dyad. Three AsK132958 analogues, each containing a Tyr in the vicinity of Lys19, were therefore generated in an effort to restore binding, but none showed activity against any of K V channels tested. However, AsK132958 and its analogues are less susceptible to proteolysis than that of ShK. Our structure suggests that Lys19, which might be expected to occupy the pore of the channel, is not sufficiently accessible for binding, and therefore that AsK132958 must have a distinct functional role that does not involve K V channels. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Hidden among Sea Anemones: The First Comprehensive Phylogenetic Reconstruction of the Order Actiniaria (Cnidaria, Anthozoa, Hexacorallia) Reveals a Novel Group of Hexacorals (United States)

    Rodríguez, Estefanía; Barbeitos, Marcos S.; Brugler, Mercer R.; Crowley, Louise M.; Grajales, Alejandro; Gusmão, Luciana; Häussermann, Verena; Reft, Abigail; Daly, Marymegan


    Sea anemones (order Actiniaria) are among the most diverse and successful members of the anthozoan subclass Hexacorallia, occupying benthic marine habitats across all depths and latitudes. Actiniaria comprises approximately 1,200 species of solitary and skeleton-less polyps and lacks any anatomical synapomorphy. Although monophyly is anticipated based on higher-level molecular phylogenies of Cnidaria, to date, monophyly has not been explicitly tested and at least some hypotheses on the diversification of Hexacorallia have suggested that actiniarians are para- or poly-phyletic. Published phylogenies have demonstrated the inadequacy of existing morphological-based classifications within Actiniaria. Superfamilial groups and most families and genera that have been rigorously studied are not monophyletic, indicating conflict with the current hierarchical classification. We test the monophyly of Actiniaria using two nuclear and three mitochondrial genes with multiple analytical methods. These analyses are the first to include representatives of all three currently-recognized suborders within Actiniaria. We do not recover Actiniaria as a monophyletic clade: the deep-sea anemone Boloceroides daphneae, previously included within the infraorder Boloceroidaria, is resolved outside of Actiniaria in several of the analyses. We erect a new genus and family for B. daphneae, and rank this taxon incerti ordinis. Based on our comprehensive phylogeny, we propose a new formal higher-level classification for Actiniaria composed of only two suborders, Anenthemonae and Enthemonae. Suborder Anenthemonae includes actiniarians with a unique arrangement of mesenteries (members of Edwardsiidae and former suborder Endocoelantheae). Suborder Enthemonae includes actiniarians with the typical arrangement of mesenteries for actiniarians (members of former suborders Protantheae, Ptychodacteae, and Nynantheae and subgroups therein). We also erect subgroups within these two newly-erected suborders

  14. Measurements of cnidae from sea anemones (Cnidaria: Actiniaria, III: ranges and other measures of statistical dispersion, their interrelations and taxonomic relevance

    Directory of Open Access Journals (Sweden)

    R. B. Williams


    Full Text Available This is the third of a series of papers examining the taxonomic relevance of some statistical treatments of measurements of cnidae from sea anemones (Actiniaria. Some cnida lengths from fresh tissue samples (column ectoderm, tentacles or acontia from Nematostella vectensis, Haliplanella lineata, Sagartia elegans, Metridium senile, Cereus pedunculatus, Sagartia troglodytes, Anthopleura thallia, Urticina eques and Sagartiogeton lacerates were measured. Five measures of statistical dispersion (sample standard deviation, coefficient of variation, observed sample range, standard range, and 99% probable maximum value of the standard range were calculated, and their interrelations and potential applications were appraised. It has long been the convention to use the largest and smallest cnida sizes (observed sample range from tissue samples in attempts to establish differences between actiniarian taxa. However, such data do not reflect the true extremes of a population range. In the present study, the 99% probable maximum value of the standard range for a standard abundance of 1,000 gave the greatest and, therefore, the most cautious estimate of a population range of cnida sizes for a species. This maximum standard range is the only measure of dispersion of cnida sizes that may be used validly to demonstrate that anemone specimens are of different species, and then only if there is no overlap between the extreme cnida sizes being compared. However, partial or complete overlaps of cnida size extremes do not necessarily indicate that specimens are conspecific; other taxonomic characters must also be considered. Coefficients of variation may provide valuable clues as to the homogeneity or heterogeneity of samples of cnida measurements. This paper should be read in conjunction with the first two in this series, which address the taxonomic relevance of differences between mean cnida sizes (Williams, 1996, Sci. Mar., 60: 339-351; 1998, Sci. Mar., 62: 361-372.

  15. A sea anemone of many names: a review of the taxonomy and distribution of the invasive actiniarian Diadumene lineata (Diadumenidae, with records of its reappearance on the Texas coast

    Directory of Open Access Journals (Sweden)

    Zachary B. Hancock


    Full Text Available Diadumene lineata (Actiniaria: Diadumenidae is a prolific invader of coastal environments around the world. First described from Asia, this sea anemone has only been reported once from the western Gulf of Mexico at Port Aransas, Texas. No subsequent sampling has located this species at this locality. The first record of the reappearance of D. lineata on the Texas coast from three locations in the Galveston Bay area is provided, and its geographic distribution and taxonomic history reviewed.

  16. Natural selection and neutral evolution jointly drive population divergence between alpine and lowland ecotypes of the allopolyploid plant Anemone multifida (Ranunculaceae). (United States)

    McEwen, Jamie R; Vamosi, Jana C; Rogers, Sean M


    Population differentiation can be driven in large part by natural selection, but selectively neutral evolution can play a prominent role in shaping patters of population divergence. The decomposition of the evolutionary history of populations into the relative effects of natural selection and selectively neutral evolution enables an understanding of the causes of population divergence and adaptation. In this study, we examined heterogeneous genomic divergence between alpine and lowland ecotypes of the allopolyploid plant, Anemone multifida. Using peak height and dominant AFLP data, we quantified population differentiation at non-outlier (neutral) and outlier loci to determine the potential contribution of natural selection and selectively neutral evolution to population divergence. We found 13 candidate loci, corresponding to 2.7% of loci, with signatures of divergent natural selection between alpine and lowland populations and between alpine populations (Fst  = 0.074-0.445 at outlier loci), but neutral population differentiation was also evident between alpine populations (FST  = 0.041-0.095 at neutral loci). By examining population structure at both neutral and outlier loci, we determined that the combined effects of selection and neutral evolution are associated with the divergence of alpine populations, which may be linked to extreme abiotic conditions and isolation between alpine sites. The presence of outlier levels of genetic variation in structured populations underscores the importance of separately analyzing neutral and outlier loci to infer the relative role of divergent natural selection and neutral evolution in population divergence.

  17. Nutrients, signals, and photosynthetic release by symbiotic algae. The impact of taurine on the dinoflagellate alga Symbiodinium from the sea anemone Aiptasia pulchella

    International Nuclear Information System (INIS)

    Wang, J.T.; Douglas, A.E.


    Exogenous concentrations of 10 micromolar to 1 mM of the nonprotein amino acid taurine stimulated photosynthate release from the dinoflagellate alga Symbiodinium, which had been freshly isolated from the sea anemone Aiptasia pulchella. Photosynthate release, as induced by taurine and animal extract, was metabolically equivalent at both concentrations in that they (a) stimulated photosynthate release to the same extent and (b) induced the selective release of photosynthetically derived organic acids. A complex mixture of amino acids at 75 mM also promoted photosynthate release, but the release rate was reduced by 34% after the omission of taurine (3 mM) from the mixture, suggesting that much of the effect of amino acids was largely attributable to taurine. Exogenous 14C-labeled taurine was taken up by the cells, and more than 95% of the internalized 14C was recovered as taurine, indicating that taurine-induced photosynthate release was not dependent on taurine metabolism. Both taurine uptake and taurine-induced photosynthate release by Symbiodinium exhibited saturation kinetics, but with significantly different Km values of 68 and 21 micromolar, respectively. The difference in Km values is compatible with the hypothesis that Symbiodinium has a taurine signal transducer that is responsible for photosynthate release and is distinct from the taurine transporter

  18. Natural selection and neutral evolution jointly drive population divergence between alpine and lowland ecotypes of the allopolyploid plant Anemone multifida (Ranunculaceae.

    Directory of Open Access Journals (Sweden)

    Jamie R McEwen

    Full Text Available Population differentiation can be driven in large part by natural selection, but selectively neutral evolution can play a prominent role in shaping patters of population divergence. The decomposition of the evolutionary history of populations into the relative effects of natural selection and selectively neutral evolution enables an understanding of the causes of population divergence and adaptation. In this study, we examined heterogeneous genomic divergence between alpine and lowland ecotypes of the allopolyploid plant, Anemone multifida. Using peak height and dominant AFLP data, we quantified population differentiation at non-outlier (neutral and outlier loci to determine the potential contribution of natural selection and selectively neutral evolution to population divergence. We found 13 candidate loci, corresponding to 2.7% of loci, with signatures of divergent natural selection between alpine and lowland populations and between alpine populations (Fst  = 0.074-0.445 at outlier loci, but neutral population differentiation was also evident between alpine populations (FST  = 0.041-0.095 at neutral loci. By examining population structure at both neutral and outlier loci, we determined that the combined effects of selection and neutral evolution are associated with the divergence of alpine populations, which may be linked to extreme abiotic conditions and isolation between alpine sites. The presence of outlier levels of genetic variation in structured populations underscores the importance of separately analyzing neutral and outlier loci to infer the relative role of divergent natural selection and neutral evolution in population divergence.

  19. Primary structure of the precursor for the sea anemone neuropeptide Antho-RFamide (less than Glu-Gly-Arg-Phe-NH2)

    DEFF Research Database (Denmark)

    Darmer, D; Schmutzler, C; Diekhoff, D


    Neuropeptides containing the carboxylterminal sequence Arg-Phe-NH2 are found throughout the animal kingdom and are important substances mediating neuronal communication. Here, we have cloned the cDNA coding for the precursor protein of the sea anemone neuropeptide (Antho-RFamide) less than Glu......-Gly-Arg-Phe-NH2. This precursor is 334 amino acids in length and contains 19 copies of unprocessed Antho-RFamide (Gln-Gly-Arg-Phe-Gly), which are tandemly arranged in the C-terminal part of the protein. Paired basic residues (Lys-Arg) or single basic residues (Arg) occur at the C-terminal side of each Antho...... or glutamic acid residues. Such processing is, to our knowledge, hitherto unknown for peptidergic neurons. The Antho-RFamide precursor also contains two copies of the putative Antho-RFamide-related peptide Phe-Gln-Gly-Arg-Phe-NH2 and one copy of Tyr-Val-Pro-Gly-Arg-Tyr-NH2. In addition, the precursor protein...

  20. The Effect of Cholesterol on the Long-Range Network of Interactions Established among Sea Anemone Sticholysin II Residues at the Water-Membrane Interface

    Directory of Open Access Journals (Sweden)

    Sara García-Linares


    Full Text Available Actinoporins are α-pore forming proteins with therapeutic potential, produced by sea anemones. Sticholysin II (StnII from Stichodactyla helianthus is one of its most extensively characterized members. These proteins remain stably folded in water, but upon interaction with lipid bilayers, they oligomerize to form a pore. This event is triggered by the presence of sphingomyelin (SM, but cholesterol (Chol facilitates pore formation. Membrane attachment and pore formation require changes involving long-distance rearrangements of residues located at the protein-membrane interface. The influence of Chol on membrane recognition, oligomerization, and/or pore formation is now studied using StnII variants, which are characterized in terms of their ability to interact with model membranes in the presence or absence of Chol. The results obtained frame Chol not only as an important partner for SM for functional membrane recognition but also as a molecule which significantly reduces the structural requirements for the mentioned conformational rearrangements to occur. However, given that the DOPC:SM:Chol vesicles employed display phase coexistence and have domain boundaries, the observed effects could be also due to the presence of these different phases on the membrane. In addition, it is also shown that the Arg51 guanidinium group is strictly required for membrane recognition, independently of the presence of Chol.

  1. Individual marking of soft-bodied subtidal invertebrates in situ - A novel staining technique applied to the giant plumose anemone Metridium farcimen (Tilesius, 1809.

    Directory of Open Access Journals (Sweden)

    Christopher D Wells

    Full Text Available The ability to recognize individuals and track growth over time is crucial to population dynamics research as well as studies of animal behavior. Invertebrates are particularly difficult to track as they often molt, have regenerative capabilities, or lack hard parts to attach markers. We tested, in laboratory and field studies, a new way of marking sea anemones (order Actiniaria by injection of three vital stains (i.e., neutral red, methylene blue, and fluorescein. Neutral red and methylene blue did not affect growth or survival, but fluorescein was lethal at high concentrations. Marked individuals could be identified up to seven months after injection with neutral red, six weeks with methylene blue, and three days with low concentrations of fluorescein. Neutral red could be used for long-term monitoring of growth and survival in the field, and in combination with methylene blue could be used to mark individuals in distinguishable patterns for short-term studies such as examining predator-prey interactions, movement of individuals, and recruitment survival.

  2. Anthopleura radians, a new species of sea anemone (Cnidaria: Actiniaria: Actiniidae from northern Chile, with comments on other species of the genus from the South Pacific Ocean

    Directory of Open Access Journals (Sweden)

    Carlos Spano


    Full Text Available A new species of sea anemone, Anthopleura radians n. sp., is described from the intertidal zone of northern Chile and the taxonomic status of the other Anthopleura species from the South Pacific are discussed. A. radians n. sp. is characterized by a yellow-whitish and brown checkerboard-like pattern on the oral disc, adhesive verrucae along the entire column and a series of marginal projections, each bearing a brightly-colored acrorhagus on the oral surface. This is the seventh species of Anthopleura described from the South Pacific Ocean; each one distinguished by a particular combination of differences related to their coloration pattern, presence of zooxanthellae, cnidae, and mode of reproduction. Some of these species have not been reported since their original description and thus require to be taxonomically validated. A. hermaphroditica and A. aureoradiata are synonyms considering the lack of differences seen between live specimens, museum collections and published records. A. radians could also be a junior synonym of A. minima, however, no type material was found for testing this hypothesis. Furthermore, it is crucial to designate neotypes for A. inconspicua, A. rosea and A. minima since there are no name-bearing types reported for these species.

  3. Evidence for participation of GCS1 in fertilization of the starlet sea anemone Nematostella vectensis: Implication of a common mechanism of sperm–egg fusion in plants and animals

    Energy Technology Data Exchange (ETDEWEB)

    Ebchuqin, Eerdundagula; Yokota, Naoto; Yamada, Lixy [Sugashima Marine Biological Laboratory, Graduate School of Science, Nagoya University, Sugashima, Toba 517-0004 (Japan); Yasuoka, Yuuri [Marine Genomics Unit, Okinawa Institute of Science and Technology, Onna, Okinawa 904-0495 (Japan); Akasaka, Mari [Laboratory of Molecular Genetics, Graduate School of Science, Nagoya University, Chikusa-ku, Furo-cho, Nagoya 464-8602 (Japan); Arakawa, Mio; Deguchi, Ryusaku [Department of Biology, Miyagi University of Education, Sendai, Miyagi 980-0845 (Japan); Mori, Toshiyuki [Waseda Institute for Advanced Study, Waseda University, Shinjuku, Tokyo 169-8050 (Japan); Sawada, Hitoshi, E-mail: [Sugashima Marine Biological Laboratory, Graduate School of Science, Nagoya University, Sugashima, Toba 517-0004 (Japan)


    Highlights: • GCS1 is a sperm transmembrane protein that is essential for gamete fusion in flowering plants. • The GCS1 gene is present not only in angiosperms but also in unicellular organisms and animals. • NvGCS1 gene is expressed in the testis and GCS1 protein exists in sperm of a sea anemone. • Anti-GCS1 antibodies inhibited the fertilization, showing the participation in fertilization. - Abstract: It has been reported that GCS1 (Generative Cell Specific 1) is a transmembrane protein that is exclusively expressed in sperm cells and is essential for gamete fusion in flowering plants. The GCS1 gene is present not only in angiosperms but also in unicellular organisms and animals, implying the occurrence of a common or ancestral mechanism of GCS1-mediated gamete fusion. In order to elucidate the common mechanism, we investigated the role of GCS1 in animal fertilization using a sea anemone (Cnidaria), Nematostella vectensis. Although the existence of the GCS1 gene in N. vectensis has been reported, the expression of GCS1 in sperm and the role of GCS1 in fertilization are not known. In this study, we showed that the GCS1 gene is expressed in the testis and that GCS1 protein exists in sperm by in situ hybridization and proteomic analysis, respectively. Then we made four peptide antibodies against the N-terminal extracellular region of NvGCS1. These antibodies specifically reacted to NvGCS1 among sperm proteins on the basis of Western analysis and potently inhibited fertilization in a concentration-dependent manner. These results indicate that sperm GCS1 plays a pivotal role in fertilization, most probably in sperm–egg fusion, in a starlet sea anemone, suggesting a common gamete-fusion mechanism shared by eukaryotic organisms.

  4. Antifouling activity by sea anemone (Heteractis magnifica and H. aurora extracts against marine biofilm bacteria Actividades antiincrustantes de las extractos de las anémonas marinas Heteractis magnifica y H. aurora frente a biofilm de bacterias marinas

    Directory of Open Access Journals (Sweden)

    Subramanian Bragadeeswaran


    Full Text Available Sea anemones (Actiniaria are solitary, ocean-dwelling members of the phylum Cnidaria and the class Anthozoa. In this study, we screened antibacterial activity of two benthic sea anemones (Heteractis magnifica and H. aurora collected from the Mandapam coast of southeast India. Crude extracts of the sea anemone were assayed against seven bacterial biofilms isolated from three different test panels. The crude extract of H. magnifica showed a maximum inhibition zone of 18 mm against Pseudomonas sp. and Escherichia coli and a minimum inhibition zone of 3 mm against Pseudomonas aeruginosa, Micrococcus sp., and Bacillus cerens for methanol, acetone, and DCM extracts, respectively. The butanol extract of H. aurora showed a maximum inhibition zone of 23 mm against Vibrio parahaemolyticus, whereas the methanol extract revealed a minimum inhibition zone of 1 mm against V. parahaemolyticus. The present study revealed that the H. aurora extracts were more effective than those of H. magnifica and that the active compounds from the sea anemone can be used as antifouling compounds.Las anémonas de mar (Actiniaria son solitarias, habitantes oceánicos del phylum Cnidaria y de la clase Anthozoa. En este estudio se determina la actividad antibacteriana de dos anémonas bentónicas Heteractis magnifica y H. aurora recolectadas en la costa de Mandapam, sudeste de India. Los extractos crudos de estas anémonas fueron ensayados frente a siete biofilms bacterianos aislados de tres paneles de control distintos. El extracto crudo de la anémona H. magnifica mostró una zona inhibición máxima de 18 mm contra Psudomonas sp. y Escherichia coli y la zona de inhibición mínima de 3 mm fue encontrada frente a Pseudomonas aeruginosa, Micrococus sp. y Bacillus cerens de extractos de metanol, acetona y DCM respectivamente. El extracto de butanol de la anémona H. magnifica mostró una zona de inhibición máxima de 23 mm frente a Vibrio parahemolyticus, mientras que con el

  5. Kunitz-Type Peptide HCRG21 from the Sea Anemone Heteractis crispa Is a Full Antagonist of the TRPV1 Receptor

    Directory of Open Access Journals (Sweden)

    Margarita Monastyrnaya


    Full Text Available Sea anemone venoms comprise multifarious peptides modulating biological targets such as ion channels or receptors. The sequence of a new Kunitz-type peptide, HCRG21, belonging to the Heteractis crispa RG (HCRG peptide subfamily was deduced on the basis of the gene sequence obtained from the Heteractis crispa cDNA. HCRG21 shares high structural homology with Kunitz-type peptides APHC1–APHC3 from H. crispa, and clusters with the peptides from so named “analgesic cluster” of the HCGS peptide subfamily but forms a separate branch on the NJ-phylogenetic tree. Three unique point substitutions at the N-terminus of the molecule, Arg1, Gly2, and Ser5, distinguish HCRG21 from other peptides of this cluster. The trypsin inhibitory activity of recombinant HCRG21 (rHCRG21 was comparable with the activity of peptides from the same cluster. Inhibition constants for trypsin and α-chymotrypsin were 1.0 × 10−7 and 7.0 × 10−7 M, respectively. Electrophysiological experiments revealed that rHCRG21 inhibits 95% of the capsaicin-induced current through transient receptor potential family member vanilloid 1 (TRPV1 and has a half-maximal inhibitory concentration of 6.9 ± 0.4 μM. Moreover, rHCRG21 is the first full peptide TRPV1 inhibitor, although displaying lower affinity for its receptor in comparison with other known ligands. Macromolecular docking and full atom Molecular Dynamics (MD simulations of the rHCRG21–TRPV1 complex allow hypothesizing the existence of two feasible, intra- and extracellular, molecular mechanisms of blocking. These data provide valuable insights in the structural and functional relationships and pharmacological potential of bifunctional Kunitz-type peptides.

  6. Distribution of CpG Motifs in Upstream Gene Domains in a Reef Coral and Sea Anemone: Implications for Epigenetics in Cnidarians.

    Directory of Open Access Journals (Sweden)

    Adam G Marsh

    Full Text Available Coral reefs are under assault from stressors including global warming, ocean acidification, and urbanization. Knowing how these factors impact the future fate of reefs requires delineating stress responses across ecological, organismal and cellular scales. Recent advances in coral reef biology have integrated molecular processes with ecological fitness and have identified putative suites of temperature acclimation genes in a Scleractinian coral Acropora hyacinthus. We wondered what unique characteristics of these genes determined their coordinate expression in response to temperature acclimation, and whether or not other corals and cnidarians would likewise possess these features. Here, we focus on cytosine methylation as an epigenetic DNA modification that is responsive to environmental stressors. We identify common conserved patterns of cytosine-guanosine dinucleotide (CpG motif frequencies in upstream promoter domains of different functional gene groups in two cnidarian genomes: a coral (Acropora digitifera and an anemone (Nematostella vectensis. Our analyses show that CpG motif frequencies are prominent in the promoter domains of functional genes associated with environmental adaptation, particularly those identified in A. hyacinthus. Densities of CpG sites in upstream promoter domains near the transcriptional start site (TSS are 1.38x higher than genomic background levels upstream of -2000 bp from the TSS. The increase in CpG usage suggests selection to allow for DNA methylation events to occur more frequently within 1 kb of the TSS. In addition, observed shifts in CpG densities among functional groups of genes suggests a potential role for epigenetic DNA methylation within promoter domains to impact functional gene expression responses in A. digitifera and N. vectensis. Identifying promoter epigenetic sequence motifs among genes within specific functional groups establishes an approach to describe integrated cellular responses to

  7. Who knows not where an anemone does wear his sting? Could polypeptides released from the columnar vesicles of Bunodosoma cangicum induce apoptosis in the ZF-L cell line? (United States)

    Bastos, Claudio L Q; Varela, Antonio Sergio; Ferreira, Shana Pires; Nornberg, Bruna Felix; Boyle, Robert Tew


    We provide ultrastructural and cytological evidence that the tentacles of the sea anemone Bunodosoma cangicum does not contain cytotoxic venom. However, we show that the stimulated secretion of an apparent mixture of biomolecules containing polypeptides from the columnar vesicles of Bunodosoma cangicum is apparently a potent inducer of apoptosis in the zebrafish cell line, ZF-L. Microscopic fluorescence, cell morphology and flow cytometric assays confirm the apoptotic activity. Crude vesicle venom was partially purified by size exclusion chromatography. PAGE analysis shows that this venom contains low weight polypeptides but no measurable protein. The apoptotic activity is heat labile, and the observed peptides concurrent with this activity have a molecular weight of approximately 2000 Da. This manuscript is the first report of biologically active molecules and peptides associated with columnar vesicles of anemones, and the first to confirm that the tentacles of B. cangicum do not contain cytotoxic venom, and express spirocytes exclusively. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. A diverse array of creatine kinase and arginine kinase isoform genes is present in the starlet sea anemone Nematostella vectensis, a cnidarian model system for studying developmental evolution. (United States)

    Uda, Kouji; Ellington, W Ross; Suzuki, Tomohiko


    Phosphagen (guanidino) kinases (PK) constitute a family of homologous phosphotransferases catalyzing the reversible transfer of the high-energy phosphoryl group of ATP to naturally occurring guanidine compounds. Prior work has shown that PKs can be phylogenetically separated into two distinct groups- an arginine kinase (AK) subfamily and a creatine kinase (CK) subfamily. The latter includes three CK isoforms- cytoplasmic CK (CyCK), mitochondrial CK (MiCK) and three-domain flagellar CK (fCK). In the present study we identified six unique PK genes from the draft genome sequence of the starlet sea anemone Nematostella vectensis, a well-known model organism for understanding metazoan developmental evolution. Using reverse transcription polymerase chain reaction (RTPCR) methods, full length cDNAs were amplified for all of these PKs. These cDNAs were cloned and expressed in Escherichia coli as 6x His-tagged fusion proteins. The six PKs were identified as the three typical CK isoforms (CyCK, MiCK and fCK), two unusual AKs (a two-domain AK (2DAK) and a three-domain AK (3DAK)) and a PK which phosphorylated arginine. The latter enzyme had a very low AK activity (its apparent V(max) value being less than 0.2% that of 3DAK), lacks several key residues necessary for AK enzyme activity, and was tentatively designated as AK1. As far as we know, this constitutes the first report of an AK with the three fused AK domains. The Bayesian tree suggested that the third domain of 3DAK likely evolved from the gene for domain 2 of typical two-domain AK found widely in cnidarians. Construction of phylogenetic trees and comparison of exon-intron organizations of their respective genes indicated that the N. vectensis three-domain fCK and 3DAK evolved independently, and both enzymes are likely to be targeted to cell membranes since they have a myristoylation signal at their respective N-termini. These results complement prior work on other basal invertebrates showing that multiple CK and AK

  9. Different Principles of ADP-Ribose-Mediated Activation and Opposite Roles of the NUDT9 Homology Domain in the TRPM2 Orthologs of Man and Sea Anemone

    Directory of Open Access Journals (Sweden)

    Frank Kühn


    Full Text Available A decisive element in the human cation channel TRPM2 is a region in its cytosolic C-terminus named NUDT9H because of its homology to the NUDT9 enzyme, a pyrophosphatase degrading ADP-ribose (ADPR. In hTRPM2, however, the NUDT9H domain has lost its enzymatic activity but serves as a binding domain for ADPR. As consequence of binding, gating of the channel is initiated. Since ADPR is produced after oxidative DNA damage, hTRPM2 mediates Ca2+ influx in response to oxidative stress which may lead to cell death. In the genome of the sea anemone Nematostella vectensis (nv, a preferred model organism for the evolution of key bilaterian features, a TRPM2 ortholog has been identified that contains a NUDT9H domain as well. Heterologous expression of nvTRPM2 in HEK-293 cells reveals a cation channel with many close similarities to the human counterpart. Most notably, nvTRPM2 is activated by ADPR, and Ca2+ is a co-agonist. However, the intramolecular mechanisms of ADPR gating as well as the role of NUDT9H are strikingly different in the two species. Whereas already subtle changes of NUDT9H abolish ADPR gating in hTRPM2, the region can be completely removed from nvTRPM2 without loss of responses to ADPR. An alternative ADPR binding site seems to be present but has not yet been characterized. The ADP-ribose pyrophosphatase (ADPRase function of nvNUDT9H has been preserved but can be abolished by numerous genetic manipulations. All these manipulations create channels that are sensitive to hydrogen peroxide which fails to induce channel activity in wild-type nvTRPM2. Therefore, the function of NUDT9H in nvTRPM2 is the degradation of ADPR, thereby reducing agonist concentration in the presence of oxidative stress. Thus, the two TRPM2 orthologs have evolved divergently but nevertheless gained analogous functional properties, i.e., gating by ADPR with Ca2+ as co-factor. Opposite roles are played by the respective NUDT9H domains, either binding of ADPR and mediating

  10. Vitamin B1 thiazole derivative reduces transmembrane current through ionic channels formed by toxins from black widow spider venom and sea anemone in planar phospholipid membranes. (United States)

    Shatursky, Oleg Ya; Volkova, Tatyana M; Romanenko, Olexander V; Himmelreich, Nina H; Grishin, Eugene V


    The vitamin B1 (thiamine) structural analogue 3-decyloxycarbonylmethyl-4-methyl-5-(beta-hydroxyethyl) thiazole chloride (DMHT) (0.1 mM) reversibly reduced transmembrane currents in CaCl2 and KCl solutions via ionic channels produced by latrotoxins (alpha-latrotoxin (alpha-LT) and alpha-latroinsectotoxin (alpha-LIT)) from black widow spider venom and sea anemone toxin (RTX) in the bilayer lipid membranes (BLMs). Introduction of DMHT from the cis-side of BLM bathed in 10 mM CaCl2 inhibited transmembrane current by 31.6+/-3% and by 61.8+/-3% from the trans-side of BLM for alpha-LT channels. Application of DMHT in the solution of 10 mM CaCl2 to the cis-side of BLM decreased the current through the alpha-LIT and RTX channels by 52+/-4% and 50+/-5%, respectively. Addition of Cd2+ (1 mM) to the cis- or trans-side of the membrane after the DMHT-induced depression of Ca2+-current across the alpha-LT channels caused its further decrease by 85+/-5% that coincides favorably with the intensity of Cd2+ blocking in control experiments without DMHT. These data suggest that DMHT inhibiting is not specific for latrotoxin channels only and DMHT may exert its action on alpha-LT channels without considerable influence on the ionogenic groups of Ca2+-selective site inside the channel cavity. The binding kinetics of DMHT with the alpha-LT channel shows no cooperativity and allows to expect that the DMHT binding site of the toxin is formed by one ionogenic group as the slopes of inhibition rate determined in log-log coordinates are 1.25 on the trans-side and 0.68 on the cis-side. Similar pK of binding (5.4 on the trans-side and 5.7 on the cis-side) also suggest that DMHT may interact with the same high affinity site of alpha-LT channel on either side of the BLM. The comparative analysis of effective radii measured for alpha-LT, alpha-LIT and RTX channels on the cis-side (0.9 nm, 0.53 nm and 0.55 nm, correspondingly) and for alpha-LT channel on the trans-side (0.28+/-0.18 nm) with the

  11. Distribution patterns of Chilean shallow-water sea anemones (Cnidaria: Anthozoa: Actiniaria, Corallimorpharia; with a discussion of the taxonomic and zoogeographic relationships between the actinofauna of the South East Pacific, the South West Atlantic and the Antarctic

    Directory of Open Access Journals (Sweden)

    Verena Häussermann


    Full Text Available The first complete zoogeographical analysis of Chilean shallow water sea anemones (Actiniaria and Corallimorpharia and their taxonomic relations with neighbouring faunas is provided, based on extensive recent sampling in combination with a literature review. Between 1994 and 2004, we collected more than 1000 specimens of 32 distinct species of Actiniaria and Corallimorpharia at more than 100 sites along the Chilean coast between Arica (18°30’S; 70°19’W and the Straits of Magellan (53°36’S 70°56’W. Sampling was done in the intertidal during low tides and in the subtidal by means of SCUBA diving down to depths of 40 m. The northern part of the Chilean fjord region showed the highest number of species (23. Our results contradict an abrupt general change in the marine faunal composition at 42°S, instead showing the continuation of species of the exposed coast and the joining of fjord species due to the availability of additional habitats in the richly structured fjord region south of 42°S, and also to eurybathy. The southern distribution limits of the species we found in northern and central Chile show only one significant concentration around the Peninsula Taitao (approx. 48°S. This either indicates a zoogeographic barrier for shallow water species at the Peninsula Taitao, or is a sampling artifact caused by poor data from the region between the Peninsula Taitao and the Straits of Magellan. According to the literature, 18 of the 63 described Chilean sea anemones (Pacific Ocean can also be found in Argentina (Atlantic Ocean and 13 in the Antarctic. However, many records and statuses of the common species of the South East Pacific and the South West Atlantic/Antarctic are uncertain or doubtful and need revision or confirmation.

  12. Actiniarian Sea anemone fauna of India

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.

    stream_size 11 stream_content_type text/plain stream_name Mar_Biofouling_Power_Plants_1990_218.pdf.txt stream_source_info Mar_Biofouling_Power_Plants_1990_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset...

  13. Characterization of the gut microbiota in the red panda (Ailurus fulgens.

    Directory of Open Access Journals (Sweden)

    Fanli Kong

    Full Text Available The red panda is the only living species of the genus Ailurus. Like giant pandas, red pandas are also highly specialized to feed mainly on highly fibrous bamboo. Although several studies have focused on the gut microbiota in the giant panda, little is known about the gut microbiota of the red panda. In this study, we characterized the fecal microbiota from both wild (n = 16 and captive (n = 6 red pandas using a pyrosequecing based approach targeting the V1-V3 hypervariable regions of the 16S rRNA gene. Distinct bacterial communities were observed between the two groups based on both membership and structure. Wild red pandas maintained significantly higher community diversity, richness and evenness than captive red pandas, the communities of which were skewed and dominated by taxa associated with Firmicutes. Phylogenetic analysis of the top 50 OTUs revealed that 10 of them were related to known cellulose degraders. To the best of our knowledge, this is the first study of the gut microbiota of the red panda. Our data suggest that, similar to the giant panda, the gut microbiota in the red panda might also play important roles in the digestion of bamboo.

  14. Characterization of the gut microbiota in the red panda (Ailurus fulgens). (United States)

    Kong, Fanli; Zhao, Jiangchao; Han, Shushu; Zeng, Bo; Yang, Jiandong; Si, Xiaohui; Yang, Benqing; Yang, Mingyao; Xu, Huailiang; Li, Ying


    The red panda is the only living species of the genus Ailurus. Like giant pandas, red pandas are also highly specialized to feed mainly on highly fibrous bamboo. Although several studies have focused on the gut microbiota in the giant panda, little is known about the gut microbiota of the red panda. In this study, we characterized the fecal microbiota from both wild (n = 16) and captive (n = 6) red pandas using a pyrosequecing based approach targeting the V1-V3 hypervariable regions of the 16S rRNA gene. Distinct bacterial communities were observed between the two groups based on both membership and structure. Wild red pandas maintained significantly higher community diversity, richness and evenness than captive red pandas, the communities of which were skewed and dominated by taxa associated with Firmicutes. Phylogenetic analysis of the top 50 OTUs revealed that 10 of them were related to known cellulose degraders. To the best of our knowledge, this is the first study of the gut microbiota of the red panda. Our data suggest that, similar to the giant panda, the gut microbiota in the red panda might also play important roles in the digestion of bamboo.

  15. Phylogenetic analysis of anemone fishes of the Persian Gulf using ...

    African Journals Online (AJOL)



    Jun 17, 2008 ... 1Department of Marine Biology, Islamic Azad University, Science and Research Branch, Hesarak, Tehran, Iran. 2Department of Microbiology, National Institute of Genetic Engineering and Biotechnology, Pajouhesh BLV, Tehran,. Iran. ³Aquatic Animals Health and Diseases, Faculty of Veterinary Medicine, ...

  16. Plasma composition in a sigmoidal anemone active region

    International Nuclear Information System (INIS)

    Baker, D.; Van Driel-Gesztelyi, L.; Green, L. M.; Carlyle, J.; Brooks, D. H.; Démoulin, P.; Steed, K.


    Using spectra obtained by the EUV Imaging Spectrometer (EIS) instrument onboard Hinode, we present a detailed spatially resolved abundance map of an active region (AR)-coronal hole (CH) complex that covers an area of 359'' × 485''. The abundance map provides first ionization potential (FIP) bias levels in various coronal structures within the large EIS field of view. Overall, FIP bias in the small, relatively young AR is 2-3. This modest FIP bias is a consequence of the age of the AR, its weak heating, and its partial reconnection with the surrounding CH. Plasma with a coronal composition is concentrated at AR loop footpoints, close to where fractionation is believed to take place in the chromosphere. In the AR, we found a moderate positive correlation of FIP bias with nonthermal velocity and magnetic flux density, both of which are also strongest at the AR loop footpoints. Pathways of slightly enhanced FIP bias are traced along some of the loops connecting opposite polarities within the AR. We interpret the traces of enhanced FIP bias along these loops to be the beginning of fractionated plasma mixing in the loops. Low FIP bias in a sigmoidal channel above the AR's main polarity inversion line, where ongoing flux cancellation is taking place, provides new evidence of a bald patch magnetic topology of a sigmoid/flux rope configuration.

  17. Blocking actions of the sea anemone, Bunodosoma cavernata ...

    African Journals Online (AJOL)

    It was also found to block acetylcholine (ACh) – induced contractions of the ileum of grass cutter (90 + 6.2% inhibition + SEM) and the contractile action induced by ACh (0.2mg and 0.4mg) (89 + 5.8% inhibition + SEM) and histamine (0.075mg and 0.15mg) on the rabbit ileum (80 + 4.6% inhibition + SEM) . The antagonism ...

  18. Tiny sea anemone from the Lower Cambrian of China.

    Directory of Open Access Journals (Sweden)

    Jian Han

    Full Text Available BACKGROUND: Abundant fossils from the Ediacaran and Cambrian showing cnidarian grade grossly suggest that cnidarian diversification occurred earlier than that of other eumetazoans. However, fossils of possible soft-bodied polyps are scanty and modern corals are dated back only to the Middle Triassic, although molecular phylogenetic results support the idea that anthozoans represent the first major branch of the Cnidaria. Because of difficulties in taxonomic assignments owing to imperfect preservation of fossil cnidarian candidates, little is known about forms ancestral to those of living groups. METHODS AND FINDINGS: We have analyzed the soft-bodied polypoid microfossils Eolympia pediculata gen. et sp. nov. from the lowest Cambrian Kuanchuanpu Formation in southern China by scanning electron microscopy and computer-aided microtomography after isolating fossils from sedimentary rocks by acetic acid maceration. The fossils, about a half mm in body size, are preserved with 18 mesenteries including directives bilaterally arranged, 18 tentacles and a stalk-like pedicle. The pedicle suggests a sexual life cycle, while asexual reproduction by transverse fission also is inferred by circumferential grooves on the body column. CONCLUSIONS: The features found in the present fossils fall within the morphological spectrum of modern Hexacorallia excluding Ceriantharia, and thus Eolympia pediculata could be a stem member for this group. The fossils also demonstrate that basic features characterizing modern hexacorallians such as bilateral symmetry and the reproductive system have deep roots in the Early Cambrian.

  19. Mechanisms of tentacle morphogenesis in the sea anemone Nematostella vectensis. (United States)

    Fritz, Ashleigh E; Ikmi, Aissam; Seidel, Christopher; Paulson, Ariel; Gibson, Matthew C


    Evolution of the capacity to form secondary outgrowths from the principal embryonic axes was a crucial innovation that potentiated the diversification of animal body plans. Precisely how such outgrowths develop in early-branching metazoan species remains poorly understood. Here we demonstrate that three fundamental processes contribute to embryonic tentacle development in the cnidarian Nematostella vectensis. First, a pseudostratified ectodermal placode forms at the oral pole of developing larvae and is transcriptionally patterned into four tentacle buds. Subsequently, Notch signaling-dependent changes in apicobasal epithelial thickness drive elongation of these primordia. In parallel, oriented cell rearrangements revealed by clonal analysis correlate with shaping of the elongating tentacles. Taken together, our results define the mechanism of embryonic appendage development in an early-branching metazoan, and thereby provide a novel foundation for understanding the diversification of body plans during animal evolution.

  20. Digestion rates of prey eaten by intertidal sea anemones from the ...

    African Journals Online (AJOL)

    Of the various prey categories tested, amphipods tended to be the most rapidly digested group, while molluscs and echinoderms usually remained in the coelenteron the longest. Mean gut retention times in B. reynaudi, the only species found both in False Bay (1 TC) and on the cold west coast (12'C) were markedly longer ...

  1. RGM regulates BMP-mediated secondary axis formation in the sea anemone Nematostella vectensis. (United States)

    Leclère, Lucas; Rentzsch, Fabian


    Patterning of the metazoan dorsoventral axis is mediated by a complex interplay of BMP signaling regulators. Repulsive guidance molecule (RGM) is a conserved BMP coreceptor that has not been implicated in axis specification. We show that NvRGM is a key positive regulator of BMP signaling during secondary axis establishment in the cnidarian Nematostella vectensis. NvRGM regulates first the generation and later the shape of a BMP-dependent Smad1/5/8 gradient with peak activity on the side opposite the NvBMP/NvRGM/NvChordin expression domain. Full knockdown of Smad1/5/8 signaling blocks the formation of endodermal structures, the mesenteries, and the establishment of bilateral symmetry, while altering the gradient through partial NvRGM or NvBMP knockdown shifts the boundaries of asymmetric gene expression and the positioning of the mesenteries along the secondary axis. These findings provide insight into the diversification of axis specification mechanisms and identify a previously unrecognized role for RGM in BMP-mediated axial patterning. Copyright © 2014 The Authors. Published by Elsevier Inc. All rights reserved.

  2. The effect on the transcriptome of Anemone coronaria following infection with rust (Tranzschelia discolor). (United States)

    Laura, Marina; Borghi, Cristina; Bobbio, Valentina; Allavena, Andrea


    In order to understand plant/pathogen interaction, the transcriptome of uninfected (1S) and infected (2I) plant was sequenced at 3'end by the GS FLX 454 platform. De novo assembly of high-quality reads generated 27,231 contigs leaving 37,191 singletons in the 1S and 38,393 in the 2I libraries. ESTcalc tool suggested that 71% of the transcriptome had been captured, with 99% of the genes present being represented by at least one read. Unigene annotation showed that 50.5% of the predicted translation products shared significant homology with protein sequences in GenBank. In all 253 differential transcript abundance (DTAs) were in higher abundance and 52 in lower abundance in the 2I library. 128 higher abundance DTA genes were of fungal origin and 49 were clearly plant sequences. A tBLASTn-based search of the sequences using as query the full length predicted polypeptide product of 50 R genes identified 16 R gene products. Only one R gene (PGIP) was up-regulated. The response of the plant to fungal invasion included the up-regulation of several pathogenesis related protein (PR) genes involved in JA signaling and other genes associated with defense response and down regulation of cell wall associated genes, non-race-specific disease resistance1 (NDR1) and other genes like myb, presqualene diphosphate phosphatase (PSDPase), a UDP-glycosyltransferase 74E2-like (UGT). The DTA genes identified here should provide a basis for understanding the A. coronaria/T. discolor interaction and leads for biotechnology-based disease resistance breeding.

  3. Unconventional amino acid sequence of the sun anemone (Stoichactis helianthus) polypeptide neurotoxin

    International Nuclear Information System (INIS)

    Kem, W.; Dunn, B.; Parten, B.; Pennington, M.; Price, D.


    A 5000 dalton polypeptide neurotoxin (Sh-NI) purified by G50 Sephadex, P-cellulose, and SP-Sephadex chromatography was homogeneous by isoelectric focusing. Sh-NI was highly toxic to crayfish (LD 50 0.6 μg/kg) but without effect upon mice at 15,000 μg/kg (i.p. injection). The reduced, 3 H-carboxymethylated toxin and its fragments were subjected to automatic Edman degradation and the resulting PTH-amino acids were identified by HPLC, back hydrolysis, and scintillation counting. Peptides resulting from proteolytic (clostripain, staphylococcal protease) and chemical (tryptophan) cleavage were sequenced. The sequence is: AACKCDDEGPDIRTAPLTGTVDLGSCNAGWEKCASYYTIIADCCRKKK. This sequence differs considerably from the homologous Anemonia and Anthopleura toxins; many of the identical residues (6 half-cystines, G9, P10, R13, G19, G29, W30) are probably critical for folding rather than receptor recognition. However, the Sh-NI sequence closely resembles Radioanthus macrodactylus neurotoxin III and r. paumotensis II. The authors propose that Sh-NI and related Radioanthus toxins act upon a different site on the sodium channel

  4. Evolutionary Diversification of Banded Tube-Dwelling Anemones (Cnidaria; Ceriantharia; Isarachnanthus) in the Atlantic Ocean (United States)

    Stampar, Sergio N.; Maronna, Maximiliano M.; Vermeij, Mark J. A.; Silveira, Fabio L. d.; Morandini, André C.


    The use of molecular data for species delimitation in Anthozoa is still a very delicate issue. This is probably due to the low genetic variation found among the molecular markers (primarily mitochondrial) commonly used for Anthozoa. Ceriantharia is an anthozoan group that has not been tested for genetic divergence at the species level. Recently, all three Atlantic species described for the genus Isarachnanthus of Atlantic Ocean, were deemed synonyms based on morphological simmilarities of only one species: Isarachnanthus maderensis. Here, we aimed to verify whether genetic relationships (using COI, 16S, ITS1 and ITS2 molecular markers) confirmed morphological affinities among members of Isarachnanthus from different regions across the Atlantic Ocean. Results from four DNA markers were completely congruent and revealed that two different species exist in the Atlantic Ocean. The low identification success and substantial overlap between intra and interspecific COI distances render the Anthozoa unsuitable for DNA barcoding, which is not true for Ceriantharia. In addition, genetic divergence within and between Ceriantharia species is more similar to that found in Medusozoa (Hydrozoa and Scyphozoa) than Anthozoa and Porifera that have divergence rates similar to typical metazoans. The two genetic species could also be separated based on micromorphological characteristics of their cnidomes. Using a specimen of Isarachnanthus bandanensis from Pacific Ocean as an outgroup, it was possible to estimate the minimum date of divergence between the clades. The cladogenesis event that formed the species of the Atlantic Ocean is estimated to have occured around 8.5 million years ago (Miocene) and several possible speciation scenarios are discussed. PMID:22815928

  5. Distribution, habitat use and ecology of deepwater Anemones (Actiniaria) in the Gulf of Mexico (United States)

    Ammons, Archie W.; Daly, Marymegan


    The distribution of deepwater Actiniaria is poorly known. Rarely are these organisms identified to family, as this requires both well-preserved specimens and taxonomic expertise. Ecological information is similarly lacking. From the results of a comprehensive surveying program in the deep Gulf of Mexico, we report the occurrence of nine species of Actiniaria. For the most abundant four of these, we plot distributions and discuss habitat use, morphological variation, and feeding strategies. Actiniaria in the Gulf appear to have broad, basin-wide distributions with little depth preference. Faunal biomass is highest in the NE Gulf within submarine canyons or at the base of slope escarpments. Attachment mode is mostly opportunistic on various types of hard substrata, including trash. Sediment-dwelling forms are very abundant at an organically rich site within a large submarine canyon.

  6. Aphid resistance in florist's chrysanthemum (Chrysanthemum morifolium Ramat.) induced by sea anemone equistatin overexpression

    NARCIS (Netherlands)

    Valizadeh, M.; Deraison, C.; Kazemitabar, S.K.; Rahbé, Y.; Jongsma, M.A.


    Florist's chrysanthemum (Chrysanthemum morifolium Ramat.) belongs to the Asteraceae family and represents the second most important floricultural crop in the world. Most genotypes are sensitive to aphids and infestations can lower quality and cause transmission of viruses. The protease inhibitor Sea

  7. Tentacle cnidae of the sea anemone Metridium senile (Linnaeus, 1761 (Cnidaria: Anthozoa

    Directory of Open Access Journals (Sweden)

    Carina Östman


    Full Text Available Tentacle cnidae of Metridium senile (Linnaeus, 1761 were examined by light microscopy. In addition to spirocysts, feeding-tentacles had 3 nematocyst categories grouped into medium and small size-classes, including 5 types. Spirocysts dominated, especially distally, followed by medium b-mastigophores. The density of cnidae decreased towards the tentacle base. Early cnidoblasts were numerous on the tentacle tip. Late cnidoblasts appeared in a moderate number on the mid-tentacle. Catch-tentacles, found in two Metridium specimens, had a maturity gradient of isorhizas and gland cells along their length. Their tip had two distinct types of mature isorhizas in great numbers and large gland cells, but lacked spirocysts. Mature isorhizas and gland cells decreased in number towards the tentacle base. On the mid-tentacle differentiating ages of isorhizas were numerous. Ordinary feeding-tentacle cnidae, abundant at the tentacle base, decreased in number distally along the tentacle.

  8. Development and epithelial organisation of muscle cells in the sea anemone Nematostella vectensis (United States)


    Introduction Nematostella vectensis, a member of the cnidarian class Anthozoa, has been established as a promising model system in developmental biology, but while information about the genetic regulation of embryonic development is rapidly increasing, little is known about the cellular organization of the various cell types in the adult. Here, we studied the anatomy and development of the muscular system of N. vectensis to obtain further insights into the evolution of muscle cells. Results The muscular system of N. vectensis is comprised of five distinct muscle groups, which are differentiated into a tentacle and a body column system. Both systems house longitudinal as well as circular portions. With the exception of the ectodermal tentacle longitudinal muscle, all muscle groups are of endodermal origin. The shape and epithelial organization of muscle cells vary considerably between different muscle groups. Ring muscle cells are formed as epitheliomuscular cells in which the myofilaments are housed in the basal part of the cell, while the apical part is connected to neighboring cells by apical cell-cell junctions. In the longitudinal muscles of the column, the muscular part at the basal side is connected to the apical part by a long and narrow cytoplasmic bridge. The organization of these cells, however, remains epitheliomuscular. A third type of muscle cell is represented in the longitudinal muscle of the tentacle. Using transgenic animals we show that the apical cell-cell junctions are lost during differentiation, resulting in a detachment of the muscle cells to a basiepithelial position. These muscle cells are still located within the epithelium and outside of the basal matrix, therefore constituting basiepithelial myocytes. We demonstrate that all muscle cells, including the longitudinal basiepithelial muscle cells of the tentacle, initially differentiate from regular epithelial cells before they alter their epithelial organisation. Conclusions A wide range of different muscle cell morphologies can already be found in a single animal. This suggests how a transition from an epithelially organized muscle system to a mesenchymal could have occurred. Our study on N. vectensis provides new insights into the organisation of a muscle system in a non-bilaterian organism. PMID:25009575

  9. New records on sea anemones (Anthozoa: Actiniaria) from hydrothermal vents and cold seeps

    NARCIS (Netherlands)

    López-González, P.J.; Rodríguez, E.; Gili, J.-M.; Segonzac, M.


    During several cruises carried out by the Ifremer (Institut français de recherche pour l’exploitation de la mer) with the submersile “Nautile” at different hydrothermal sites and cold seeps, an important collection of anthozoans - mainly actiniarians - was sampled. Additional material was collected

  10. A redescription of the Sea Anemone Bunodosoma Biscayensis (Fischer, 1874) (Actiniaria, Actiniidae)

    NARCIS (Netherlands)

    Hartog, den J.C.


    Bunodes biscayensis Fischer, 1874, a species of Actiniaria described from Moulleau, Arcachon, south-western coast of France, and never recorded since, was rediscovered in July 1985 and found again in 1986 and 1987 in several localities along the French "Côte Basque" between the mouth of the river

  11. Asexual reproduction and molecular systematics of the sea anemone Anthopleura krebsi (Actiniaria: Actiniidae

    Directory of Open Access Journals (Sweden)

    Paula Braga Gomes


    Full Text Available In this paper we use allozyme analyses to demonstrate that individuals in Anthopleura krebsi aggregates are monoclonal. Additionally, sympatric samples of the red and the green colour-morphs of A. krebsi from Pernambuco, Brazil were genetically compared and no significant differences were observed between them (gene identity= 0.992, indicating that they do not belong to different biological species. All individuals within aggregates of the green colour-morph were found to be identical over the five polymorphic loci analysed. Such results would be extremely unlikely (PEn el presente trabajo se utilizó análisis de aloenzimas para demostrar que los individuos en los agregados de la especie Anthopleura krebsi son monoclonales. Además, muestras simpátricas de las variedades roja y verde fueron comparadas genéticamente y ninguna diferencia significativa fue observada entre ellas (Identidad génica= 0.992, indicando que ellas no pertenecen a especies biológicamente distintas. Todos los individuos dentro de un agregado de la variedad roja resultaron ser idénticos para los cinco loci polimórficos analizados. Tal resultado sería extremadamente improbable (p<10 -11 si los individuos analizados hubiesen sido generados a través de reproducción sexual, confirmando así la presencia de reproducción asexual en esta especie.

  12. A note on the high elevation distribution record of Red Panda Ailurus fulgens (Mammalia: Carnivora: Ailuridae in Tawang District, Arunachal Pradesh, India

    Directory of Open Access Journals (Sweden)

    D. Dorjee


    Full Text Available The present record provides one of the highest documented presence information of red pandas in India, in remote parts of western Arunachal Pradesh. The record came in the form of carcass of a Red Panda which was accidentally caught in an animal snare in remote sub-alpine mountain slopes at 4325m above sea level inside a Community Conserved Area in Tawang District, discovered during a monitoring trip by the villagers. The record also showcases the rich biodiversity of the area and the local community’s efforts to safeguard it.

  13. Effect of polypeptides from sea anemone Heteractis crispa on the rodent blood pressure, heart rate, and hemostasis. (United States)

    Skobtsova, L A; Dyachenko, I A; Andreev, Ya A; Logashina, Yu A; Murashev, A N; Grishin, E V


    АРНС1-3 peptides, modulators of TRPV1 receptors, have been administered to SD rats to study their influence on the animal hemostatic system, heart rate, and blood pressure. None of АЗРС1-3 polypeptides have any effect on the hemostatic system. Both АРНС1 and АРНС2 polypeptides increased significantly the heart rate, but they did not affect blood pressure, which was probably caused by an ability of these polypeptides to modify animal thermoregulation.

  14. Excitability parameters and sensitivity to anemone toxin ATX-II in rat small diameter primary sensory neurones discriminated by Griffonia simplicifolia isolectin IB4. (United States)

    Snape, Alistair; Pittaway, James F; Baker, Mark D


    Sensory neurone subtypes (ATX-II might also discriminate neurones and report that 1 microm has negligible or small effects on action potentials in IB4 +ve, but dramatically increased action potential duration in IB4 ve, neurones. The toxin did not act on tetrodotoxin-resistant (TTX-r) Na(V)1.8 currents; discrimination was based on tetrodotoxin-sensitive (TTX-s) Na(+) channel expression. We also explored the effects of varying the holding potential on current threshold, and the effect of repetitive activation on action currents in IB4 +ve and ve neurones. IB4 +ve neurones became more excitable with depolarization over the range 100 to 20 mV, but IB4 ve neurones exhibited peak excitability near 55 mV, and were inexcitable at 20 mV. Eliciting action potentials at 2 Hz, we found that peak inward action current in IB4 +ve neurones was reduced, whereas changes in the current amplitude were negligible in most IB4 ve neurones. Our findings are consistent with relatively toxin-insensitive channels including Na(V)1.7 being expressed in IB4 +ve neurones, whereas toxin sensitivity indicates that IB4 ve neurones may express Na(V)1.1 or Na(V)1.2, or both. The retention of excitability at low membrane potentials, and the responses to repetitive stimulation are explained by the known preferential expression of Na(V)1.8 in IB4 +ve neurones, and the reduction in action current in IB4 +ve neurones with repetitive stimulation supports a novel hypothesis explaining the slowing of conduction velocity in C-fibres by the build-up of Na(+) channel inactivation.

  15. Sea-anemone toxin ATX-II elicits A-fiber-dependent pain and enhances resurgent and persistent sodium currents in large sensory neurons

    Directory of Open Access Journals (Sweden)

    Klinger Alexandra B


    Full Text Available Abstract Background Gain-of-function mutations of the nociceptive voltage-gated sodium channel Nav1.7 lead to inherited pain syndromes, such as paroxysmal extreme pain disorder (PEPD. One characteristic of these mutations is slowed fast-inactivation kinetics, which may give rise to resurgent sodium currents. It is long known that toxins from Anemonia sulcata, such as ATX-II, slow fast inactivation and skin contact for example during diving leads to various symptoms such as pain and itch. Here, we investigated if ATX-II induces resurgent currents in sensory neurons of the dorsal root ganglion (DRGs and how this may translate into human sensations. Results In large A-fiber related DRGs ATX-II (5 nM enhances persistent and resurgent sodium currents, but failed to do so in small C-fiber linked DRGs when investigated using the whole-cell patch-clamp technique. Resurgent currents are thought to depend on the presence of the sodium channel β4-subunit. Using RT-qPCR experiments, we show that small DRGs express significantly less β4 mRNA than large sensory neurons. With the β4-C-terminus peptide in the pipette solution, it was possible to evoke resurgent currents in small DRGs and in Nav1.7 or Nav1.6 expressing HEK293/N1E115 cells, which were enhanced by the presence of extracellular ATX-II. When injected into the skin of healthy volunteers, ATX-II induces painful and itch-like sensations which were abolished by mechanical nerve block. Increase in superficial blood flow of the skin, measured by Laser doppler imaging is limited to the injection site, so no axon reflex erythema as a correlate for C-fiber activation was detected. Conclusion ATX-II enhances persistent and resurgent sodium currents in large diameter DRGs, whereas small DRGs depend on the addition of β4-peptide to the pipette recording solution for ATX-II to affect resurgent currents. Mechanical A-fiber blockade abolishes all ATX-II effects in human skin (e.g. painful and itch-like paraesthesias, suggesting that it mediates its effects mainly via activation of A-fibers.

  16. Sea-anemone toxin ATX-II elicits A-fiber-dependent pain and enhances resurgent and persistent sodium currents in large sensory neurons. (United States)

    Klinger, Alexandra B; Eberhardt, Mirjam; Link, Andrea S; Namer, Barbara; Kutsche, Lisa K; Schuy, E Theresa; Sittl, Ruth; Hoffmann, Tali; Alzheimer, Christian; Huth, Tobias; Carr, Richard W; Lampert, Angelika


    Gain-of-function mutations of the nociceptive voltage-gated sodium channel Nav1.7 lead to inherited pain syndromes, such as paroxysmal extreme pain disorder (PEPD). One characteristic of these mutations is slowed fast-inactivation kinetics, which may give rise to resurgent sodium currents. It is long known that toxins from Anemonia sulcata, such as ATX-II, slow fast inactivation and skin contact for example during diving leads to various symptoms such as pain and itch. Here, we investigated if ATX-II induces resurgent currents in sensory neurons of the dorsal root ganglion (DRGs) and how this may translate into human sensations. In large A-fiber related DRGs ATX-II (5 nM) enhances persistent and resurgent sodium currents, but failed to do so in small C-fiber linked DRGs when investigated using the whole-cell patch-clamp technique. Resurgent currents are thought to depend on the presence of the sodium channel β4-subunit. Using RT-qPCR experiments, we show that small DRGs express significantly less β4 mRNA than large sensory neurons. With the β4-C-terminus peptide in the pipette solution, it was possible to evoke resurgent currents in small DRGs and in Nav1.7 or Nav1.6 expressing HEK293/N1E115 cells, which were enhanced by the presence of extracellular ATX-II. When injected into the skin of healthy volunteers, ATX-II induces painful and itch-like sensations which were abolished by mechanical nerve block. Increase in superficial blood flow of the skin, measured by Laser doppler imaging is limited to the injection site, so no axon reflex erythema as a correlate for C-fiber activation was detected. ATX-II enhances persistent and resurgent sodium currents in large diameter DRGs, whereas small DRGs depend on the addition of β4-peptide to the pipette recording solution for ATX-II to affect resurgent currents. Mechanical A-fiber blockade abolishes all ATX-II effects in human skin (e.g. painful and itch-like paraesthesias), suggesting that it mediates its effects mainly via activation of A-fibers.

  17. The effects of asexual reproduction and inter-genotypic aggression on the genotypic structure of populations of the sea anemone Actinia tenebrosa. (United States)

    Ayre, D J


    Genotype frequencies of adult and juvenile Actinia tenebrosa from 2 populations showed that settlement and recruitment predominantly involved the localised asexual (ameiotic) proliferation of established genotypes. However, there is strong indirect evidence that the genotypic variation was generated by sexual reproduction. Genotypic structuring of these populations was detected at 2 levels. First, coarse clumping of genotypically identical adults and juveniles occurred on a scale consistent with the pattern of asexual dispersal. Second, fine-scale clustering of genotypically identical adults and juveniles occurred on a scale consistent with predicted effects of inter-genotypic aggression. Inter-genotypic aggression seems certain to play an important role in inter-genotypic competition for recruitment space and should reduce the input of genotypic variation into established populations. The applicability of the Strawberry-Coral Model to the life history of this species is discussed.

  18. The Transcriptome of the Zoanthid Protopalythoa variabilis (Cnidaria, Anthozoa) Predicts a Basal Repertoire of Toxin-like and Venom-Auxiliary Polypeptides


    Huang, Chen; Morlighem, Jean-Étienne RL; Zhou, Hefeng; Lima, Érica P; Gomes, Paula B; Cai, Jing; Lou, Inchio; Pérez, Carlos D; Lee, Simon Ming; Rádis-Baptista, Gandhi


    Abstract Protopalythoa is a zoanthid that, together with thousands of predominantly marine species, such as hydra, jellyfish, and sea anemones, composes the oldest eumetazoan phylum, i.e., the Cnidaria. Some of these species, such as sea wasps and sea anemones, are highly venomous organisms that can produce deadly toxins for preying, for defense or for territorial disputes. Despite the fact that hundreds of organic and polypeptide toxins have been characterized from sea anemones and jellyfish...

  19. The proteomic profile of Stichodactyla duerdeni secretion reveals the presence of a novel O-linked glycopeptide

    DEFF Research Database (Denmark)

    Cassoli, Juliana Silva; Verano-Braga, Thiago; Oliveira, Joacir Stolarz


    UNLABELLED: Sea anemones represent one of the emerging groups of interest concerning venomous animals in toxinology and the goal of the present work was the prospection, and the structural and functional characterization of the compounds present in the secretion of the sea anemone Stichodactyla...... of analysis is perfectly suitable to other sea anemone secretions and animal venoms. Moreover, new peptide structures can arise contributing to the knowledge of the diversity of these animal peptides....

  20. Vth Pan American Symposium on Animal, Plant and Microbial Toxins

    National Research Council Canada - National Science Library

    Ownby, Charlotte


    ..., cardiotoxins, and antihemorrhagic factors. Presentations on plant and microbial toxins include work done on ricin, Clostridium perfringens enterotoxin, cone snail peptides, sea anemone toxins, proteinase inhibitors and maitotoxin...

  1. Invertebrate medicine

    National Research Council Canada - National Science Library

    Lewbart, G.A


    .... Coverage includes sponges, jellyfish, anemones, corals, mollusks, starfish, sea urchins, crabs, crayfish, lobsters, shrimp, hermit crabs, spiders, scorpions, and many more, with chapters organized by taxonomy...


    CERN Document Server


    CERN's anemones will soon be orphans. We are looking for someone willing to look after the aquarium in the main building, for one year. If you are interested, or if you would like more information, please call 73830. (The anemones living in the aquarium thank you in anticipation.)

  3. Chemical and biological characterization of a crude venom extract ...

    African Journals Online (AJOL)

    Background: Sea-anemones, in common with other members of the phylum cnidaria (coelenterate) possess numerous tentacles containing specialized stinging cells of cnidocysts. Our main objective is to elucidate the chemical character and biological properties of this Nigerian species of sea anemone Bunodosoma ...

  4. Vegetatieve vermeerdering van Nidularium in vloeibare media

    NARCIS (Netherlands)

    Pierik, R.L.M.; Steegmans, H.H.M.


    Het snel en veilig opbouwen van Nudilarium blijkt niet eenvoudig te zijn (dikwijls ontstaat callus waaruit adventieve scheuten ontstaan). Nidularium fulgens, die tot de Nudilariumceae behoort, kan nu in vitro gekloond worden zonder dat mutaties optreden, zodat deze soort op grote schaal veilig in de

  5. The morphology–diet relationship and its role in the coexistence of two species of annual fishes

    Czech Academy of Sciences Publication Activity Database

    Keppeler, F. W.; Lanés, L. E. K.; Rolon, A. S.; Stenert, C.; Lehmann, P.; Reichard, Martin; Maltchik, L.


    Roč. 24, č. 1 (2015), s. 77-90 ISSN 0906-6691 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Austrolebias minuano * Cynopoecilus fulgens * niche overlap * sexual dimorphism * ontogeny Subject RIV: EG - Zoology Impact factor: 2.052, year: 2015

  6. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The oxazole and indole based heterocyclic photochromic fulgides were synthesized from their corresponding fulgenic acid derivatives by clay catalysed microwave irradiation methodology. Improved yields of fulgides were observed by the microwave irradiation method as compared other chemical methods employed so far ...

  7. Microwave-assisted synthesis of photochromic fulgides

    Indian Academy of Sciences (India)

    The oxazole and indole based heterocyclic photochromic fulgides were synthesized from their corresponding fulgenic acid derivatives by clay catalysed microwave irradiation methodology. Improved yields of fulgides were observed by the microwave irradiation method as compared other chemical methods employed so far ...

  8. Lights and shades on an historical vaccine canine distemper virus, the Rockborn strain

    DEFF Research Database (Denmark)

    Martella, V.; Blixenkrone-Møller, Merete; Elia, G.


    to differ from the commonly used vaccine strain, Onderstepoort (93.0% nt and 91.7% aa), and to resemble more closely (99.6% nt and 99.3% aa) a CDV strain detected in China from a Lesser Panda (Ailurus fulgens). An additional four CDV strains matching (>99% nt identity) the Rockborn virus were identified...

  9. Review of the odd chrysidid genus Loboscelidia Westwood, 1874 (Hymenoptera, Chrysididae, Loboscelidiinae

    Directory of Open Access Journals (Sweden)

    Lynn Kimsey


    Full Text Available The chrysidid genus Loboscelidia is reviewed and 11 new species are described, including L. cinnamonea (Borneo, L. fulgens (Viet Nam, L. fulva (Thailand, L. incompleta (India, L. kafae (Borneo, L. laminata (Viet Nam, L. meifungae (Borneo, L. nasiformis (Thailand, L. nitidula (Thailand, L. pecki (Viet Nam, and L. sisik (Borneo. A key to males of the species of Loboscelidia is given.

  10. Marine protected area restricts demographic connectivity: Dissimilarity in a marine environment can function as a biological barrier. (United States)

    Sato, Masaaki; Honda, Kentaro; Uy, Wilfredo H; Baslot, Darwin I; Genovia, Tom G; Nakamura, Yohei; Bernardo, Lawrence Patrick C; Kurokochi, Hiroyuki; Pantallano, Allyn Duvin S; Lian, Chunlan; Nadaoka, Kazuo; Nakaoka, Masahiro


    The establishment of marine protected areas (MPAs) can often lead to environmental differences between MPAs and fishing zones. To determine the effects on marine dispersal of environmental dissimilarity between an MPA and fishing zone, we examined the abundance and recruitment patterns of two anemonefishes ( Amphiprion frenatus and A. perideraion ) that inhabit sea anemones in different management zones (i.e., an MPA and two fishing zones) by performing a field survey and a genetic parentage analysis. We found lower levels of abundance per anemone in the MPA compared to the fishing zones for both species ( n  = 1,525 anemones, p  = .032). The parentage analysis also showed that lower numbers of fishes were recruited from the fishing zones and outside of the study area into each anemone in the MPA than into each anemone in the fishing zones ( n  = 1,525 anemones, p  fishing zones ( n  = 384 females, p  = .516). Because the ocean currents around the study site were unlikely to cause a lower settlement intensity of larvae in the MPA, the ocean circulation was not considered crucial to the observed abundance and recruitment patterns. Instead, stronger top-down control and/or a lower density of host anemones in the MPA were potential factors for such patterns. Our results highlight the importance of dissimilarity in a marine environment as a factor that affects connectivity.

  11. (Carlgren, 1938) nov. comb. (Cnidaria: Actiniaria)

    African Journals Online (AJOL)

    - ... In-situ observations and photographs of an unusual and spectacular red and white striped, mobile anemone, which appears to feed on gorgonians ..... mental conditions at the times of collection, or detailing the composition of the benthic ...

  12. Marine organisms and their adaption - Adaptions solve the challenges of existence in the sea.

    Digital Repository Service at National Institute of Oceanography (India)

    Gonsalves, M.J.B.D.; Das, A.; LokaBharathi, P.A.

    great diversity of organisms. To survive, these organisms need to secure food, successfully reproduce and avoid predation. Simple animals, such as anemones or worms, absorb the gases through their skin. Mobile animals use gills, or even lungs to absorb...

  13. African Journal of Biotechnology - Vol 12, No 50 (2013)

    African Journals Online (AJOL)

    Aphid resistance in florist's chrysanthemum (Chrysanthemum morifolium Ramat.) induced by sea anemone equistatin overexpression. Mahmood Valizadeh, Celine Deraison, Seyed Kamal Kazemitabar, Yvan Rahbé, Maarten A Jongsma ...

  14. Compilation of 1986 Annual Reports of the Navy ELF (Extremely Low Frequency) Communications System Ecological Monitoring Program. Volume 3. TABS H-J. (United States)


    chronicles the data collection and analysis activities for a monitoring project during 1986. As in the past, each report has been reviewed by four or...sediments thoroughly and re- taining the suspended animals in a 60 tm mesh soil sieve. Animals were preserved in 80% ethyl alcohol . The sediments were...Gaultheria procuinbens Hepatica Labrador Tea Hepat ia americana Ledum groenland icum Anemone Bog Laurel Anemone sp Kahnmia polifolia Blue Cohosh Bog

  15. Species Profiles. Life Histories and Environmental Requirements of Coastal Fishes and Invertebrates (Pacific Southwest). BLACK, GREEN, and RED ABALONES. (United States)


    abalone landings abalones grow fast. Under optimal and ex-vissel value in California, conditions in a laboratory culture , 1965-1982 some juvenile red...Lithothamnion sp. Hymenena sp. Plocamium coccineum Tr i daea sp. Rhodymenia sp. Lithothamnion sp. Porphyra sp. Prionitis sp. Rhodymenia sp...Fecundacion artifi- Abalones, shells, and sea otters: cal y dessarrollo embrionario de dynamics of prey populations in Haliotis fulgens Philippi, 1845

  16. Food habits and conservation threats of the red panda in Rara National Park, Nepal


    Sharma, Hari Prasad


    This thesis deals with issues of conservation threats to the red panda (Ailurus fulgens), specifically regarding foraging resources and anthropogenic activities i.e. livestock grazing. I studied the diet components of red panda during the pre-monsoon and post-monsoon seasons of this herbivorous carnivore. I evaluated the diet of red panda through micro-histological study of fecal matters to determine the composition of diets. The results indicated that the red panda feeds primarily on bam...

  17. Typification of taxa of subfamily Silenoideae (Caryophyllaceae Juss.) from Siberia and Russian Far East based on materials kept in the Herbarium of the Komarov Botanical Institute (LE)


    G. A. Lazkov


    Data on type material of previously not typified taxa of the subfamily Silenoideae (Caryophyllaceae Juss.), kept in the Herbarium of the Komarov Botanical Institute (LE) are summarized in the paper. All relevant taxa including eight species (or subsequently accepted as species: Gastrolychnis violascens Tolm., Gypsophila stricta Bunge, Heterochroa petraea Bunge, Lychnis ajanensis var. villosula Trautv. [L. villosula (Trautv.) Gorschk.], L. fulgens var. wilfordi Regel [L. wilfordi (Regel) Maxim...

  18. Morphological and functional study of the marginal sphincter of the sea anemones Phymactis clematis and Aulactinia marplatensis from intertidal of Mar del Plata, Argentina Estudio morfológico y funcional del esfínter marginal de las anémonas de mar Phymactis clematis y Aulactinia marplatensis del intermareal de Mar del Plata, Argentina

    Directory of Open Access Journals (Sweden)

    Elvira A. González Oliveira


    Full Text Available It was made the characterization of marginal sphincter to the species Phymactis clematis (Drayton in Dana, 1849 and Aulactinia marplatensis (Zamponi, 1977, from intertidal ecosystem through their morphogical and functional study. The species P. clematis has a circumscript sphincter of palmate type. This muscle is constituted by a mesogloeal axis and several mesogloeal subaxes. Axis as well as subaxes give a support to the endoderm which border is smooth. Aulactinia marplatensis has a circunscript sphincter pinnate type. The axis has a truncated cone shape while in P. clematis the shape is cylindrical on its origin and it is bifurcated at the end. Both species experiments were carried out using the isolated muscles. They were stimulated at increasing KCl concentrations ranging from 20 to 200 mM. The results were analysed in the form of dose-response curves expressed in tension in grams force vs concentration. Contractil force increases in a sigmoid form to increasing KCl concentrations. The correlation between morphology and function and the differences shown in both species would be related to their intertidal distribution.Se realizó la caracterización de las anémonas de mar Phymactis clematis (Drayton in Dana, 1849 y Aulactinia marplatensis (Zamponi, 1977 del ecosistema intermareal mediante estudio morfológico y funcional. La especie P. clematis tiene un esfínter circunscripto de tipo palmado. Este músculo está constituido por un eje mesogloeal y varios subejes mesogloeales. Tanto el eje como los subejes dan soporte al endodermo cuyo borde es liso. La especie A. marplatensis tiene un esfínter circunscripto de tipo pinnado. El eje tiene forma de cono truncado mientras que en P. clematis es cilíndrico en su origen bifurcándose en su parte final. Los experimentos fueron llevados a cabo usando el músculo aislado de ambas especies. Estos fueron estimulados a concentraciones crecientes de KCl en un rango de 20 a 200 mM. Los resultados fueron analizados mediante curvas dosis-respuesta expresados en tensión en gramos fuerza vs concentración. La fuerza contráctil se incrementó en forma sigmoidea. La correlación entre la morfología y función y las diferencias mostradas en ambas especies podrían estar relacionadas con su distribución en el intertidal.

  19. Ontogenetic variations and feeding habits of a Neotropical annual fish from southern Brazil

    Directory of Open Access Journals (Sweden)

    Tatiana S. Dias

    Full Text Available ABSTRACT Knowing the feeding biology of a population and its ontogenetic aspects can help in understanding the functioning of fish assemblages, essential to the conservation of the habitat biodiversity in which these species are found. Annual fishes complete their life cycle in temporary aquatic environments, existing in adult stage only for brief annual periods. Changes in the feeding habits between different size classes could indicate that a species belongs to different feeding groups in different growth phases. The aim of this work was to characterize the diet of Cynopoecilus fulgens Costa, 2002 in a temporary flooded area in the coastal plain of southern Brazil, taking into consideration possible alterations in feeding habits in different body size classes caused by ontogenetic changes, to explain the coexistence of these individuals in a short space of time. The diet analysis indicated that C. fulgens is a generalist, consuming small crustaceans and autochthonous insects. Intraspecific differences in diet were determined when compared between nine classes of standard length. Adults fed mainly on autochthonous insects, and juveniles ingested mostly crustaceans, with the population being separated into two trophic groups: invertivores and invertivores with a tendency towards zooplanktivory. It is possible to conclude that the ontogenetic changes in the diet of C. fulgens are related to morphological restrictions due to the size of the individuals, since feeding competitive relations are probably not so evident.

  20. Lichen-moss interactions within biological soil crusts (United States)

    Ruckteschler, Nina; Williams, Laura; Büdel, Burkhard; Weber, Bettina


    Biological soil crusts (biocrusts) create well-known hotspots of microbial activity, being important components of hot and cold arid terrestrial regions. They colonize the uppermost millimeters of the soil, being composed of fungi, (cyano-) bacteria, algae, lichens, bryophytes and archaea in varying proportions. Biocrusts protect the (semi-) arid landscape from wind and water erosion, and also increase water holding capacity and nutrient content. Depending on location and developmental stage, composition and species abundance vary within biocrusts. As species live in close contact, they are expected to influence each other, but only a few interactions between different organisms have so far been explored. In the present study, we investigated the effects of the lichen Fulgensia fulgens whilst growing on the moss Trichostomum crispulum. While 77% of Fulgensia fulgens thalli were found growing associated with mosses in a German biocrust, up to 95% of Fulgensia bracteata thalli were moss-associated in a Swedish biocrust. In 49% (Germany) and in 78% (Sweden) of cases, thalli were observed on the moss T. crispulum and less frequently on four and three different moss species. Beneath F. fulgens and F. bracteata thalli, the mosses were dead and in close vicinity to the lichens the mosses appeared frail, bringing us to the assumption that the lichens may release substances harming the moss. We prepared a water extract from the lichen F. fulgens and used this to water the moss thalli (n = 6) on a daily basis over a time-span of three weeks. In a control setup, artificial rainwater was applied to the moss thalli (n = 6). Once a week, maximum CO2 gas exchange rates of the thalli were measured under constant conditions and at the end of the experiment the chlorophyll content of the moss samples was determined. In the course of the experiment net photosynthesis (NP) of the treatment samples decreased concurrently with an increase in dark respiration (DR). The control samples

  1. Cohabitation promotes high diversity of clownfishes in the Coral Triangle. (United States)

    Camp, Emma F; Hobbs, Jean-Paul A; De Brauwer, Maarten; Dumbrell, Alex J; Smith, David J


    Global marine biodiversity peaks within the Coral Triangle, and understanding how such high diversity is maintained is a central question in marine ecology. We investigated broad-scale patterns in the diversity of clownfishes and their host sea anemones by conducting 981 belt-transects at 20 locations throughout the Indo-Pacific. Of the 1508 clownfishes encountered, 377 fish occurred in interspecific cohabiting groups and cohabitation was almost entirely restricted to the Coral Triangle. Neither the diversity nor density of host anemone or clownfish species alone influenced rates of interspecific cohabitation. Rather cohabitation occurred in areas where the number of clownfish species exceeds the number of host anemone species. In the Coral Triangle, cohabiting individuals were observed to finely partition their host anemone, with the subordinate species inhabiting the periphery. Furthermore, aggression did not increase in interspecific cohabiting groups, instead dominant species were accepting of subordinate species. Various combinations of clownfish species were observed cohabiting (independent of body size, phylogenetic relatedness, evolutionary age, dentition, level of specialization) in a range of anemone species, thereby ensuring that each clownfish species had dominant reproductive individuals in some cohabiting groups. Clownfishes are obligate commensals, thus cohabitation is an important process in maintaining biodiversity in high diversity systems because it supports the persistence of many species when host availability is limiting. Cohabitation is a likely explanation for high species richness in other obligate commensals within the Coral Triangle, and highlights the importance of protecting these habitats in order to conserve unique marine biodiversity. © 2016 The Author(s).

  2. Crustaceans associated with Cnidaria, Bivalvia, Echinoidea and Pisces at São Tomé and Príncipe islands.

    Directory of Open Access Journals (Sweden)

    Wirtz, P.


    Full Text Available Symbiotic crustaceans were searched for at sea anemones (Actiniaria, encrusting anemones (Zoantharia, horny coral (Gorgonaria, black coral (Antipatharia, bivalves (Bivalvia, and sea urchins (Echinoidea at São Tomé and Príncipe Islands (Gulf of Guinea, eastern central Atlantic. Sixteen species of crustaceans were found in association with these invertebrate hosts; eleven of them were new records for the area and two species, belonging to the genera Hippolyte and Heteromysis, were new for science. The thalassinid Axiopsis serratifrons was occasionally associated with an undescribed species of gobiid fish.

  3. Mites of the genus Neharpyrhynchus Fain (Acariformes, Harpirhynchidae from Neotropical birds

    Directory of Open Access Journals (Sweden)

    Andre Bochkov


    Full Text Available Three new species of parasitic mites of the genus Neharpyrhynchus Fain (Acariformes, Harpirhynchidae are described from Neotropical birds, N. chlorospingus sp. n. from Chlorospingus pileatus (Passeriformes, Emberizidae from Costa Rica, N. mironovi sp. n. from Dacnys cayana (Passeriformes, Thraupidae and N. tangara sp. n. from Tangara cayana (Thraupidae both from Brazil. Neharpyrhynchus trochilinus (Fain is recorded from 3 new hosts of the family Trochilidae (Apodiformes, Panterpe insignis and Eugenes fulgens from Costa Rica, and Amazilia lactea from Brazil. Emended diagnosis of the genus and a key to species are provided; all records of Neharpyrhynchus species are summarized.

  4. Pharmacological effects of two cytolysins isolated from the sea ...

    Indian Academy of Sciences (India)

    Sticholysins I and II (St I/II) are cytolysins purified from the sea anemone Stichodactyla helianthus. In this study, we show their pharmacological action on guinea-pig and snail models in native and pH-denatured conditions in order to correlate the pharmacological findings with the pore-forming activity of both isoforms.

  5. Toelating Herbasan SC welkom voor dahlia, A. coronaria en narcis

    NARCIS (Netherlands)

    Leeuwen, van P.J.; Koster, A.T.J.; Trompert, J.P.T.


    Onlangs is Herbasan SC voor de onkruidbestrijding in onder meer dahlia, narcis en Anemone coronaria toegelaten. PPO ging na hoe het middel het beste is in te zetten. In dit artikel zijn de resultaten van het onderzoek vermeld en een advies voor toepassing

  6. To Build an Ecosystem: An Introductory Lab for Environmental Science & Biology Students (United States)

    Hudon, Daniel; Finnerty, John R.


    A hypothesis-driven laboratory is described that introduces students to the complexities of ecosystem function. Students work with live algae, brine shrimp, and sea anemones to test hypotheses regarding the trophic interactions among species, the exchange of nutrients and gases, and the optimal ratio of producers to consumers and predators in…

  7. Heliacus (Gastropoda: Architectonicidae) symbiotic with Zoanthiniaria (Coelenterata). (United States)

    Robertson, R


    Eight species of Heliacus are obligate symbionts with Zoanthus and Palythoa, colonial zoanthid sea anemones. The gastropods live among Zoanthus polyps and under the edges of Palythoa incrustations, on which they feed and to which they and their egg masses are attached with sturdy but elastic mucous threads.

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 25 of 1853 ... (Cnidaria: Actiniaria) a mobile sea anemone attacking octocorals, Abstract PDF. Karin Riemann-Zürneck, Charles L. Griffiths. Vol 35, No 2 (2000), Kroyeria deetsi n.sp. (Kroyeriidae: Siphonostomatoida), a parasitic copepod infecting gills of spinner sharks, Carcharhinus brevipinna (Müller & Henle, 1839), ...

  9. African Zoology - Vol 34, No 4 (1999)

    African Journals Online (AJOL)

    Korsaranthus natalensis (Carlgren, 1938) nov. comb. (Cnidaria: Actiniaria) a mobile sea anemone attacking octocorals · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Karin Riemann-Zürneck, Charles L. Griffiths, 190-196 ...

  10. Three methods for isolating viable anthozoan endoderm cells with their intracellular symbiotic dinoflagellates (United States)

    Gates, R. D.; Muscatine, L.


    Three maceration methods are described for the isolation of single endoderm cells from marine cnidarians. Two are enzymatic treatments suitable for fleshy anthozoans such as sea anemones and zoanthids. The third employs calcium free sea water and is suitable for stony corals. The viability and morphology of the endoderm cells is described using fluorogenic dyes and scanning and transmission electron microscopy.

  11. Zoanthids of the Cape Verde Islands and their symbionts: previously unexamined diversity in the Northeastern Atlantic

    NARCIS (Netherlands)

    Reimer, J.D.; Hirose, M.; Wirtz, P.


    The marine invertebrate fauna of the Cape Verde Islands contains many endemic species due to their isolated location in the eastern Atlantic, yet research has not been conducted on most taxa here. One such group are the zoanthids or mat anemones, an order of benthic cnidarians (Hexacorallia:

  12. Fulltext PDF

    Indian Academy of Sciences (India)

    electrostatic interactions as well as lipid composition. J. Biosci. 36 781–791] DOI 10.1007/s12038-011-9156-4. 1. Introduction. The pore-forming proteins sticholysin I and sticholysin. II (St I/II) produced by the sea anemone Stichodactyla helianthus (Lanio et al. 2001) are highly hemolytic toxins with 93% sequence identity.

  13. In memoriam Jacobus Cornelis (Koos) den Hartog (1942-2000), marine naturalist

    NARCIS (Netherlands)

    Land, van der J.


    Jacobus Cornelis den Hartog was born on 17 April 1942 in Broek op Langedijk. He read biology at Leiden University from 1963 to 1970. He worked at the Caribbean Marine Biological Station on Curaçao from 1971 to 1973, where he studied Caribbean sea anemones. From 1973 he worked in the National Museum

  14. Pharmacological effects of two cytolysins isolated from the sea ...

    Indian Academy of Sciences (India)



    Dec 7, 2009 ... experimental (Cuba: Ciencia y Técnica); Chapter 2, pp 97–99. Tejuca M, Serra S M, Ferreras M, Lanio M E and Menestrina G. 1996 Mechanism of membrane permeabilization by sticholysin, a cytolysin isolated from the sea anemone Stichodactyla helianthus; Biochemistry 35 14947–14957. MS received 10 ...

  15. Untitled

    African Journals Online (AJOL)

    protein/kg mice i.p (Eno et al. 1998). [n the same study, it was! found that the extract produced spontaneous contractions of the guineapig ileum, and that it blocked the contractile effect of histamine. The blocking actions of the extract of another sea anemone, Tealia felina on histamine ~ induced contractions of the guinea pig ...

  16. Study of UO2 radioinduced densification

    International Nuclear Information System (INIS)

    Stora, J.P.; Bruet, M.


    Measurements of radioinduced densification were performed on UO 2 DCN (intergranular fine porosity) and UO 2 DCI (interaggregate coarse porosity) in the Anemone device. The densification kinetics was followed by measuring the shrinkage of the oxide column on neutron radiographic plates. UO 2 DCI was found stable in regard to densification. At power near 450Wcm -1 , densification is hitten by restructuring phenomena [fr

  17. Pharmacological effects of two cytolysins isolated from the sea ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 34; Issue 6. Pharmacological effects of two cytolysins isolated from the sea anemone Stichodactyla helianthus. T García D Martinez A Palmero C Soto M Tejuca F Pazos R Menéndez C Alvarez A Garateix. Articles Volume 34 Issue 6 December 2009 pp 891-898 ...

  18. Author Details

    African Journals Online (AJOL)

    Acuña, Fabian H. Vol 39, No 2 (2004) - Articles Species richness, endemicity and distribution patterns of South African sea anemones (Cnidaria: Actiniaria & Corallimorpharia) Abstract. ISSN: 2224-073X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about ...

  19. Venom Evolution

    Indian Academy of Sciences (India)

    IAS Admin

    The term venom is used for a variety of toxins that are injected by certain animals into a victim through a specialized apparatus. Though venom is most commonly employed as a means of defense and predation, it is also used as a means of asserting dominance over conspecifics. Venomous animals include sea anemones ...

  20. Contribution to the knowledge of the nervous system in the tentacles of some coelenterates (Anemonia sulcata, Metridium senile, Cerianthus membranaceus, Tealia felina and Hydra vulgaris)

    NARCIS (Netherlands)

    Marle, van J.


    The nervous system in the tentacles of the sea anemones Tealia felina, Anemonia sulcata, Metridium senile and Cerianthus membranaceus was studied using light microscopic and electron microscopic techniques. Because of the small dimensions of the nerve cells (6—7 µm) and of the neurites (diameter

  1. The occurrence of Sagartia elegans (Dalyell, 1848) (Anthozoa: Actiniaria) in the Netherlands

    NARCIS (Netherlands)

    Ates, R.M.L.; Dekker, R.; Faasse, M.A.; Hartog, den J.C.


    The occurrence of the sea anemone Sagartia elegans var. miniata, var. nivea and var. venusta in considerable numbers at three localities in the Netherlands is reported upon. Previous records of the species in Dutch coastal waters are reviewed. Most of these are considered as doubtful. Characters to

  2. Onubactis rocioi gen. et spec. nov., a new species of Actiniidae (Anthozoa: Actiniaria) from the southern Iberian Peninsula

    NARCIS (Netherlands)

    López-González, P.J.; Hartog, den J.C.; García-Gómez, J.C.


    A new genus and species of sea anemone, Onubactis rocioi gen. et spec. nov. (Actiniidae) is described from the Atlantic coast of the southern Iberian Peninsula. The main features of Onubactis rocioi are: a smooth to corrugate scapus, a delicate scapulus provided with a ruff of non-adherent papillate

  3. Actiniaria from Ria de Arosa, Galicia, northwestern Spain, in the Netherlands Centre for Biodiversity Naturalis, Leiden

    NARCIS (Netherlands)

    Hartog, den J.C.; Ates, R.M.L.


    Twentysix species of sea anemones (Actiniaria) collected in Galicia, northwestern Spain are present in the collection of the Netherlands Centre for Biodiversity Naturalis. They are listed and discussed. The cnidom of seventeen species is surveyed. Diadumene cincta is not a recent immigrant in

  4. A case of associated occurrence of the crab Lauridromia inter-media (Laurie, 1906) (Crustacea: Decapoda: Dromiidae) and the actinian Nemanthus annamensis Carlgren, 1943 (Anthozoa: Actiniaria: Nemanthidae)

    NARCIS (Netherlands)

    Lavaleye, M.S.S.; Hartog, den J.C.


    Members of the crab family Dromiidae tend to cover their carapace mostly with sponges or colonial tunicates. More rarely are used other objects or organisms such as solitary Tunicata, Zoantharia (= encrusting anemones), valves of Bivalvia, etc.; a review of these is presented. A new association of a

  5. Gastrin/CCK-like immunoreactivity in the nervous system of coelenterates

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Sundler, F; Rehfeld, J F


    Using immunocytochemistry, gastrin/CCK-like immunoreactivity is found in sensory nerve cells in the ectoderm of the mouth region of hydra and in nerve cells in the endoderm of all body regions of the sea anemone tealia. These results are corroborated by radioimmunoassay: One hydra contains at lea...

  6. Aechmea Ruiz & Pav. (Bromeliaceae do Estado de Pernambuco, Brasil Aechmea Ruiz & Pav. (Bromeliaceae from Pernambuco State, Brazil

    Directory of Open Access Journals (Sweden)

    Gardene Maria de Sousa


    Full Text Available Foram registradas dez espécies do gênero Aechmea no Estado de Pernambuco: A. aquilega (Salisb. Griseb., A. eurycorymbus Harms, A. fulgensBrongn., A. lingulata (L. Baker, A. mertensü(G. Mey. Schult. f., A. mulfordii L. B. Sm., A. murícata(Arruda L. B. Sm., A. stelligera L. B. Sm., A. tomentosa M&z e A. werdermannii Harms. Duas espécies são endêmicas (A. murícata e A. werdermannii e uma nova ocorrência (A. stelligerd foi referida para Pernambuco. São apresentados chave, descrições, ilustrações e comentários das espécies estudadas.A taxonomic study of the genus Aechmea ofPernambuco, Brazil was done. Ten species were found: A. aquilega (Salisb. Griseb., A. euryccrymhusHarms, A.fulgensBrongn., A. lingulataXL. Baker, A. mertensii(G. Mey. Schult. f., A. mulfordiih. B. Sm., A. murícata (Arruda L. B. Sm., A. stelligera L. B. Sm., A. tomentosa Mez and A werdermannii Harms. Aechmea murícata and A. werdermannii are endemic, and A. stelligera is a new records for Pernambuco State. Key, descriptions, comments and illustrations of the species are included.

  7. Phytoecdysteroids of the East Asian Caryophyllaceae (United States)

    Novozhilova, Elena; Rybin, Viacheslav; Gorovoy, Petr; Gavrilenko, Irina; Doudkin, Roman


    Background: Occurrence of integristerone A (1), 20-hydroxyecdysone (2), ecdysone (3), 2-deoxy-20-hydroxyecdysone (4) has been analyzed in 64 species of the East Asian Caryophyllaceae. Materials and Methods: Ecdysteroid content was determinate by high-performance liquid chromatography (HPLC). HPLC with a high-resolution mass spectrometry was performed on Shimadzu LCMS-IT-TOF (Japan) system equipped with a LC-20A Prominence liquid chromatograph, a photodiode array detector SPD-M20A and ion-trap/time-of-flight mass spectrometer. Results: New sources of phytoecdysteroids: Melandriumsachalinense and Melandrium firmum have been revealed. It is the 1st time that two has been identified in M. sachalinense and M. firmum; 1 in the species: Lychnis fulgens, Silene repens, Silene foliosa, Silene stenophylla, Silene jenisseensis and M. sachalinense; 3 in Lychnis cognata; 4 in L. fulgens, S. stenophylla and S. jenisseensis (the tribe Lychnideae, the subfamily Caryophylloideae). Ecdysteroid-negative taxa are Spergularia rubra of the tribe Sperguleae; species of the genera Minuartia, Honckenya, Eremogone, Arenaria, Moehringia, Pseudostellaria, Fimbripetalum, Stellaria and Cerastium of the tribe Alsineae; Scleranthus annuus of the tribe Sclerantheae, as well as the East Asian representatives of the genera Gypsophila, Psammophiliela, Dianthus and Saponaria of the tribe Diantheae; Oberna and Agrostemma of the tribe Lychnideae. Conclusion: This investigation shows the most promising sources of ecdysteriods are species of genera Silene and Lychnis. PMID:26109770

  8. Worldwide exploration of the microbiome harbored by the cnidarian model, Exaiptasia pallida (Agassiz in Verrill, 1864) indicates a lack of bacterial association specificity at a lower taxonomic rank (United States)

    Brown, Tanya; Otero, Christopher; Grajales, Alejandro; Rodriguez, Estefania


    Examination of host-microbe interactions in early diverging metazoans, such as cnidarians, is of great interest from an evolutionary perspective to understand how host-microbial consortia have evolved. To address this problem, we analyzed whether the bacterial community associated with the cosmopolitan and model sea anemone Exaiptasia pallida shows specific patterns across worldwide populations ranging from the Caribbean Sea, and the Atlantic and Pacific oceans. By comparing sequences of the V1–V3 hypervariable regions of the bacterial 16S rRNA gene, we revealed that anemones host a complex and diverse microbial community. When examined at the phylum level, bacterial diversity and abundance associated with E. pallida are broadly conserved across geographic space with samples, containing largely Proteobacteria and Bacteroides. However, the species-level makeup within these phyla differs drastically across space suggesting a high-level core microbiome with local adaptation of the constituents. Indeed, no bacterial OTU was ubiquitously found in all anemones samples. We also revealed changes in the microbial community structure after rearing anemone specimens in captivity within a period of four months. Furthermore, the variation in bacterial community assemblages across geographical locations did not correlate with the composition of microalgal Symbiodinium symbionts. Our findings contrast with the postulation that cnidarian hosts might actively select and maintain species-specific microbial communities that could have resulted from an intimate co-evolution process. The fact that E. pallida is likely an introduced species in most sampled localities suggests that this microbial turnover is a relatively rapid process. Our findings suggest that environmental settings, not host specificity, seem to dictate bacterial community structure associated with this sea anemone. More than maintaining a specific composition of bacterial species some cnidarians associate with a

  9. Towards a revision of the genus Periclimenes: resurrection of Ancylocaris Schenkel, 1902, and designation of three new genera (Crustacea, Decapoda, Palaemonidae

    Directory of Open Access Journals (Sweden)

    Zdeněk Ďuriš


    Full Text Available Based on recently published molecular phylogenies of Indo-West Pacific palaemonid shrimps and further morphological evidence, the systematic position of several species of the polyphyletic genus Periclimenes is revised. The generic name Ancylocaris Schenkel, 1902 is re-established for the anemone-associated P. brevicarpalis. Actinimenes gen. n., is proposed for the anemone-associated P. inornatus, P. ornatellus and P. ornatus, all of which have a subspatulate first pereiopod. Cristimenes gen. n., is designated for the echinoderm-associated species, P. commensalis, P. cristimanus, and P. zanzibaricus, all with a unique carpo-propodal articulation of the second pereiopods. Rapimenes gen. n. is established for the hydroid and antipatharian-associated P. brucei, P. granulimanus, and P. laevimanus, for which the long, slender and unequal second pereiopods and prehensile ambulatory propodi are the main synapomorphic characters.

  10. Cnidarian Neurotoxic Peptides Affecting Central Nervous System Targets. (United States)

    Lazcano-Pérez, Fernando; Hernández-Guzmán, Ulises; Sánchez-Rodríguez, Judith; Arreguín-Espinosa, Roberto


    Natural products from animal venoms have been used widely in the discovery of novel molecules with particular biological activities that enable their use as potential drug candidates. The phylum Cnidaria (jellyfish, sea anemones, corals zoanthids, hydrozoans, etc.) is the most ancient venomous phylum on earth. Its venoms are composed of a complex mixture of peptidic compounds with neurotoxic and cytolitic properties that have shown activity on mammalian systems despite the fact that they are naturally targeted against fish and invertebrate preys, mainly crustaceans. For this reason, cnidarian venoms are an interesting and vast source of molecules with a remarkable activity on central nervous system, targeting mainly voltage-gated ion channels, ASIC channels, and TRPV1 receptors. In this brief review, we list the amino acid sequences of most cnidarian neurotoxic peptides reported to date. Additionally, we propose the inclusion of a new type of voltage-gated sea anemone sodium channel toxins based on the most recent reports.

  11. Morphological and molecular characteristics of foliar nematode attacking silver birch (Betula pendula Roth in Poland

    Directory of Open Access Journals (Sweden)

    Chałańska A.


    Full Text Available Aphelenchoides fragariae (Ritzema Bos, 1890 Christie, 1932 was isolated from leaves of silver birch (Betula pendula Roth seedlings proving that the source of infection was anemones plants. This is the first report to our best knowledge showing that the source of nematode infection of a woody plant could be a perennial plant. A. fragariae was identified by morphometric and molecular analyses. Morphological diagnosis based on the bending shape of the tail of males and pronounced apex and rostrum proved to be the most accurate reliable characteristic. On the opposite, the high variability of the mucron shape in female tails made the identification by microscopic analyses difficult. Identification of the species was confirmed by analysis of 28S rDNA sequences. The morphometric data of adults extracted from silver birch was compared with that of nematodes isolated from Anemone hupehensis (Lemoine Lemoine. Males body length varied highly in samples collected from both host plant species.

  12. Towards a revision of the genus Periclimenes: resurrection of Ancylocaris Schenkel, 1902, and designation of three new genera (Crustacea, Decapoda, Palaemonidae) (United States)

    Ďuriš, Zdeněk; Horká, Ivona


    Abstract Based on recently published molecular phylogenies of Indo-West Pacific palaemonid shrimps and further morphological evidence, the systematic position of several species of the polyphyletic genus Periclimenes is revised. The generic name Ancylocaris Schenkel, 1902 is re-established for the anemone-associated Periclimenes brevicarpalis. Actinimenes gen. n., is proposed for the anemone-associated Periclimenes inornatus, Periclimenes ornatellus and Periclimenes ornatus, all of which have a subspatulate first pereiopod. Cristimenes gen. n., is designated for the echinoderm-associated species, Periclimenes commensalis, Periclimenes cristimanus, and Periclimenes zanzibaricus, all with a unique carpo-propodal articulation of the second pereiopods. Rapimenes gen. n. is established for the hydroid and antipatharian-associated Periclimenes brucei, Periclimenes granulimanus, and Periclimenes laevimanus, for which the long, slender and unequal second pereiopods and prehensile ambulatory propodi are the main synapomorphic characters. PMID:28228674

  13. Additional Remarks on Ranunculaceae in Taiwan (8 -Revision of Ranunculaceae in Taiwan

    Directory of Open Access Journals (Sweden)

    T.Y. Aleck Yang


    Full Text Available This is a taxonomic study of the genera of Ranunculaceae in Taiwan, including Aconitum L., Anemone L., Calathodes L., Cimicifuga Hook.f. & Thomson, Coptis L., Dichocarpum L., Ranunculus L., Semiaquilegea Makino, Thalictrum L. and Trollius L. Anemone vitifolia Buch.-Ham. ex DC. var. matsudae Yamam. is recognized in Taiwan; the concept of the genus Cimicifuga is still accepted, excluding genus Actaea. A key to the genera, keys to the taxa under each genus and synonyms of each taxon are provided. The taxonomic descriptions of taxa are only for those published after 1996. For easy understanding and checking of Taiwanese Ranunculaceae, phenology, distribution and specimens examined in each taxon are also presented. Totally, there are 11 genera and 51 taxa (including 41 species, 2 subspecies and 8 varieties of family Ranunculaceae in Taiwan.

  14. Zoanthids of the Cape Verde Islands and their symbionts: previously unexamined diversity in the Northeastern Atlantic


    Reimer, J.D.; Hirose, M.; Wirtz, P.


    The marine invertebrate fauna of the Cape Verde Islands contains many endemic species due to their isolated location in the eastern Atlantic, yet research has not been conducted on most taxa here. One such group are the zoanthids or mat anemones, an order of benthic cnidarians (Hexacorallia: Zoantharia) common in many marine environments. In this study, the diversity of zoanthids in the Cape Verde Islands is specifically examined for the first time. Field images and sampling are combined with...

  15. Ascertaining the potential effects of temperature on growth, survival and feeding of different juvenile clown fish


    Vishwas Rao Methari; Thipramalai Thankappan Ajith Kumar; Mohideen Abdul Badhul Haq; Chinna Raja; Sheik Mohamed


    Objective: To determine the physiological and ecological responses of marine ornamental fishes to the change of water temperature with its potential effects on the growth, survival and feeding in clown fish. Methods: Three different sea anemone fish (Premnas biaculeatus, Amphiprion clarkii, Amphiprion akallopisos) were reared in confinement at water temperatures of 26, 28, 30, 32, and 34 °C using thermostat and they were maintained up to the marketable size, and growth, surv...

  16. Palytoxin Found in Palythoa sp. Zoanthids (Anthozoa, Hexacorallia) Sold in the Home Aquarium Trade


    Deeds, Jonathan R.; Handy, Sara M.; White, Kevin D.; Reimer, James D.


    Zoanthids (Anthozoa, Hexacorallia) are colonial anemones that contain one of the deadliest toxins ever discovered, palytoxin (LD(50) in mice 300 ng/kg), but it is generally believed that highly toxic species are not sold in the home aquarium trade. We previously showed that an unintentionally introduced zoanthid in a home aquarium contained high concentrations of palytoxin and was likely responsible for a severe respiratory reaction when an individual attempted to eliminate the contaminant co...

  17. Use of Vegetation in Delineating Wetland Borders in Upper Missouri River Basin; North-Central United States. (United States)


    The 7.5- to 8.0-m dichtomy marks the end of the distribution of Scirpus fluviatilis, Stachys palustris, Mentha .4 arvensis and ruderals growing on the...diif Mentha arvensis UtricuiiiTulgaris - Transition Zonp hgrpyron srnithii** Helianthus maxmiliani Amroi Palo Lacuca serriola* Anemone ciiiidnss** Mel...BRINE 1 *Brornus jpnicus Thunb. BRJAP 10 fro-mu tectorwa L. BRTEC 5 Calamaro-stis canadensis (Michx.) Beauv- CACAN 10 caaarouti anxpnsa Gray CAINE 30

  18. Engineering of Nanoscale Antifouling and Hydrophobic Surfaces on Naval Structural Steel HY-80 by Anodizing (United States)


    form a biofilm—an assemblage of attached cells, which is commonly referred to as slime [29]. These microorganisms adhere to the surface by...extracellular polymeric substances (EPS). So the biofilm, which is the result of micro fouling, comprises both the microorganisms and the EPS, and thus the... sponges , anemones, tunicates, and hydroids, whilst hard fouling comprises invertebrates such as barnacles, mussels, and tubeworms. The specific

  19. Simulating living organisms with populations of point vortices

    Energy Technology Data Exchange (ETDEWEB)

    Schmieder, R.W.


    The author has found that time-averaged images of small populations of point vortices can exhibit motions suggestive of the behavior of individual organisms. As an example, the author shows that collections of point vortices confined in a box and subjected to heating can generate patterns that are broadly similar to interspecies defense in certain sea anemones. It is speculated that other simple dynamical systems can be found to produce similar complex organism-like behavior.

  20. Short Toxin-like Proteins Abound in Cnidaria Genomes


    Tirosh, Yitshak; Linial, Itai; Askenazi, Manor; Linial, Michal


    Cnidaria is a rich phylum that includes thousands of marine species. In this study, we focused on Anthozoa and Hydrozoa that are represented by the Nematostella vectensis (Sea anemone) and Hydra magnipapillata genomes. We present a method for ranking the toxin-like candidates from complete proteomes of Cnidaria. Toxin-like functions were revealed using ClanTox, a statistical machine-learning predictor trained on ion channel inhibitors from venomous animals. Fundamental features that were emph...

  1. Coral reef fish smell leaves to find island homes (United States)

    Dixson, Danielle L; Jones, Geoffrey P; Munday, Philip L; Planes, Serge; Pratchett, Morgan S; Srinivasan, Maya; Syms, Craig; Thorrold, Simon R


    Recent studies have shown that some coral reef fish larvae return to natal reefs, while others disperse to distant reefs. However, the sensory mechanisms used to find settlement sites are poorly understood. One hypothesis is that larvae use olfactory cues to navigate home or find other suitable reef habitats. Here we show a strong association between the clownfish Amphiprion percula and coral reefs surrounding offshore islands in Papua New Guinea. Host anemones and A. percula are particularly abundant in shallow water beneath overhanging rainforest vegetation. A series of experiments were carried out using paired-choice flumes to evaluate the potential role of water-borne olfactory cues in finding islands. Recently settled A. percula exhibited strong preferences for: (i) water from reefs with islands over water from reefs without islands; (ii) water collected near islands over water collected offshore; and (iii) water treated with either anemones or leaves from rainforest vegetation. Laboratory reared-juveniles exhibited the same positive response to anemones and rainforest vegetation, suggesting that olfactory preferences are innate rather than learned. We hypothesize that A. percula use a suite of olfactory stimuli to locate vegetated islands, which may explain the high levels of self-recruitment on island reefs. This previously unrecognized link between coral reefs and island vegetation argues for the integrated management of these pristine tropical habitats. PMID:18755672

  2. The Transcriptome of the Zoanthid Protopalythoa variabilis (Cnidaria, Anthozoa) Predicts a Basal Repertoire of Toxin-like and Venom-Auxiliary Polypeptides. (United States)

    Huang, Chen; Morlighem, Jean-Étienne Rl; Zhou, Hefeng; Lima, Érica P; Gomes, Paula B; Cai, Jing; Lou, Inchio; Pérez, Carlos D; Lee, Simon Ming; Rádis-Baptista, Gandhi


    Protopalythoa is a zoanthid that, together with thousands of predominantly marine species, such as hydra, jellyfish, and sea anemones, composes the oldest eumetazoan phylum, i.e., the Cnidaria. Some of these species, such as sea wasps and sea anemones, are highly venomous organisms that can produce deadly toxins for preying, for defense or for territorial disputes. Despite the fact that hundreds of organic and polypeptide toxins have been characterized from sea anemones and jellyfish, practically nothing is known about the toxin repertoire in zoanthids. Here, based on a transcriptome analysis of the zoanthid Protopalythoa variabilis, numerous predicted polypeptides with canonical venom protein features are identified. These polypeptides comprise putative proteins from different toxin families: neurotoxic peptides, hemostatic and hemorrhagic toxins, membrane-active (pore-forming) proteins, protease inhibitors, mixed-function venom enzymes, and venom auxiliary proteins. The synthesis and functional analysis of two of these predicted toxin products, one related to the ShK/Aurelin family and the other to a recently discovered anthozoan toxin, displayed potent in vivo neurotoxicity that impaired swimming in larval zebrafish. Altogether, the complex array of venom-related transcripts that are identified in P. variabilis, some of which are first reported in Cnidaria, provides novel insight into the toxin distribution among species and might contribute to the understanding of composition and evolution of venom polypeptides in toxiferous animals. © The Author 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  3. The multigene families of actinoporins (part II): Strategies for heterologous production in Escherichia coli. (United States)

    Valle, A; Hervis, Y P; Socas, L B P; Canet, L; Faheem, M; Barbosa, J A R G; Lanio, M E; Pazos, I F


    The sea anemone venom contains pore-forming proteins (PFP) named actinoporins, due to their purification from organisms belonging to Actiniaria order and its ability to form pores in sphingomyelin-containing membranes. Actinoporins are generally basic, monomeric and single-domain small proteins (∼20 kDa) that are classified as α-type PFP since the pore formation in membranes occur through α-helical elements. Different actinoporin isoforms have been isolated from most of the anemones species, as was analyzed in the first part of this review. Several actinoporin full-length genes have been identified from genomic-DNA libraries or messenger RNA. Since the actinoporins lack carbohydrates and disulfide bridges, their expression in bacterial systems is suitable. The actinoporins heterologous expression in Escherichia coli simplifies their production, replaces the natural source reducing the ecological damage in anemone populations, and allows the production of site-specific mutants for the study of the structure-function relationship. In this second part of the review, the strategies for heterologous production of actinoporins in Escherichia coli are analyzed, as well as the different approaches used for their purification. The activity of the recombinant proteins with respect to the wild-type is also reviewed. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Host specialist clownfishes are environmental niche generalists. (United States)

    Litsios, Glenn; Kostikova, Anna; Salamin, Nicolas


    Why generalist and specialist species coexist in nature is a question that has interested evolutionary biologists for a long time. While the coexistence of specialists and generalists exploiting resources on a single ecological dimension has been theoretically and empirically explored, biological systems with multiple resource dimensions (e.g. trophic, ecological) are less well understood. Yet, such systems may provide an alternative to the classical theory of stable evolutionary coexistence of generalist and specialist species on a single resource dimension. We explore such systems and the potential trade-offs between different resource dimensions in clownfishes. All species of this iconic clade are obligate mutualists with sea anemones yet show interspecific variation in anemone host specificity. Moreover, clownfishes developed variable environmental specialization across their distribution. In this study, we test for the existence of a relationship between host-specificity (number of anemones associated with a clownfish species) and environmental-specificity (expressed as the size of the ecological niche breadth across climatic gradients). We find a negative correlation between host range and environmental specificities in temperature, salinity and pH, probably indicating a trade-off between both types of specialization forcing species to specialize only in a single direction. Trade-offs in a multi-dimensional resource space could be a novel way of explaining the coexistence of generalist and specialists. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

  5. Typification of taxa of subfamily Silenoideae (Caryophyllaceae Juss. from Siberia and Russian Far East based on materials kept in the Herbarium of the Komarov Botanical Institute (LE

    Directory of Open Access Journals (Sweden)

    G. A. Lazkov


    Full Text Available Data on type material of previously not typified taxa of the subfamily Silenoideae (Caryophyllaceae Juss., kept in the Herbarium of the Komarov Botanical Institute (LE are summarized in the paper. All relevant taxa including eight species (or subsequently accepted as species: Gastrolychnis violascens Tolm., Gypsophila stricta Bunge, Heterochroa petraea Bunge, Lychnis ajanensis var. villosula Trautv. [L. villosula (Trautv. Gorschk.], L. fulgens var. wilfordi Regel [L. wilfordi (Regel Maxim.], L. tristis Bunge, Melandrium olgae Maxim., Silene melandriiformis Maxim., five varieties (Melandrium affine var. Intermedium Tolm., Silene repens var. pratensis Kom., S. repens var. alpina Kom., S. repens var. angustifolia Turcz., S. repens var. latifolia Turcz., and one form (Silene repens f. densa Kom. are lectotypified.Key words: Caryophyllaceae, Silenoideae, type specimens, typification, Komarov Botanical Institute (LE, Siberia, Far East. 

  6. Abundancia de colibríes y uso de flores en un bosque templado del sureste de México Hummingbird abundance and flowers use in a template forest from Southeast Mexico

    Directory of Open Access Journals (Sweden)

    Ruth Partida Lara


    Full Text Available La abundancia de los colibríes puede variar por la fenología de floración de las plantas de las que se alimentan. Sin embargo, la información sobre la interacción colibrí-flor es limitada en ambientes tropicales de montaña. En este estudio se evaluó la abundancia de colibríes con redes de niebla y se registró la fenología de floración mensual de las flores visitadas por los colibríes en tres ambientes (bosque de encino, de neblina y matorral en la Reserva Ecológica Huitepec, Chiapas, México de enero a agosto 2010. Cuatro especies de colibríes (Hylocharis leucotis, Lampornis amethystinus, Lamprolaima rhami y Eugenes fulgens se registraron y sus abundancias variaron entre ambientes (H3.8=14.8, p=0.001. Siete especies de plantas fueron visitadas por los colibríes, y presentaron una mayor floración formando parches durante la temporada de secas. En el matorral se concentró el mayor número de especies de plantas con flores. Fuchsia paniculata presentó el mayor periodo de floración aunque solo fue visitada por H. leucotis. Passiflora membranacea fue la única especie visitada por las cuatro especies de colibríes. La única asociación positiva fue la abundancia de E. fulgens con la floración de P. membranacea (rS=0.93, p=0.02. Las fluctuaciones de las abundancias de colibríes en este estudio están en cierta forma determinadas por las interacciones del recurso floral y su distribución en el ambienteHummingbird abundance varies with plant bloom phenology used for feeding. However, the information on hummingbird-flower interaction is limited for tropical mountain environments. We evaluated hummingbird abundance using mist nest and estimated monthly flowering phenology visited by hummingbirds in three different habitats (oak forest, cloud forest and bush from January to August 2010 in Huitepec Ecological Reserve. We recorded four hummingbird species (Hylocharis leucotis, Lampornis amethystinus, Lamprolaima rhami and Eugenes

  7. Abundancia de colibríes y uso de flores en un bosque templado del sureste de México

    Directory of Open Access Journals (Sweden)

    Ruth Partida Lara


    Full Text Available La abundancia de los colibríes puede variar por la fenología de floración de las plantas de las que se alimentan. Sin embargo, la información sobre la interacción colibrí-flor es limitada en ambientes tropicales de montaña. En este estudio se evaluó la abundancia de colibríes con redes de niebla y se registró la fenología de floración mensual de las flores visitadas por los colibríes en tres ambientes (bosque de encino, de neblina y matorral en la Reserva Ecológica Huitepec, Chiapas, México de enero a agosto 2010. Cuatro especies de colibríes (Hylocharis leucotis, Lampornis amethystinus, Lamprolaima rhami y Eugenes fulgens se registraron y sus abundancias variaron entre ambientes (H3.8=14.8, p=0.001. Siete especies de plantas fueron visitadas por los colibríes, y presentaron una mayor floración formando parches durante la temporada de secas. En el matorral se concentró el mayor número de especies de plantas con flores. Fuchsia paniculata presentó el mayor periodo de floración aunque solo fue visitada por H. leucotis. Passiflora membranacea fue la única especie visitada por las cuatro especies de colibríes. La única asociación positiva fue la abundancia de E. fulgens con la floración de P. membranacea (rS=0.93, p=0.02. Las fluctuaciones de las abundancias de colibríes en este estudio están en cierta forma determinadas por las interacciones del recurso floral y su distribución en el ambiente

  8. Trophic ecology of deep-sea Asteroidea (Echinodermata) from eastern Canada (United States)

    Gale, Katie S. P.; Hamel, Jean-François; Mercier, Annie


    Asteroids (sea stars) can be important predators in benthic communities and are often present in ecologically important and vulnerable deep-sea coral and sponge habitats. However, explicit studies on the trophic ecology of deep-sea asteroids are rare. We investigated the diets of seven species of deep-sea asteroid from the bathyal zone of Newfoundland and Labrador, eastern Canada. A multifaceted approach including live animal observations, stomach content analysis, and stable isotope analysis revealed the asteroids to be either top predators of megafauna or secondary consumers (mud ingesters, infaunal predators, and suspension feeders). The stable isotope signatures of Ceramaster granularis, Hippasteria phrygiana, and Mediaster bairdi are characteristic of high-level predators, having δ15N values 4.4‰ (more than one trophic level) above Ctenodiscus crispatus, Leptychaster arcticus, Novodinia americana, and Zoroaster fulgens. We present strong evidence that corals and sponges are common food items for two of the predatory species, C. granularis and H. phrygiana. During laboratory feeding trials, live H. phrygiana fed on several species of soft coral and C. granularis fed on sponges. Stomach content analysis of wild-caught individuals revealed sclerites from sea pens (e.g. Pennatula sp.) in the stomachs of both asteroid species; H. phrygiana also contained sclerites from at least two other species of octocoral and siliceous sponge spicules were present in the stomachs of C. granularis. The stomach contents of the secondary consumers contained a range of invertebrate material. Leptychaster arcticus and Ctenodiscus crispatus feed infaunally on bulk sediment and molluscs, Zoroaster fulgens is a generalist infaunal predator, and the brisingid Novodinia americana is a specialist suspension feeder on benthopelagic crustaceans. This study provides a foundation for understanding the ecological roles of bathyal asteroids, and suggests that some species may have the

  9. Fouling community dominated by Metridium senile (Cnidaria: Anthozoa: Actiniaria in Bahía San Julián (southern Patagonia, Argentina

    Directory of Open Access Journals (Sweden)

    Juan Pablo Martin


    Full Text Available The objective of this study is to provide information about a harbour-fouling community dominated by Metridium senile in southern Patagonia. Several steel tubes from the wharf of Puerto San Julián were extracted to perform repair tasks, allowing the attached benthic community to be studied. Sampling was conducted at three levels: lower intertidal, 3-4 m depth and 6-7 m depth. In the lower intertidal, M. senile had a relative abundance of 43%, the most abundant accompanying species being Perumytilus purpuratus, Mytilus edulis platensis and Aulacomya atra atra. At subtidal level, the anemone showed relative abundances of 64% and 65%, and was accompanied by Monocorophium insidiosum at 3-4 m depth and by polychaetes of families Sabellidae and Syllidae at 6-7 m at depth. In the lower intertidal, epibiosis was more frequent on P. purpuratus, A. atra atra and M. edulis platensis, while in the subtidal, the richness of substrate-organisms increased significantly and the anemone was fixed to A. atra atra, M. edulis platensis, Paramolgula gregaria, Crepipatella dilatata, Austromegabalanus psittacus, Hiatella arctica, Polyzoa opuntia, Pyura sp. and Sabellidae tubes. The ability of M. senile to settle on many different organisms, along with other strategies, makes it a colonizer able to displace other species that could compete with it for substratum. Given the cosmopolitan nature of M. senile, the fact that this species has not been previously reported in the coastal zone of the region, and the results of our study, we discuss the possibility that this sea anemone is an invasive alien species in southern Patagonia, or at least a cryptogenic species.

  10. Characterization of two Bunodosoma granulifera toxins active on cardiac sodium channels (United States)

    Goudet, Cyril; Ferrer, Tania; Galàn, Loipa; Artiles, Adriana; Batista, Cesar F V; Possani, Lourival D; Alvarez, Julio; Aneiros, Abel; Tytgat, Jan


    Two sodium channel toxins, BgII and BgIII, have been isolated and purified from the sea anemone Bunodosoma granulifera. Combining different techniques, we have investigated the electrophysiological properties of these toxins. We examined the effect of BgII and BgIII on rat ventricular strips. These toxins prolong action potentials with EC50 values of 60 and 660 nM and modify the resting potentials. The effect on Na+ currents in rat cardiomyocytes was studied using the patch-clamp technique. BgII and BgIII slow the rapid inactivation process and increase the current density with EC50 values of 58 and 78 nM, respectively. On the cloned hH1 cardiac Na+ channel expressed in Xenopus laevis oocytes, BgII and BgIII slow the inactivation process of Na+ currents (respective EC50 values of 0.38 and 7.8 μM), shift the steady-state activation and inactivation parameters to more positive potentials and the reversal potential to more negative potentials. The amino acid sequences of these toxins are almost identical except for an asparagine at position 16 in BgII which is replaced by an aspartic acid in BgIII. In all experiments, BgII was more potent than BgIII suggesting that this conservative residue is important for the toxicity of sea anemone toxins. We conclude that BgII and BgIII, generally known as neurotoxins, are also cardiotoxic and combine the classical effects of sea anemone Na+ channels toxins (slowing of inactivation kinetics, shift of steady-state activation and inactivation parameters) with a striking decrease on the ionic selectivity of Na+ channels. PMID:11704639

  11. The mining of toxin-like polypeptides from EST database by single residue distribution analysis (United States)


    Background Novel high throughput sequencing technologies require permanent development of bioinformatics data processing methods. Among them, rapid and reliable identification of encoded proteins plays a pivotal role. To search for particular protein families, the amino acid sequence motifs suitable for selective screening of nucleotide sequence databases may be used. In this work, we suggest a novel method for simplified representation of protein amino acid sequences named Single Residue Distribution Analysis, which is applicable both for homology search and database screening. Results Using the procedure developed, a search for amino acid sequence motifs in sea anemone polypeptides was performed, and 14 different motifs with broad and low specificity were discriminated. The adequacy of motifs for mining toxin-like sequences was confirmed by their ability to identify 100% toxin-like anemone polypeptides in the reference polypeptide database. The employment of novel motifs for the search of polypeptide toxins in Anemonia viridis EST dataset allowed us to identify 89 putative toxin precursors. The translated and modified ESTs were scanned using a special algorithm. In addition to direct comparison with the motifs developed, the putative signal peptides were predicted and homology with known structures was examined. Conclusions The suggested method may be used to retrieve structures of interest from the EST databases using simple amino acid sequence motifs as templates. The efficiency of the procedure for directed search of polypeptides is higher than that of most currently used methods. Analysis of 39939 ESTs of sea anemone Anemonia viridis resulted in identification of five protein precursors of earlier described toxins, discovery of 43 novel polypeptide toxins, and prediction of 39 putative polypeptide toxin sequences. In addition, two precursors of novel peptides presumably displaying neuronal function were disclosed. PMID:21281459

  12. Characterization of small HSPs from Anemonia viridis reveals insights into molecular evolution of alpha crystallin genes among cnidarians.

    Directory of Open Access Journals (Sweden)

    Aldo Nicosia

    Full Text Available Gene family encoding small Heat-Shock Proteins (sHSPs containing α-crystallin domain are found both in prokaryotic and eukaryotic organisms; however, there is limited knowledge of their evolution. In this study, two small HSP genes termed AvHSP28.6 and AvHSP27, both organized in one intron and two exons, were characterised in the Mediterranean snakelocks anemone Anemonia viridis. The release of the genome sequence of Hydra magnipapillata and Nematostella vectensis enabled a comprehensive study of the molecular evolution of α-crystallin gene family among cnidarians. Most of the H. magnipapillata sHSP genes share the same gene organization described for AvHSP28.6 and AvHSP27, differing from the sHSP genes of N. vectensis which mainly show an intronless architecture. The different genomic organization of sHSPs, the phylogenetic analyses based on protein sequences, and the relationships among Cnidarians, suggest that the A.viridis sHSPs represent the common ancestor from which H. magnipapillata genes directly evolved through segmental genome duplication. Additionally retroposition events may be considered responsible for the divergence of sHSP genes of N. vectensis from A. viridis. Analyses of transcriptional expression profile showed that AvHSP28.6 was constitutively expressed among different tissues from both ectodermal and endodermal layers of the adult sea anemones, under normal physiological conditions and also under different stress condition. Specifically, we profiled the transcriptional activation of AvHSP28.6 after challenges with different abiotic/biotic stresses showing induction by extreme temperatures, heavy metals exposure and immune stimulation. Conversely, no AvHSP27 transcript was detected in such dissected tissues, in adult whole body cDNA library or under stress conditions. Hence, the involvement of AvHSP28.6 gene in the sea anemone defensome is strongly suggested.

  13. Microbial diversity and activity in the Nematostella vectensis holobiont: insights from 16S rRNA gene sequencing, isolate genomes, and a pilot-scale survey of gene expression

    Directory of Open Access Journals (Sweden)

    Jia Yi Har


    Full Text Available We have characterized the molecular and genomic diversity of the microbiota of the starlet sea anemone Nematostella vectensis, a cnidarian model for comparative developmental and functional biology and a year-round inhabitant of temperate salt marshes. Molecular phylogenetic analysis of 16S rRNA gene clone libraries revealed four ribotypes associated with N. vectensis at multiple locations and times. These associates include two novel ribotypes within the ε-Proteobacterial order Campylobacterales and the Spirochetes, respectively, each sharing 99% 16S rRNA identity with Endozoicomonas elysicola and Pseudomonas oleovorans, respectively. Species-specific PCR revealed that these populations persisted in N. vectensis asexually propagated under laboratory conditions. cDNA indicated expression of the Campylobacterales and Endozoicomonas 16S rRNA in anemones from Sippewissett Marsh, MA. A collection of bacteria from laboratory raised N. vectensis was dominated by isolates from P. oleovorans and Rhizobium radiobacter. Isolates from field-collected anemones revealed an association with Limnobacter and Stappia isolates. Genomic DNA sequencing was carried out on 10 cultured bacterial isolates representing field- and laboratory-associates, i.e. Limnobacter spp., Stappia spp., P. oleovorans and R. radiobacter. Genomes contained multiple genes identified as virulence (host-association factors while S. stellulata and L. thiooxidans genomes revealed pathways for mixotrophic sulfur oxidation. A pilot metatranscriptome of laboratory-raised N. vectensis was compared to the isolate genomes and indicated expression of ORFs from L. thiooxidans with predicted functions of motility, nutrient scavenging (Fe and P, polyhydroxyalkanoate synthesis for carbon storage, and selective permeability (porins. We hypothesize that such activities may mediate acclimation and persistence of bacteria in N. vectensis.

  14. Partitioning of Respiration in an Animal-Algal Symbiosis: Implications for Different Aerobic Capacity Between Symbiodinium spp.

    Directory of Open Access Journals (Sweden)

    Thomas David Hawkins


    Full Text Available Cnidarian-dinoflagellate symbioses are ecologically important and the subject of much investigation. However, our understanding of critical aspects of symbiosis physiology, such as the partitioning of total respiration between the host and symbiont, remains incomplete. Specifically, we know little about how the relationship between host and symbiont respiration varies between different holobionts (host-symbiont combinations. We applied molecular and biochemical techniques to investigate aerobic respiratory capacity in naturally symbiotic Exaiptasia pallida sea anemones, alongside animals infected with either homologous ITS2-type A4 Symbiodinium or a heterologous isolate of Symbiodinium minutum (ITS2-type B1. In naturally symbiotic anemones, host, symbiont, and total holobiont mitochondrial citrate synthase (CS enzyme activity, but not host mitochondrial copy number, were reliable predictors of holobiont respiration. There was a positive association between symbiont density and host CS specific activity (mg protein-1, and a negative correlation between host- and symbiont CS specific activities. Notably, partitioning of total CS activity between host and symbiont in this natural E. pallida population was significantly different to the host/symbiont biomass ratio. In re-infected anemones, we found significant between-holobiont differences in the CS specific activity of the algal symbionts. Furthermore, the relationship between the partitioning of total CS activity and the host/symbiont biomass ratio differed between holobionts. These data have broad implications for our understanding of cnidarian-algal symbiosis. Specifically, the long-held assumption of equivalency between symbiont/host biomass and respiration ratios can result in significant overestimation of symbiont respiration and potentially erroneous conclusions regarding the percentage of carbon translocated to the host. The interspecific variability in symbiont aerobic capacity provides

  15. Assimilation and partitioning of prey nitrogen within two anthozoans and their endosymbiotic zooxanthellae (United States)

    Piniak, G.A.; Lipschultz, F.; McClelland, J.


    The movement of nitrogen from zooplankton prey into the temperate scleractinian coral Oculina arbuscula and the anemone Aiptasia pallida was measured using 15N-labeled brine shrimp. The efficiency with which prey nitrogen was incorporated into cnidarian tissues was species-specific. O. arbuscula with a full complement of zooxanthellae had an assimilation efficiency of nearly 100%, compared to only 46% for corals containing few zooxanthellae. In A. pallida, symbiont density had no effect, and nitrogen assimilation was 23 to 29%. In both species, the host retained the bulk of the ingested label. Complete digestion was rapid (feeding and de novo synthesis.

  16. Molecular cloning of a preprohormone from Hydra magnipapillata containing multiple copies of Hydra-L Wamide (Leu-Trp-NH2) neuropeptides: evidence for processing at Ser and Asn residues

    DEFF Research Database (Denmark)

    Leviev, I; Williamson, M; Grimmelikhuijzen, C J


    The simple, freshwater polyp Hydra is often used as a model to study development in cnidarians. Recently, a neuropeptide, cloned a preprohormone...... from Hydra magnipapillata containing 11 (eight different) immature neuropeptide sequences that are structurally related to the metamorphosis-inducing neuropeptide from sea anermones. During the final phase of our cloning experiments, another research team independently isolated and sequenced five...... most frequent one being Gly-Pro-Pro-Pro-Gly-Leu-Trp-NH2; Hydra-LWamide l; three copies). Based on their structural similarities with the metamorphosis-inducing neuropeptide from sea anemones, the mature peptides derived from the Hydra-LWamide preprohormone are potential candidates for being...

  17. Isolation of a substance activating foot formation in hydra

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Schaller, H C


    -forming potential of the tissue (2) It does not accelerate head regeneration, nor do the head factors of hydra discovered by Schaller (1973) and Berking (1977) accelerate foot regeneration. We propose that the foot-activating substance is a morphogen responsible for foot formation in hydra. The foot activator can...... be extracted from hydra tissue with methanol and separated from other known morphogens of hydra by gel filtration and ion-exchange chromatography. A substance with similar biological and physicochemical properties can be isolated from sea anemones....

  18. In memoriam Jacobus Cornelis (Koos) den Hartog (1942-2000), marine naturalist


    Land, van der, J.


    Jacobus Cornelis den Hartog was born on 17 April 1942 in Broek op Langedijk. He read biology at Leiden University from 1963 to 1970. He worked at the Caribbean Marine Biological Station on Curaçao from 1971 to 1973, where he studied Caribbean sea anemones. From 1973 he worked in the National Museum of Natural History in Leiden, where he became curator of Coelenterata in 1975. For 25 years he was an active member of the marine research group of the museum and as such he participated in 15 expe...

  19. Mini-review: The Morphology, Mineralogy and Microbiology of Accumulated Iron Corrosion Products (United States)


    U-166 and the SS Robert E. Lee, known to be carrying 5,000 tons of aluminum ore ( bauxite ) at the time it sank, was also used to support the notion of...suggested that porosity within the tubercle deter- mined the ease with which ions migrate within the core. Table 2. World War II shipwrecks in the Gulf of...diversity, reef fishes U-166 1,256 1942–1942 U-boat Mines and torpedoes Brown and white rusticles, Venus flytrap anemones, abundant red deep-sea crab

  20. Inotropic response elicited by nematocyst contents of Hydra oligactis (Coelenterata: Hydrozoa). (United States)

    Lesh-Laurie, G E; DiBlasi, S L; Suchy, P E; Senturia, J B


    1. Intact, isolated nematocysts from the non-toxic, freshwater coelenterate Hydra oligactis contain soluble material(s) capable of producing a sustained increase in the rate of developed force in the vertebrate myocardium. 2. The positive inotropic effects of this material(s) appear grossly comparable to those described for Anthopleurin-A (AP-A) and Toxin II (ATX-II) from sea anemones. 3. The effects of the nematocyst material are distinct from those of known vasoactive peptides reported to occur in Hydra.

  1. [Venomous and poisonous animals. V. Envenomations by venomous marine invertebrates]. (United States)

    Bédry, R; de Haro, L


    Epidemiological information about marine envenomation is generally less extensive in Europe than in tropical countries where this type of injury is more severe and the need for medical attention is more frequent. For this reason use of the regional poison control centers in the areas where envenomation occurs must be encouraged. The purpose of this review is to describe envenomation by poisonous marine invertebrates (cephalopods, sea urchins, cone shells, jellyfish, anemones, star-fish, corals, and worms). Understanding of these envenomation syndromes is important not only in tropical areas but also in Europe where importation of dangerous species has increased in recent years.

  2. Ten new records of marine invertebrates from the Azores

    Directory of Open Access Journals (Sweden)

    WIRTZ, P.


    Full Text Available The sea anemones Telmatactis cricoides (Duchassaign, 1850 and Actinia n. sp., themolluscs Tonna galea Linnaeus, 1758, Vitreolina philippi (de Rayneval & Ponzi, 1854,Melanella n. sp., Phidiana lynceus (de Rayneval & Ponzi, 1854 and Anomia patelliformis(Linnaeus, 1761, the nemertine Baseodiscus delineatus (DelleChiaje, 1825 and the echinoderms Leptosynapta inhaerens (O. F. Müller, 1776 and Stichopus regalis (Cuvier, 1817, are here recorded from the Azores for the first time. The presence of the two starfishspecies Chaetaster longipes (Retzius, 1805 and Luidia ciliaris (Philippi, 1837 in the Azores is confirmed and the spawning behaviour of the sea urchin Echinocyamus pusillus (O. F. Müller, 1776 is described.

  3. Meerkats (Suricata suricatta, a new definitive host of the canid nematode Angiostrongylus vasorum

    Directory of Open Access Journals (Sweden)

    Nina Gillis-Germitsch


    Full Text Available Angiostronglyus vasorum is a cardiopulmonary nematode infecting mainly canids such as dogs (Canis familiaris and foxes (Vulpes vulpes. Natural infections have also been reported in mustelids and red pandas (Ailurus fulgens fulgens. We report the occurrence of natural A. vasorum infections in a group of captive meerkats (Suricata suricatta, housed at a university facility in Switzerland. A. vasorum first-stage larvae (L1 were initially identified in a pooled faecal sample. Individual samples, investigated with the Baermann-Wetzel technique, revealed that 41% (7/17 of the meerkats were infected, with ranges of 2–125 L1/g faeces. PCR and sequencing of part of the ITS-2 region resulted in 100% identity with A. vasorum. Infected animals did not show clinical signs. One meerkat died two days after diagnosis. Upon necropsy one adult specimen was recovered; histological examination of the lung revealed granulomatous pneumonia caused by A. vasorum larvae and eggs as well as intima and media hyperplasia and isolated arteriosclerosis of larger lung vessels. However, the cause of death was a spleen rupture with associated blood loss. All meerkats were topically treated with 10 mg imidacloprid/2.5 mg moxidectin per animal, after which they became negative in all follow up faecal examinations. Potential intermediate (gastropods and paratenic hosts (birds were collected from within or outside the meerkats enclosure. Gastropods were examined by PCR and bird samples by digestion. Four out of 193 (2.1% gastropod samples were positive for A. vasorum, whereas none of the bird samples were positive. Meerkats, belonging to the Herpestidae, therefore are suitable definitive hosts for A. vasorum, with production and excretion of live L1. Meerkats kept in captivity in areas where A. vasorum is endemic and with potential contact to intermediate hosts are at risk of infection. Regular faecal examinations including Baermann-Wetzel technique should be considered

  4. Natural cleaning of the black-lip pearl oyster Pinctada margaritifera by butterflyfishes (Chaetodon) in French Polynesia (United States)

    Bertucci, Frédéric; Legraverant, Yohann; Berthe, Cécile; Brooker, Rohan M.; Lo, Cédrik; Lecchini, David


    Biofouling increases the operational and economic costs associated with pearl production. As current procedures for reducing oyster biofouling can be detrimental to survival and growth and may pollute the surrounding environment developing alternative, biologically-mediated, methods could potentially increase both production and ecological sustainability. With this in mind, the present study investigated natural cleaning of black-lipped pearl oysters, Pinctada margaritifera, by butterflyfishes (Chaetodon). The feeding behaviour of six butterflyfish species was examined at Rangiroa Atoll, French Polynesia: Chaetodon auriga, Chaetodon citrinellus, Chaetodon ephippium, Chaetodon lunulatus, Chaetodon trifascialis and Chaetodon ulietensis. All species cleaned the surface of pearl oysters by removing epibionts (from 16% to 40% of total biomass), although dietary variation may explain different cleaning efficiencies. Generalist omnivores (C. auriga, C. citrinellus, C. ephippium and C. ulietensis) were the most efficient cleaners (% cleaning range: 26-40% of total biomass). Within this group, C. ephippium removed the most biomass (average of 41%) targeting algae and anemones. However, C. auriga targeted the most diverse range of epibionts, removing significant amounts of algae, sponges, tunicates, and anemones. These results suggest that foraging by butterflyfishes can substantially reduce biofouling on economically-important tropical bivalves.

  5. Investigation of fungal root colonizers of the invasive plant Vincetoxicum rossicum and co-occurring local native plants in a field and woodland area in Southern Ontario

    Directory of Open Access Journals (Sweden)

    Cindy Bongard


    Full Text Available Fungal communities forming associations with plant roots have generally been described as ranging from symbiotic to parasitic. Disruptions to these associations consequently can have significant impacts on native plant communities. We examined how invasion by Vincetoxicum rossicum, a plant native to Europe, can alter both the arbuscular mycorrhizal fungi, as well as the general fungal communities associating with native plant roots in both field and woodland sites in Southern Ontario. In two different sites in the Greater Toronto Area, we took advantage of invasion by V. rossicum and neighbouring uninvaded sites to investigate the fungal communities associating with local plant roots, including goldenrod (Solidago spp., wild red raspberry (Rubus idaeus, Canada anemone (Anemone canadensis, meadow rue (Thalictrum dioicum, and wild ginger (Asarum canadense. Fungi colonizing roots were characterized with terminal restriction fragment length polymorphism (T-RFLP analysis of amplified total fungal (TF and arbuscular mycorrhizal fungal (AMF ribosomal fragments. We saw a significant effect of the presence of this invader on the diversity of TF phylotypes colonizing native plant roots, and a composition shift of both the TF and AMF community in native roots in both sites. In native communities invaded by V. rossicum, a significant increase in richness and colonization density of TF suggests that invaders such as V. rossicum may be able to influence the composition of soil fungi available to natives, possibly via mechanisms such as increased carbon provision or antibiosis attributable to unique root exudates.

  6. Probability of successful larval dispersal declines fivefold over 1 km in a coral reef fish. (United States)

    Buston, Peter M; Jones, Geoffrey P; Planes, Serge; Thorrold, Simon R


    A central question of marine ecology is, how far do larvae disperse? Coupled biophysical models predict that the probability of successful dispersal declines as a function of distance between populations. Estimates of genetic isolation-by-distance and self-recruitment provide indirect support for this prediction. Here, we conduct the first direct test of this prediction, using data from the well-studied system of clown anemonefish (Amphiprion percula) at Kimbe Island, in Papua New Guinea. Amphiprion percula live in small breeding groups that inhabit sea anemones. These groups can be thought of as populations within a metapopulation. We use the x- and y-coordinates of each anemone to determine the expected distribution of dispersal distances (the distribution of distances between each and every population in the metapopulation). We use parentage analyses to trace recruits back to parents and determine the observed distribution of dispersal distances. Then, we employ a logistic model to (i) compare the observed and expected dispersal distance distributions and (ii) determine the relationship between the probability of successful dispersal and the distance between populations. The observed and expected dispersal distance distributions are significantly different (p < 0.0001). Remarkably, the probability of successful dispersal between populations decreases fivefold over 1 km. This study provides a framework for quantitative investigations of larval dispersal that can be applied to other species. Further, the approach facilitates testing biological and physical hypotheses for the factors influencing larval dispersal in unison, which will advance our understanding of marine population connectivity.

  7. Novel Kunitz-like Peptides Discovered in the Zoanthid Palythoa caribaeorum through Transcriptome Sequencing. (United States)

    Liao, Qiwen; Li, Shengnan; Siu, Shirley Weng In; Yang, Binrui; Huang, Chen; Chan, Judy Yuet-Wa; Morlighem, Jean-Étienne R L; Wong, Clarence Tsun Ting; Rádis-Baptista, Gandhi; Lee, Simon Ming-Yuen


    Palythoa caribaeorum (class Anthozoa) is a zoanthid that together jellyfishes, hydra, and sea anemones, which are venomous and predatory, belongs to the Phyllum Cnidaria. The distinguished feature in these marine animals is the cnidocytes in the body tissues, responsible for toxin production and injection that are used majorly for prey capture and defense. With exception for other anthozoans, the toxin cocktails of zoanthids have been scarcely studied and are poorly known. Here, on the basis of the analysis of P. caribaeorum transcriptome, numerous predicted venom-featured polypeptides were identified including allergens, neurotoxins, membrane-active, and Kunitz-like peptides (PcKuz). The three predicted PcKuz isotoxins (1-3) were selected for functional studies. Through computational processing comprising structural phylogenetic analysis, molecular docking, and dynamics simulation, PcKuz3 was shown to be a potential voltage gated potassium-channel inhibitor. PcKuz3 fitted well as new functional Kunitz-type toxins with strong antilocomotor activity as in vivo assessed in zebrafish larvae, with weak inhibitory effect toward proteases, as evaluated in vitro. Notably, PcKuz3 can suppress, at low concentration, the 6-OHDA-induced neurotoxicity on the locomotive behavior of zebrafish, which indicated PcKuz3 may have a neuroprotective effect. Taken together, PcKuz3 figures as a novel neurotoxin structure, which differs from known homologous peptides expressed in sea anemone. Moreover, the novel PcKuz3 provides an insightful hint for biodrug development for prospective neurodegenerative disease treatment.

  8. Grazing intensity influences the strength of an associational refuge on temperate reefs. (United States)

    Levenbach, Stuart


    Recent studies have emphasized the role of positive interactions in ecological communities, but few have addressed how positive interactions are mediated by abiotic stress and biotic interactions. Here, I investigate the effect of a facilitator species on the abundance of macroalgae over a gradient of herbivory. Grazing by sea urchins can be intense on temperate reefs along the California coast, with benthic macroalgae growing exclusively in physical refuges and interspersed within colonies of the strawberry anemone, Corynactis californica. Field experiments indicated that the net effect of C. californica on turf algae was strongly nonlinear over a gradient in density of sea urchins. At low intensities of urchin grazing, the anemone and macroalgae competed for space, with algae capable of overgrowing C. californica. At intermediate grazing intensities, C. californica provided a refuge for turf algae but not for juvenile kelp. Neither turf algae nor kelp benefited from the presence of C. californica at the highest levels of grazing intensity, as sea urchins consumed nearly all macroalgae. The hump-shaped effect observed for C. californica contrasts with the prevailing view in ecological theory that positive interactions are more common in harsh environmental conditions. The results reported here qualify this view and underscore the need to evaluate positive interactions over a range of abiotic stress and consumer pressure.

  9. A Chemical Approach to Mitigate Coral Bleaching (United States)

    Marty-Rivera, M.; Yudowski, G.


    Changes in sea surface temperature and irradiance can induce bleaching and increase mortality in corals. Coral bleaching occurs when symbiotic algae living inside the coral is degraded or expelled, reducing the availability of energetic resources. Oxidative stress has been suggested as a possible molecular mechanism triggering bleaching. We hypothesized that reduction of reactive oxygen species (ROS) during stress could mitigate or prevent coral bleaching. We utilized the coral Porites Astreoides as our model to test the effects of two natural antioxidants, catechin and Resveratrol, on thermally induced bleaching. Coral fragments were exposed to four treatments: high temperature (32°C), high temperature plus antioxidants (1μM), ambient temperature (25°C), or ambient temperature (25°C) plus antioxidant for four days. A total of 8 corals were used per treatment. We measured several photobiological parameters, such as maximum quantum yield and light curves to assess the viability of symbiodinium spp. after thermal stress in the presence of antioxidants. Preliminary experiments on a model species, the sea anemone Aiptasia pallida and corals, showed that exposure to antioxidants reduced intracellular levels of ROS. Additionally, antioxidant-treated anemones showed higher photosynthetic efficiency (67%) than those exposed to high-temperature alone.

  10. An actinoporin plays a key role in water stress in the moss Physcomitrella patens. (United States)

    Hoang, Quoc Truong; Cho, Sung Hyun; McDaniel, Stuart F; Ok, Sung Han; Quatrano, Ralph S; Shin, Jeong Sheop


    * Modern land plants arose from a green algae-like ancestor c. 480 million years ago. While several novel morphological features were critical for survival in the aerial environment, physiological innovation undoubtedly played a key role in the colonization of terrestrial habitats. Recently, actinoporin genes, a small group of pore-forming toxins from sea anemones, have been found in the bryophyte and lycophyte lineages of land plants where they are upregulated in water-stressed tissues. * The bryoporin gene in the moss Physcomitrella patens (PpBP) was functionally characterized by RNA blot analyses and overexpression in P. patens. In order to examine functional homology between PpBP and sea anemone actinoporins, the recombinant PpBP was subjected to hemolytic analysis of pig blood cells, which is one of the specific activities of actinoporins. * PpBP was upregulated by various abiotic stresses, in particular most strongly by dehydration stress. Overexpression of the bryoporin gene heightens drought tolerance in P. patens significantly. In addition, PpBP shared the highest structural homology with actinoporins in a three-dimensional structural database and showed hemolytic activity. * These results suggest that this phylogenetic distribution may have resulted from an ancient horizontal gene transfer and actinoporins may have played an important role in early land plants.

  11. Multi-omics analysis of thermal stress response in a zooxanthellate cnidarian reveals the importance of associating with thermotolerant symbionts

    KAUST Repository

    Cziesielski, Maha J.


    Corals and their endosymbiotic dinoflagellates of the genus Symbiodinium have a fragile relationship that breaks down under heat stress, an event known as bleaching. However, many coral species have adapted to high temperature environments such as the Red Sea (RS). To investigate mechanisms underlying temperature adaptation in zooxanthellate cnidarians we compared transcriptome- and proteome-wide heat stress response (24 h at 32°C) of three strains of the model organism Aiptasia pallida from regions with differing temperature profiles; North Carolina (CC7), Hawaii (H2) and the RS. Correlations between transcript and protein levels were generally low but inter-strain comparisons highlighted a common core cnidarian response to heat stress, including protein folding and oxidative stress pathways. RS anemones showed the strongest increase in antioxidant gene expression and exhibited significantly lower reactive oxygen species (ROS) levels in hospite However, comparisons of antioxidant gene and protein expression between strains did not show strong differences, indicating similar antioxidant capacity across the strains. Subsequent analysis of ROS production in isolated symbionts confirmed that the observed differences of ROS levels in hospite were symbiont-driven. Our findings indicate that RS anemones do not show increased antioxidant capacity but may have adapted to higher temperatures through association with more thermally tolerant symbionts.

  12. Sequencing and de novo transcriptome assembly of Anthopleura dowii Verrill (1869, from Mexico

    Directory of Open Access Journals (Sweden)

    Jorge-Tonatiuh Ayala-Sumuano


    Full Text Available Next-generation technologies for determination of genomics and transcriptomics composition have a wide range of applications. Moreover, the development of tools for big data set analysis has allowed the identification of molecules and networks involved in metabolism, evolution or behavior. By natural habitats aquatic organisms have implemented molecular strategies for survival, including the production and secretion of toxic compounds for their predators; therefore these organisms are possible sources of proteins or peptides with potential biotechnological application. In the last decade anthozoans, mainly octocorals but also sea anemones, have been proben to be a source of natural products. Members of the genus Anthopleura are one of the best known and most studied sea anemones because they are common constituents of rocky intertidal communities and show interesting ecological and biological phenomena (e.g. intraespecific competition, symbiosis, etc.; however, many aspects of these taxa remain in need to be analyzed. This work describes the transcriptome sequencing of Anthopleura dowii Verrill, 1869 (Cnidaria: Anthozoa: Actiniaria; this is the first report of this kind for these species. The data set used to construct the transcriptome has been deposited on NCBI's database. Illumina sequence reads are available under BioProject accession number PRJNA329297 and Sequence Read Archive under accession number SRP078992.

  13. Long-term phyto-, ornitho- and ichthyophenological time-series analyses in Estonia (United States)

    Ahas, Rein

    This study analyzes a long-term phenological time series for the impact assessment of climate changes on Estonian nature and for the methodological study of the possible limitations of using phenological time series for climate trend analyses. These limiting factors can influence the results of studies more than the real impact of climate changes, which may have a much smaller numeric value. The 132-year series of the arrival of the skylark (Alauda arvensis) and the white wagtail (Motacilla alba), the 78-year series of the blossoming of the wood anemone (Anemone nemorosa), the bird cherry (Padus racemosa), apple trees (Malus domestica) and lilacs (Syringa vulgaris), and the 44-year series of the spawning of pike (Esox lucius) and bream (Abramis brama) were studied at three selected observation points in Estonia. The study of the phenological time series shows that Estonian springs have, on the basis of the database, advanced 8 days on average over the last 80-year period; the last 40-year period has warmed even faster.

  14. Black, green, and red abalones. Species profiles: life histories and environmental requirements of coastal fishes and invertebrates (Pacific Southwest. )

    Energy Technology Data Exchange (ETDEWEB)

    Ault, J.S.


    Black, green, and red abalones (Haliotis cracherodii, H. fulgens, and H. rufescens, respectivley) are of commercial and ecological importance and are distributed widely along the California coast. The abalones are morphologically similar; species are distinguished by particular shell sculpture, color, and body characteristics. Their latitudinal and bathymetric distribution is stratified and most closely related to temperature. Small juveniles eat mainly microflora; adults eat primarily drift macro-algae, preferring specific brown or red algae, when available. Spawning occurs during summer; gonad ripening depends on food quality and quantity and water temperature. Larvae are lecithotrophic and remain planktonic for periods of 5 to 14 days after hatching; settling is substrate specific. Postlarvae and adults require hard substrate for attachment. Juveniles are cryptic, adults usually more exposed. Growth rates are similar, although maximum size varies with species. Increases in shell length and body weight correlate positively with food abundance and temperature. Below depths of 6 m, sea urchins are major competitors for food and space. Predation by invertebrates is low. Decreased abalone production from central California is associated with range expansion and increased predation by sea otters, the major source of abalone mortality. General declines in California landings are due to mortality from improper picking and replacement, habitat degradation, and perhaps overfishing. Commercial and sport diving efforts have increased sharply, whereas annual landings of abalones declined from 1965 to 1982.

  15. Outbreak and genotyping of canine distemper virus in captive Siberian tigers and red pandas. (United States)

    Zhang, He; Shan, Fen; Zhou, Xia; Li, Bing; Zhai, Jun-Qiong; Zou, Shu-Zhan; Wu, Meng-Fan; Chen, Wu; Zhai, Shao-Lun; Luo, Man-Lin


    In this study, four canine distemper virus (CDV) strains were isolated from captive Siberian tigers (Panthera tigris altaica) and red pandas (Ailurus fulgens) during two separate CDV outbreaks in a zoo in Guangdong province, China. Sequence alignment and phylogenetic analyses based on the full-length hemagglutinin (H) and fusion (F) genes showed that they were closely identical to genotype Asia-1. Prior to confirmation of CDV in Siberian tigers, to control spread of the disease, a live attenuated combination CDV vaccine was used among almost all carnivore animals except for red pandas in which another recombinant combination CDV vaccine was used. However, about two months later, CDV re-emerged and caused the death among red pandas. Based on the vaccination records, the live combination vaccine could be considered an ideal weapon against CDV in zoo carnivore animals. Although the recombinant combination CDV vaccine was safe for red pandas, its protection effectiveness remains to be further investigated. Moreover, according to the outbreak interval time and sequence characterization, we suspected that stray cats circulating in the zoo were the intermediate host, which contributed to CDV spread from stray dogs to zoo animals. This study revealed the importance of vaccination and biosecurity for zoo animals.

  16. Temporal-spatial segregation among hummingbirds foraging on honeydew in a temperate forest in Mexico

    Directory of Open Access Journals (Sweden)



    Full Text Available Spatial and temporal variation in interactions between hummingbirds and plants have often been examined, and hummingbirds and insects are known to indirectly interact in networks of nectar plants. In a highland temperate forest in Hidalgo, Mexico some oak trees were heavily infested by honeydew-producing insects (family Margarodidae, tribe Xylococcini, genus Strigmacoccus and the honeydew was consumed by hummingbirds. Here using survival analysis we investigate how the honeydew produced by dense populations of these margarodids is temporally and spatially partitioned by hummingbirds. We also measured the availability and quality of honeydew exudates, and then we recorded the time until a bird visited and used such resources. Four hummingbird species consumed this resource (Atthis eloisa, Hylocharis leucotis, Colibri thalassinus and Eugenes fulgens. Data from 294 hours of observation on seven focal trees suggested temporal and spatial segregation among visiting birds according to body size and territorial behavior during the most honeydew-limited time. Hummingbird species differed in the daily times they foraged, as well as in the location where honeydew-producing insects were visited on the trees. Temporal and spatial segregation among hummingbird species is interpreted as an adaptation to reduce the risk of aggressive encounters. This may facilitate multispecies coexistence and allow these birds to exploit honeydew more effectively [Current Zoology 57 (1: 56–62, 2011].

  17. Hovering in the heat: effects of environmental temperature on heat regulation in foraging hummingbirds. (United States)

    Powers, Donald R; Langland, Kathleen M; Wethington, Susan M; Powers, Sean D; Graham, Catherine H; Tobalske, Bret W


    At high temperature (greater than 40°C) endotherms experience reduced passive heat dissipation (radiation, conduction and convection) and increased reliance on evaporative heat loss. High temperatures challenge flying birds due to heat produced by wing muscles. Hummingbirds depend on flight for foraging, yet inhabit hot regions. We used infrared thermography to explore how lower passive heat dissipation during flight impacts body-heat management in broad-billed ( Cynanthus latirostris , 3.0 g), black-chinned ( Archilochus alexandri , 3.0 g), Rivoli's ( Eugenes fulgens , 7.5 g) and blue-throated ( Lampornis clemenciae , 8.0 g) hummingbirds in southeastern Arizona and calliope hummingbirds ( Selasphorus calliope , 2.6 g) in Montana. Thermal gradients driving passive heat dissipation through eye, shoulder and feet dissipation areas are eliminated between 36 and 40°C. Thermal gradients persisted at higher temperatures in smaller species, possibly allowing them to inhabit warmer sites. All species experienced extended daytime periods lacking thermal gradients. Broad-billed hummingbirds lacking thermal gradients regulated the mean total-body surface temperature at approximately 38°C, suggesting behavioural thermoregulation. Blue-throated hummingbirds were inactive when lacking passive heat dissipation and hence might have the lowest temperature tolerance of the four species. Use of thermal refugia permitted hummingbirds to tolerate higher temperatures, but climate change could eliminate refugia, forcing distributional shifts in hummingbird populations.

  18. Three-dimensional computer simulations of feeding behaviour in red and giant pandas relate skull biomechanics with dietary niche partitioning. (United States)

    Figueirido, Borja; Tseng, Zhijie Jack; Serrano-Alarcón, Francisco J; Martín-Serra, Alberto; Pastor, Juan F


    The red (Ailurus fulgens) and giant (Ailuropoda melanoleuca) pandas are mammalian carnivores convergently adapted to a bamboo feeding diet. However, whereas Ailurus forages almost entirely on younger leaves, fruits and tender trunks, Ailuropoda relies more on trunks and stems. Such difference in foraging mode is considered a strategy for resource partitioning where they are sympatric. Here, we use finite-element analysis to test for mechanical differences and similarities in skull performance between Ailurus and Ailuropoda related to diet. Feeding simulations suggest that the two panda species have similar ranges of mechanical efficiency and strain energy profiles across the dentition, reflecting their durophagous diet. However, the stress distributions and peaks in the skulls of Ailurus and Ailuropoda are remarkably different for biting at all tooth locations. Although the skull of Ailuropoda is capable of resisting higher stresses than the skull of Ailurus, the latter is able to distribute stresses more evenly throughout the skull. These differences in skull biomechanics reflect their distinct bamboo feeding preferences. Ailurus uses repetitive chewing in an extended mastication to feed on soft leaves, and Ailuropoda exhibits shorter and more discrete periods of chomp-and-swallow feeding to break down hard bamboo trunks.

  19. Comparative genomics reveals convergent evolution between the bamboo-eating giant and red pandas. (United States)

    Hu, Yibo; Wu, Qi; Ma, Shuai; Ma, Tianxiao; Shan, Lei; Wang, Xiao; Nie, Yonggang; Ning, Zemin; Yan, Li; Xiu, Yunfang; Wei, Fuwen


    Phenotypic convergence between distantly related taxa often mirrors adaptation to similar selective pressures and may be driven by genetic convergence. The giant panda (Ailuropoda melanoleuca) and red panda (Ailurus fulgens) belong to different families in the order Carnivora, but both have evolved a specialized bamboo diet and adaptive pseudothumb, representing a classic model of convergent evolution. However, the genetic bases of these morphological and physiological convergences remain unknown. Through de novo sequencing the red panda genome and improving the giant panda genome assembly with added data, we identified genomic signatures of convergent evolution. Limb development genes DYNC2H1 and PCNT have undergone adaptive convergence and may be important candidate genes for pseudothumb development. As evolutionary responses to a bamboo diet, adaptive convergence has occurred in genes involved in the digestion and utilization of bamboo nutrients such as essential amino acids, fatty acids, and vitamins. Similarly, the umami taste receptor gene TAS1R1 has been pseudogenized in both pandas. These findings offer insights into genetic convergence mechanisms underlying phenotypic convergence and adaptation to a specialized bamboo diet.

  20. Comparing chemolithoautotrophic subseafloor communities across geochemical gradients using meta-omics and RNA-SIP (United States)

    Fortunato, C. S.; Huber, J. A.


    The chemolithoautotrophic microbial community of the rocky subseafloor potentially provides a large amount of organic carbon to the deep ocean, yet our understanding of the activity and metabolic complexity of subseafloor organisms remains poorly described. Past studies have shown that the taxonomic structure of subseafloor communities differs based on the geochemical signatures of individual vents. In this study, we expanded beyond phylogeny and used a combination of metagenomic, metatranscriptomic, and RNA-based stable isotope probing (RNA-SIP) analyses to identify the metabolic potential, expression patterns, and the active autotrophic players and genomic pathways present in venting fluids from Axial Seamount, an active submarine volcano off the coast of Oregon, USA. Low-temperature diffuse vent fluids from three hydrothermal vents, Marker 113, Marker 33, and Anemone, were filtered and preserved on the seafloor for metagenome and metatranscriptome analyses. Fluid for RNA-SIP was also collected and incubated shipboard with 13C-labeled sodium bicarbonate at 30ºC, 55ºC, and 80ºC for each vent. Taxonomically, Epsilonproteobacteria comprised a significant proportion of the community at all three vents, but each vent also had distinct groups that were abundant including SUP05 at Anemone and Methanococcus at Marker 113. Functionally, vents shared many metabolic processes including genes for denitrification, sulfur reduction and sulfur, hydrogen, and ammonium oxidation, which were present and expressed in similar abundance across all three vents. One metabolic difference between vents was the presence and expression of genes for methanogenesis, which were highly abundant and expressed at Marker 113, in lower abundance and expression at Marker 33, and not present at Anemone. RNA-SIP analysis is ongoing but initial results from Marker 113 revealed that at mesophilic, thermophilic, or hyperthemophilic temperatures, different genera and autotrophic metabolisms dominated

  1. Interactions between benthic predators and zooplanktonic prey are affected by turbulent waves. (United States)

    Robinson, H E; Finelli, C M; Koehl, M A R


    Predators capture prey in complex and variable environments. In the ocean, bottom-dwelling (benthic) organisms are subjected to water currents, waves, and turbulent eddies. For benthic predators that feed on small animals carried in the water (zooplankton), flow not only delivers prey, but can also shape predator-prey interactions. Benthic passive suspension feeders collect prey delivered by movement of ambient water onto capture-surfaces, whereas motile benthic predators, such as burrow-dwelling fish, dart out to catch passing zooplankton. How does the flow of ambient water affect these contrasting modes of predation by benthic zooplanktivores? We studied the effects of turbulent, wavy flow on the encounter, capture, and retention of motile zooplanktonic prey (copepods, Acartia spp.) by passive benthic suspension feeders (sea anemones, Anthopleura elegantissima). Predator-prey interactions were video-recorded in a wave-generating flume under two regimes of oscillating flow with different peak wave velocities and levels of turbulent kinetic energy ("weak" and "strong" waves). Rates of encounter (number of prey passing through a sea anemone's capture zone per time), capture (prey contacting and sticking to tentacles per time), and retention (prey retained on tentacles, without struggling free or washing off, per time) were measured at both strengths of waves. Strong waves enhanced encounter rates both for dead copepods and for actively swimming copepods, but there was so much variability in the behavior of the live prey that the effect of wave strength on encounter rates was not significant. Trapping efficiency (number of prey retained per number encountered) was the same in both flow regimes because, although fewer prey executed maneuvers to escape capture in strong waves, more of the captured prey was washed off the predators' tentacles. Although peak water velocities and turbulence of waves did not affect feeding rates of passive suspension-feeding sea anemones

  2. Isolation of a substance activating foot formation in hydra

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Schaller, H C


    -forming potential of the tissue (2) It does not accelerate head regeneration, nor do the head factors of hydra discovered by Schaller (1973) and Berking (1977) accelerate foot regeneration. We propose that the foot-activating substance is a morphogen responsible for foot formation in hydra. The foot activator can...... be extracted from hydra tissue with methanol and separated from other known morphogens of hydra by gel filtration and ion-exchange chromatography. A substance with similar biological and physicochemical properties can be isolated from sea anemones.......We have developed an assay for a substance from hydra that accelerates foot regeneration in the animal. This substance is specific for the foot as evidenced by the following findings: (1) It is present in the animal as a steep gradient descending from foot to head, paralleling the foot...

  3. Mechanisms for eco-immunity in a changing enviroment: how does the coral innate immune system contend with climate change? (United States)

    Traylor-Knowles, N. G.


    Innate immunity plays a central role in maintaining homeostasis, and within the context of impending climate change scenarios, understanding how this system works is critical. However, the actual mechanisms involved in the evolution of the innate immune system are largely unknown. Cnidaria (including corals, sea anemones and jellyfish) are well suited for studying the fundamental functions of innate immunity because they share a common ancestor with bilaterians. This study will highlight the transcriptomic changes during a heat shock in the coral Acropora hyacinthus of American Samoa, examining the temporal changes, every half an hour for 5 hours. We hypothesize that genes involved in innate immunity, and extracellular matrix maintenance will be key components to the heat stress response. This presentation will highlight the novel role of the tumor necrosis factor receptor gene family as a responder to heat stress and present future directions for this developing field in coral reef research.

  4. [Steroidal alkaloid batrachotoxin--instrument for studying voltage-regulated sodium channels]. (United States)

    Khodorov, B I


    Results of recent studies on the batrachotoxin (BTX) effect on the properties of voltage-operated sodium channels in excitable membranes are summarized in the review. The following problems are considered: allosteric interaction of the BTX receptor with structural entities of the sodium channel responsible for its activation, inactivation, ion selectivity, binding of polypeptide (scorpion and anemone) toxins, local anesthetics and many blocking drugs; relationship between BTX-induced changes in the sodium conductance and intramembrane charge movement; relationship between ion selectivity and effective pK of the selectivity filter acid group of sodium channels modified by BTX or aconitine; effects of BTX on the behaviour and conductance (gamma) of single sodium channels. The problem of the BTX receptor location and possible mechanism of the sodium channel modification by BTX are discussed.

  5. A trophic model of fringing coral reefs in Nanwan Bay, southern Taiwan suggests overfishing. (United States)

    Liu, Pi-Jen; Shao, Kwang-Tsao; Jan, Rong-Quen; Fan, Tung-Yung; Wong, Saou-Lien; Hwang, Jiang-Shiou; Chen, Jen-Ping; Chen, Chung-Chi; Lin, Hsing-Juh


    Several coral reefs of Nanwan Bay, Taiwan have recently undergone shifts to macroalgal or sea anemone dominance. Thus, a mass-balance trophic model was constructed to analyze the structure and functioning of the food web. The fringing reef model was comprised of 18 compartments, with the highest trophic level of 3.45 for piscivorous fish. Comparative analyses with other reef models demonstrated that Nanwan Bay was similar to reefs with high fishery catches. While coral biomass was not lower, fish biomass was lower than those of reefs with high catches. Consequently, the sums of consumption and respiratory flows and total system throughput were also decreased. The Nanwan Bay model potentially suggests an overfished status in which the mean trophic level of the catch, matter cycling, and trophic transfer efficiency are extremely reduced.

  6. Peptides in the nervous systems of cnidarians: structure, function, and biosynthesis

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Leviev, I; Carstensen, Kathrine


    Cnidarians are the lowest animal group having a nervous system and it was probably within this phylum or in a related ancestor group that nervous systems first evolved. The primitive nervous systems of cnidarians are strongly peptidergic. From a single sea anemone species, Anthopleura elegantissima...... molecule. In addition to well-known, "classical" processing enzymes, novel prohormone processing enzymes must be present in cnidarian neurons. These include a processing enzyme hydrolyzing at the C-terminal sides of acidic (Asp and Glu) residues and a dipeptidyl aminopeptidase digesting at the C......-terminal sides of N-terminally located X-Pro and X-Ala sequences. All this shows that the primitive nervous systems of cnidarians are already quite complex, and that neuropeptides play a central role in the physiology of these animals....

  7. First molecular identification of the transgene red fluorescent protein (RFP in transgenic ornamental zebrafish (Danio rerio introduced in Peru

    Directory of Open Access Journals (Sweden)

    Carlos Scotto


    Full Text Available In this paper the transgenic fluorescent red, orange and pink zebra fish (Danio rerio, found in local aquariums in Peru, were identified using the PCR technique to amplify the transgene RFP sea anemone belonging to Discosoma spp. The gene expression of the red fluorescent protein (RFP transgene was found to determine different gradients-of-bioluminescence (shades in color in each GMO fish analyzed. We performed sequence analysis of the two variants of the RFP along with six variants of the existing fluorescent protein GFP from the Genbank, this could help identify quickly if they are new genes or variants thereof as these novel fluorescent proteins may be introduced in aquatic GMO in the future. Thus, developing and improving biosecurity measures through its timely detection at the molecular genetic level.

  8. Marine Organisms with Anti-Diabetes Properties

    Directory of Open Access Journals (Sweden)

    Chiara Lauritano


    Full Text Available Diabetes is a chronic degenerative metabolic disease with high morbidity and mortality rates caused by its complications. In recent years, there has been a growing interest in looking for new bioactive compounds to treat this disease, including metabolites of marine origin. Several aquatic organisms have been screened to evaluate their possible anti-diabetes activities, such as bacteria, microalgae, macroalgae, seagrasses, sponges, corals, sea anemones, fish, salmon skin, a shark fusion protein as well as fish and shellfish wastes. Both in vitro and in vivo screenings have been used to test anti-hyperglycemic and anti-diabetic activities of marine organisms. This review summarizes recent discoveries in anti-diabetes properties of several marine organisms as well as marine wastes, existing patents and possible future research directions in this field.

  9. A deep sea community at the Kebrit brine pool in the Red Sea

    KAUST Repository

    Vestheim, Hege


    Approximately 25 deep sea brine pools occur along the mid axis of the Red Sea. These hypersaline, anoxic, and acidic environments have previously been reported to host diverse microbial communities. We visited the Kebrit brine pool in April 2013 and found macrofauna present just above the brine–seawater interface (~1465 m). In particular, inactive sulfur chimneys had associated epifauna of sea anemones, sabellid type polychaetes, and hydroids, and infauna consisting of capitellid polychaetes, gastropods of the genus Laeviphitus (fam. Elachisinidae), and top snails of the family Cocculinidae. The deep Red Sea generally is regarded as extremely poor in benthos. We hypothesize that the periphery along the Kebrit holds increased biomass and biodiversity that are sustained by prokaryotes associated with the brine pool or co-occurring seeps.

  10. DNA methylation regulates transcriptional homeostasis of algal endosymbiosis in the coral model Aiptasia

    KAUST Repository

    Li, Yong


    The symbiotic relationship between cnidarians and dinoflagellates is the cornerstone of coral reef ecosystems. Although research is focusing on the molecular mechanisms underlying this symbiosis, the role of epigenetic mechanisms, which have been implicated in transcriptional regulation and acclimation to environmental change, is unknown. To assess the role of DNA methylation in the cnidarian-dinoflagellate symbiosis, we analyzed genome-wide CpG methylation, histone associations, and transcriptomic states of symbiotic and aposymbiotic anemones in the model system Aiptasia. We find methylated genes are marked by histone H3K36me3 and show significant reduction of spurious transcription and transcriptional noise, revealing a role of DNA methylation in the maintenance of transcriptional homeostasis. Changes in DNA methylation and expression show enrichment for symbiosis-related processes such as immunity, apoptosis, phagocytosis recognition and phagosome formation, and unveil intricate interactions between the underlying pathways. Our results demonstrate that DNA methylation provides an epigenetic mechanism of transcriptional homeostasis during symbiosis.

  11. A new species of Halcampella (Actiniaria, Halcampoididae from the eastern Weddell Sea and Antarctic Peninsula

    Directory of Open Access Journals (Sweden)

    Estefanía Rodríguez


    Full Text Available A new species of soft-bottom-dwelling sea anemone of the genus Halcampella is described and illustrated based on 47 specimens collected during the Polarstern cruises ANT XV/3 and ANT XVII/3 to the Antarctic Peninsula and the eastern Weddell Sea. The new Halcampella species is easily distinguishable from its congeners by the number of cycles of mesenteries and tentacles, the cnidae and the geographic distribution. The new species is described and compared to the available type material of the other species of the genus and new cnidae data are given for H. maxima Hertwig, 1888 and H. robusta Carlgren, 1931. According to other authors H. endromitata (Andres, 1881 is considered a nomen dubium and H. maxima is here proposed as the types species of the genus.

  12. The alkaloid Ageladine A, originally isolated from marine sponges, used for pH-sensitive imaging of transparent marine animals. (United States)

    Bickmeyer, Ulf


    The brominated pyrrole-imidazole Ageladine A was used for live imaging of the jellyfish (jellies) Nausithoe werneri, the sea anemone Metridium senile and the flatworm Macrostomum lignano. The fluorescence properties of Ageladine A allow for estimation of pH values in tissue and organs in living animals. The results showed that Nausithoe werneri had the most acidic areas in the tentacles and close to the mouth (pH 4-6.5), Metridium senile harbours aggregates of high acidity in the tentacles (pH 5) and in Macrostomum lignano, the rhabdoids, the gonads and areas close to the mouth were the most acidic with values down to pH 5.

  13. The Alkaloid Ageladine A, Originally Isolated from Marine Sponges, Used for pH-Sensitive Imaging of Transparent Marine Animals

    Directory of Open Access Journals (Sweden)

    Ulf Bickmeyer


    Full Text Available The brominated pyrrole-imidazole Ageladine A was used for live imaging of the jellyfish (jellies Nausithoe werneri, the sea anemone Metridium senile and the flatworm Macrostomum lignano. The fluorescence properties of Ageladine A allow for estimation of pH values in tissue and organs in living animals. The results showed that Nausithoe werneri had the most acidic areas in the tentacles and close to the mouth (pH 4–6.5, Metridium senile harbours aggregates of high acidity in the tentacles (pH 5 and in Macrostomum lignano, the rhabdoids, the gonads and areas close to the mouth were the most acidic with values down to pH 5.

  14. The nervous systems of cnidarians

    DEFF Research Database (Denmark)

    Grimmelikhuijzen, C J; Westfall, J A


    Cnidarians have simple nervous systems and it was probably within this group or a closely-related ancestor that nervous systems first evolved. The basic plan of the cnidarian nervous system is that of a nerve net which, at some locations, has condensed to form nerve plexuses, or circular...... specialized neurons that we find in higher animals today. The primitive nervous system of cnidarians is strongly peptidergic: from a single sea anemone species Anthopleura elegantissima, we have now isolated 16 different novel neuropeptides. These peptides are biologically active and cause inhibitions...... that the peptides are located in neuronal dense-cored vesicles associated with both synaptic and non-synaptic release sites. All these data indicate that evolutionarily "old" nervous systems use peptides as transmitters. We have also investigated the biosynthesis of the cnidarian neuropeptides. These neuropeptides...

  15. Identification and gene expression analysis of a taxonomically restricted cysteine-rich protein family in reef-building corals.

    Directory of Open Access Journals (Sweden)

    Shinichi Sunagawa

    Full Text Available The amount of genomic sequence information continues to grow at an exponential rate, while the identification and characterization of genes without known homologs remains a major challenge. For non-model organisms with limited resources for manipulative studies, high-throughput transcriptomic data combined with bioinformatics methods provide a powerful approach to obtain initial insights into the function of unknown genes. In this study, we report the identification and characterization of a novel family of putatively secreted, small, cysteine-rich proteins herein named Small Cysteine-Rich Proteins (SCRiPs. Their discovery in expressed sequence tag (EST libraries from the coral Montastraea faveolata required the performance of an iterative search strategy based on BLAST and Hidden-Markov-Model algorithms. While a discernible homolog could neither be identified in the genome of the sea anemone Nematostella vectensis, nor in a large EST dataset from the symbiotic sea anemone Aiptasia pallida, we identified SCRiP sequences in multiple scleractinian coral species. Therefore, we postulate that this gene family is an example of lineage-specific gene expansion in reef-building corals. Previously published gene expression microarray data suggest that a sub-group of SCRiPs is highly responsive to thermal stress. Furthermore, data from microarray experiments investigating developmental gene expression in the coral Acropora millepora suggest that different SCRiPs may play distinct roles in the development of corals. The function of these proteins remains to be elucidated, but our results from in silico, transcriptomic, and phylogenetic analyses provide initial insights into the evolution of SCRiPs, a novel, taxonomically restricted gene family that may be responsible for a lineage-specific trait in scleractinian corals.

  16. Life history and feeding biology of the deep-sea pycnogonid Nymphon hirtipes (United States)

    Mercier, Annie; Baillon, Sandrine; Hamel, Jean-François


    Pycnogonids (sea spiders) are commonly collected at bathyal and abyssal depths all around the world; however, little is known about species from deep-water habitats. The present study explores the life history of Nymphon hirtipes collected in northeastern Newfoundland between 700 and 1450 m depth and monitored in mesocosms for over 2 years. The pycnogonids were found in association with octocorals, hydrozoans and sea anemones. Adult females developed mature oocytes between June and August. Paired mating followed by oviposition occurred between early July and mid-October. Up to three egg masses were brooded by each male. It took a maximum of 4 months for the propagules to hatch from the egg mass. Offspring developed from walking leg-bearing larvae to early juveniles over the next ~5 months before leaving the male's protection. Mating and oviposition coincided with the highest water temperatures of the annual cycle and dispersal of juveniles occurred in spring, when phytodetritus deposition was high and as ocean temperature rose markedly. All the females died after oviposition and the males ~9 months later, after juvenile dispersal. The sex ratio of mature individuals (~55-60 mm leg span) was 2 males for 3 females. Fecundity was estimated to be 184-288 eggs per adult female. Adults of N. hirtipes were seen feeding on hydrozoan polyps, small sea anemones (Stephanauge nexilis) and nudibranchs. Larvae and early juveniles did not feed while brooded by the male. Upon dispersal, their feeding apparatus became functional and they began feeding on hydrozoan polyps. After 13 months of growth post hatching, the juveniles reached ~21 mm leg span. Curve fitting estimated that ~7 years are required to reach the adult size of 55 mm leg span.

  17. Glucose-Induced Trophic Shift in an Endosymbiont Dinoflagellate with Physiological and Molecular Consequences. (United States)

    Xiang, Tingting; Jinkerson, Robert E; Clowez, Sophie; Tran, Cawa; Krediet, Cory J; Onishi, Masayuki; Cleves, Phillip A; Pringle, John R; Grossman, Arthur R


    Interactions between the dinoflagellate endosymbiont Symbiodinium and its cnidarian hosts (e.g. corals, sea anemones) are the foundation of coral-reef ecosystems. Carbon flow between the partners is a hallmark of this mutualism, but the mechanisms governing this flow and its impact on symbiosis remain poorly understood. We showed previously that although Symbiodinium strain SSB01 can grow photoautotrophically, it can grow mixotrophically or heterotrophically when supplied with Glc, a metabolite normally transferred from the alga to its host. Here we show that Glc supplementation of SSB01 cultures causes a loss of pigmentation and photosynthetic activity, disorganization of thylakoid membranes, accumulation of lipid bodies, and alterations of cell-surface morphology. We used global transcriptome analyses to determine if these physiological changes were correlated with changes in gene expression. Glc-supplemented cells exhibited a marked reduction in levels of plastid transcripts encoding photosynthetic proteins, although most nuclear-encoded transcripts (including those for proteins involved in lipid synthesis and formation of the extracellular matrix) exhibited little change in their abundances. However, the altered carbon metabolism in Glc-supplemented cells was correlated with modest alterations (approximately 2x) in the levels of some nuclear-encoded transcripts for sugar transporters. Finally, Glc-bleached SSB01 cells appeared unable to efficiently populate anemone larvae. Together, these results suggest links between energy metabolism and cellular physiology, morphology, and symbiotic interactions. However, the results also show that in contrast to many other organisms, Symbiodinium can undergo dramatic physiological changes that are not reflected by major changes in the abundances of nuclear-encoded transcripts and thus presumably reflect posttranscriptional regulatory processes. © 2018 American Society of Plant Biologists. All Rights Reserved.

  18. Accumulation of HMX (octahydro-1,3,5,7-tetranitro-1,3,5,7-tetrazocine) in indigenous and agricultural plants grown in HMX-contaminated anti-tank firing-range soil. (United States)

    Groom, Carl A; Halasz, Annamaria; Paquet, Louise; Morris, Neil; Olivier, Lucie; Dubois, Charles; Hawari, Jalal


    To investigate their potential for phytoremediation, selected agricultural and indigenous terrestrial plants were examined fortheir capacity to accumulate and degrade the explosive octahydro-1 ,3,5,7-tetra nitro-1,3,5,7-tetrazocine (HMX). Plant tissue and soil extracts were analyzed for the presence of HMX and possible degradative metabolites using high-performance liquid chromatography with diode-array UV detection (HPLC-UV), micellar electrokinetic chromatography with diode-array UV detection (MEKC-UV), and HPLC with electrospray ionization mass spectrometry (LC-MS). The pattern of HMX accumulation for alfalfa (Medicago sativa), bush bean (Phaseolus vulgaris), canola (Brassica rapa), wheat (Triticum aestivum), and perennial ryegrass (Loliumperenne) grown in a controlled environment on contaminated soil from an anti-tank firing range was similar to that observed for plants (wild bergamot (Monarda fistulosa), western wheat grass (Agropyron smithii), brome grass (Bromus sitchensis), koeleria (Koeleria gracilis), goldenrod (Solidago sp.), blueberry (Vaccinium sp.), anemone (Anemone sp.), common thistle (Circium vulgare), wax-berry (Symphoricarpos albus), western sage (Artemisia gnaphalodes), and Drummond's milk vetch (Astragalus drummondii)) collected from the range. No direct evidence of plant-mediated HMX (bio)chemical transformation was provided by the available analytical methods. Traces of mononitroso-HMX were found in contaminated soil extracts and were also observed in leaf extracts. The dominant mechanism for HMX translocation and accumulation in foliar tissue was concluded to be aqueous transpirational flux and evaporation. The accumulation of HMX in the leaves of most of the selected species to levels significantly above soil concentration is relevant to the assessment of both phytoremediation potential and environmental risks.

  19. Functional characterization of sticholysin I and W111C mutant reveals the sequence of the actinoporin's pore assembly.

    Directory of Open Access Journals (Sweden)

    Valeria Antonini

    Full Text Available The use of pore-forming toxins in the construction of immunotoxins against tumour cells is an alternative for cancer therapy. In this protein family one of the most potent toxins are the actinoporins, cytolysins from sea anemones. We work on the construction of tumour proteinase-activated immunotoxins using sticholysin I (StI, an actinoporin isolated from the sea anemone Stichodactyla helianthus. To accomplish this objective, recombinant StI (StIr with a mutation in the membrane binding region has been employed. In this work, it was evaluated the impact of mutating tryptophan 111 to cysteine on the toxin pore forming capability. StI W111C is still able to permeabilize erythrocytes and liposomes, but at ten-fold higher concentration than StI. This is due to its lower affinity for the membrane, which corroborates the importance of residue 111 for the binding of actinoporins to the lipid bilayer. In agreement, other functional characteristics not directly associated to the binding, are essentially the same for both variants, that is, pores have oligomeric structures with similar radii, conductance, cation-selectivity, and instantaneous current-voltage behavior. In addition, this work provides experimental evidence sustaining the toroidal protein-lipid actinoporins lytic structures, since the toxins provoke the trans-bilayer movement (flip-flop of a pyrene-labeled analogue of phosphatidylcholine in liposomes, indicating the existence of continuity between the outer and the inner membrane leaflet. Finally, our planar lipid membranes results have also contributed to a better understanding of the actinoporin's pore assembly mechanism. After the toxin binding and the N-terminal insertion in the lipid membrane, the pore assembly occurs by passing through different transient sub-conductance states. These states, usually 3 or 4, are due to the successive incorporation of N-terminal α-helices and lipid heads to the growing pores until a stable toroidal

  20. Ascertaining the potential effects of temperature on growth, survival and feeding of different juvenile clown fish

    Directory of Open Access Journals (Sweden)

    Vishwas Rao Methari


    Full Text Available Objective: To determine the physiological and ecological responses of marine ornamental fishes to the change of water temperature with its potential effects on the growth, survival and feeding in clown fish. Methods: Three different sea anemone fish (Premnas biaculeatus, Amphiprion clarkii, Amphiprion akallopisos were reared in confinement at water temperatures of 26, 28, 30, 32, and 34 °C using thermostat and they were maintained up to the marketable size, and growth, survival and feeding were evaluated during the experimental period. Results: The results illustrated that water temperature influenced the physiological performance of juveniles of three different sea anemone fish significantly. The growth and survival rates of juveniles of three different clown fish significantly increased with the increase of water temperature from 26 °C to 34 °C (P<0.05. Water temperature also influenced the feeding of three different clown fish significantly with feed conversion ratio increased from (0.071±0.020, (0.075±0.030 and (0.079±0.028 to (0.057±0.040, (0.047±0.030 and (0.045±0.028 for Premnas biaculeatus, Amphiprion clarkii and Amphiprion akallopisos respectively with increase of water temperature from 26 °C to 34 °C (P<0.05. Specific growth rates (P<0.05 increased significantly with increase of water temperature and positively correlated with the feed conversion ratio, indicating that growth rates are significantly increased with increase of temperature. Conclusions: This study deliberately reveals that the physiological response of juveniles of clown fish as the change of water temperature and substantiated that water temperature influenced juvenile growth, survival and feeding significantly. This study also put forward that the reduced growth, survival and feeding of juveniles at lower temperature which have ecological impacts on clown fish juveniles in settlement and population replacement in the wild.

  1. First insight into the viral community of the cnidarian model metaorganism Aiptasia using RNA-Seq data

    KAUST Repository

    Brüwer, Jan D.


    Current research posits that all multicellular organisms live in symbioses with associated microorganisms and form so-called metaorganisms or holobionts. Cnidarian metaorganisms are of specific interest given that stony corals provide the foundation of the globally threatened coral reef ecosystems. To gain first insight into viruses associated with the coral model system Aiptasia (sensu Exaiptasia pallida), we analyzed an existing RNA-Seq dataset of aposymbiotic, partially populated, and fully symbiotic Aiptasia CC7 anemones with Symbiodinium. Our approach included the selective removal of anemone host and algal endosymbiont sequences and subsequent microbial sequence annotation. Of a total of 297 million raw sequence reads, 8.6 million (∼3%) remained after host and endosymbiont sequence removal. Of these, 3,293 sequences could be assigned as of viral origin. Taxonomic annotation of these sequences suggests that Aiptasia is associated with a diverse viral community, comprising 116 viral taxa covering 40 families. The viral assemblage was dominated by viruses from the families Herpesviridae (12.00%), Partitiviridae (9.93%), and Picornaviridae (9.87%). Despite an overall stable viral assemblage, we found that some viral taxa exhibited significant changes in their relative abundance when Aiptasia engaged in a symbiotic relationship with Symbiodinium. Elucidation of viral taxa consistently present across all conditions revealed a core virome of 15 viral taxa from 11 viral families, encompassing many viruses previously reported as members of coral viromes. Despite the non-random selection of viral genetic material due to the nature of the sequencing data analyzed, our study provides a first insight into the viral community associated with Aiptasia. Similarities of the Aiptasia viral community with those of corals corroborate the application of Aiptasia as a model system to study coral holobionts. Further, the change in abundance of certain viral taxa across different

  2. A vertical wall dominated by Acesta excavata and Neopycnodonte zibrowii, part of an undersampled group of deep-sea habitats.

    Directory of Open Access Journals (Sweden)

    Mark P Johnson

    Full Text Available We describe a novel biotope at 633 to 762 m depth on a vertical wall in the Whittard Canyon, an extensive canyon system reaching from the shelf to the deep sea on Ireland's continental margin. We explored this wall with an ROV and compiled a photomosaic of the habitat. The assemblage contributing to the biotope was dominated by large limid bivalves, Acesta excavata (mean shell height 10.4 cm, and deep-sea oysters, Neopycnodonte zibrowii, at high densities, particularly at overhangs. Mean density of N. zibrowii increased with depth, with densities of the most closely packed areas of A. excavata also increasing with depth. Other taxa associated with the assemblage included the solitary coral Desmophyllum dianthus, cerianthid anemones, comatulid crinoids, the trochid gastropod Margarites sp., the portunid crab Bathynectes longispina and small fish of the family Bythitidae. The scleractinian coral Madrepora oculata, the pencil urchin Cidaris cidaris and a species of Epizoanthus were also common. Prominent but less abundant species included the flytrap anemone Actinoscyphia saginata, the carrier crab Paramola cuvieri, and the fishes Lepidion eques and Conger conger. Observations of the hydrography of the canyon system identified that the upper 500 m was dominated by Eastern North Atlantic Water, with Mediterranean Outflow Water beneath it. The permanent thermocline is found between 600 and 1000 m depth, i.e., in the depth range of the vertical wall and the dense assemblage of filter feeders. Beam attenuation indicated nepheloid layers present in the canyon system with the greatest amounts of suspended material at the ROV dive site between 500 and 750 m. A cross-canyon CTD transect indicated the presence of internal waves between these depths. We hypothesise that internal waves concentrate suspended sediment at high concentrations at the foot of the vertical wall, possibly explaining the large size and high density of filter-feeding molluscs.

  3. Raddeanin A induces human gastric cancer cells apoptosis and inhibits their invasion in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Xue, Gang [Department of Oncology, Nanjing University of Chinese Medicine, Nanjing (China); Zou, Xi [Department of Oncology, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China); Zhou, Jin-Yong [Laboratory Center, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China); Sun, Wei [Department of Oncology, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China); Wu, Jian [Laboratory Center, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China); Xu, Jia-Li [Department of Oncology, Nanjing University of Chinese Medicine, Nanjing (China); Wang, Rui-Ping, E-mail: [Department of Oncology, Affiliated Hospital of Nanjing University of Chinese Medicine, Jiangsu Province Hospital of Traditional Chinese Medicine, Nanjing (China)


    Highlights: •Raddeanin A is a triterpenoid saponin in herb medicine Anemone raddeana Regel. •Raddeanin A can inhibit 3 kinds of gastric cancer cells’ proliferation and invasion. •Caspase-cascades’ activation indicates apoptosis induced by Raddeanin A. •MMPs, RECK, Rhoc and E-cad are involved in Raddeanin A-induced invasion inhibition. -- Abstract: Raddeanin A is one of the triterpenoid saponins in herbal medicine Anemone raddeana Regel which was reported to suppress the growth of liver and lung cancer cells. However, little was known about its effect on gastric cancer (GC) cells. This study aimed to investigate its inhibitory effect on three kinds of different differentiation stage GC cells (BGC-823, SGC-7901 and MKN-28) in vitro and the possible mechanisms. Proliferation assay and flow cytometry demonstrated Raddeanin A’s dose-dependent inhibitory effect and determined its induction of cells apoptosis, respectively. Transwell assay, wounding heal assay and cell matrix adhesion assay showed that Raddeanin A significantly inhibited the abilities of the invasion, migration and adhesion of the BGC-823 cells. Moreover, quantitative real time PCR and Western blot analysis found that Raddeanin A increased Bax expression while reduced Bcl-2, Bcl-xL and Survivin expressions and significantly activated caspase-3, caspase-8, caspase-9 and poly-ADP ribose polymerase (PARP). Besides, Raddeanin A could also up-regulate the expression of reversion inducing cysteine rich protein with Kazal motifs (RECK), E-cadherin (E-cad) and down-regulate the expression of matrix metalloproteinases-2 (MMP-2), MMP-9, MMP-14 and Rhoc. In conclusion, Raddeanin A inhibits proliferation of human GC cells, induces their apoptosis and inhibits the abilities of invasion, migration and adhesion, exhibiting potential to become antitumor drug.

  4. Transdermal delivery of scopolamine by natural submicron injectors: in-vivo study in pig.

    Directory of Open Access Journals (Sweden)

    Esther Shaoul

    Full Text Available Transdermal drug delivery has made a notable contribution to medical practice, but has yet to fully achieve its potential as an alternative to oral delivery and hypodermic injections. While transdermal delivery systems would appear to provide an attractive solution for local and systemic drug delivery, only a limited number of drugs can be delivered through the outer layer of the skin. The most difficult to deliver in this way are hydrophilic drugs. The aquatic phylum Cnidaria, which includes sea anemones, corals, jellyfish and hydra, is one of the most ancient multicellular phyla that possess stinging cells containing organelles (cnidocysts, comprising a sophisticated injection system. The apparatus is folded within collagenous microcapsules and upon activation injects a thin tubule that immediately penetrates the prey and delivers its contents. Here we show that this natural microscopic injection system can be adapted for systemic transdermal drug delivery once it is isolated from the cells and uploaded with the drug. Using a topically applied gel containing isolated natural sea anemone injectors and the muscarinic receptor antagonist scopolamine, we found that the formulated injectors could penetrate porcine skin and immediately deliver this hydrophilic drug. An in-vivo study in pigs demonstrated, for the first time, rapid systemic delivery of scopolamine, with T(max of 30 minutes and C(max 5 times higher than in controls treated topically with a scopolamine-containing gel without cnidocysts. The ability of the formulated natural injection system to penetrate a barrier as thick as the skin and systemically deliver an exogenous compound presents an intriguing and attractive alternative for hydrophilic transdermal drug delivery.

  5. Adaptations to endosymbiosis in a cnidarian-dinoflagellate association: differential gene expression and specific gene duplications. (United States)

    Ganot, Philippe; Moya, Aurélie; Magnone, Virginie; Allemand, Denis; Furla, Paola; Sabourault, Cécile


    Trophic endosymbiosis between anthozoans and photosynthetic dinoflagellates forms the key foundation of reef ecosystems. Dysfunction and collapse of symbiosis lead to bleaching (symbiont expulsion), which is responsible for the severe worldwide decline of coral reefs. Molecular signals are central to the stability of this partnership and are therefore closely related to coral health. To decipher inter-partner signaling, we developed genomic resources (cDNA library and microarrays) from the symbiotic sea anemone Anemonia viridis. Here we describe differential expression between symbiotic (also called zooxanthellate anemones) or aposymbiotic (also called bleached) A. viridis specimens, using microarray hybridizations and qPCR experiments. We mapped, for the first time, transcript abundance separately in the epidermal cell layer and the gastrodermal cells that host photosynthetic symbionts. Transcriptomic profiles showed large inter-individual variability, indicating that aposymbiosis could be induced by different pathways. We defined a restricted subset of 39 common genes that are characteristic of the symbiotic or aposymbiotic states. We demonstrated that transcription of many genes belonging to this set is specifically enhanced in the symbiotic cells (gastroderm). A model is proposed where the aposymbiotic and therefore heterotrophic state triggers vesicular trafficking, whereas the symbiotic and therefore autotrophic state favors metabolic exchanges between host and symbiont. Several genetic pathways were investigated in more detail: i) a key vitamin K-dependant process involved in the dinoflagellate-cnidarian recognition; ii) two cnidarian tissue-specific carbonic anhydrases involved in the carbon transfer from the environment to the intracellular symbionts; iii) host collagen synthesis, mostly supported by the symbiotic tissue. Further, we identified specific gene duplications and showed that the cnidarian-specific isoform was also up-regulated both in the

  6. Adaptations to endosymbiosis in a cnidarian-dinoflagellate association: differential gene expression and specific gene duplications.

    Directory of Open Access Journals (Sweden)

    Philippe Ganot


    Full Text Available Trophic endosymbiosis between anthozoans and photosynthetic dinoflagellates forms the key foundation of reef ecosystems. Dysfunction and collapse of symbiosis lead to bleaching (symbiont expulsion, which is responsible for the severe worldwide decline of coral reefs. Molecular signals are central to the stability of this partnership and are therefore closely related to coral health. To decipher inter-partner signaling, we developed genomic resources (cDNA library and microarrays from the symbiotic sea anemone Anemonia viridis. Here we describe differential expression between symbiotic (also called zooxanthellate anemones or aposymbiotic (also called bleached A. viridis specimens, using microarray hybridizations and qPCR experiments. We mapped, for the first time, transcript abundance separately in the epidermal cell layer and the gastrodermal cells that host photosynthetic symbionts. Transcriptomic profiles showed large inter-individual variability, indicating that aposymbiosis could be induced by different pathways. We defined a restricted subset of 39 common genes that are characteristic of the symbiotic or aposymbiotic states. We demonstrated that transcription of many genes belonging to this set is specifically enhanced in the symbiotic cells (gastroderm. A model is proposed where the aposymbiotic and therefore heterotrophic state triggers vesicular trafficking, whereas the symbiotic and therefore autotrophic state favors metabolic exchanges between host and symbiont. Several genetic pathways were investigated in more detail: i a key vitamin K-dependant process involved in the dinoflagellate-cnidarian recognition; ii two cnidarian tissue-specific carbonic anhydrases involved in the carbon transfer from the environment to the intracellular symbionts; iii host collagen synthesis, mostly supported by the symbiotic tissue. Further, we identified specific gene duplications and showed that the cnidarian-specific isoform was also up-regulated both

  7. Expanded functional diversity of shaker K(+ channels in cnidarians is driven by gene expansion.

    Directory of Open Access Journals (Sweden)

    Timothy Jegla

    Full Text Available The genome of the cnidarian Nematostella vectensis (starlet sea anemone provides a molecular genetic view into the first nervous systems, which appeared in a late common ancestor of cnidarians and bilaterians. Nematostella has a surprisingly large and diverse set of neuronal signaling genes including paralogs of most neuronal signaling molecules found in higher metazoans. Several ion channel gene families are highly expanded in the sea anemone, including three subfamilies of the Shaker K(+ channel gene family: Shaker (Kv1, Shaw (Kv3 and Shal (Kv4. In order to better understand the physiological significance of these voltage-gated K(+ channel expansions, we analyzed the function of 18 members of the 20 gene Shaker subfamily in Nematostella. Six of the Nematostella Shaker genes express functional homotetrameric K(+ channels in vitro. These include functional orthologs of bilaterian Shakers and channels with an unusually high threshold for voltage activation. We identified 11 Nematostella Shaker genes with a distinct "silent" or "regulatory" phenotype; these encode subunits that function only in heteromeric channels and serve to further diversify Nematostella Shaker channel gating properties. Subunits with the regulatory phenotype have not previously been found in the Shaker subfamily, but have evolved independently in the Shab (Kv2 family in vertebrates and the Shal family in a cnidarian. Phylogenetic analysis indicates that regulatory subunits were present in ancestral cnidarians, but have continued to diversity at a high rate after the split between anthozoans and hydrozoans. Comparison of Shaker family gene complements from diverse metazoan species reveals frequent, large scale duplication has produced highly unique sets of Shaker channels in the major metazoan lineages.

  8. Species, diaspore volume and body mass matter in gastropod seed feeding behavior.

    Directory of Open Access Journals (Sweden)

    Manfred Türke

    Full Text Available BACKGROUND: Seed dispersal of ant-dispersed plants (myrmecochores is a well studied ecosystem function. Recently, slugs have been found to act as seed dispersers of myrmecochores. The aim of our study was to (1 further generalize the finding that gastropods feed on seeds of myrmecochores and hence may act as seed dispersers, (2 to test whether gastropod body mass and the volume of diaspores have an influence on the seed dispersal potential. METHODOLOGY AND PRINCIPAL FINDINGS: We assessed the seed dispersal potential of four slug and snail species with a set of seven myrmecochorous plant species from seven different plant families common to Central European beech forests. Diaspores differed in shape and size. Gastropods differed in their readiness to feed on diaspores and in the proportion of seeds that were swallowed as a whole, and this readiness generally decreased with increasing diaspore size. Smaller Arionid slugs (58 mm body length; mean mostly fed on the elaiosome but also swallowed small diaspores and therefore not only act as elaiosome consumers, a nutrient rich appendage on myrmecochorous diaspores, but may also disperse seeds. Large Arionid slugs (>100 mm body length swallowed diaspores of all sizes. Diaspores swallowed by gastropods were defecated without damage. Within-species variability in body size also affect seed dispersal potential, as larger individuals of the red slug (Arion rufus swallowed more diaspores of wood anemone (Anemone nemorosa than smaller ones. CONCLUSIONS AND SIGNIFICANCE: Our results help to generalize the finding that gastropods consume and potentially disperse seeds of myrmecochores. The dispersal potential of gastropods is strongly influenced by diaspore size in relation to gastropod size.

  9. Species, diaspore volume and body mass matter in gastropod seed feeding behavior. (United States)

    Türke, Manfred; Weisser, Wolfgang W


    Seed dispersal of ant-dispersed plants (myrmecochores) is a well studied ecosystem function. Recently, slugs have been found to act as seed dispersers of myrmecochores. The aim of our study was to (1) further generalize the finding that gastropods feed on seeds of myrmecochores and hence may act as seed dispersers, (2) to test whether gastropod body mass and the volume of diaspores have an influence on the seed dispersal potential. We assessed the seed dispersal potential of four slug and snail species with a set of seven myrmecochorous plant species from seven different plant families common to Central European beech forests. Diaspores differed in shape and size. Gastropods differed in their readiness to feed on diaspores and in the proportion of seeds that were swallowed as a whole, and this readiness generally decreased with increasing diaspore size. Smaller Arionid slugs (58 mm body length; mean) mostly fed on the elaiosome but also swallowed small diaspores and therefore not only act as elaiosome consumers, a nutrient rich appendage on myrmecochorous diaspores, but may also disperse seeds. Large Arionid slugs (>100 mm body length) swallowed diaspores of all sizes. Diaspores swallowed by gastropods were defecated without damage. Within-species variability in body size also affect seed dispersal potential, as larger individuals of the red slug (Arion rufus) swallowed more diaspores of wood anemone (Anemone nemorosa) than smaller ones. Our results help to generalize the finding that gastropods consume and potentially disperse seeds of myrmecochores. The dispersal potential of gastropods is strongly influenced by diaspore size in relation to gastropod size.

  10. Contrasting physiological plasticity in response to environmental stress within different cnidarians and their respective symbionts (United States)

    Hoadley, Kenneth D.; Pettay, Daniel. T.; Dodge, Danielle; Warner, Mark E.


    Given concerns surrounding coral bleaching and ocean acidification, there is renewed interest in characterizing the physiological differences across the multiple host-algal symbiont combinations commonly found on coral reefs. Elevated temperature and CO2 were used to compare physiological responses within the scleractinian corals Montipora hirsuta ( Symbiodinium C15) and Pocillopora damicornis ( Symbiodinium D1), as well as the corallimorph (a non-calcifying anthozoan closely related to scleractinians) Discosoma nummiforme ( Symbiodinium C3). Several physiological proxies were affected more by temperature than CO2, including photochemistry, algal number and cellular chlorophyll a. Marked differences in symbiont number, chlorophyll and volume contributed to distinctive patterns of chlorophyll absorption among these animals. In contrast, carbon fixation either did not change or increased under elevated temperature. Also, the rate of photosynthetically fixed carbon translocated to each host did not change, and the percent of carbon translocated to the host increased in the corallimorph. Comparing all data revealed a significant negative correlation between photosynthetic rate and symbiont density that corroborates previous hypotheses about carbon limitation in these symbioses. The ratio of symbiont-normalized photosynthetic rate relative to the rate of symbiont-normalized carbon translocation (P:T) was compared in these organisms as well as the anemone, Exaiptasia pallida hosting Symbiodinium minutum, and revealed a P:T close to unity ( D. nummiforme) to a range of 2.0-4.5, with the lowest carbon translocation in the sea anemone. Major differences in the thermal responses across these organisms provide further evidence of a range of acclimation potential and physiological plasticity that highlights the need for continued study of these symbioses across a larger group of host taxa.

  11. Raddeanin A induces human gastric cancer cells apoptosis and inhibits their invasion in vitro

    International Nuclear Information System (INIS)

    Xue, Gang; Zou, Xi; Zhou, Jin-Yong; Sun, Wei; Wu, Jian; Xu, Jia-Li; Wang, Rui-Ping


    Highlights: •Raddeanin A is a triterpenoid saponin in herb medicine Anemone raddeana Regel. •Raddeanin A can inhibit 3 kinds of gastric cancer cells’ proliferation and invasion. •Caspase-cascades’ activation indicates apoptosis induced by Raddeanin A. •MMPs, RECK, Rhoc and E-cad are involved in Raddeanin A-induced invasion inhibition. -- Abstract: Raddeanin A is one of the triterpenoid saponins in herbal medicine Anemone raddeana Regel which was reported to suppress the growth of liver and lung cancer cells. However, little was known about its effect on gastric cancer (GC) cells. This study aimed to investigate its inhibitory effect on three kinds of different differentiation stage GC cells (BGC-823, SGC-7901 and MKN-28) in vitro and the possible mechanisms. Proliferation assay and flow cytometry demonstrated Raddeanin A’s dose-dependent inhibitory effect and determined its induction of cells apoptosis, respectively. Transwell assay, wounding heal assay and cell matrix adhesion assay showed that Raddeanin A significantly inhibited the abilities of the invasion, migration and adhesion of the BGC-823 cells. Moreover, quantitative real time PCR and Western blot analysis found that Raddeanin A increased Bax expression while reduced Bcl-2, Bcl-xL and Survivin expressions and significantly activated caspase-3, caspase-8, caspase-9 and poly-ADP ribose polymerase (PARP). Besides, Raddeanin A could also up-regulate the expression of reversion inducing cysteine rich protein with Kazal motifs (RECK), E-cadherin (E-cad) and down-regulate the expression of matrix metalloproteinases-2 (MMP-2), MMP-9, MMP-14 and Rhoc. In conclusion, Raddeanin A inhibits proliferation of human GC cells, induces their apoptosis and inhibits the abilities of invasion, migration and adhesion, exhibiting potential to become antitumor drug

  12. High photobiont diversity in the common European soil crust lichenPsora decipiens. (United States)

    Ruprecht, Ulrike; Brunauer, Georg; Türk, Roman


    The genetic diversity of green algal photobionts (chlorobionts) in soil crust forming lichens was studied as part of the SCIN-project (Soil Crust InterNational). A total of 64 lichen samples were collected from four different sites along latitudinal and altitudinal gradients in Europe (Tabernas/Spain; Hochtor-Großglockner/Austria; Gynge Alvar/Sweden; Ruine Homburg/Germany). The dominant lichen species at all four sites was Psora decipiens , often occurring with Buellia elegans, Fulgensia bracteata, F. fulgens and Peltigera rufescens. Genetic identification of chlorobionts was carried out using the nuclear marker (nrITS) and a chloroplast marker ( psb L-J). We found P. decipiens to be associated with several different species of Trebouxia and Asterochloris , although previously described to only have Asterochloris sp. The phylogenetic analyses revealed a high chlorobiont diversity with 12 well supported clades, including Trebouxia asymmetrica , T. jamesii , T. impressa and other, as yet taxonomically unidentified clades ( Trebouxia sp. URa1-4, T . sp. URa6, T . sp. URa7-13). Additionally, five clades of Asterochloris were identified ( A. magna, A. sp. URa14 -17). Most of the chlorobiont species appeared to be cosmopolitan, but five clades were unevenly distributed between the sampling sites with only Trebouxia being found in the warm and dry Spanish habitats and combinations of Trebouxia and Asterochloris in the cooler and more humid habitats. The wide range of chlorobiont species might contribute to the observed domination of P. decipiens at all four research sites of the SCIN project which range from a desert in Spain to an alpine site in the Alps of Austria.

  13. Medwall, notre contemporain ?

    Directory of Open Access Journals (Sweden)

    Jean-Paul Debax


    Full Text Available Le texte Fulgens et Lucres de H. Medwall, joué en 1989 à Toulouse, était très largement fidèle à celui de 1494, en vers rimés, la rime étant un véhicule du charme et du comique tout à la fois. Les chevilles ont été scrupuleusement conservées, pour leur effet comique et phatique. Le metteur en scène s’est refusé à reconstituer les formes anciennes, et s’est gardé de tout exotisme, s’efforçant de gérer l’écart entre la mise en scène d’aujourd’hui et la réalisation censée avoir été celle du Moyen Âge. La différence entre les protagonistes historiques et les serviteurs-amuseurs a été soulignée par les costumes, le rapport au public et l’utilisation d’un livret tenu à la main par les premiers. Ce qui est recherché est un équilibre entre pratiques médiévales et contemporaines, et non point un compromis, qui aurait pour résultat de balloter le spectateur dans un univers incohérent. La connaissance des conditions initiales ne peut-être qu’un point de départ pour la réflexion, ce sont les conditions réelles et présentes de la représentation qui ont guidé les choix du metteur en scène d’aujourd’hui.

  14. Distribution and habitat use of red panda in the Chitwan-Annapurna Landscape of Nepal.

    Directory of Open Access Journals (Sweden)

    Damber Bista

    Full Text Available In Nepal, the red panda (Ailurus fulgens has been sparsely studied, although its range covers a wide area. The present study was carried out in the previously untapped Chitwan-Annapurna Landscape (CHAL situated in central Nepal with an aim to explore current distributional status and identify key habitat use. Extensive field surveys conducted in 10 red panda range districts were used to estimate species distribution by presence-absence occupancy modeling and to predict distribution by presence-only modeling. The presence of red pandas was recorded in five districts: Rasuwa, Nuwakot, Myagdi, Baglung and Dhading. The predictive distribution model indicated that 1,904.44 km2 of potential red panda habitat is available in CHAL with the protected area covering nearly 41% of the total habitat. The habitat suitability analysis based on the probability of occurrence showed only 16.58% (A = 315.81 km2 of the total potential habitat is highly suitable. Red Panda occupancy was estimated to be around 0.0667, indicating nearly 7% (218 km2 of the total habitat is occupied with an average detection probability of 0.4482±0.377. Based on the habitat use analysis, altogether eight variables including elevation, slope, aspect, proximity to water sources, bamboo abundance, height, cover, and seasonal precipitation were observed to have significant roles in the distribution of red pandas. In addition, 25 tree species were documented from red panda sign plots out of 165 species recorded in the survey area. Most common was Betula utilis followed by Rhododendron spp. and Abies spectabilis. The extirpation of red pandas in previously reported areas indicates a need for immediate action for the long-term conservation of this species in CHAL.

  15. Habitat correlates of the red panda in the temperate forests of Bhutan. (United States)

    Dorji, Sangay; Vernes, Karl; Rajaratnam, Rajanathan


    Anthropogenic activities and associated global climate change are threatening the biodiversity in the Himalayas against a backdrop of poor knowledge of the region's threatened species. The red panda (Ailurus fulgens) is a threatened mammal confined to the eastern Himalayas, and because of Bhutan's central location in the distributional range of red pandas, its forests are integral to the long-term viability of wild populations. Detailed habitat requirements of the red panda are largely speculative, and there is virtually no ecological information available on this species in Bhutan. Between 2007 and 2009, we established 615 presence/absence plots in a systematic sampling of resident habitat types within Jigme Dorji and Thrumshingla National Parks, Bhutan, to investigate broad and fine-scale red panda habitat associations. Additional locality records of red pandas were obtained from interviewing 664 park residents. Red pandas were generally confined to cool broadleaf and conifer forests from 2,110-4,389 m above sea level (asl), with the majority of records between 2,400-3,700 m asl on south and east-facing slopes. At a finer scale, multivariate analysis revealed that red pandas were strongly associated with old growth Bhutan Fir (Abies densa) forest dominated by a dense cover of Yushania and Arundanaria bamboo with a high density of fallen logs and tree stumps at ground level; a high density of trees, dead snags, and rhododendron shrubs in the mid-storey; and locations that were close to water. Because Bhutan's temperate forests that encompass prime red panda habitat are also integral to human subsistence and socio-economic development, there exists an inadvertent conflict between the needs of people and red pandas. As such, careful sustainable management of Bhutan's temperate forests is necessary if a balance is to be met between the socioeconomic needs of people and the conservation goals for red pandas.

  16. Mammals of Kalimpong Hills, Darjeeling District, West Bengal, India

    Directory of Open Access Journals (Sweden)

    J.K. Mallick


    Full Text Available Neora Valley National Park (NVNP in the Kalimpong Hills, Darjeeling District, having a wide range of altitudinal variations (183-3,200 m and climatic conditions and forming an ecological trijunction with Sikkim and Bhutan, is the last virgin wilderness in West Bengal. It is a global hotspot for the unique ecosystem, where tropical, sub-tropical, temperate and sub-temperate forests represent a wealth of biodiversity including many threatened and rare mammals. It is the prime habitat of Ailurus fulgens (estimated population 28-32, Neofelis nebulosa (population unassessed, Ursus thibetanus (18, Bos gaurus (81, Hemitragus jemlahicus (32, Naemorhedus goral (73, Capricornis sumatraensis (89, Rusa unicolor (286, Muntiacus vaginalis (590 and Sus scrofa (615. Discovery of Panthera tigris (20 in 1998 prompted the forest department to include NVNP as a sensitive wildlife zone. Many authors recorded the mammalian diversity in Darjeeling District since the mid-nineteenth century, but most of them referred to the Darjeeling Hills. The documentations on Kalimpong Hills are scarce because of the dense canopy, thick undergrowth and inaccessible terrain, particularly in the pristine forests of Neora Valley. Consequently, a comprehensive compendium of the mammals in this region was not prepared. A study was undertaken in 2008-2009 with a view to bridging this knowledge-gap and presenting an updated account of the mammalian species in this new short-listed World Heritage Site and surrounding forests of the Kalimpong Hills based on literature review, questionnaire survey, direct sighting and indirect evidences. During June-October 1916, N.A. Baptista recorded 29 mammalian species (22 genera out of 563 specimens collected, from the region. The present study registered 99 species (68 genera after 94 years.

  17. Analysis of Genomic DNAs from Nine Rosaceae Species Using Surface-Enhanced Raman Scattering. (United States)

    Lu, Qiu; Lang, Tao; Fan, Shuguo; Chen, Wen; Zang, Deqing; Chen, Jing; Shi, Minzhen


    Surface-enhanced Raman scattering (SERS) of genomic DNA was used to determine genetic relationships and species identification of nine plants from three subfamilies of Rosaceae. Genomic DNA was extracted, and the SERS spectra were obtained by using a nanosilver collosol at an excitation wavelength of 785 nm. Adenine and ribodesose were the active sites of genomic DNAs in the silver surface-enhanced Raman spectra. The strong peak at 714 cm(-1) was assigned to the stretching vibration of adenine, the strong peak at 1011cm(-1) contributed to the stretching vibration of the deoxyribose and the scissoring vibrations of cytosine, and the strong peak at 625 cm(-1) is the stretching vibration of glycosidic bond and the scissoring vibrations of guanine. The three-dimensional plot of the first, second, and third principal components showed that the nine species could be classified into three categories (three subfamilies), consistent with the traditional classification. The model of the hierarchical cluster combined with the principal component of the second derivative was more reasonable. The results of the cluster analysis showed that apricot (Prunus armeniaca L.) and cherry (Prunus seudocerasus Lindl.) were clustered into one category (Prunoideae); firethorn (Firethorn fortuneana Li.), loquat (Eriobotrya japonica Lindl.), apple (Malus pumila Mill.), and crabapple (Malus hallianna Koehne.) were clustered into a second category (Pomoideae); and potentilla (Potentilla fulgens Wall.), rose (Rosa chinensis Jacd.), and strawberry (Fragaria chiloensis Duchesne.) were clustered into a third category (Rosoideae). These classifications were in accordance with the traditional classification with a correction rate of clustering of 100%. The correct rate of species identification was 100%. These five main results indicate that the genetic relationship and species identification of nine Rosaceae species could be determined by using SERS spectra of their genomic DNAs.

  18. Habitat correlates of the red panda in the temperate forests of Bhutan.

    Directory of Open Access Journals (Sweden)

    Sangay Dorji

    Full Text Available Anthropogenic activities and associated global climate change are threatening the biodiversity in the Himalayas against a backdrop of poor knowledge of the region's threatened species. The red panda (Ailurus fulgens is a threatened mammal confined to the eastern Himalayas, and because of Bhutan's central location in the distributional range of red pandas, its forests are integral to the long-term viability of wild populations. Detailed habitat requirements of the red panda are largely speculative, and there is virtually no ecological information available on this species in Bhutan. Between 2007 and 2009, we established 615 presence/absence plots in a systematic sampling of resident habitat types within Jigme Dorji and Thrumshingla National Parks, Bhutan, to investigate broad and fine-scale red panda habitat associations. Additional locality records of red pandas were obtained from interviewing 664 park residents. Red pandas were generally confined to cool broadleaf and conifer forests from 2,110-4,389 m above sea level (asl, with the majority of records between 2,400-3,700 m asl on south and east-facing slopes. At a finer scale, multivariate analysis revealed that red pandas were strongly associated with old growth Bhutan Fir (Abies densa forest dominated by a dense cover of Yushania and Arundanaria bamboo with a high density of fallen logs and tree stumps at ground level; a high density of trees, dead snags, and rhododendron shrubs in the mid-storey; and locations that were close to water. Because Bhutan's temperate forests that encompass prime red panda habitat are also integral to human subsistence and socio-economic development, there exists an inadvertent conflict between the needs of people and red pandas. As such, careful sustainable management of Bhutan's temperate forests is necessary if a balance is to be met between the socioeconomic needs of people and the conservation goals for red pandas.

  19. A first telecoupling analysis of multi-species poaching trade in Nepal: When outside demands seek and distribute a local resource in times of globalization (United States)

    Regmi, G. R.; Lama, R. P.; Puri, G.; Huettmann, F.


    Asia remains one of the last wilderness resources in the world. It's widely praised for those resources and they are in a global appreciation and demand. Considering open borders, many of them virtually uncontrollable in Asia, and globalization in full swing, precious local resources become available to a global audience without much constraint though. Nepal and its unique biodiversity presents us with one of such cases while hard data remain elusive. Here we present a first telecoupling analysis based on poaching and crime statistics presented in the public print national daily newspapers (Kantipur and Gorkhapatra) in Nepal. This review highlights a few high-profile species (timber: Sal Shorea robusta , Sissoo Dalbergia sissoo, Pine Pinus species; aromatic and medicinal plants: Red Sandal Wood Santalum album, Orchid Orchid species, Paris Paris polyphylla, Jatamashi Nardostachys grandiflora, Kutki Picrorhyza scrophulariiflora and wildlife: Royal Bengal Tiger Panthera tigris tigris, Rhino Rhinoceros unicornis, Pangolin Manis species, Common Leopard Panthera pardus, Red Panda Ailurus fulgens, Snow Leopard Panthera uncia) in Nepal, traded out directly and illegally to India and China. We provide a wider perspective regarding sending, receiving and spill-over agents. Arguably, the western world as the spill-over agent set up a globalization framework that allows for items, virtually any items, to be shipped across borders, e.g. done on foot, by car or plane. It further allows to create and satisfy a demand by the receiver (=nations in wider Asia), and a system that circumvents the legal structure in the sending location (=Nepal and its biodiversity hotspots and wilderness). We extend the traditional telecoupling analysis with a flow analysis of money, remittance payments and banking networks. This research describes for the first time such a system which is by now essentially found worldwide, how it operates, what devastating impacts it leaves behind on landscapes, and

  20. Residency in white-eared hummingbirds (Hylocharis leucotis) and its effect in territorial contest resolution. (United States)

    Mendiola-Islas, Verónica; Lara, Carlos; Corcuera, Pablo; Valverde, Pedro Luis


    Territory owners usually defeat intruders. One explanation for this observation is the uncorrelated asymmetry hypothesis which argues that contests might be settled by an arbitrary convention such as "owners win." We studied the effect of territorial residency on contest asymmetries in the white-eared hummingbird ( Hylocharis leucotis ) in a fir forest from central Mexico. Twenty white-eared male adult hummingbird territories were monitored during a winter season, recording the territorial behavior of the resident against intruding hummingbirds. The size and quality of the territory were related to the probability that the resident would allow the use of flowers by the intruder. Various generalized models (logistical models) were generated to describe the probabilities of victory for each individual resident depending on the different combinations of three predictor variables (territory size, territory quality, and intruder identity). In general, small and low quality territory owners tend to prevent conspecific intruders from foraging at a higher rate, while they frequently fail to exclude heterospecific intruders such as the magnificent hummingbird ( Eugenes fulgens ) or the green violetear hummingbird ( Colibri thalassinus ) on any territory size. Our results showed that the identity of the intruder and the size and quality of the territory determined the result of the contests, but not the intensity of defense. Initially, the rule that "the resident always wins" was supported, since no resident was expelled from its territory during the study. Nevertheless, the resident-intruder asymmetries during the course of a day depended on different factors, such as the size and quality of the territory and, mainly, the identity of the intruders. Our results showed that flexibility observed in contest tactics suggests that these tactics are not fixed but are socially plastic instead and they can be adjusted to specific circumstances.

  1. Flight mechanics and control of escape manoeuvres in hummingbirds. II. Aerodynamic force production, flight control and performance limitations. (United States)

    Cheng, Bo; Tobalske, Bret W; Powers, Donald R; Hedrick, Tyson L; Wang, Yi; Wethington, Susan M; Chiu, George T-C; Deng, Xinyan


    The superior manoeuvrability of hummingbirds emerges from complex interactions of specialized neural and physiological processes with the unique flight dynamics of flapping wings. Escape manoeuvring is an ecologically relevant, natural behaviour of hummingbirds, from which we can gain understanding into the functional limits of vertebrate locomotor capacity. Here, we extend our kinematic analysis of escape manoeuvres from a companion paper to assess two potential limiting factors of the manoeuvring performance of hummingbirds: (1) muscle mechanical power output and (2) delays in the neural sensing and control system. We focused on the magnificent hummingbird (Eugenes fulgens, 7.8 g) and the black-chinned hummingbird (Archilochus alexandri, 3.1 g), which represent large and small species, respectively. We first estimated the aerodynamic forces, moments and the mechanical power of escape manoeuvres using measured wing kinematics. Comparing active-manoeuvring and passive-damping aerodynamic moments, we found that pitch dynamics were lightly damped and dominated by the effect of inertia, while roll dynamics were highly damped. To achieve observed closed-loop performance, pitch manoeuvres required faster sensorimotor transduction, as hummingbirds can only tolerate half the delay allowed in roll manoeuvres. Accordingly, our results suggested that pitch control may require a more sophisticated control strategy, such as those based on prediction. For the magnificent hummingbird, we estimated that escape manoeuvres required muscle mass-specific power 4.5 times that during hovering. Therefore, in addition to the limitation imposed by sensorimotor delays, muscle power could also limit the performance of escape manoeuvres. © 2016. Published by The Company of Biologists Ltd.

  2. Flight mechanics and control of escape manoeuvres in hummingbirds. I. Flight kinematics. (United States)

    Cheng, Bo; Tobalske, Bret W; Powers, Donald R; Hedrick, Tyson L; Wethington, Susan M; Chiu, George T C; Deng, Xinyan


    Hummingbirds are nature's masters of aerobatic manoeuvres. Previous research shows that hummingbirds and insects converged evolutionarily upon similar aerodynamic mechanisms and kinematics in hovering. Herein, we use three-dimensional kinematic data to begin to test for similar convergence of kinematics used for escape flight and to explore the effects of body size upon manoeuvring. We studied four hummingbird species in North America including two large species (magnificent hummingbird, Eugenes fulgens, 7.8 g, and blue-throated hummingbird, Lampornis clemenciae, 8.0 g) and two smaller species (broad-billed hummingbird, Cynanthus latirostris, 3.4 g, and black-chinned hummingbirds Archilochus alexandri, 3.1 g). Starting from a steady hover, hummingbirds consistently manoeuvred away from perceived threats using a drastic escape response that featured body pitch and roll rotations coupled with a large linear acceleration. Hummingbirds changed their flapping frequency and wing trajectory in all three degrees of freedom on a stroke-by-stroke basis, likely causing rapid and significant alteration of the magnitude and direction of aerodynamic forces. Thus it appears that the flight control of hummingbirds does not obey the 'helicopter model' that is valid for similar escape manoeuvres in fruit flies. Except for broad-billed hummingbirds, the hummingbirds had faster reaction times than those reported for visual feedback control in insects. The two larger hummingbird species performed pitch rotations and global-yaw turns with considerably larger magnitude than the smaller species, but roll rates and cumulative roll angles were similar among the four species. © 2016. Published by The Company of Biologists Ltd.

  3. Residency in white-eared hummingbirds (Hylocharis leucotis and its effect in territorial contest resolution

    Directory of Open Access Journals (Sweden)

    Verónica Mendiola-Islas


    Full Text Available Background Territory owners usually defeat intruders. One explanation for this observation is the uncorrelated asymmetry hypothesis which argues that contests might be settled by an arbitrary convention such as “owners win.” We studied the effect of territorial residency on contest asymmetries in the white-eared hummingbird (Hylocharis leucotis in a fir forest from central Mexico. Methods Twenty white-eared male adult hummingbird territories were monitored during a winter season, recording the territorial behavior of the resident against intruding hummingbirds. The size and quality of the territory were related to the probability that the resident would allow the use of flowers by the intruder. Various generalized models (logistical models were generated to describe the probabilities of victory for each individual resident depending on the different combinations of three predictor variables (territory size, territory quality, and intruder identity. Results In general, small and low quality territory owners tend to prevent conspecific intruders from foraging at a higher rate, while they frequently fail to exclude heterospecific intruders such as the magnificent hummingbird (Eugenes fulgens or the green violetear hummingbird (Colibri thalassinus on any territory size. Our results showed that the identity of the intruder and the size and quality of the territory determined the result of the contests, but not the intensity of defense. Discussion Initially, the rule that “the resident always wins” was supported, since no resident was expelled from its territory during the study. Nevertheless, the resident-intruder asymmetries during the course of a day depended on different factors, such as the size and quality of the territory and, mainly, the identity of the intruders. Our results showed that flexibility observed in contest tactics suggests that these tactics are not fixed but are socially plastic instead and they can be adjusted to

  4. Distribution and habitat use of red panda in the Chitwan-Annapurna Landscape of Nepal. (United States)

    Bista, Damber; Shrestha, Saroj; Sherpa, Peema; Thapa, Gokarna Jung; Kokh, Manish; Lama, Sonam Tashi; Khanal, Kapil; Thapa, Arjun; Jnawali, Shant Raj


    In Nepal, the red panda (Ailurus fulgens) has been sparsely studied, although its range covers a wide area. The present study was carried out in the previously untapped Chitwan-Annapurna Landscape (CHAL) situated in central Nepal with an aim to explore current distributional status and identify key habitat use. Extensive field surveys conducted in 10 red panda range districts were used to estimate species distribution by presence-absence occupancy modeling and to predict distribution by presence-only modeling. The presence of red pandas was recorded in five districts: Rasuwa, Nuwakot, Myagdi, Baglung and Dhading. The predictive distribution model indicated that 1,904.44 km2 of potential red panda habitat is available in CHAL with the protected area covering nearly 41% of the total habitat. The habitat suitability analysis based on the probability of occurrence showed only 16.58% (A = 315.81 km2) of the total potential habitat is highly suitable. Red Panda occupancy was estimated to be around 0.0667, indicating nearly 7% (218 km2) of the total habitat is occupied with an average detection probability of 0.4482±0.377. Based on the habitat use analysis, altogether eight variables including elevation, slope, aspect, proximity to water sources, bamboo abundance, height, cover, and seasonal precipitation were observed to have significant roles in the distribution of red pandas. In addition, 25 tree species were documented from red panda sign plots out of 165 species recorded in the survey area. Most common was Betula utilis followed by Rhododendron spp. and Abies spectabilis. The extirpation of red pandas in previously reported areas indicates a need for immediate action for the long-term conservation of this species in CHAL.

  5. Lineage-specific evolution of bitter taste receptor genes in the giant and red pandas implies dietary adaptation. (United States)

    Shan, Lei; Wu, Qi; Wang, Le; Zhang, Lei; Wei, Fuwen


    Taste 2 receptors (TAS2R) mediate bitterness perception in mammals, thus are called bitter taste receptors. It is believed that these genes evolved in response to species-specific diets. The giant panda (Ailuropoda melanoleuca) and red panda (Ailurus fulgens styani) in the order Carnivora are specialized herbivores with an almost exclusive bamboo diet (>90% bamboo). Because bamboo is full of bitter tasting compounds, we hypothesized that adaptive evolution has occurred at TAS2R genes in giant and red pandas throughout the course of their dietary shift. Here, we characterized 195 TAS2R genes in 9 Carnivora species and examined selective pressures on these genes. We found that both pandas harbor more putative functional TAS2R genes than other carnivores, and pseudogenized TAS2R genes in the giant panda are different from the red panda. The purifying selection on TAS2R1, TAS2R9 and TAS2R38 in the giant panda, and TAS2R62 in the red panda, has been strengthened throughout the course of adaptation to bamboo diet, while selective constraint on TAS2R4 and TAS2R38 in the red panda is relaxed. Remarkably, a few positively selected sites on TAS2R42 have been specifically detected in the giant panda. These results suggest an adaptive response in both pandas to a dietary shift from carnivory to herbivory, and TAS2R genes evolved independently in the 2 pandas. Our findings provide new insight into the molecular basis of mammalian sensory evolution and the process of adaptation to new ecological niches. © 2017 The Authors. Integrative Zoology published by International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and John Wiley & Sons Australia, Ltd.

  6. Benthic assemblages of mega epifauna on the Oregon continental margin (United States)

    Hemery, Lenaïg G.; Henkel, Sarah K.; Cochrane, Guy R.


    Environmental assessment studies are usually required by a country's administration before issuing permits for any industrial activities. One of the goals of such environmental assessment studies is to highlight species assemblages and habitat composition that could make the targeted area unique. A section of the Oregon continental slope that had not been previously explored was targeted for the deployment of floating wind turbines. We carried out an underwater video survey, using a towed camera sled, to describe its benthic assemblages. Organisms were identified to the lowest taxonomic level possible and assemblages described related to the nature of the seafloor and the depth. We highlighted six invertebrate assemblages and three fish assemblages. For the invertebrates within flat soft sediments areas we defined three different assemblages based on primarily depth: a broad mid-depth (98–315 m) assemblage dominated by red octopus, sea pens and pink shrimps; a narrower mid-depth (250–270 m) assemblage dominated by box crabs and various other invertebrates; and a deeper (310–600 m) assemblage dominated by sea urchins, sea anemones, various snails and zoroasterid sea stars. The invertebrates on mixed sediments also were divided into three different assemblages: a shallow (~100 m deep) assemblage dominated by plumose sea anemones, broad mid-depth (170–370 m) assemblage dominated by sea cucumbers and various other invertebrates; and, again, a narrower mid-depth (230–270 m) assemblage, dominated by crinoids and encrusting invertebrates. For the fish, we identified a rockfish assemblage on coarse mixed sediments at 170–370 m and another fish assemblage on smaller mixed sediments within that depth range (250–370 m) dominated by thornyheads, poachers and flatfishes; and we identified a wide depth-range (98–600 m) fish assemblage on flat soft sediments dominated by flatfishes, eelpouts and thornyheads. Three of these assemblages (the two

  7. Benthic assemblages of mega epifauna on the Oregon continental margin (United States)

    Hemery, Lenaïg G.; Henkel, Sarah K.; Cochrane, Guy R.


    Environmental assessment studies are usually required by a country's administration before issuing permits for any industrial activities. One of the goals of such environmental assessment studies is to highlight species assemblages and habitat composition that could make the targeted area unique. A section of the Oregon continental slope that had not been previously explored was targeted for the deployment of floating wind turbines. We carried out an underwater video survey, using a towed camera sled, to describe its benthic assemblages. Organisms were identified to the lowest taxonomic level possible and assemblages described related to the nature of the seafloor and the depth. We highlighted six invertebrate assemblages and three fish assemblages. For the invertebrates within flat soft sediments areas we defined three different assemblages based on primarily depth: a broad mid-depth (98-315 m) assemblage dominated by red octopus, sea pens and pink shrimps; a narrower mid-depth (250-270 m) assemblage dominated by box crabs and various other invertebrates; and a deeper (310-600 m) assemblage dominated by sea urchins, sea anemones, various snails and zoroasterid sea stars. The invertebrates on mixed sediments also were divided into three different assemblages: a shallow ( 100 m deep) assemblage dominated by plumose sea anemones, broad mid-depth (170-370 m) assemblage dominated by sea cucumbers and various other invertebrates; and, again, a narrower mid-depth (230-270 m) assemblage, dominated by crinoids and encrusting invertebrates. For the fish, we identified a rockfish assemblage on coarse mixed sediments at 170-370 m and another fish assemblage on smaller mixed sediments within that depth range (250-370 m) dominated by thornyheads, poachers and flatfishes; and we identified a wide depth-range (98-600 m) fish assemblage on flat soft sediments dominated by flatfishes, eelpouts and thornyheads. Three of these assemblages (the two broad fish assemblages and the deep

  8. A journey into the wild of the cnidarian model system Aiptasia and its symbionts

    KAUST Repository

    Voolstra, Christian R.


    The existence of coral reef ecosystems relies critically on the mutualistic relationship between calcifying cnidarians and photosynthetic, dinoflagellate endosymbionts in the genus Symbiodinium. Reef-corals have declined globally due to anthropogenic stressors, for example, rising sea-surface temperatures and pollution that often disrupt these symbiotic relationships (known as coral bleaching), exacerbating mass mortality and the spread of disease. This threatens one of the most biodiverse marine ecosystems providing habitats to millions of species and supporting an estimated 500 million people globally (Hoegh-Guldberg et al. 2007). Our understanding of cnidarian-dinoflagellate symbioses has improved notably with the recent application of genomic and transcriptomic tools (e.g. Voolstra et al. 2009; Bayer et al. 2012; Davy et al. 2012), but a model system that allows for easy manipulation in a laboratory environment is needed to decipher underlying cellular mechanisms important to the functioning of these symbioses. To this end, the sea anemone Aiptasia, otherwise known as a \\'pest\\' to aquarium hobbyists, is emerging as such a model system (Schoenberg & Trench 1980; Sunagawa et al. 2009; Lehnert et al. 2012). Aiptasia is easy to grow in culture and, in contrast to its stony relatives, can be maintained aposymbiotically (i.e. dinoflagellate free) with regular feeding. However, we lack basic information on the natural distribution and genetic diversity of these anemones and their endosymbiotic dinoflagellates. These data are essential for placing the significance of this model system into an ecological context. In this issue of Molecular Ecology, Thornhill et al. (2013) are the first to present genetic evidence on the global distribution, diversity and population structure of Aiptasia and its associated Symbiodinium spp. By integrating analyses of the host and symbiont, this research concludes that the current Aitpasia taxonomy probably needs revision and that two

  9. The scavenger receptor repertoire in six cnidarian species and its putative role in cnidarian-dinoflagellate symbiosis

    Directory of Open Access Journals (Sweden)

    Emilie F. Neubauer


    Full Text Available Many cnidarians engage in a mutualism with endosymbiotic photosynthetic dinoflagellates that forms the basis of the coral reef ecosystem. Interpartner interaction and regulation includes involvement of the host innate immune system. Basal metazoans, including cnidarians have diverse and complex innate immune repertoires that are just beginning to be described. Scavenger receptors (SR are a diverse superfamily of innate immunity genes that recognize a broad array of microbial ligands and participate in phagocytosis of invading microbes. The superfamily includes subclades named SR-A through SR-I that are categorized based on the arrangement of sequence domains including the scavenger receptor cysteine rich (SRCR, the C-type lectin (CTLD and the CD36 domains. Previous functional and gene expression studies on cnidarian-dinoflagellate symbiosis have implicated SR-like proteins in interpartner communication and regulation. In this study, we characterized the SR repertoire from a combination of genomic and transcriptomic resources from six cnidarian species in the Class Anthozoa. We combined these bioinformatic analyses with functional experiments using the SR inhibitor fucoidan to explore a role for SRs in cnidarian symbiosis and immunity. Bioinformatic searches revealed a large diversity of SR-like genes that resembled SR-As, SR-Bs, SR-Es and SR-Is. SRCRs, CTLDs and CD36 domains were identified in multiple sequences in combinations that were highly homologous to vertebrate SRs as well as in proteins with novel domain combinations. Phylogenetic analyses of CD36 domains of the SR-B-like sequences from a diversity of metazoans grouped cnidarian with bilaterian sequences separate from other basal metazoans. All cnidarian sequences grouped together with moderate support in a subclade separately from bilaterian sequences. Functional experiments were carried out on the sea anemone Aiptasia pallida that engages in a symbiosis with Symbiodinium minutum

  10. Giant Panda (Ailuropoda melanoleuca Buccal Mucosa Tissue as a Source of Multipotent Progenitor Cells.

    Directory of Open Access Journals (Sweden)

    Hilary M A Prescott

    Full Text Available Since the first mammal was cloned, the idea of using this technique to help endangered species has aroused considerable interest. However, several issues limit this possibility, including the relatively low success rate at every stage of the cloning process, and the dearth of usable tissues from these rare animals. iPS cells have been produced from cells from a number of rare mammalian species and this is the method of choice for strategies to improve cloning efficiency and create new gametes by directed differentiation. Nevertheless information about other stem cell/progenitor capabilities of cells from endangered species could prove important for future conservation approaches and adds to the knowledge base about cellular material that can be extremely limited. Multipotent progenitor cells, termed skin-derived precursor (SKP cells, can be isolated directly from mammalian skin dermis, and human cheek tissue has also been shown to be a good source of SKP-like cells. Recently we showed that structures identical to SKPs termed m-SKPs could be obtained from monolayer/ two dimensional (2D skin fibroblast cultures. Here we aimed to isolate m-SKPs from cultured cells of three endangered species; giant panda (Ailuropoda melanoleuca; red panda (Ailurus fulgens; and Asiatic lion (Panthera leo persica. m-SKP-like spheres were formed from the giant panda buccal mucosa fibroblasts; whereas dermal fibroblast (DF cells cultured from abdominal skin of the other two species were unable to generate spheres. Under specific differentiation culture conditions giant panda spheres expressed neural, Schwann, adipogenic and osteogenic cell markers. Furthermore, these buccal mucosa derived spheres were shown to maintain expression of SKP markers: nestin, versican, fibronectin, and P75 and switch on expression of the stem cell marker ABCG2. These results demonstrate that giant panda cheek skin can be a useful source of m-SKP multipotent progenitors. At present lack of

  11. Can lichen species of BSC acclimate to changing environments? (United States)

    Williams, Laura; Colesie, Claudia; Büdel, Burkhard


    sites. Lichen species are also analysed to investigate the variability within their morphological and physiological traits and whether this is site specific. From the transplant experiment lichen samples are analysed to find whether lichen species can readily switch their photobiont to a locally adapted symbiont and whether the morphological and physiological parameters change in order to acclimatise to the new conditions. This work is currently ongoing and here the initial results from the lichen species Psora decipiens, Fulgensia fulgens (green algal lichens) and Peltigera rufescens (cyanolichen) are presented.

  12. Lichens show that fungi can acclimate their respiration to seasonal changes in temperature. (United States)

    Lange, Otto L; Green, T G Allan


    Five species of lichens, the majority members of a soil-crust community ( Cladonia convoluta, Diploschistes muscorum, Fulgensia fulgens, Lecanora muralis, Squamarina lentigera) showed seasonal changes of temperature sensitivity of their dark respiration (DR) to such an extent that several substantially met the definition of full acclimation, i.e. near identical DR under different nocturnal temperature conditions during the course of the year. C. convoluta, for example, had maximal DR at 5 degrees C of -0.42, -1.11 and -0.09 nmol CO(2) g(-1) s(-1) in autumn, winter, and summer, respectively, a tenfold range. However, at the mean night temperatures for the same three seasons, 9.7 degrees C, 4.2 degrees C and 13.6 degrees C, maximal DR were almost identical at -1.11, -0.93, and -1.45 nmol CO(2) g(-1) s(-1). The information was extracted from measurements using automatic cuvettes that continuously recorded a sample lichen's gas exchange every 30 min under near-natural conditions. The longest period (for L. muralis) covered 15 months and 22,000 data sets whilst, for the other species studied, data blocks were available throughout the calendar year. The acclimation of DR means that maximal net carbon fixation rates remain substantially similar throughout the year and are not depressed by increased carbon loss by respiration in warmer seasons. This is especially important for lichens because of their normally high rate of DR compared to net photosynthesis. We suggest that lichens, especially soil-crust species, could be a suitable model for fungi generally, a group of organisms for which little is known about temperature acclimation because of the great difficulty in separating the organism from its growth medium. Fungi, whether saprophytic, symbiotic or parasitic, including soil lichens, are important components of soil ecosystems and contribute much of the respired CO(2) from these systems. Temperature acclimation by fungi would mean that expected increases in carbon

  13. Giant Panda (Ailuropoda melanoleuca) Buccal Mucosa Tissue as a Source of Multipotent Progenitor Cells. (United States)

    Prescott, Hilary M A; Manning, Craig; Gardner, Aaron; Ritchie, William A; Pizzi, Romain; Girling, Simon; Valentine, Iain; Wang, Chengdong; Jahoda, Colin A B


    Since the first mammal was cloned, the idea of using this technique to help endangered species has aroused considerable interest. However, several issues limit this possibility, including the relatively low success rate at every stage of the cloning process, and the dearth of usable tissues from these rare animals. iPS cells have been produced from cells from a number of rare mammalian species and this is the method of choice for strategies to improve cloning efficiency and create new gametes by directed differentiation. Nevertheless information about other stem cell/progenitor capabilities of cells from endangered species could prove important for future conservation approaches and adds to the knowledge base about cellular material that can be extremely limited. Multipotent progenitor cells, termed skin-derived precursor (SKP) cells, can be isolated directly from mammalian skin dermis, and human cheek tissue has also been shown to be a good source of SKP-like cells. Recently we showed that structures identical to SKPs termed m-SKPs could be obtained from monolayer/ two dimensional (2D) skin fibroblast cultures. Here we aimed to isolate m-SKPs from cultured cells of three endangered species; giant panda (Ailuropoda melanoleuca); red panda (Ailurus fulgens); and Asiatic lion (Panthera leo persica). m-SKP-like spheres were formed from the giant panda buccal mucosa fibroblasts; whereas dermal fibroblast (DF) cells cultured from abdominal skin of the other two species were unable to generate spheres. Under specific differentiation culture conditions giant panda spheres expressed neural, Schwann, adipogenic and osteogenic cell markers. Furthermore, these buccal mucosa derived spheres were shown to maintain expression of SKP markers: nestin, versican, fibronectin, and P75 and switch on expression of the stem cell marker ABCG2. These results demonstrate that giant panda cheek skin can be a useful source of m-SKP multipotent progenitors. At present lack of sample numbers

  14. Cascading effects of fishing on Galapagos rocky reef communities: reanalysis using corrected data (United States)

    Sonnenholzner, Jorge I.; Ladah, Lydia B.; Lafferty, Kevin D.


    This article replaces Sonnenholzner et al. (2007; Mar Ecol Prog Ser 343:77–85), which was retracted on September 19, 2007, due to errors in entry of data on sea urchins. We sampled 10 highly fished and 10 (putatively) lightly fished shallow rocky reefs in the southeastern area of the Galapagos Marine Reserve, Ecuador. After the correction, these are the new results: there was a negative association between slate-pencil urchins Eucidaris galapagensis and non-coralline algae. In addition, pencil urchins were less abundant where there were many predators. An indirect positive association between predators and non-coralline algae occurred. Fishing appeared to affect this trophic cascade. The spiny lobster Panulirus penicillatus, the slipper lobster Scyllarides astori, and the Mexican hogfish Bodianus diplotaenia were significantly less abundant at highly fished sites. Urchin density was higher at highly fished sites. Non-coralline algae were nearly absent from highly fished sites, where a continuous carpet of the anemone Aiptasia sp. was recorded, and the algal assemblage was mainly structured by encrusting coralline and articulated calcareous algae.

  15. Actions of ATX-II and other gating-modifiers on Na(+) currents in HEK-293 cells expressing WT and DeltaKPQ hNa(V) 1.5 Na(+) channels. (United States)

    Spencer, C Ian


    Voltage-gated Na(+) channels underlie the action potential upstroke in excitable cells, and both natural and synthetic inactivation inhibitors prolong the Na(+) current (I(Na)). The effects of Na(+) channel mutations on these pharmacological actions are incompletely investigated. Therefore, I compared the effects of inactivation inhibitors on I(Na) in WT or mutant (DeltaKPQ) human cardiac Na(+) channels expressed in HEK-293 cells, by measuring difference currents sensitive to 50muM tetrodotoxin. Veratridine and the pyrethroid tefluthrin prolonged I(Na) in WT and DeltaKPQ without obvious differential effects, while a sea anemone toxin (ATX-II) and a synthetic inotrope (SDZ 201-106) prolonged WT I(Na), but apparently blocked I(Na) in the DeltaKPQ mutant. This block was due, at least in-part, to enhanced steady-state inactivation, with half-inactivation potentials shifted by up to -17mV. Inactivation enhancement by ATX-II also persisted when conditioning depolarizations were abbreviated, and was unaffected by the additional presence of SDZ 201-106 consistent with these agents having unique interactions with DeltaKPQ Na(+) channels. It is concluded that the toxin-binding sites for ATX-II and SDZ 201-106 have allosteric effects converging on a common path affecting steady-state inactivation of DeltaKPQ I(Na). Pharmacological modulation of this path to increase inactivation in mutant Na(+) channels could potentially produce therapeutic benefits.

  16. Sinus node dysfunction in ATX-II-induced in-vitro murine model of long QT3 syndrome and rescue effect of ranolazine. (United States)

    Wu, Jingjing; Cheng, Longxian; Lammers, Wim J; Wu, Lin; Wang, Xin; Shryock, John C; Belardinelli, Luiz; Lei, Ming


    The aim of this study was to characterize the role of the late Na+ current (I(Na,L)) as a mechanism for induction of both tachy and bradyarrhythmias in murine heart and sino-atrial node tissue. The sea anemone toxin ATX-II and ranolazine were used to increase and inhibit, respectively, I(Na,L). In sixteen hearts studied, exposure to 1-10nM ATX-II caused a slowing of intrinsic heart rate and prolongations of the P-R and QT intervals, the duration of the monophasic action potential, and the sinus node recovery time, accompanied by frequent occurrences of early after depolarisations, delayed after depolarisations and rapid, repetitive ventricular tachy and sino-atrial bradyarrhythmias. ATX-II also slowed sinus node pacemaking, and induced bradycardic arrhythmias in isolated sino-atrial preparations (n=5). The ATX-II-induced alteration of electrophysiological properties and occurrence of arrhythmic events were significantly attenuated by 10 microM ranolazine in intact hearts (n=11) and isolated sino-atrial preparations (n=5). In conclusion, the I(Na,L) enhancer ATX-II causes both tachy and bradyarrhythmias in the murine heart, and these arrhythmias are markedly attenuated by the I(Na,L) blocker, ranolazine (10 microM). The results suggest that I(Na,L) blockade may be the mechanism underlying the reductions of both brady and tachyarrhythmias by ranolazine that were observed during the MERLIN-TIMI clinical outcomes trial.

  17. Mutation Breeding of various spray chrysanthemum cultivars by gamma-ray irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sang Hoon; Chung, Sung Jin; Kim, Dong Sub; Kim, Jin Baek; Kang, Si Yong [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Lee, Geung Joo [Mokpo National University, Muan (Korea, Republic of)


    This study was carried out to analyze mutation rate and spectrum of chrysanthemum by gamma-ray irradiation. Five flower types, 16 cultivars including 'Geumsu', 'Hwiparam', 'Ilwol', 'Magic', 'Moonlight', 'Noblewine', 'Pinky', 'Progy', 'Sangtte', 'Waterfog', 'Whitneypangpang', 'Yelloweye', 'Yellowpangpang', 'Yesmiso', 'Yesmorning', and 'Yestogether' were irradiated as 30, 50, and 70 Gy dose during 24 hours. As a result, mutation rate was identified as the highest in single type among five flower types, but there was a little difference according to cultivars. Mutation rate was increased in proportion to irradiation dose in anemone, pompon, and spider type cultivars, but there wasn't clear in single and semi-double type cultivars. Mutation spectrum was identified as the highest in the cultivar 'Noblewine'. The most sensitive cultivars to radiation were revealed as 'Noblewine' and 'Yesmorning' and the least were Moonlight', 'Waterfog', and 'Yellowpangpang'. Consequently, there was much difference in radio-sensitivity according to cultivars of chrysanthemum and flower type was correlated a little with mutation rate.

  18. Chromophore Deprotonation State Alters the Optical Properties of Blue Chromoprotein.

    Directory of Open Access Journals (Sweden)

    Cheng-Yi Chiang

    Full Text Available Chromoproteins (CPs have unique colors and can be used in biological applications. In this work, a novel blue CP with a maximum absorption peak (λmax at 608 nm was identified from the carpet anemone Stichodactyla gigantea (sgBP. In vivo expression of sgBP in zebrafish would change the appearance of the fishes to have a blue color, indicating the potential biomarker function. To enhance the color properties, the crystal structure of sgBP at 2.25 Å resolution was determined to allow structure-based protein engineering. Among the mutations conducted in the Gln-Tyr-Gly chromophore and chromophore environment, a S157C mutation shifted the λmax to 604 nm with an extinction coefficient (ε of 58,029 M-1·cm-1 and darkened the blue color expression. The S157C mutation in the sgBP chromophore environment could affect the color expression by altering the deprotonation state of the phenolic group in the chromophore. Our results provide a structural basis for the blue color enhancement of the biomarker development.

  19. Genetic diversity of giant clams (Tridacna spp.) and their associated Symbiodinium in the central Red Sea

    KAUST Repository

    Pappas, Melissa


    The biodiversity of the Red Sea remains relatively understudied, particularly for invertebrate taxa. Documenting present patterns of biodiversity is essential for better understanding Red Sea reef ecosystems and how these ecosystems may be impacted by stressors (such as fishing and climate change). Several species of giant clams (genus Tridacna) are reported from the Red Sea, although the majority of research effort has occurred in the Gulf of Aqaba. We investigated the genetic diversity (16S rDNA) of the Tridacna species found in the central Saudi Arabian Red Sea. We also investigated the genetic diversity (ITS rDNA) of symbiotic dinoflagellates Symbiodinium associated with these clams. Samples were collected from nine reefs on a cross-shelf gradient near Thuwal, Saudi Arabia. Two species, T. squamosa and T. maxima, were recorded, with the latter being the most abundant. Tridacna squamosina, a species recently reported in the northern Red Sea, was not found, suggesting that this species is not present or is very rare in our study region. All tridacnids sampled were found to harbor Symbiodinium grouped in Clade A, considered an opportunistic, heat-tolerant symbiont group in anemones and corals. The consistent association with Clade A Symbiodinium in central Red Sea tridacnids may reflect the consequence of adaptation to the relatively extreme conditions of the Red Sea. This study contributes to an ever-growing catalog of Red Sea biodiversity and serves as important baseline information for a region experiencing dynamic pressures.

  20. Aquatic proteins with repetitive motifs provide insights to bioengineering of novel biomaterials. (United States)

    Yang, Yun Jung; Jung, Dooyup; Yang, Byeongseon; Hwang, Byeong Hee; Cha, Hyung Joon


    Proteins with repetitive motifs play vital structural and adhesive functions in nature. Some repeat proteins in particular have adapted to harsh aquatic surroundings to support the survival and reproduction of organisms. Significant effort has been made to identify aquatic repeat proteins with attractive properties and functions to be used as novel biomaterials. Examples of such proteins include matrix proteins from pearl oysters, minicollagens from sea anemones, cement proteins from sandcastle worms, and byssal proteins from marine mussels. Here, several repetitive motifs from aquatic proteins are reviewed, and their characteristic properties are linked to practical uses in three aspects of aquatic life: defense, shelter, and attachment. Some repetitive motifs interact with minerals and consequently generate strong outer cover of shells, and some motifs relate with sticky nature, which contribute to organisms' habitation by adhering themselves in harsh aquatic environments. Other motifs, such as silk- or collagen-like motifs, are also involved in structural rigidity as shown in mussel's byssus and egg membrane. Thus, understanding aquatic repetitive motifs will provide clues about biomedical and biotechnological applications of engineered biomaterials in wet environments. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Coral larvae move toward reef sounds.

    Directory of Open Access Journals (Sweden)

    Mark J A Vermeij

    Full Text Available Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (<1 mm that influence settlement success are difficult to observe in situ and are therefore largely unknown. Here, we show that coral larvae respond to acoustic cues that may facilitate detection of habitat from large distances and from upcurrent of preferred settlement locations. Using in situ choice chambers, we found that settling coral larvae were attracted to reef sounds, produced mainly by fish and crustaceans, which we broadcast underwater using loudspeakers. Our discovery that coral larvae can detect and respond to sound is the first description of an auditory response in the invertebrate phylum Cnidaria, which includes jellyfish, anemones, and hydroids as well as corals. If, like settlement-stage reef fish and crustaceans, coral larvae use reef noise as a cue for orientation, the alleviation of noise pollution in the marine environment may gain further urgency.

  2. The ghost of fouling communities past: the effect of original community on subsequent recruitment. (United States)

    Ralston, Emily A; Swain, Geoffrey W


    Biofouling on ships has been linked to the spread of invasive species, which has been identified as one of the current primary threats to the environment. Previous research on antifouling coatings suggested that the quantity of fouling, as well as community composition, on biocidal coatings was modified by prior fouling settlement. The experiment reported in this paper was designed to determine how preconditioning affected the rate and composition of subsequent fouling on transplanted silicone coatings. A series of 10 × 20 cm panels coated with Intersleek 700 or DC3140 were placed at three locations in Florida (Ponce Inlet, Sebastian Inlet, and Port of Miami), which were characterized by distinct fouling communities. Panels were immersed for four months, cleaned, and reciprocally transplanted among the three sites. Fouling community composition and coverage were characterized at bimonthly intervals both before and after transplantation. The original fouling community affected the subsequent fouling composition and recolonization by tunicates, sea anemones, barnacles, sponges, hydroids, and arborescent bryozoans. The community-level effects were short-term, lasting 2-4 months, but specific responses lasted up to 14 months post-transplant.

  3. Characterisation of nitric oxide synthase in three cnidarian-dinoflagellate symbioses.

    Directory of Open Access Journals (Sweden)

    Helena Safavi-Hemami

    Full Text Available BACKGROUND: Nitric oxide synthase (NOS is an enzyme catalysing the conversion of L-arginine to L-citrulline and nitric oxide (NO, the latter being an essential messenger molecule for a range of biological processes. Whilst its role in higher vertebrates is well understood little is known about the role of this enzyme in early metazoan groups. For instance, NOS-mediated signalling has been associated with Cnidaria-algal symbioses, however controversy remains about the contribution of enzyme activities by the individual partners of these mutualistic relationships. METHODOLOGY/PRINCIPAL FINDINGS: Using a modified citrulline assay we successfully measured NOS activity in three cnidarian-algal symbioses: the sea anemone Aiptasia pallida, the hard coral Acropora millepora, and the soft coral Lobophytum pauciflorum, so demonstrating a wide distribution of this enzyme in the phylum Cnidaria. Further biochemical (citrulline assay and histochemical (NADPH-diaphorase investigations of NOS in the host tissue of L. pauciflorum revealed the cytosolic and calcium dependent nature of this enzyme and its in situ localisation within the coral's gastrodermal tissue, the innermost layer of the body wall bearing the symbiotic algae. Interestingly, enzyme activity could not be detected in symbionts freshly isolated from the cnidarians, or in cultured algal symbionts. CONCLUSIONS/SIGNIFICANCE: These results suggest that NOS-mediated NO release may be host-derived, a finding that has the potential to further refine our understanding of signalling events in cnidarian-algal symbioses.

  4. Evidence for miRNA-mediated modulation of the host transcriptome in cnidarian-dinoflagellate symbiosis

    KAUST Repository

    Baumgarten, Sebastian


    Reef-building corals and other cnidarians living in symbiotic relationships with intracellular, photosynthetic dinoflagellates in the genus Symbiodinium undergo transcriptomic changes during infection with the algae and maintenance of the endosymbiont population. However, the precise regulatory mechanisms modulating the host transcriptome are unknown. Here we report apparent post-transcriptional gene regulation by miRNAs in the sea anemone Aiptasia, a model system for cnidarian-dinoflagellate endosymbiosis. Aiptasia encodes mainly species-specific miRNAs, and there appears to have been recent differentiation within the Aiptasia genome of miRNAs that are commonly conserved among anthozoan cnidarians. Analysis of miRNA expression showed that both conserved and species-specific miRNAs are differentially expressed in response to endosymbiont infection. Using cross-linking immunoprecipitation of Argonaute, the central protein of the miRNA-induced silencing complex, we identified miRNA binding sites on a transcriptome-wide scale and found that the targets of the miRNAs regulated in response to symbiosis include genes previously implicated in biological processes related to Symbiodinium infection. Our study shows that cnidarian miRNAs recognize their mRNA targets via high-complementarity target binding and suggests that miRNA-mediated modulations of genes and pathways are important during the onset and maintenance of cnidarian-dinoflagellate endosymbiosis. This article is protected by copyright. All rights reserved.

  5. Human risk associated with palytoxin exposure. (United States)

    Deeds, Jonathan R; Schwartz, Michael D


    Palytoxin (PTX) was first isolated from the zoanthid Palythoa toxica. Evaluation of PTX toxicity using various animal models determined that PTX was extremely potent through intravenous, intraperitoneal, and intratracheal exposure. PTX was less potent by direct intragastric exposure. PTX also caused significant, non-lethal effects through dermal and ocular exposure. PTX and PTX-like compounds have now been found in additional zoanthid species, red alga, a sea anemone, and several dinoflagellates. PTXs are found throughout certain reef associated food webs, including in fish and crabs responsible for human illness and death. Many of the organisms found to contain PTXs in the environment are also sold in the home aquarium trade, and recent evidence suggests poisonings have occurred through exposure to these organisms. Due to co-occurrence with other seafood toxins, such as ciguatoxins, saxitoxins, and tetrodotoxin, it has been difficult to assess the true risk of PTX poisoning through seafood consumption in humans, but limited cases have been well documented, some involving human fatalities. Recent evidence also suggests that humans are negatively impacted through PTX exposure by inhalation and dermal routes. Continued research into the distribution and occurrence of PTX and PTX-like compounds both in seafood and marine organisms sold in the aquarium trade appears warranted. Published by Elsevier Ltd.

  6. A purified Palythoa venom fraction delays sodium current inactivation in sympathetic neurons. (United States)

    Lazcano-Pérez, Fernando; Vivas, Oscar; Román-González, Sergio A; Rodríguez-Bustamante, Eduardo; Castro, Héctor; Arenas, Isabel; García, David E; Sánchez-Puig, Nuria; Arreguín-Espinosa, Roberto


    Palythoa caribaeorum is a zoanthid (Phylum Cnidaria, class Anthozoa) commonly found in shallow waters of coral reefs along the Mexican Atlantic coast. Little is known on the pharmacological and biochemical properties of the venom components of this animal group. Toxin peptides from other cnidarian venoms, like sea anemones, target sodium and potassium voltage-gated channels. In this study, we tested the activity of a low molecular weight fraction from the venom of P. caribaeorum on voltage-gated sodium channels of the superior cervical ganglion (SCG) neurons of the rat. Our results showed that this fraction delays tetrodotoxin (TTX)-sensitive sodium channel inactivation indicated by a reversible 2-fold increase of the current at the decay. A peptide responsible for this activity was isolated and characterized. Its sequence showed that it does not resemble any previously reported toxin. Together, these results evidence the presence of neurotoxins in P. caribaeorum that act on sodium channels. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Zoanthamine-Type Alkaloids from the Zoanthid Zoanthus kuroshio Collected in Taiwan and Their Effects on Inflammation. (United States)

    Hsu, Yu-Ming; Chang, Fang-Rong; Lo, I-Wen; Lai, Kuei-Hung; El-Shazly, Mohamed; Wu, Tung-Ying; Du, Ying-Chi; Hwang, Tsong-Long; Cheng, Yuan-Bin; Wu, Yang-Chang


    Zoanthus kuroshio is a colorful zoanthid with a fluorescent pink oral disc and brown tentacles, which dominates certain parts of the Taiwanese and Japanese coasts. This sea anemone is a rich source of biologically active alkaloids. In the current investigation, two novel halogenated zoanthamines [5α-iodozoanthenamine (1) and 11β-chloro-11-deoxykuroshine A (2)], along with four new zoanthamines [18-epi-kuroshine A (3), 7α-hydroxykuroshine E (4), 5α-methoxykuroshine E (5), and 18-epi-kuroshine E (6)], and six known compounds were isolated from Z. kuroshio. Compounds 1 and 2 are the first examples of halogenated zoanthamine-type alkaloids isolated from nature. Compounds 3 and 6 are the first zoanthamine stereoisomers with a cis-junction of the A/B rings. All isolated compounds were evaluated for their anti-inflammatory activities by measuring their effects on superoxide anion generation and elastase release by human neutrophils in response to fMLP.

  8. Sterol patterns of cultured zooxanthellae isolated from marine invertebrates: Synthesis of gorgosterol and 23-desmethylgorgosterol by aposymbiotic algae. (United States)

    Withers, N W; Kokke, W C; Fenical, W; Djerassi, C


    QUANTITATIVE STEROL COMPOSITIONS OF CULTURED ZOOXANTHELLAE ISOLATED FROM VARIOUS PACIFIC AND ATLANTIC INVERTEBRATE HOSTS: Zoanthus sociatus (a zoanthid), Oculina diffusa (a scleractian coral), Tridacna gigas (a giant clam), Melibe pilosa (a nudibranch), and Aiptasia pulchella (a sea anemone) are reported. The results clearly demonstrate large differences in sterol patterns of zooxanthellae and that there is no obvious relationship between the taxonomic affiliation of the host and the sterol pattern of its isolated symbiont. The sterols of the zooxanthellae of O. diffusa (Cnidaria) and T. gigas (Mollusca) are qualitatively equivalent. Based on the structures of the two major free sterols synthesized by each alga, the zooxanthellae from different hosts were separated into three distinct groups. It was also found that an aposymbiotic alga can synthesize the unique marine sterols gorgosterol and 23-desmethylgorgosterol. Most of the sterols were identified by using mass spectroscopy and 360-MHz proton magnetic resonance. Spectroscopic data are reported for four novel sterols-(23,24R)-dimethyl-5alpha-cholest-(22E)-en-3beta-o l, 23-methyl-5alpha-cholest-22E-en-3beta-ol, cholesta-5,14-dien-3beta-ol, and 4alpha-methyl-5alpha-cholesta-8(14)-24-dien-3beta-ol.

  9. Palytoxin found in Palythoa sp. zoanthids (Anthozoa, Hexacorallia sold in the home aquarium trade.

    Directory of Open Access Journals (Sweden)

    Jonathan R Deeds


    Full Text Available Zoanthids (Anthozoa, Hexacorallia are colonial anemones that contain one of the deadliest toxins ever discovered, palytoxin (LD(50 in mice 300 ng/kg, but it is generally believed that highly toxic species are not sold in the home aquarium trade. We previously showed that an unintentionally introduced zoanthid in a home aquarium contained high concentrations of palytoxin and was likely responsible for a severe respiratory reaction when an individual attempted to eliminate the contaminant colonies using boiling water. To assess the availability and potential exposure of palytoxin to marine aquarium hobbyists, we analyzed zoanthid samples collected from local aquarium stores for palytoxin using liquid chromatography and high resolution mass spectrometry and attempted to identify the specimens through genetic analysis of 16S and cytochrome c oxidase 1 (COI markers. We found four specimens of the same apparent species of zoanthid, that we described previously to be responsible for a severe respiratory reaction in a home aquarium, to be available in three aquarium stores in the Washington D.C. area. We found all of these specimens (n = 4 to be highly toxic with palytoxin or palytoxin-like compounds (range 0.5-3.5 mg crude toxin/g zoanthid. One of the most potent non-protein compounds ever discovered is present in dangerous quantities in a select species of zoanthid commonly sold in the home aquarium trade.

  10. The synthesis of mycosporine-like amino acids (MAAs) by cultured, symbiotic dinoflagellates. (United States)

    T Banaszak1 A; LaJeunesse; Trench


    We tested the hypothesis that there is a relation between phylotypes (phylogenetic types, as determined by restriction fragment length polymorphism (RFLP) and partial sequence analysis of the small subunit ribosomal RNA gene (SSUrDNA)) and the synthesis of mycosporine-like amino acids (MAAs) by symbiotic dinoflagellates under the influence of ultraviolet radiation (UV-B/A) and photosynthetically active radiation (PAR). We exposed 27 isolates of symbiotic dinoflagellates simultaneously to UV-B/A and PAR, and subsequently determined the MAAs present in cell extracts and in the media. The algae used included 24 isolates of Symbiodinium spp. originating from jellyfishes, sea anemones, zoanthids, scleractinians, octocorals, and bivalves, and three others in the genera Gymnodinium, Gloeodinium and Amphidinium from a jellyfish, an hydrocoral and a flatworm, respectively. In this study, all of the phylotype A Symbiodinium spp. synthesized up to three identified MAAs. None of the 11 cultured phylotypes B and C Symbiodinium spp. synthesized MAAs. The three non-Symbiodinium symbionts also synthesized up to three MAAs. The results support a conclusion that phylotype A Symbiodinium spp. have a high predilection for the synthesis of MAAs, while phylotypes B and C do not. Synthesis of MAAs by symbiotic dinoflagellates in culture does not appear to relate directly to depths or to the UV exposure regimes from which the consortia were collected.

  11. Pyrosequencing reveals diverse microbial community associated with the zoanthid Palythoa australiae from the South China Sea. (United States)

    Sun, Wei; Zhang, Fengli; He, Liming; Li, Zhiyong


    Diverse sessile organisms inhabit the coral reef ecosystems, including corals, sponges, and sea anemones. In the past decades, scleractinian corals (Cnidaria, Anthozoa, Scleractinia) and their associated microorganisms have attracted much attention. Zoanthids (Cnidaria, Anthozoa, Zoanthidea) are commonly found in coral reefs. However, little is known about the community structure of zoanthid-associated microbiota. In this study, the microbial community associated with the zoanthid Palythoa australiae in the South China Sea was investigated by 454 pyrosequencing. As a result, 2,353 bacterial, 583 archaeal, and 36 eukaryotic microbial ribotypes were detected, respectively. A total of 22 bacterial phyla (16 formally described phyla and six candidate phyla) were recovered. Proteobacteria was the most abundant group, followed by Chloroflexi and Actinobacteria. High-abundance Rhizobiales and diverse Chloroflexi were observed in the bacterial community. The archaeal population was composed of Crenarchaeota and Euryarchaeota, with Marine Group I as the dominant lineage. In particular, Candidatus Nitrosopumilus dominated the archaeal community. Besides bacteria and archaea, the zoanthid harbored eukaryotic microorganisms including fungi and algae though their diversity was very low. This study provided the first insights into the microbial community associated with P. australiae by 454 pyrosequencing, consequently laid a basis for the understanding of the association of P. australiae-microbes symbioses.

  12. Palytoxin found in Palythoa sp. zoanthids (Anthozoa, Hexacorallia) sold in the home aquarium trade. (United States)

    Deeds, Jonathan R; Handy, Sara M; White, Kevin D; Reimer, James D


    Zoanthids (Anthozoa, Hexacorallia) are colonial anemones that contain one of the deadliest toxins ever discovered, palytoxin (LD(50) in mice 300 ng/kg), but it is generally believed that highly toxic species are not sold in the home aquarium trade. We previously showed that an unintentionally introduced zoanthid in a home aquarium contained high concentrations of palytoxin and was likely responsible for a severe respiratory reaction when an individual attempted to eliminate the contaminant colonies using boiling water. To assess the availability and potential exposure of palytoxin to marine aquarium hobbyists, we analyzed zoanthid samples collected from local aquarium stores for palytoxin using liquid chromatography and high resolution mass spectrometry and attempted to identify the specimens through genetic analysis of 16S and cytochrome c oxidase 1 (COI) markers. We found four specimens of the same apparent species of zoanthid, that we described previously to be responsible for a severe respiratory reaction in a home aquarium, to be available in three aquarium stores in the Washington D.C. area. We found all of these specimens (n = 4) to be highly toxic with palytoxin or palytoxin-like compounds (range 0.5-3.5 mg crude toxin/g zoanthid). One of the most potent non-protein compounds ever discovered is present in dangerous quantities in a select species of zoanthid commonly sold in the home aquarium trade.

  13. [Intoxications specific to the Aquitaine region]. (United States)

    Bédry, R; Gromb, S


    Some intoxications are more specifically linked to the Aquitaine region than to other regions of France, due to environmental circumstances (fauna, flora, climate) or traditional activities (gastronomy). Three types of intoxications are particular in this area. Pine processionary caterpillar envenomations (Thaumetopoea pityocampa), a Southern Europe pinewood parasite, are frequently encountered in the Landes' forest. They are responsible of ocular and/or skin lesions with urticaria or contact dermatitis, seldom associated with immediate IgE hypersensitivity. According to the south Atlantic coastal region geology and the marine streams, venomous marine animals are mainly located in Charente-Maritime for jellyfish, in Gironde and in Landes for weeverfish and in Atlantic Pyrenees for sea anemone. Usually not dangerous, first-aid workers treat most cases of these envenomations. Some endemic mushrooms (Tricholoma auratum) which grow on the dunes of the Atlantic coastal region, are usually considered as very good comestibles, but were recently responsible for serious intoxications: T.auratum was responsible of several cases of rhabdomyolysis, without neurological involvement, nor renal or hepatic lesion. Three deaths were notified. Animal studies confirmed the responsibility of the mushrooms.

  14. Unipotent progenitors contribute to the generation of sensory cell types in the nervous system of the cnidarian Nematostella vectensis. (United States)

    Busengdal, Henriette; Rentzsch, Fabian


    Nervous systems often consist of a large number of different types of neurons which are generated from neural stem and progenitor cells by a series of symmetric and asymmetric divisions. The origin and early evolution of these neural progenitor systems is not well understood. Here we use a cnidarian model organism, Nematostella vectensis, to gain insight into the generation of neural cell type diversity in a non-bilaterian animal. We identify NvFoxQ2d as a transcription factor that is expressed in a population of spatially restricted, proliferating ectodermal cells that are derived from NvSoxB(2)-expressing neural progenitor cells. Using a transgenic reporter line we show that the NvFoxQ2d cells undergo a terminal, symmetric division to generate a morphologically homogeneous population of putative sensory cells. The abundance of these cells, but not their proliferation status is affected by treatment with the γ-secretase inhibitor DAPT, suggesting regulation by Notch signalling. Our data suggest that intermediate progenitor cells and symmetric divisions contribute to the formation of the seemingly simple nervous system of a sea anemone. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Sicily in D.H. Lawrence’s Imagery

    Directory of Open Access Journals (Sweden)

    Carla Comellini


    Full Text Available D.H. Lawrence, who spent two years in Sicily, precisely in Fontana Vecchia, near Taormina and Aetna (where the God Vulcan used to live, has always been fascinated by Italy and Sicily in particular, the places where, in his opinion, most myths are rooted. His fascination for Sicily is due both to the sculpture of The Seated Demeter or Core, that he saw in the archaeological Museum in Syracuse, and to the Sicilians, described “as handsome as Adonis”, and who seem to manifest and share the sexual energy usually connected to Pan and Dionysus. The image of Sicily recurs in D.H. Lawrence’s entire production, often indirectly suggested by images such as: the volcanoes, the mythical Sicilian monsters “Scylla and Charybdis”, and the references to the Myth of Pluto and Persephone, which took place in Enna, as told in his poem "Purple Anemones" (in Birds, Beasts and Flowers. Moreover, his novella Sun deals with the flourishing Mediterranean landscape of Sicily, with Aetna in the distance, and the memory of the Sicules, the archaic inhabitants of the island. It is also worth mentioning that D.H. Lawrence translated several works by the Sicilian Giovanni Verga: from Mastro-Don Gesualdo (1923 to Cavalleria Rusticana and Other Stories (1928.

  16. Novel venom gene discovery in the platypus. (United States)

    Whittington, Camilla M; Papenfuss, Anthony T; Locke, Devin P; Mardis, Elaine R; Wilson, Richard K; Abubucker, Sahar; Mitreva, Makedonka; Wong, Emily S W; Hsu, Arthur L; Kuchel, Philip W; Belov, Katherine; Warren, Wesley C


    To date, few peptides in the complex mixture of platypus venom have been identified and sequenced, in part due to the limited amounts of platypus venom available to study. We have constructed and sequenced a cDNA library from an active platypus venom gland to identify the remaining components. We identified 83 novel putative platypus venom genes from 13 toxin families, which are homologous to known toxins from a wide range of vertebrates (fish, reptiles, insectivores) and invertebrates (spiders, sea anemones, starfish). A number of these are expressed in tissues other than the venom gland, and at least three of these families (those with homology to toxins from distant invertebrates) may play non-toxin roles. Thus, further functional testing is required to confirm venom activity. However, the presence of similar putative toxins in such widely divergent species provides further evidence for the hypothesis that there are certain protein families that are selected preferentially during evolution to become venom peptides. We have also used homology with known proteins to speculate on the contributions of each venom component to the symptoms of platypus envenomation. This study represents a step towards fully characterizing the first mammal venom transcriptome. We have found similarities between putative platypus toxins and those of a number of unrelated species, providing insight into the evolution of mammalian venom.

  17. Draft genomes of the corallimorpharians Amplexidiscus fenestrafer and Discosoma sp

    KAUST Repository

    Wang, Xin


    Corallimorpharia are the closest non-calcifying relatives of reef-building corals. Aside from their popularity among aquarium hobbyists, their evolutionary position between the Actiniaria (sea anemones) and the Scleractinia (hard corals) makes them ideal candidates for comparative studies aiming at understanding the evolution of hexacorallian orders in general and reef-building corals in particular. Here we have sequenced and assembled two draft genomes for the Corallimorpharia species Amplexidiscus fenestrafer and Discosoma sp.. The draft genomes encompass 370 Mbp and 445 Mbp respectively and encode for 21,372 and 23,199 genes. To facilitate future studies using these resources, we provide annotations for the predicted gene models-not only at gene level, by annotating gene models with the function of the best-matching homolog, and GO terms when available; but also at protein domain level, where gene function can be better verified through the conservation of the sequence and order of protein domains. Further, we provide an online platform (, which includes a BLAST interface as well as a genome browser to facilitate the use of these resources. We believe that these two genomes are important resources for future studies on hexacorallian systematics and the evolutionary basis of their specific traits such as the symbiotic relationship with dinoflagellates of the genus Symbiodinium or the evolution of calcification in reef-building corals. This article is protected by copyright. All rights reserved.

  18. RUNX in Invertebrates. (United States)

    Hughes, S; Woollard, A


    Runx genes have been identified in all metazoans and considerable conservation of function observed across a wide range of phyla. Thus, insight gained from studying simple model organisms is invaluable in understanding RUNX biology in higher animals. Consequently, this chapter will focus on the Runx genes in the diploblasts, which includes sea anemones and sponges, as well as the lower triploblasts, including the sea urchin, nematode, planaria and insect. Due to the high degree of functional redundancy amongst vertebrate Runx genes, simpler model organisms with a solo Runx gene, like C. elegans, are invaluable systems in which to probe the molecular basis of RUNX function within a whole organism. Additionally, comparative analyses of Runx sequence and function allows for the development of novel evolutionary insights. Strikingly, recent data has emerged that reveals the presence of a Runx gene in a protist, demonstrating even more widespread occurrence of Runx genes than was previously thought. This review will summarize recent progress in using invertebrate organisms to investigate RUNX function during development and regeneration, highlighting emerging unifying themes.

  19. Dinosaur footprints and other ichnofauna from the cretaceous Kem Kem beds of Morocco. (United States)

    Ibrahim, Nizar; Varricchio, David J; Sereno, Paul C; Wilson, Jeffery A; Wilson, Jeff A; Dutheil, Didier B; Martill, David M; Baidder, Lahssen; Zouhri, Samir


    We describe an extensive ichnofossil assemblage from the likely Cenomanian-age 'lower' and 'upper' units of the 'Kem Kem beds' in southeastern Morocco. In the lower unit, trace fossils include narrow vertical burrows in cross-bedded sandstones and borings in dinosaur bone, with the latter identified as the insect ichnotaxon Cubiculum ornatus. In the upper unit, several horizons preserve abundant footprints from theropod dinosaurs. Sauropod and ornithischian footprints are much rarer, similar to the record for fossil bone and teeth in the Kem Kem assemblage. The upper unit also preserves a variety of invertebrate traces including Conichnus (the resting trace of a sea-anemone), Scolicia (a gastropod trace), Beaconites (a probable annelid burrow), and subvertical burrows likely created by crabs for residence and detrital feeding on a tidal flat. The ichnofossil assemblage from the Upper Cretaceous Kem Kem beds contributes evidence for a transition from predominantly terrestrial to marine deposition. Body fossil and ichnofossil records together provide a detailed view of faunal diversity and local conditions within a fluvial and deltaic depositional setting on the northwestern coast of Africa toward the end of the Cretaceous.

  20. Giant deep-sea protist produces bilaterian-like traces. (United States)

    Matz, Mikhail V; Frank, Tamara M; Marshall, N Justin; Widder, Edith A; Johnsen, Sönke


    One of the strongest paleontological arguments in favor of the origin of bilaterally symmetrical animals (Bilateria) prior to their obvious and explosive appearance in the fossil record in the early Cambrian, 542 million years ago, is the occurrence of trace fossils shaped like elongated sinuous grooves or furrows in the Precambrian. Being restricted to the seafloor surface, these traces are relatively rare and of limited diversity, and they do not show any evidence of the use of hard appendages. They are commonly attributed to the activity of the early nonskeletonized bilaterians or, alternatively, large cnidarians such as sea anemones or sea pens. Here we describe macroscopic groove-like traces produced by a living giant protist and show that these traces bear a remarkable resemblance to the Precambrian trace fossils, including those as old as 1.8 billion years. This is the first evidence that organisms other than multicellular animals can produce such traces, and it prompts re-evaluation of the significance of Precambrian trace fossils as evidence of the early diversification of Bilateria. Our observations also render indirect support to the highly controversial interpretation of the enigmatic Ediacaran biota of the late Precambrian as giant protists.

  1. Dinosaur footprints and other ichnofauna from the cretaceous Kem Kem beds of Morocco.

    Directory of Open Access Journals (Sweden)

    Nizar Ibrahim

    Full Text Available We describe an extensive ichnofossil assemblage from the likely Cenomanian-age 'lower' and 'upper' units of the 'Kem Kem beds' in southeastern Morocco. In the lower unit, trace fossils include narrow vertical burrows in cross-bedded sandstones and borings in dinosaur bone, with the latter identified as the insect ichnotaxon Cubiculum ornatus. In the upper unit, several horizons preserve abundant footprints from theropod dinosaurs. Sauropod and ornithischian footprints are much rarer, similar to the record for fossil bone and teeth in the Kem Kem assemblage. The upper unit also preserves a variety of invertebrate traces including Conichnus (the resting trace of a sea-anemone, Scolicia (a gastropod trace, Beaconites (a probable annelid burrow, and subvertical burrows likely created by crabs for residence and detrital feeding on a tidal flat. The ichnofossil assemblage from the Upper Cretaceous Kem Kem beds contributes evidence for a transition from predominantly terrestrial to marine deposition. Body fossil and ichnofossil records together provide a detailed view of faunal diversity and local conditions within a fluvial and deltaic depositional setting on the northwestern coast of Africa toward the end of the Cretaceous.

  2. Sea-floor geology in central Rhode Island Sound south of Sakonnet Point, Rhode Island (United States)

    McMullen, K.Y.; Poppe, L.J.; Ackerman, S.D.; Worley, C.R.; Nadeau, M.A.; Van Hoy, M. V.


    The U.S. Geological Survey (USGS) and the National Oceanic and Atmospheric Administration (NOAA) are working together to study the sea floor along the northeastern coast of the United States. NOAA collected multibeam-echosounder data during hydrographic survey H11995 in a 63-square-kilometer area in central Rhode Island Sound, south of Sakonnet Point, Rhode Island. The USGS collected sediment samples, bottom video, and still photographs from 27 stations in this study area to verify an interpretation of the bathymetric data. Collected data are used to map areas of scour depressions and erosional outliers, megaripples, boulders, and relatively undisturbed modern marine sediments. In general, much of the eastern part of the study area, a submerged segment of the Harbor Hill-Roanoke Point-Charlestown-Buzzards Bay moraine, is bouldery. Bottom photography shows boulders are generally encrusted with hydrozoans, algae, and anemone. Scour depressions, presumably formed by long-period storm waves, and erosional outliers of Holocene sediments dominate the western part of the study area and several large areas in the east. The scour depressions tend to have coarser grained sediment than intervening erosional outliers. The coarseness likely creates turbulence in the water over these areas, which prevents fine-grained sediment deposition. Several small areas of megaripples are visible in the bathymetry data in the west. Other sandy areas are typically rippled, with burrows, worm tubes, and starfish present.

  3. Iridescence of a Marine Bacterium and Classification of Prokaryotic Structural Colors (United States)

    Vukusic, Peter; Luke, Stephen


    Iridescence is a property of structural color that is occasionally encountered in higher eukaryotes but that has been poorly documented in the prokaryotic kingdom. In the present work, we describe a marine bacterium, identified as Cellulophaga lytica, isolated from the surface of an anemone, that exhibits bright green iridescent colonies under direct epi-illumination. This phenomenon has not previously been investigated in detail. In this study, color changes of C. lytica colonies were observed at various angles of direct illumination or observation. Its iridescent green appearance was dominant on various growth media. Red and violet colors were also discerned on colony edges. Remarkable C. lytica bacterial iridescence was revealed and characterized using high-resolution optical spectrometry. In addition to this, by culturing other bacterial strains to which various forms of faintly iridescent traits have previously been attributed, we identify four principal appearance characteristics of structural color in prokaryotes. A new general classification of bacterial iridescence is therefore proposed in this study. Furthermore, a specific separate class is described for iridescent C. lytica strains because they exhibit what is so far a unique intense glitter-like iridescence in reflection. C. lytica is the first prokaryote discovered to produce the same sort of intense iridescence under direct illumination as that associated with higher eukaryotes, like some insects and birds. Due to the nature of bacterial biology, cultivation, and ubiquity, this discovery may be of significant interest for both ecological and nanoscience endeavors. PMID:22267664

  4. [Dangerous marine animals]. (United States)

    Antensteiner, G


    Sea-biological basic knowledge for divers is offered only in special lessons for advanced scuba divers. According to statistics, however, five per cent of the deadly diving accidents are caused by underwater organisms. This number could be reduced to a fraction, by correct behaviour during the dive and after an accident. The most frequent accidents with sea animals during water sports are not by unprovoked shark attacks, which cause six deaths world-wide per year on the average, but turn out with usually well camouflaged sea inhabitants, that do not attack humans, rather by their inadvertence coincidentally get in contact with it. The various defense instruments of the often small, inconspicuous organisms reach from teeth over poison stings, pricks, spines, scalpelles, nettle injections and chemical weapons up to poison arrows. Due to that variety of the maritime life, the most important representatives of its type are explained including severity level of the caused injury or contamination. Both, diagnostic position and therapy possibility are described as follows: 1. Porifera (sponge), 2. Hydrozoa (white weed, yellow flower head), Actinaria (sea anemones), 3. Conidae (cone shells), Tridocna (giant clam), octopoda (octopus), 4. Acanthaster planci (crown of thorns), Echinodea (sea urchins), Holothurioidea (sea cucumber), 5. Selachoidei (shark), Batoidei (Ray), Muraenidae (moray), Plotosidae (barbel eels), Synanciidae (stonefish), Scorpaenidae (scorpionfish), Pterois (lion fish), Sphyraena Spec. (barracuda), Balistidae (triggerfish), Ostracionidae (puffer).

  5. Structures of peptide families by nuclear magnetic resonance spectroscopy and distance geometry

    Energy Technology Data Exchange (ETDEWEB)

    Pease, J.H.


    The three dimensional structures of several small peptides were determined using a combination of {sup 1}H nuclear magnetic resonance (NMR) and distance geometry calculations. These techniques were found to be particularly helpful for analyzing structural differences between related peptides since all of the peptides' {sup 1}H NMR spectra are very similar. The structures of peptides from two separate classes are presented. Peptides in the first class are related to apamin, an 18 amino acid peptide toxin from honey bee venom. The {sup 1}H NMR assignments and secondary structure determination of apamin were done previously. Quantitative NMR measurements and distance geometry calculations were done to calculate apamin's three dimensional structure. Peptides in the second class are 48 amino acid toxins from the sea anemone Radianthus paumotensis. The {sup 1}H NMR assignments of toxin II were done previously. The {sup 1}H NMR assignments of toxin III and the distance geometry calculations for both peptides are presented.

  6. Relative Contributions of Various Cellular Mechanisms to Loss of Algae during Cnidarian Bleaching. (United States)

    Bieri, Tamaki; Onishi, Masayuki; Xiang, Tingting; Grossman, Arthur R; Pringle, John R


    When exposed to stress such as high seawater temperature, corals and other cnidarians can bleach due to loss of symbiotic algae from the host tissue and/or loss of pigments from the algae. Although the environmental conditions that trigger bleaching are reasonably well known, its cellular and molecular mechanisms are not well understood. Previous studies have reported the occurrence of at least four different cellular mechanisms for the loss of symbiotic algae from the host tissue: in situ degradation of algae, exocytic release of algae from the host, detachment of host cells containing algae, and death of host cells containing algae. The relative contributions of these several mechanisms to bleaching remain unclear, and it is also not known whether these relative contributions change in animals subjected to different types and/or durations of stresses. In this study, we used a clonal population of the small sea anemone Aiptasia, exposed individuals to various precisely controlled stress conditions, and quantitatively assessed the several possible bleaching mechanisms in parallel. Under all stress conditions tested, except for acute cold shock at 4°C, expulsion of intact algae from the host cells appeared to be by far the predominant mechanism of bleaching. During acute cold shock, in situ degradation of algae and host-cell detachment also became quantitatively significant, and the algae released under these conditions appeared to be severely damaged.

  7. Treating autoimmune disorders with venom-derived peptides. (United States)

    Shen, Bingzheng; Cao, Zhijian; Li, Wenxin; Sabatier, Jean-Marc; Wu, Yingliang


    The effective treatment of autoimmune diseases remains a challenge. Voltage-gated potassium Kv1.3 channels, which are expressed in lymphocytes, are a new therapeutic target for treating autoimmune disease. Consequently, Kv1.3 channel-inhibiting venom-derived peptides are a prospective resource for new drug discovery and clinical application. Area covered: Preclinical and clinical studies have produced a wealth of information on Kv1.3 channel-inhibiting venom-derived peptides, especially from venomous scorpions and sea anemones. This review highlights the advances in screening and design of these peptides with diverse structures and potencies. It focuses on representative strategies for improving peptide selectivity and discusses the preclinical research on those venom-derived peptides as well as their clinical developmental status. Expert opinion: Encouraging results indicate that peptides isolated from the venom of venomous animals are a large resource for discovering immunomodulators that act on Kv1.3 channels. Since the structural diversity of venom-derived peptides determines the variety of their pharmacological activities, the design and optimization of venom-peptides for improved Kv1.3 channel-specificity has been advanced through some representative strategies, such as peptide chemical modification, amino acid residue truncation and binding interface modulation. These advances should further accelerate research, development and the future clinical application of venom-derived peptides selectively targeting Kv1.3 channels.


    Directory of Open Access Journals (Sweden)

    Kamaluddin Kasim


    Full Text Available Banggai cardinal fish (Pterapogonkauderni, Koumans 1933 is uncommon example of a marine fish with distributed in small range area while being in highly exploited. This fish is in high demand as an ornamental fish. However, the information on the number of density is limited. An underwater visual fish census survey was conducted in June to July 2010 at 18 fishing sites around Banggai archipelago to estimate the density of the stock and assess the impact of fishing and habitat on density. The areas are divided into three main islands, namely Banggai Island, Peleng Island, Toropot-Tumbak-Labobo Island. The lowest density index of the P. kauderni recorded at Kindandal village on Peleng Island, 0.014 fish/m2while the highest abundance index of 3.0 fish/m2 found at Toropot village at Toropot Island. In three survey sites (Bonebaru and Toropot villages where the fishing activities are still ongoing, the density has declined compared to the survey conducted in 2004. Majority of the villages in Peleng Island have lower density compared with the other islands probably due to the degradation of microhabitat of P. kauderni. In many cases, microhabitat degradation might be as a result of collection of sea urchins and sea anemone for consumption by local community.

  9. Different transfer pathways of an organochlorine pesticide across marine tropical food webs assessed with stable isotope analysis.

    Directory of Open Access Journals (Sweden)

    Charlotte R Dromard

    Full Text Available Chlordecone is a persistent organochlorine pesticide used in the banana fields of the French West Indies from 1972 to 1993. Three marine habitats (mangroves, seagrass beds and coral reefs of two study sites located downstream contaminated rivers were chosen to evaluate the level of contamination of marine food webs. On each habitat, the food chain collected included suspended organic matter, primary producers (macroalgae, algal turf, seagrass, zooplankton, symbiotic organisms (corals, sea anemones, primary consumers (herbivores, suspension feeders, biofilm feeders, omnivores and detritivores (lobsters, fish, secondary consumers (carnivores 1: invertebrate feeders, planktivores and tertiary consumers (carnivores 2: invertebrate and fish feeders, piscivores. Log-linear regressions of the concentrations of chlordecone versus nitrogen isotopic ratios (δ15N were used to assess the bioaccumulation of chlordecone along trophic food webs. At each site, bioconcentration and bioamplification take part on the transfer of chlordecone in marine organisms. In mangroves (i.e. close to the source of pollution, lower trophic magnification factors (TMF indicated that bioconcentration prevailed over bioamplification phenomenon. The opposite phenomenon appeared on coral reefs in which bioconcentration processes were less important and bioamplification pathway became dominant. Far from the source of pollution, molecules of chlordecone seemed to be transfered to organisms mostly via trophic interactions rather than water contact.

  10. Fuel performance under normal PWR conditions: A review of relevant experimental results and models

    International Nuclear Information System (INIS)

    Charles, M.; Lemaignan, C.


    Experiments conducted at Grenoble (CEA/DRN) over the past 20 years in the field of nuclear fuel behaviour are reviewed. Of particular concern is the need to achieve a comprehensive understanding of and subsequently overcome the limitations associated with high burnup and load-following conditions (pellet-cladding interaction (PCI), fission gas release (FGR), water-side corrosion). A general view is given of the organization of research work as well as some ecperimental details (irradiation, postirradiation examination - PIE). Based on various experimental programmes (Cyrano, Medicis, Anemone, Furet, Tango, Contact, Cansar, Hatac, Flog, Decor), the main contributions of the thermomechanical behaviour of a PWR fuel rod are described: thermal conductivity, in-pile densification, swelling, fission gas release in steady state and moderate transient conditions, gap thermal conductance, formation of primary and secondary ridges under PCI conditions. Specific programmes (Gdgrif, Thermox, Grimox) are devoted to the behaviour of particular fuels (gadolinia-bearing fuel, MOX fuel). Moreover, microstructure-based studies have been undertaken on fission gas release (fine analysis of the bubble population inside irradiated fuel samples), and on cladding behaviour (PCI related studies on stress-corrosion cracking (SCC), irradiation effects on ziraloy microstructure). (orig.)

  11. What Hydra can teach us about chemical ecology -how a simple, soft organism survives in a hostile aqueous environment. (United States)

    Rachamim, Tamar; Sher, Daniel


    Hydra and its fellow cnidarians - sea anemones, corals and jellyfish - are simple, mostly sessile animals that depend on bioactive chemicals for survival. In this review, we briefly describe what is known about the chemical armament of Hydra, and detail future research directions where Hydra can help illuminate major questions in chemical ecology, pharmacology, developmental biology and evolution. Focusing on two groups of putative toxins from Hydra - phospholipase A2s and proteins containing ShK and zinc metalloprotease domains, we ask: how do different venom components act together during prey paralysis? How is a venom arsenal created and how does it evolve? How is the chemical arsenal delivered to its target? To what extent does a chemical and biotic coupling exist between an organism and its environment? We propose a model whereby in Hydra and other cnidarians, bioactive compounds are secreted both as localized point sources (nematocyte discharges) and across extensive body surfaces, likely combining to create complex "chemical landscapes". We speculate that these cnidarian-derived chemical landscapes may affect the surrounding community on scales from microns to, in the case of coral reefs, hundreds of kilometers.

  12. Hydra actinoporin-like toxin-1, an unusual hemolysin from the nematocyst venom of Hydra magnipapillata which belongs to an extended gene family. (United States)

    Glasser, Eliezra; Rachamim, Tamar; Aharonovich, Dikla; Sher, Daniel


    Cnidarians rely on their nematocysts and the venom injected through these unique weaponry systems to catch prey and protect themselves from predators. The development and physiology of the nematocysts of Hydra magnipapillata, a classic model organism, have been intensively studied, yet the composition and biochemical activity of their venom components are mostly unknown. Here, we show that hydra actinoporin-like toxins (HALTs), which have previously been associated with Hydra nematocysts, belong to a multigene family comprising six genes, which have diverged from a single common ancestor. All six genes are expressed in a population of Hydra magnipapillata. When expressed recombinantly, HALT-1 (Δ-HYTX-Hma1a), an actinoporin-like protein found in the stenoteles (the main penetrating nematocysts used in prey capture), reveals hemolytic activity, albeit about two-thirds lower than that of the anemone actinoporin equinatoxin II (EqTII, Δ-AITX-Aeq1a). HALT-1 also differs from EqTII in the size of its pores, and likely does not utilize sphingomyelin as a membrane receptor. We describe features of the HALT-1 sequence which may contribute to this difference in activity, and speculate on the role of this unusual family of pore-forming toxins in the ecology of Hydra. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Short Toxin-like Proteins Abound in Cnidaria Genomes

    Directory of Open Access Journals (Sweden)

    Michal Linial


    Full Text Available Cnidaria is a rich phylum that includes thousands of marine species. In this study, we focused on Anthozoa and Hydrozoa that are represented by the Nematostella vectensis (Sea anemone and Hydra magnipapillata genomes. We present a method for ranking the toxin-like candidates from complete proteomes of Cnidaria. Toxin-like functions were revealed using ClanTox, a statistical machine-learning predictor trained on ion channel inhibitors from venomous animals. Fundamental features that were emphasized in training ClanTox include cysteines and their spacing along the sequences. Among the 83,000 proteins derived from Cnidaria representatives, we found 170 candidates that fulfill the properties of toxin-like-proteins, the vast majority of which were previously unrecognized as toxins. An additional 394 short proteins exhibit characteristics of toxin-like proteins at a moderate degree of confidence. Remarkably, only 11% of the predicted toxin-like proteins were previously classified as toxins. Based on our prediction methodology and manual annotation, we inferred functions for over 400 of these proteins. Such functions include protease inhibitors, membrane pore formation, ion channel blockers and metal binding proteins. Many of the proteins belong to small families of paralogs. We conclude that the evolutionary expansion of toxin-like proteins in Cnidaria contributes to their fitness in the complex environment of the aquatic ecosystem.

  14. Toxic polypeptides of the hydra--a bioinformatic approach to cnidarian allomones. (United States)

    Sher, Daniel; Knebel, Alin; Bsor, Tamar; Nesher, Nir; Tal, Tzachy; Morgenstern, David; Cohen, Eran; Fishman, Yelena; Zlotkin, Eliahu


    Cnidarians such as hydrae and sea anemones are sessile, predatory, soft bodied animals which depend on offensive and defensive allomones for prey capture and survival. These allomones are distributed throughout the entire organism both in specialized stinging cells (nematocytes) and in the body tissues. The cnidarian allomonal system is composed of neurotoxins, cytolysins and toxic phospholipapses. The present bioinformatic survey was motivated by the fact that while hydrae are the most studied model cnidarian, little is known about their allomones. A large-scale EST database from Hydra magnipapillata was searched for orthologs of known cnidarian allomones, as well as for allomones found in other venomous organisms. We show that the hydrae express orthologs of cnidarian phospholipase A2 toxins and cytolysins belonging to the actinoporin family, but could not find orthologs of the 'classic' short chain neurotoxins affecting sodium and potassium conductance. Hydrae also express proteins similar to elapid-like phospholipases, CRISP proteins, Prokineticin-like polypeptides and toxic deoxyribonucleases. Our results illustrate a high level of complexity in the hydra allomonal system, suggest that several toxins represent a basal component of all cnidarian allomones, and raise the intriguing possibility that similar proteins may fulfill both endogenous and allomonal roles in cnidaria.

  15. The cnidarian nematocyst: a miniature extracellular matrix within a secretory vesicle. (United States)

    Ozbek, Suat


    Nematocysts are the taxon-defining features of all cnidarians including jellyfish, sea anemones, and corals. They are highly sophisticated organelles used for the capture of prey and defense. The nematocyst capsule is produced within a giant post-Golgi vesicle, which is continuously fed by proteins from the secretory pathway. Mature nematocysts consist of a hollow capsule body in which a long tubule is coiled up that, upon discharge, is expelled in a harpoon-like fashion. This is accompanied by the release of a toxin cocktail stored in the capsule matrix. Nematocyst discharge, which is one of the fastest processes in biology, is driven by an extreme osmotic pressure of about 150 bar. The molecular analysis of the nematocyst has from the beginning indicated a collagenous nature of the capsule structure. In particular, a large family of unusual minicollagens has been demonstrated to form the highly resistant scaffold of the capsule. Recent findings on the molecular composition of Hydra nematocysts have confirmed the notion of a specialized extracellular matrix, which is assembled during an intracellular secretion process to form the most complex predatory apparatus at the cellular level.

  16. Short toxin-like proteins abound in Cnidaria genomes. (United States)

    Tirosh, Yitshak; Linial, Itai; Askenazi, Manor; Linial, Michal


    Cnidaria is a rich phylum that includes thousands of marine species. In this study, we focused on Anthozoa and Hydrozoa that are represented by the Nematostella vectensis (Sea anemone) and Hydra magnipapillata genomes. We present a method for ranking the toxin-like candidates from complete proteomes of Cnidaria. Toxin-like functions were revealed using ClanTox, a statistical machine-learning predictor trained on ion channel inhibitors from venomous animals. Fundamental features that were emphasized in training ClanTox include cysteines and their spacing along the sequences. Among the 83,000 proteins derived from Cnidaria representatives, we found 170 candidates that fulfill the properties of toxin-like-proteins, the vast majority of which were previously unrecognized as toxins. An additional 394 short proteins exhibit characteristics of toxin-like proteins at a moderate degree of confidence. Remarkably, only 11% of the predicted toxin-like proteins were previously classified as toxins. Based on our prediction methodology and manual annotation, we inferred functions for over 400 of these proteins. Such functions include protease inhibitors, membrane pore formation, ion channel blockers and metal binding proteins. Many of the proteins belong to small families of paralogs. We conclude that the evolutionary expansion of toxin-like proteins in Cnidaria contributes to their fitness in the complex environment of the aquatic ecosystem.

  17. Tox-Prot, the toxin protein annotation program of the Swiss-Prot protein knowledgebase. (United States)

    Jungo, Florence; Bairoch, Amos


    The Tox-Prot program was initiated in order to provide the scientific community a summary of the current knowledge on animal protein toxins. The aim of this program is to systematically annotate all proteins which act as toxins and are produced by venomous and poisonous animals. Venomous animals such as snakes, scorpions, spiders, jellyfish, insects, cone snails, sea anemones, lizards, some fish, and platypus are equipped with a specialized organ to inject venom in their prey. In contrast, poisonous animals such as some fish or worms, lack such organs. Each toxin is annotated according to the quality standards of Swiss-Prot. This means providing a wealth of information that includes the description of the function, domain structure, subcellular location, tissue specificity, variants, similarities to other proteins, keywords, etc. In the framework of this program, particular care has been made to capture what is known on the function and mode of action, posttranslational modifications and 3D structural data which are all relatively abundant in the field of protein toxins. Researchers are welcome to contribute their knowledge to the scientific community by submitting relevant findings to Swiss-Prot concerning toxins at More information on Tox-Prot can be found at

  18. The Mauve Stinger Pelagia noctiluca (Forsskål, 1775. Distribution, Ecology, Toxicity and Epidemiology of Stings.

    Directory of Open Access Journals (Sweden)

    Luigi Pane


    Full Text Available The toxicity of Cnidaria is a subject of concern due to its influence on humans. In particular, jellyfish blooms can highly affect human economical activities, such as bathing, fishery, tourism, etc., as well as the public health. Stinging structures of Cnidaria (nematocysts produce remarkable effects on human skin, such as erythema, swelling, burning and vesicles, and at times further severe dermonecrotic, cardio- and neurotoxic effects, which are particularly dangerous in sensitive subjects. In several zones the toxicity of jellyfish is a very important health problem, thus it has stimulated the research on these organisms; to date toxicological research on Cnidarian venoms in the Mediterranean region is not well developed due to the weak poisonousness of venoms of jellyfish and anemones living in this area. In spite of this, during last decades several problems were also caused in the Mediterranean by stinging consequent to Cnidarian blooms mainly caused by Pelagia noctiluca (Forsskål, 1775 which is known to be the most venomous Mediterranean jellyfish. This paper reviews the knowledge on this jellyfish species, particularly considering its occurrence and toxicity.

  19. Influence of salmonid aquaculture activities on a rock-cliff epifaunal community in Jervis Inlet, British Columbia. (United States)

    Sutherland, T F; Sterling, A M; Ou, M


    Benthic video surveys were carried out at two marine finfish aquaculture and associated reference sites in Jervis Inlet (JI), British Columbia. Substrate composition, epifaunal diversity, mat-forming taxa (primary indicators: opportunistic polychaete complexes (OPCs) and sulfide-oxidizing bacteria) and waste pellets were quantitatively assessed. Hard-bottom substrates were dominated by rock wall, skeletal sponge matrix, graded bedrock, rock-veneer, and cobble. Aquaculture waste outputs (modelled depositional carbon fluxes and observations of waste feed/faecal pellets) were correlated with benthic organic enrichment indicators (OPC and sulfide-oxidizing bacteria). Sulfide-oxidizing bacteria varied in abundance up to a modelled depositional carbon flux of ~2gCm -2 day -1 where it sustained 50% areal coverage. Glass sponges revealed an inverse relationship with aquaculture waste outputs and sulfide-oxidizing bacteria. Plumose anemones and shrimp showed a low frequency of occurrence at reference sites; however, they were abundant within the near-field zone of the aquaculture sites associated with a higher modelled carbon flux. Future research should focus on the response of various taxa to depositional gradients and their potential role as secondary indicators of aquaculture activities associated with rock-cliff communities. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  20. Transcriptomic responses to heat stress and bleaching in the elkhorn coral Acropora palmata

    KAUST Repository

    DeSalvo, MK


    The emergence of genomic tools for reef-building corals and symbiotic anemones comes at a time when alarming losses in coral cover are being observed worldwide. These tools hold great promise in elucidating novel and unforeseen cellular processes underlying the successful mutualism between corals and their dinoflagellate endosymbionts Symbiodinium spp. Since thermal stress triggers a breakdown in the symbiosis (coral bleaching), measuring the transcriptomic response to thermal stress-induced bleaching offers an extraordinary view of cellular processes that are specific to coral–algal symbioses. In the present study, we utilized a cDNA microarray containing 2059 genes of the threatened Caribbean elkhorn coral Acropora palmata to identify genes that are differentially expressed upon thermal stress. Fragments from replicate colonies were exposed to elevated temperature for 2 d, and samples were frozen for microarray analysis after 24 and 48 h. Totals of 204 and 104 genes were differentially expressed in samples that were collected 1 and 2 d after thermal stress, respectively. Analysis of the differentially expressed genes indicates a cellular stress response in A. palmata involving (1) growth arrest, (2) chaperone activity, (3) nucleic acid stabilization and repair, and (4) removal of damaged macromolecules. Other differentially expressed processes include sensory perception, metabolite transfer between host and endosymbiont, nitric oxide signaling, and modifications to the actin cytoskeleton and extracellular matrix. The results are compared with those from a previous coral microarray study of thermal stress in Montastraea faveolata, and point to an overall evolutionary conserved bleaching response in scleractinian corals.

  1. Convergent Evolution of Sodium Ion Selectivity in Metazoan Neuronal Signaling

    Directory of Open Access Journals (Sweden)

    Maya Gur Barzilai


    Full Text Available Ion selectivity of metazoan voltage-gated Na+ channels is critical for neuronal signaling and has long been attributed to a ring of four conserved amino acids that constitute the ion selectivity filter (SF at the channel pore. Yet, in addition to channels with a preference for Ca2+ ions, the expression and characterization of Na+ channel homologs from the sea anemone Nematostella vectensis, a member of the early-branching metazoan phylum Cnidaria, revealed a sodium-selective channel bearing a noncanonical SF. Mutagenesis and physiological assays suggest that pore elements additional to the SF determine the preference for Na+ in this channel. Phylogenetic analysis assigns the Nematostella Na+-selective channel to a channel group unique to Cnidaria, which diverged >540 million years ago from Ca2+-conducting Na+ channel homologs. The identification of Cnidarian Na+-selective ion channels distinct from the channels of bilaterian animals indicates that selectivity for Na+ in neuronal signaling emerged independently in these two animal lineages.

  2. Damage of eukaryotic cells by the pore-forming toxin sticholysin II: Consequences of the potassium efflux. (United States)

    Cabezas, Sheila; Ho, Sylvia; Ros, Uris; Lanio, María E; Alvarez, Carlos; van der Goot, F Gisou


    Pore-forming toxins (PFTs) form holes in membranes causing one of the most catastrophic damages to a target cell. Target organisms have evolved a regulated response against PFTs damage including cell membrane repair. This ability of cells strongly depends on the toxin concentration and the properties of the pores. It has been hypothesized that there is an inverse correlation between the size of the pores and the time required to repair the membrane, which has been for long a non-intuitive concept and far to be completely understood. Moreover, there is a lack of information about how cells react to the injury triggered by eukaryotic PFTs. Here, we investigated some molecular events related with eukaryotic cells response against the membrane damage caused by sticholysin II (StII), a eukaryotic PFT produced by a sea anemone. We evaluated the change in the cytoplasmic potassium, identified the main MAPK pathways activated after pore-formation by StII, and compared its effect with those from two well-studied bacterial PFTs: aerolysin and listeriolysin O (LLO). Strikingly, we found that membrane recovery upon StII damage takes place in a time scale similar to LLO in spite of the fact that they form pores by far different in size. Furthermore, our data support a common role of the potassium ion, as well as MAPKs in the mechanism that cells use to cope with these toxins injury. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Spawning of coral reef invertebrates and a second spawning season for scleractinian corals in the central Red Sea

    KAUST Repository

    Bouwmeester, Jessica


    Recent coral spawning observations in the central Red Sea show that most scleractinian species release their gametes in the spring, with a majority of species spawning in April. There is, however, a lack of reproductive data for several other coral species, as well as a general lack of data for other invertebrates. Here, we document the detailed timing of spawning for 13 scleractinian coral species, one sea anemone, and six echinoderms from an inshore reef off the coast of Thuwal, Saudi Arabia, in the spring between April and June 2014. Furthermore, inferred from the presence of mature gametes, we report the month of spawning for three additional coral species in the spring. Seven scleractinian coral species were inferred to release their gametes in a second reproductive season, in the autumn, between September and November. This is the first report of a second spawning season in the Arabian region. Biannual spawning has so far been reported on the Great Barrier Reef, in Western Australia, in Indonesia, in Malaysia, in Palau, in Thailand, in Taiwan, and in Western Samoa. © 2016, The American Microscopical Society, Inc.

  4. The Mucus of Actinia equina (Anthozoa, Cnidaria: An Unexplored Resource for Potential Applicative Purposes

    Directory of Open Access Journals (Sweden)

    Loredana Stabili


    Full Text Available The mucus produced by many marine organisms is a complex mixture of proteins and polysaccharides forming a weak watery gel. It is essential for vital processes including locomotion, navigation, structural support, heterotrophic feeding and defence against a multitude of environmental stresses, predators, parasites, and pathogens. In the present study we focused on mucus produced by a benthic cnidarian, the sea anemone Actinia equina (Linnaeus, 1758 for preventing burial by excess sedimentation and for protection. We investigated some of the physico-chemical properties of this matrix such as viscosity, osmolarity, electrical conductivity, protein, carbohydrate, and total lipid contents. Some biological activities such as hemolytic, cytotoxic, and antibacterial lysozyme-like activities were also studied. The A. equina mucus is mainly composed by water (96.2% ± 0.3%, whereas its dry weight is made of 24.2% ± 1.3% proteins and 7.8% ± 0.2% carbohydrates, with the smallest and largest components referable to lipids (0.9% and inorganic matter (67.1%. The A. equina mucus matrix exhibited hemolytic activity on rabbit erythrocytes, cytotoxic activity against the tumor cell line K562 (human erythromyeloblastoid leukemia and antibacterial lysozyme-like activity. The findings from this study improve the available information on the mucus composition in invertebrates and have implications for future investigations related to exploitation of A. equina and other sea anemones’ mucus as a source of bioactive compounds of high pharmaceutical and biotechnological interest.

  5. Molecular assessment of heterotrophy and prey digestion in zooxanthellate cnidarians. (United States)

    Leal, M C; Nejstgaard, J C; Calado, R; Thompson, M E; Frischer, M E


    Zooxanthellate cnidarians are trophically complex, relying on both autotrophy and heterotrophy. Although several aspects of heterotrophy have been studied in these organisms, information linking prey capture with digestion is still missing. We used prey-specific PCR-based tools to assess feeding and prey digestion of two zooxanthellate cnidarians - the tropical sea anemone Aiptasia sp. and the scleractinian coral Oculina arbuscula. Prey DNA disappeared rapidly for the initial 1-3 days, whereas complete digestion of prey DNA required up to 10 days in O. arbuscula and 5 or 6 days in Aiptasia sp. depending on prey species. These digestion times are considerably longer than previously reported from microscopy-based examination of zooxanthellate cnidarians and prey DNA breakdown in other marine invertebrates, but similar to prey DNA breakdown reported from terrestrial invertebrates such as heteroptera and spiders. Deprivation of external prey induced increased digestion rates during the first days after feeding in O. arbuscula, but after 6 days of digestion, there were no differences in the remaining prey levels in fed and unfed corals. This study indicates that prey digestion by symbiotic corals may be slower than previously reported and varies with the type of prey, the cnidarian species and its feeding history. These observations have important implications for bioenergetic and trophodynamic studies on zooxanthellate cnidarians. © 2013 John Wiley & Sons Ltd.

  6. Antiarrhythmic effect of IKr activation in a cellular model of LQT3

    DEFF Research Database (Denmark)

    Diness, Jonas Goldin; Hansen, Rie Schultz; Nissen, Jakob Dahl


    BACKGROUND: Long QT syndrome type 3 (LQT3) is an inherited cardiac disorder caused by gain-of-function mutations in the cardiac voltage-gated sodium channel, Na(v)1.5. LQT3 is associated with the polymorphic ventricular tachycardia torsades de pointes (TdP), which can lead to syncope and sudden...... cardiac death. The sea anemone toxin ATX-II has been shown to inhibit the inactivation of Na(v)1.5, thereby closely mimicking the underlying cause of LQT3 in patients. OBJECTIVE: The hypothesis for this study was that activation of the I(Kr) current could counteract the proarrhythmic effects of ATX....... Application of ATX-II (10 nM) was proarrhythmic, causing a profound increase of APD(90) as well as early afterdepolarizations and increased beat-to-beat variability. Two independent I(Kr) activators attenuated the proarrhythmic effects of ATX-II. NS3623 did not affect the late sodium current (I...

  7. Aiptasia sp. larvae as a model to reveal mechanisms of symbiont selection in cnidarians

    KAUST Repository

    Wolfowicz, Iliona


    Symbiosis, defined as the persistent association between two distinct species, is an evolutionary and ecologically critical phenomenon facilitating survival of both partners in diverse habitats. The biodiversity of coral reef ecosystems depends on a functional symbiosis with photosynthetic dinoflagellates of the highly diverse genus Symbiodinium, which reside in coral host cells and continuously support their nutrition. The mechanisms underlying symbiont selection to establish a stable endosymbiosis in non-symbiotic juvenile corals are unclear. Here we show for the first time that symbiont selection patterns for larvae of two Acropora coral species and the model anemone Aiptasia are similar under controlled conditions. We find that Aiptasia larvae distinguish between compatible and incompatible symbionts during uptake into the gastric cavity and phagocytosis. Using RNA-Seq, we identify a set of candidate genes potentially involved in symbiosis establishment. Together, our data complement existing molecular resources to mechanistically dissect symbiont phagocytosis in cnidarians under controlled conditions, thereby strengthening the role of Aiptasia larvae as a powerful model for cnidarian endosymbiosis establishment.

  8. Structural and Developmental Disparity in the Tentacles of the Moon Jellyfish Aurelia sp.1.

    Directory of Open Access Journals (Sweden)

    David A Gold

    Full Text Available Tentacles armed with stinging cells (cnidocytes are a defining trait of the cnidarians, a phylum that includes sea anemones, corals, jellyfish, and hydras. While cnidarian tentacles are generally characterized as structures evolved for feeding and defense, significant variation exists between the tentacles of different species, and within the same species across different life stages and/or body regions. Such diversity suggests cryptic distinctions exist in tentacle function. In this paper, we use confocal and transmission electron microscopy to contrast the structure and development of tentacles in the moon jellyfish, Aurelia species 1. We show that polyp oral tentacles and medusa marginal tentacles display markedly different cellular and muscular architecture, as well as distinct patterns of cellular proliferation during growth. Many structural differences between these tentacle types may reflect biomechanical solutions to different feeding strategies, although further work would be required for a precise mechanistic understanding. However, differences in cell proliferation dynamics suggests that the two tentacle forms lack a conserved mechanism of development, challenging the textbook-notion that cnidarian tentacles can be homologized into a conserved bauplan.

  9. Epipodial Tentacle Gene Expression and Predetermined Resilience to Summer Mortality in the Commercially Important Greenlip Abalone, Haliotis laevigata. (United States)

    Shiel, Brett P; Hall, Nathan E; Cooke, Ira R; Robinson, Nicholas A; Strugnell, Jan M


    "Summer mortality" is a phenomenon that occurs during warm water temperature spikes that results in the mass mortality of many ecologically and economically important mollusks such as abalone. This study aimed to determine whether the baseline gene expression of abalone before a laboratory-induced summer mortality event was associated with resilience to summer mortality. Tentacle transcriptomes of 35 greenlip abalone (Haliotis laevigata) were sequenced prior to the animals being exposed to an increase in water temperature-simulating conditions which have previously resulted in summer mortality. Abalone derived from three source locations with different environmental conditions were categorized as susceptible or resistant to summer mortality depending on whether they died or survived after the water temperature was increased. We detected two genes showing significantly higher expression in resilient abalone relative to susceptible abalone prior to the laboratory-induced summer mortality event. One of these genes was annotated through the NCBI non-redundant protein database using BLASTX to an anemone (Exaiptasia pallida) Transposon Ty3-G Gag Pol polyprotein. Distinct gene expression signatures were also found between resilient and susceptible abalone depending on the population origin, which may suggest divergence in local adaptation mechanisms for resilience. Many of these genes have been suggested to be involved in antioxidant and immune-related functions. The identification of these genes and their functional roles have enhanced our understanding of processes that may contribute to summer mortality in abalone. Our study supports the hypothesis that prestress gene expression signatures are indicative of the likelihood of summer mortality.

  10. Structural and Developmental Disparity in the Tentacles of the Moon Jellyfish Aurelia sp.1 (United States)

    Gold, David A.; Nakanishi, Nagayasu; Hensley, Nicholai M.; Cozzolino, Kira; Tabatabaee, Mariam; Martin, Michelle; Hartenstein, Volker; Jacobs, David K.


    Tentacles armed with stinging cells (cnidocytes) are a defining trait of the cnidarians, a phylum that includes sea anemones, corals, jellyfish, and hydras. While cnidarian tentacles are generally characterized as structures evolved for feeding and defense, significant variation exists between the tentacles of different species, and within the same species across different life stages and/or body regions. Such diversity suggests cryptic distinctions exist in tentacle function. In this paper, we use confocal and transmission electron microscopy to contrast the structure and development of tentacles in the moon jellyfish, Aurelia species 1. We show that polyp oral tentacles and medusa marginal tentacles display markedly different cellular and muscular architecture, as well as distinct patterns of cellular proliferation during growth. Many structural differences between these tentacle types may reflect biomechanical solutions to different feeding strategies, although further work would be required for a precise mechanistic understanding. However, differences in cell proliferation dynamics suggests that the two tentacle forms lack a conserved mechanism of development, challenging the textbook-notion that cnidarian tentacles can be homologized into a conserved bauplan. PMID:26241309

  11. Naked Stony Corals: Skeleton Loss in Scleractinia

    Energy Technology Data Exchange (ETDEWEB)

    Medina, Monica; Collins, Allen G.; Takaoka, Tori L.; Kuehl,Jennifer; Boore, Jeffrey L.


    Hexacorallia includes the Scleractinia, or stony corals, characterized by having an external calcareous skeleton made of aragonite, and the Corallimorpharia, or mushroom corals, that lack such a skeleton. Although each group has traditionally been considered monophyletic, some molecular phylogenetic analyses have challenged this, suggesting that skeletal features are evolutionarily plastic, and reviving notions that the scleractinian skeleton may be ephemeral and that the group itself may be polyphyletic. Nevertheless, the most comprehensive phylogenetic study of Hexacorallia supported scleractinian monophyly (REF), and so this remains controversial. In order to resolve this contentious issue, we sequenced the complete mitochondrial genome sequences of nine scleractinians and four corallimorpharians and performed phylogenetic analysis that also included three outgroups (an octocoral and two sea anemones). Our data provide the first strong evidence that Scleractinia is paraphyletic and that the Corallimorpharia is derived from within the group, from which we conclude that skeletal loss has occurred in the latter group secondarily. It is possible that a driving force in such skeletal loss could be the high levels of CO{sub 2} in the ocean during the mid-Cretaceous, which would have impacted aragonite solubility. We estimate from molecular divergence measures that the Corallimorpharia arose in the mid-Cretaceous, approximately 87 million years ago (Ma), supporting this view. These data also permit us to date the origin of Scleractinia to 265 Ma, narrowing the gap between the group's phylogenetic origin and its earliest fossil record.

  12. Insights into the Toxicological Properties of a Low Molecular Weight Fraction from Zoanthus sociatus (Cnidaria

    Directory of Open Access Journals (Sweden)

    Agostinho Antunes


    Full Text Available The phylum Cnidaria is an ancient group of venomous animals, specialized in the production and delivery of toxins. Many species belonging to the class Anthozoa have been studied and their venoms often contain a group of peptides, less than 10 kDa, that act upon ion channels. These peptides and their targets interact with high affinity producing neurotoxic and cardiotoxic effects, and even death, depending on the dose and the administration pathway. Zoanthiniaria is an order of the Subclass Hexacorallia, class Anthozoa, and unlike sea anemone (order Actiniaria, neither its diversity of toxins nor the in vivo effects of the venoms has been exhaustively explored. In this study we assessed some toxicological tests on mice with a low molecular weight fraction obtained by gel filtration in Sephadex G-50 from Zoanthus sociatus crude extract. The gel filtration chromatogram at 280 nm revealed two major peaks, the highest absorbance corresponding to the low molecular weight fraction. The toxicological effects seem to be mostly autonomic and cardiotoxic, causing death in a dose dependent manner with a LD50 of 792 μg/kg. Moreover, at a dose of 600 μg/kg the active fraction accelerated the KCl-induced lethality in mice.

  13. Dinosaur Footprints and Other Ichnofauna from the Cretaceous Kem Kem Beds of Morocco (United States)

    Ibrahim, Nizar; Varricchio, David J.; Sereno, Paul C.; Wilson, Jeff A.; Dutheil, Didier B.; Martill, David M.; Baidder, Lahssen; Zouhri, Samir


    We describe an extensive ichnofossil assemblage from the likely Cenomanian-age ‘lower’ and ‘upper’ units of the ‘Kem Kem beds’ in southeastern Morocco. In the lower unit, trace fossils include narrow vertical burrows in cross-bedded sandstones and borings in dinosaur bone, with the latter identified as the insect ichnotaxon Cubiculum ornatus. In the upper unit, several horizons preserve abundant footprints from theropod dinosaurs. Sauropod and ornithischian footprints are much rarer, similar to the record for fossil bone and teeth in the Kem Kem assemblage. The upper unit also preserves a variety of invertebrate traces including Conichnus (the resting trace of a sea-anemone), Scolicia (a gastropod trace), Beaconites (a probable annelid burrow), and subvertical burrows likely created by crabs for residence and detrital feeding on a tidal flat. The ichnofossil assemblage from the Upper Cretaceous Kem Kem beds contributes evidence for a transition from predominantly terrestrial to marine deposition. Body fossil and ichnofossil records together provide a detailed view of faunal diversity and local conditions within a fluvial and deltaic depositional setting on the northwestern coast of Africa toward the end of the Cretaceous. PMID:24603467

  14. A thrombospondin in the anthozoan Nematostella vectensis is associated with the nervous system and upregulated during regeneration

    Directory of Open Access Journals (Sweden)

    Richard P. Tucker


    Thrombospondins are multimeric extracellular matrix glycoproteins that play important roles in development, synaptogenesis and wound healing in mammals. We previously identified four putative thrombospondins in the genome of the starlet sea anemone Nematostella vectensis. This study presents the first analysis of these thrombospondins, with the goals of understanding fundamental roles of thrombospondins in the Eumetazoa. Reverse transcriptase PCR showed that each of the N. vectensis thrombospondins (Nv85341, Nv22035, Nv168100 and Nv30790 is transcribed. Three of the four thrombospondins include an RGD or KGD motif in their thrombospondin type 3 repeats at sites equivalent to mammalian thrombospondins, suggesting ancient roles as RGD integrin ligands. Phylogenetic analysis based on the C-terminal regions demonstrated a high level of sequence diversity between N. vectensis thrombospondins. A full-length cDNA sequence was obtained for Nv168100 (NvTSP168100, which has an unusual domain organization. Immunohistochemistry with an antibody to NvTSP168100 revealed labeling of neuron-like cells in the mesoglea of the retractor muscles and the pharynx. In situ hybridization and quantitative PCR showed that NvTSP168100 is upregulated during regeneration. Immunohistochemistry of the area of regeneration identified strong immunostaining of the glycocalyx, the carbohydrate-rich matrix coating the epidermis, and electron microscopy identified changes in glycocalyx organization during regeneration. Thus, N. vectensis thrombospondins share structural features with thrombospondins from mammals and may have roles in the nervous system and in matrix reorganization during regeneration.

  15. Vegetation of the ‘Mierzwice’ nature reserve and its protection

    Directory of Open Access Journals (Sweden)

    Krechowski Janusz


    Full Text Available The ‘Mierzwice’ nature reserve (forest district 206b, c and d of the Sarnaki Forest Inspectorate, situated in the area of the Podlaski Przełom Bug Landscape Park, is one of the most valuable natural assets of the central Bug river valley. The 12.98 ha reserve was established in 2010 to aid protection of the stand of xerothermic vegetation and its surrounding deciduous forest. In total, eight plant associations were identified within the reserve: Geranio-Peucedanetum cervariae, Geranio-Anemonetum sylvestris, Geranio-Trifolietum alpestris, Trifolio medii-Agrimonietum, Rubo fruticosi-Prunetum, Rhamno-Cornetum sanguinei, Potentillo albae-Quercetum and Tilio cordatae-Carpinetum betuli. Furthermore, 23 protected and 31 endangered species were found in the reserve including the following examples: Cephalanthera rubra, Thesium ebracteatum, Cypripedium calceolus, Gentiana cruciata, Anemone sylvestris, Cimicifuga europaea, Viola rupestris, Crepis praemorsa, Asperula tinctoria, Stachys recta, Laserpitium latifolium. Over the last few years, a regression of the species diagnostic number for thermophilous oak forests and xerothermic grasslands has been observed as a result of succession and expansion of Calamagrostis epigejos. Active protection of xerothermic vegetation such as uprooting of trees and bushes, regular grazing or mowing has been suggested in order to prevent the expansion of Calamagrostis epigejos.

  16. Flowers of Çoruh Valley

    Directory of Open Access Journals (Sweden)

    Ramazan Çakmakçı


    Full Text Available Coruh valley has an important biological diversity in term of plants, flora-fauna, wildlife and ecosystems. These regions contain the landraces, wild and weedy relatives, other wild, herbaceous and flowering trees, herbaceous flowering plants, medicinal and aromatic and flowering and ornamental shrubs plants species which are especially economically important plant for floriculture, eco-tourism, botanical tourism and nature tourism. Many important medicinal and aromatic and ornamental plants species are found in this region and naturally grow. It is considered that Acantholimon, Achillea, Alkanna, Allium, Amygdalus, Angelica, Anemone, Anthemis, Arabis, Arctium, Artemisia, Asparagus, Asperula, Astragalus, Calamintha, Calendula, Calutea, Campanula, Capparis, Cardamine, Centaurea, Cephalanthera, Cephalaria, Chelidonium, Chenopodium, Chysanthemum, Colchicum, Consolida, Coriandrum, Cornus, Coronilla, Cerasus, Cotoneaster, Crataegus, Crocus, Cyclamen, Dactylorhiza, Digitalis, Dianthus, Draba, Echinops, Equisetum, Ferula, Filipendula, Fritillaria, Fumaria, Gagea, Galanthus, Galium, Genista, Gentiana, Geranium, Geum, Gladiolus, Glychirrza, Helichrysum, Hesperis, Hypericum, İnula, İris, Isatis, Juniperus, Lilium, Linaria, Linum, lysimachia, Malus, Malva, Marrubium, Melissa, Mentha, Micromeria, Morina, Muscari, Mysotis, Narcissus, Neotchichatchewia, Nepeta, Onobrychis, Orchis, Ornithogalum, Origanum, Paeonia, Papaver, Pedicularis, Peganum, Phelypaea, Platanthera, Plantago, Pilosella, Pelargonium, Potentilla, Polygonum, Polygala, Primula, Punica, Prunus, Pyrus, Ranunculus, Rhamnus, Rhododendron, Rhus, Rosa, Rubia, Rubus, Rumex, Salvia, Sambucus, Satureja, Scilla, Scorzonera, Scutellaria, Sedum, Sempervivum, Sideritis, Sophora, Sorbus, Stachys, Tanecetum, Teucrium, Thymus, Trigonella, Tulipa, Tussilago, Uechtriitzia, Vaccinium, Verbascum, Verbena, Veronica, Viburnum and Ziziphora species commonly found in the region may be may be evaluated economically.

  17. Extending the family table: Insights from beyond vertebrates into the regulation of embryonic development by FGFs. (United States)

    Tulin, Sarah; Stathopoulos, Angelike


    Since the discovery of fibroblast growth factors (FGFs) much focus has been placed on elucidating the roles for each vertebrate FGF ligand, receptor, and regulating molecules in the context of vertebrate development, human disorders and cancer. Studies in human, mouse, frog, chick, and zebrafish have made great contributions to our understanding of the role of FGFs in specific processes. However, in recent years, as more genomes are sequenced, information is becoming available from many non-vertebrate models and a more complete picture of the FGF superfamily as a whole is emerging. In some cases, less redundancy in these FGF signaling systems may allow for more mechanistic insights. Studies in sea anemones have highlighted how ancient FGF signaling is and helped provide insight into the evolution of the FGF gene family. Work in nematodes has shown that different splice forms can be used for functional specificity in invertebrate FGF signaling. Comparing FGFs between urochordates and vertebrates as well as between different insect species reveals important clues into the process of gene loss, duplication and subfunctionalization of FGFs throughout evolution. Finally, comparing all members of the FGF ligand superfamily reveals variability in many properties, which may point to a feature of FGFs as being highly adaptable with regards to protein structure and signaling mechanism. Further studies on FGF signaling outside of vertebrates is likely to continue to complement work in vertebrates by contributing additional insights to the FGF field and providing unexpected information that could be used for medical applications. © 2010 Wiley-Liss, Inc.

  18. Biological and Geological Characteristics of the Gakkel Ridge (United States)

    Shank, T. M.; Bailey, J.; Edmonds, H.; Forte, P.; Helmke, E.; Humphris, S.; Kemp, J.; Nakamura, K.; Reves-Sohn, R.; Singh, H.; Willis, C.


    The Gakkel Ridge (Arctic Ocean) is one of the slowest (1.0 cm per yr), deepest (5000 m axial depth), and most hydrographically and tectonically isolated mid-ocean ridge systems on earth. This isolation from the global ridge system should have profound implications for the evolution and ecology of resident chemosynthetic fauna. The July 2007 Arctic GAkkel Vents Expedition (AGAVE) sought to define this Arctic biogeographic province and the relationship of Arctic vent fauna to Atlantic, Pacific, and hydrocarbon seep fauna through the use of an new under- ice vehicle `Camper', a fiber-optic video-guided sampling system drift towed 1 to 3 m above the seafloor. The imaging, sampling, and sensing capabilities were used to obtain high-resolution seafloor imagery to identify and collect benthic samples with a clamshell `grab' sampler and a suction 'slurp' sampler. Imagery from five video cameras, including obliquely-mounted video and downlooking digital high-definition color cameras were used to construct maps of seafloor features and faunal composition during 3 dives in the peridotite-hosted 7°E region and 13 dives in the volcanic 85°E region. The 7°E site was dominated by an almost continuous cover of pelagic sediment with abundant animal tracks, brittle stars, anemones, and shrimp. The explored 85°E area was dominated by relatively diverse and young lava morphologies- from large pillows hosting delicate surface ornamentation to lobates, long lava tubes, and fresh sheet flows, all with the upper surfaces covered (often cm thick) of fresh volcanic glass 'sediment' suggestive of explosive volcanic activity in the `recent' past. Fauna in these areas consisted mainly of sponges, anemones, amphipods and shrimp. Characterization of the newly-discovered Asgard volcanic chain, including `Oden', `Thor', and `Loke' volcanoes, in the 85°E axial valley revealed extensive microbial mats in the form of: 1) yellow `fluffy' material (often >5 cm thick) in places; and 2) yellow

  19. Patrones asociados a la conducta de desplazamiento local en Phymactis clematis Drayton (Anthozoa: Actiniidae Patterns of local movement behavior in Phymactis clematis Drayton (Anthozoa: Actiniidae

    Directory of Open Access Journals (Sweden)



    species of sea anemone along the South American coast. Likewise other sea anemone species, the adults of the P. clematis would have an active ability to make local movements. However, these have not been properly described, and causal factors are unknown. In this work we try to describe some of the basic patterns associated to the local movement behavior in P. clematis, assessed indirectly from the presence of bare rock halos around individuals in two rocky intertidal sites in the coast of northern Chile (Cavancha and Colorado Chico. Movements were more frequent and had a higher intensity at Colorado Chico, where over 50 % of individuals showed movements, although they were mainly lower than 60 mm in length. At Colorado Chico, movements would occur in individuals larger than 40 mm of pedal diameter, whereas their intensity would decrease with body size. We discussed that causes of higher movement activity at Colorado Chico could be associated to the higher abundance and lower inter-individual spacing, which would produce physical interference among individuals. In this way, we suggested that the patterns associated to the individual's body size would arise secondarily, being dependent on the levels of local abundance. Despite local movements of P. clematis at Colorado Chico occurred at a scale of a few centimeters, they could be affecting significantly the inter-individual spacing, increasing the average nearest neighbor distance. We argue that local movements could be an effective mechanism reducing the intraspecific competition in P. clematis

  20. Diversity, distribution and nature of faunal associations with deep-sea pennatulacean corals in the Northwest Atlantic.

    Directory of Open Access Journals (Sweden)

    Sandrine Baillon

    Full Text Available Anthoptilum grandiflorum and Halipteris finmarchica are two deep-sea corals (Octocorallia: Pennatulacea common on soft bottoms in the North Atlantic where they are believed to act as biogenic habitat. The former also has a worldwide distribution. To assist conservation efforts, this study examines spatial and temporal patterns in the abundance, diversity, and nature of their faunal associates. A total of 14 species were found on A. grandiflorum and 6 species on H. finmarchica during a multi-year and multi-site sampling campaign in eastern Canada. Among those, 7 and 5 species, respectively, were attached to the sea pens and categorized as close associates or symbionts. Rarefaction analyses suggest that the most common associates of both sea pens have been sampled. Biodiversity associated with each sea pen is analyzed according to season, depth and region using either close associates or the broader collection of species. Associated biodiversity generally increases from northern to southern locations and does not vary with depth (∼ 100-1400 m. Seasonal patterns in A. grandiflorum show higher biodiversity during spring/summer due to the transient presence of early life stages of fishes and shrimps whereas it peaks in fall for H. finmarchica. Two distinct endoparasitic species of highly modified copepods (families Lamippidae and Corallovexiidae commonly occur in the polyps of A. grandiflorum and H. finmarchica, and a commensal sea anemone frequently associates with H. finmarchica. Stable isotope analyses (δ(13C and δ(15N reveal potential trophic interactions between the parasites and their hosts. Overall, the diversity of obligate/permanent associates of sea pens is moderate; however the presence of mobile/transient associates highlights an ecological role that has yet to be fully elucidated and supports their key contribution to the enhancement of biodiversity in the Northwest Atlantic.

  1. Inhibitions of late INa and CaMKII act synergistically to prevent ATX-II-induced atrial fibrillation in isolated rat right atria. (United States)

    Liang, Faquan; Fan, Peidong; Jia, Jessie; Yang, Suya; Jiang, Zhan; Karpinski, Serge; Kornyeyev, Dmytro; Pagratis, Nikos; Belardinelli, Luiz; Yao, Lina


    Increases in late Na(+) current (late INa) and activation of Ca(2+)/calmodulin-dependent protein kinase (CaMKII) are associated with atrial arrhythmias. CaMKII also phosphorylates Nav1.5, further increasing late INa. The combination of a CaMKII inhibitor with a late INa inhibitor may be superior to each compound alone to suppress atrial arrhythmias. Therefore, we investigated the effect of a CaMKII inhibitor in combination with a late INa inhibitor on anemone toxin II (ATX-II, a late INa enhancer)-induced atrial arrhythmias. Rat right atrial tissue was isolated and preincubated with either the CaMKII inhibitor autocamtide-2-related inhibitory peptide (AIP), the late INa inhibitor GS458967, or both, and then exposed to ATX-II. ATX-II increased diastolic tension and caused fibrillation of isolated right atrial tissue. AIP (0.3μmol/L) and 0.1μmol/L GS458967 alone inhibited ATX-II-induced arrhythmias by 20±3% (mean±SEM, n=14) and 34±5% (n=13), respectively, whereas the two compounds in combination inhibited arrhythmias by 81±4% (n=10, pATX-induced increase of diastolic tension. Consistent with the mechanical and electrical data, 0.3μmol/L AIP and 0.1μmol/L GS458967 each inhibited ATX-II-induced CaMKII phosphorylation by 23±3% and 32±4%, whereas the combination of both compounds inhibited CaMKII phosphorylation completely. The effects of an enhanced late INa to induce arrhythmic activity and activation of CaMKII in atria are attenuated synergistically by inhibitors of late INa and CaMKII. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Ranolazine decreases diastolic calcium accumulation caused by ATX-II or ischemia in rat hearts. (United States)

    Fraser, Heather; Belardinelli, Luiz; Wang, Lianguo; Light, Peter E; McVeigh, Jeffrey J; Clanachan, Alexander S


    Cardiac pathologies are associated with increased late INa that contributes to the dysregulation of ion homeostasis and causes electrical and contractile dysfunction. This study was designed to test the hypothesis that an increased late sodium channel current (INa) leads to Ca2+ overload and left ventricular (LV) dysfunction, and thereby inhibition of late INa (e.g., by ranolazine) improves Ca2+ homeostasis and reduces LV dysfunction. Intracellular Ca2+ ([Ca2+]i) and LV function were measured simultaneously in rat isolated perfused hearts. Augmentation of late INa with sea anemone toxin-II (ATX-II, 12 nM) increased diastolic [Ca2+]i (d[Ca2+]i), and impaired LV mechanical function, but had no effect on [Ca2+]i transient amplitude. Although ranolazine (4 and 9 microM), an inhibitor of late INa, had no direct effects on d[Ca2+]i or LV function, it significantly reduced the deleterious effects of ATX-II. Global ischemia increased d[Ca2+]i and inhibited Ca2+ transient amplitude. During reperfusion, Ca2+ transient amplitude recovered fully, but d[Ca2+]i remained elevated and LV function was depressed, indicative of Ca2+ overload. Ranolazine (9 microM) reduced d[Ca2+]i accumulation during ischemia as well as reperfusion and improved recovery of LV function. These results show that augmentation of late INa with ATX-II or by ischemia is associated with diastolic Ca2+ overload and LV dysfunction. The beneficial effects of ranolazine in reducing Ca2+ overload and LV mechanical dysfunction during ischemia/reperfusion is consistent with the inhibition of late INa mechanism of action.

  3. Fruitful factors: what limits seed production of flowering plants in the alpine? (United States)

    Straka, Jason R; Starzomski, Brian M


    Predicting demographic consequences of climate change for plant communities requires understanding which factors influence seed set, and how climate change may alter those factors. To determine the effects of pollen availability, temperature, and pollinators on seed production in the alpine, we combined pollen-manipulation experiments with measurements of variation in temperature, and abundance and diversity of potential pollinators along a 400-m elevation gradient. We did this for seven dominant species of flowering plants in the Coast Range Mountains, British Columbia, Canada. The number of viable seeds set by plants was influenced by pollen limitation (quantity of pollen received), mate limitation (quality of pollen), temperature, abundance of potential pollinators, seed predation, and combinations of these factors. Early flowering species (n = 3) had higher seed set at high elevation and late-flowering species (n = 4) had higher seed set at low elevation. Degree-days >15 °C were good predictors of seed set, particularly in bee-pollinated species, but had inconsistent effects among species. Seed production in one species, Arnica latifolia, was negatively affected by seed-predators (Tephritidae) at mid elevation, where there were fewer frost-hours during the flowering season. Anemone occidentalis, a fly-pollinated, self-compatible species had high seed set at all elevations, likely due to abundant potential pollinators. Simultaneously measuring multiple factors affecting reproductive success of flowering plants helped identify which factors were most important, providing focus for future studies. Our work suggests that responses of plant communities to climate change may be mediated by flowering time, pollination syndrome, and susceptibility to seed predators.

  4. Host–symbiont recombination versus natural selection in the response of coral–dinoflagellate symbioses to environmental disturbance (United States)

    LaJeunesse, Todd C.; Smith, Robin; Walther, Mariana; Pinzón, Jorge; Pettay, Daniel T.; McGinley, Michael; Aschaffenburg, Matthew; Medina-Rosas, Pedro; Cupul-Magaña, Amilcar L.; Pérez, Andrés López; Reyes-Bonilla, Hector; Warner, Mark E.


    Mutualisms between reef-building corals and endosymbiotic dinoflagellates are particularly sensitive to environmental stress, yet the ecosystems they construct have endured major oscillations in global climate. During the winter of 2008, an extreme cold-water event occurred in the Gulf of California that bleached corals in the genus Pocillopora harbouring a thermally ‘sensitive’ symbiont, designated Symbiodinium C1b-c, while colonies possessing Symbiodinium D1 were mostly unaffected. Certain bleached colonies recovered quickly while others suffered partial or complete mortality. In most colonies, no appreciable change was observed in the identity of the original symbiont, indicating that these partnerships are stable. During the initial phases of recovery, a third species of symbiont B1Aiptasia, genetically identical to that harboured by the invasive anemone, Aiptasia sp., grew opportunistically and was visible as light-yellow patches on the branch tips of several colonies. However, this symbiont did not persist and was displaced in all cases by C1b-c several months later. Colonies with D1 were abundant at inshore habitats along the continental eastern Pacific, where seasonal turbidity is high relative to offshore islands. Environmental conditions of the central and southern coasts of Mexico were not sufficient to explain the exclusivity of D1 Pocillopora in these regions. It is possible that mass mortalities associated with major thermal disturbances during the 1997–1998 El Niño Southern Oscillation eliminated C1b-c holobionts from these locations. The differential loss of Pocillopora holobionts in response to thermal stress suggests that natural selection on existing variation can cause rapid and significant shifts in the frequency of particular coral–algal partnerships. However, coral populations may take decades to recover following episodes of severe selection, thereby raising considerable uncertainty about the long-term viability of these communities

  5. Light and vision in the deep-sea benthos: I. Bioluminescence at 500-1000 m depth in the Bahamian islands. (United States)

    Johnsen, Sönke; Frank, Tamara M; Haddock, Steven H D; Widder, Edith A; Messing, Charles G


    Bioluminescence is common and well studied in mesopelagic species. However, the extent of bioluminescence in benthic sites of similar depths is far less studied, although the relatively large eyes of benthic fish, crustaceans and cephalopods at bathyal depths suggest the presence of significant biogenic light. Using the Johnson-Sea-Link submersible, we collected numerous species of cnidarians, echinoderms, crustaceans, cephalopods and sponges, as well as one annelid from three sites in the northern Bahamas (500-1000 m depth). Using mechanical and chemical stimulation, we tested the collected species for light emission, and photographed and measured the spectra of the emitted light. In addition, in situ intensified video and still photos were taken of different benthic habitats. Surprisingly, bioluminescence in benthic animals at these sites was far less common than in mesopelagic animals from similar depths, with less than 20% of the collected species emitting light. Bioluminescent taxa comprised two species of anemone (Actinaria), a new genus and species of flabellate Parazoanthidae (formerly Gerardia sp.) (Zoanthidea), three sea pens (Pennatulacea), three bamboo corals (Alcyonacea), the chrysogorgiid coral Chrysogorgia desbonni (Alcyonacea), the caridean shrimp Parapandalus sp. and Heterocarpus ensifer (Decapoda), two holothuroids (Elasipodida and Aspidochirota) and the ophiuroid Ophiochiton ternispinus (Ophiurida). Except for the ophiuroid and the two shrimp, which emitted blue light (peak wavelengths 470 and 455 nm), all the species produced greener light than that measured in most mesopelagic taxa, with the emissions of the pennatulaceans being strongly shifted towards longer wavelengths. In situ observations suggested that bioluminescence associated with these sites was due primarily to light emitted by bioluminescent planktonic species as they struck filter feeders that extended into the water column.

  6. Spatial differences in East scotia ridge hydrothermal vent food webs: influences of chemistry, microbiology and predation on trophodynamics.

    Directory of Open Access Journals (Sweden)

    William D K Reid

    Full Text Available The hydrothermal vents on the East Scotia Ridge are the first to be explored in the Antarctic and are dominated by large peltospiroid gastropods, stalked barnacles (Vulcanolepas sp. and anomuran crabs (Kiwa sp. but their food webs are unknown. Vent fluid and macroconsumer samples were collected at three vent sites (E2, E9N and E9S at distances of tens of metres to hundreds of kilometres apart with contrasting vent fluid chemistries to describe trophic interactions and identify potential carbon fixation pathways using stable isotopes. δ(13C of dissolved inorganic carbon from vent fluids ranged from -4.6‰ to 0.8‰ at E2 and from -4.4‰ to 1.5‰ at E9. The lowest macroconsumer δ(13C was observed in peltospiroid gastropods (-30.0‰ to -31.1‰ and indicated carbon fixation via the Calvin-Benson-Bassham (CBB cycle by endosymbiotic gamma-Proteobacteria. Highest δ(13C occurred in Kiwa sp. (-19.0‰ to -10.5‰, similar to that of the epibionts sampled from their ventral setae. Kiwa sp. δ(13C differed among sites, which were attributed to spatial differences in the epibiont community and the relative contribution of carbon fixed via the reductive tricarboxylic acid (rTCA and CBB cycles assimilated by Kiwa sp. Site differences in carbon fixation pathways were traced into higher trophic levels e.g. a stichasterid asteroid that predates on Kiwa sp. Sponges and anemones at the periphery of E2 assimilated a proportion of epipelagic photosynthetic primary production but this was not observed at E9N. Differences in the δ(13C and δ(34S values of vent macroconsumers between E2 and E9 sites suggest the relative contributions of photosynthetic and chemoautotrophic carbon fixation (rTCA v CBB entering the hydrothermal vent food webs vary between the sites.

  7. Molecular cloning of Rab5 (ApRab5) in Aiptasia pulchella and its retention in phagosomes harboring live zooxanthellae

    International Nuclear Information System (INIS)

    Chen, M.-C.; Cheng, Y.-M; Hong, M.-C.; Fang, L.-S.


    The intracellular association of symbiotic dinoflagellates (zooxanthellae) with marine cnidarians is the very foundation of the highly productive and diversified coral reef ecosystems. To reveal its underlying molecular mechanisms, we previously cloned ApRab7, a Rab7 homologue of the sea anemone Aiptasia pulchella, and demonstrated its selective exclusion from phagosomes containing live zooxanthellae, but not from those containing either dead or photosynthesis-impaired algae. In this study, Rab5 was characterized, due to its key role in endocytosis and phagocytosis acting upstream of Rab7. The Aiptasia Rab5 homologue (ApRab5) is 79.5% identical to human Rab5C and contains all Rab-specific signature motifs. Subcellular fractionation study showed that ApRab5 is mainly cytosolic. EGFP reporter and phagocytosis studies indicated that membrane-associated ApRab5 is present in early endocytic and phagocytic compartments, and is able to promote their fusion. Significantly, immunofluorescence study showed that the majority of phagosomes containing either resident or newly internalized live zooxanthellae were labeled with ApRab5, while those containing either heat-killed or photosynthesis-impaired algae were mostly negative for ApRab5 staining whereas the opposite was observed for ApRab7. We propose that active phagosomal retention of ApRab5 is part of the mechanisms employed by live zooxanthellae to: (1) persist inside their host cells and (2) exclude ApRab7 from their phagosomes, thereby, establishing and/or maintaining an endosymbiotic relationship with their cnidarian hosts

  8. CoralWatch Data Analysis at Hoi Ha Wan Marine Park, Hong Kong (United States)

    Lau, A.; Hodgson, P.


    CoralWatch is a conservation organization that is based at the University of Queensland in Australia. Their development of the "Coral Health Chart" standardized the colour of corals for the further investigation of coral health and bleaching. The location of this project is in the NE part of Hong Kong in New Territories. The location faces ShenZhen, a heavily industrialized city, which is known for its pollution of the Pearl River. This area is protected by the Hong Kong Government and the WWF since 1996.Human activities have caused large amounts of greenhouse gasses to be released into the atmosphere. Carbon dioxide has caused the global temperature to rise and made ocean waters more acidic due to ocean respiration. The ocean is a carbon sink for mankind and the effect of severe acidification is negatively affecting marine life. The increase of temperature diminishes the amount of diversity of marine life; the decreasing acidity of the water has eliminated many species of shellfish and sea anemone; the increase of marine exploitation has decreased the diversity of marine life. The release of toxic waste, mainly mercury, waste and plastic products has also polluted the oceans which negatively impact coral reefs and endanger marine life.The data has been collected by observing the colours and discolouration (bleaching) of the corals of approximately 40 colonies per month. The species of coral in Hoi Ha Wan include, Favites flexuosa, Goniopora columna,Leptastrea purpurea, Lithophyllon undulatum, Pavona decussata. and Platygyra acuta (AFCD,1). The evaluation of four years of coralwatch data has shown the bleaching of hard boulder corals in Hoi Ha Wan, Hong Kong, has halted and the reefs are being to show signs of regeneration. Local marine biologists credited the improved situation of the corals to protected status of the area.

  9. Antagonism of Lidocaine Inhibition by Open-Channel Blockers That Generate Resurgent Na Current (United States)

    Bant, Jason S.; Aman, Teresa K.; Raman, Indira M.


    Na channels that generate resurgent current express an intracellular endogenous open-channel blocking protein, whose rapid binding upon depolarization and unbinding upon repolarization minimizes fast and slow inactivation. Na channels also bind exogenous compounds, such as lidocaine, which functionally stabilize inactivation. Like the endogenous blocking protein, these use-dependent inhibitors bind most effectively at depolarized potentials, raising the question of how lidocaine-like compounds affect neurons with resurgent Na current. We therefore recorded lidocaine inhibition of voltage-clamped, tetrodotoxin-sensitive Na currents in mouse Purkinje neurons, which express a native blocking protein, and in mouse hippocampal CA3 pyramidal neurons with and without a peptide from the cytoplasmic tail of NaVβ4 (the β4 peptide), which mimics endogenous open-channel block. To control channel states during drug exposure, lidocaine was applied with rapid-solution exchange techniques during steps to specific voltages. Inhibition of Na currents by lidocaine was diminished by either the β4 peptide or the native blocking protein. In peptide-free CA3 cells, prolonging channel opening with a site-3 toxin, anemone toxin II, reduced lidocaine inhibition; this effect was largely occluded by open-channel blockers, suggesting that lidocaine binding is favored by inactivation but prevented by open-channel block. In constant 100 μM lidocaine, current-clamped Purkinje cells continued to fire spontaneously. Similarly, the β4 peptide reduced lidocaine-dependent suppression of spiking in CA3 neurons in slices. Thus, the open-channel blocking protein responsible for resurgent current acts as a natural antagonist of lidocaine. Neurons with resurgent current may therefore be less susceptible to use-dependent Na channel inhibitors used as local anesthetic, antiarrhythmic, and anticonvulsant drugs. PMID:23486968

  10. Toxicity estimates for diuron and atrazine for the tropical marine cnidarian Exaiptasia pallida and in-hospite Symbiodinium spp. using PAM chlorophyll-a fluorometry. (United States)

    Howe, Pelli Louise; Reichelt-Brushett, Amanda Jean; Clark, Malcolm William; Seery, Cliff Ross


    Effective ecotoxicological risk assessments for herbicides in tropical marine environments are restricted by a lack of toxicity data, sensitive test methods and endpoints for relevant species, and this requires rectification. The symbiotic sea anemone Exaiptasia pallida is a suitable test species, representing the phylum Cnidaria and allowing for assessments of toxicological responses of both the animal host and in-hospite Symbiodinium spp. Pulse amplitude modulated (PAM) chlorophyll-a fluorometry is recognised as a valuable ecotoxicological tool, and here newly-developed test methods are presented using PAM fluorometry to measure herbicide effects on photosynthetic efficiency of in-hospite Symbiodinium spp. Additionally, measurements on healthy laboratory-reared E. pallida provide baseline data demonstrating the normal effective quantum yield (EQY) and the maximum electron transport rate (ETR m ) for Symbiodinium spp. in the absence of herbicide stress. Concentration-dependant reductions in the EQY and ETR m occurred during diuron and atrazine exposures; a mean 48-h EC50 (effective concentration; 50%) of 8μg/L of diuron was estimated, however atrazine elicited a much lower toxicity. Twelve-day exposures to 10-200μg/L diuron showed that the greatest EQY effect occurred during the first 48h, with little subsequent change. However, longer exposures to the lowest diuron treatment (1μg/L) showed the lowest EQYs after 96h followed by recovery to control levels within 12d. Furthermore, asexual reproduction was inhibited during 12-d exposures to diuron, and 12-d EC50 values of 100 and 132μg/L were estimated to inhibit successful reproduction of pedal lacerates and juveniles by 50% respectively. This study provides much needed data contributions to species sensitivity curves for development of diuron and atrazine water quality guidelines in tropical marine environments. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Early and late response of Nematostella vectensis transcriptome to heavy metals. (United States)

    Elran, Ron; Raam, Maayan; Kraus, Roey; Brekhman, Vera; Sher, Noa; Plaschkes, Inbar; Chalifa-Caspi, Vered; Lotan, Tamar


    Environmental contamination from heavy metals poses a global concern for the marine environment, as heavy metals are passed up the food chain and persist in the environment long after the pollution source is contained. Cnidarians play an important role in shaping marine ecosystems, but environmental pollution profoundly affects their vitality. Among the cnidarians, the sea anemone Nematostella vectensis is an advantageous model for addressing questions in molecular ecology and toxicology as it tolerates extreme environments and its genome has been published. Here, we employed a transcriptome-wide RNA-Seq approach to analyse N. vectensis molecular defence mechanisms against four heavy metals: Hg, Cu, Cd and Zn. Altogether, more than 4800 transcripts showed significant changes in gene expression. Hg had the greatest impact on up-regulating transcripts, followed by Cu, Zn and Cd. We identified, for the first time in Cnidaria, co-up-regulation of immediate-early transcription factors such as Egr1, AP1 and NF-κB. Time-course analysis of these genes revealed their early expression as rapidly as one hour after exposure to heavy metals, suggesting that they may complement or substitute for the roles of the metal-mediating Mtf1 transcription factor. We further characterized the regulation of a large array of stress-response gene families, including Hsp, ABC, CYP members and phytochelatin synthase, that may regulate synthesis of the metal-binding phytochelatins instead of the metallothioneins that are absent from Cnidaria genome. This study provides mechanistic insight into heavy metal toxicity in N. vectensis and sheds light on ancestral stress adaptations. © 2014 John Wiley & Sons Ltd.

  12. A critical assessment of marine aquarist biodiversity data and commercial aquaculture: identifying gaps in culture initiatives to inform local fisheries managers. (United States)

    Murray, Joanna M; Watson, Gordon J


    It is widely accepted that if well managed, the marine aquarium trade could provide socio-economic stability to local communities while incentivising the maintenance of coral reefs. However, the trade has also been implicated as having potentially widespread environmental impacts that has in part driven developments in aquaculture to relieve wild collection pressures. This study investigates the biodiversity in hobbyist aquaria (using an online survey) and those species currently available from an aquaculture source (commercial data and hobbyist initiatives) in the context of a traffic light system to highlight gaps in aquaculture effort and identify groups that require fisheries assessments. Two hundred and sixty nine species including clown fish, damsels, dotty backs, angelfish, gobies, sea horses and blennies, have reported breeding successes by hobbyists, a pattern mirrored by the European and US commercial organisations. However, there is a mismatch (high demand and low/non-existent aquaculture) for a number of groups including tangs, starfish, anemones and hermit crabs, which we recommend are priority candidates for local stock assessments. Hobbyist perception towards the concept of a sustainable aquarium trade is also explored with results demonstrating that only 40% of respondents were in agreement with industry and scientists who believe the trade could be an exemplar of a sustainable use of coral reefs. We believe that a more transparent evidence base, including the publication of the species collected and cultured, will go some way to align the concept of a sustainable trade across industry stakeholders and better inform the hobbyist when purchasing their aquaria stock. We conclude by proposing that a certification scheme established with government support is the most effective way to move towards a self-regulating industry. It would prevent industry "greenwashing" from multiple certification schemes, alleviate conservation concerns, and, ultimately

  13. Finding Nemo: hybrid assembly with Oxford Nanopore and Illumina reads greatly improves the clownfish (Amphiprion ocellaris) genome assembly. (United States)

    Tan, Mun Hua; Austin, Christopher M; Hammer, Michael P; Lee, Yin Peng; Croft, Laurence J; Gan, Han Ming


    Some of the most widely recognized coral reef fishes are clownfish or anemonefish, members of the family Pomacentridae (subfamily: Amphiprioninae). They are popular aquarium species due to their bright colours, adaptability to captivity, and fascinating behavior. Their breeding biology (sequential hermaphrodites) and symbiotic mutualism with sea anemones have attracted much scientific interest. Moreover, there are some curious geographic-based phenotypes that warrant investigation. Leveraging on the advancement in Nanopore long read technology, we report the first hybrid assembly of the clown anemonefish (Amphiprion ocellaris) genome utilizing Illumina and Nanopore reads, further demonstrating the substantial impact of modest long read sequencing data sets on improving genome assembly statistics. We generated 43 Gb of short Illumina reads and 9 Gb of long Nanopore reads, representing approximate genome coverage of 54× and 11×, respectively, based on the range of estimated k-mer-predicted genome sizes of between 791 and 967 Mbp. The final assembled genome is contained in 6404 scaffolds with an accumulated length of 880 Mb (96.3% BUSCO-calculated genome completeness). Compared with the Illumina-only assembly, the hybrid approach generated 94% fewer scaffolds with an 18-fold increase in N50 length (401 kb) and increased the genome completeness by an additional 16%. A total of 27 240 high-quality protein-coding genes were predicted from the clown anemonefish, 26 211 (96%) of which were annotated functionally with information from either sequence homology or protein signature searches. We present the first genome of any anemonefish and demonstrate the value of low coverage (∼11×) long Nanopore read sequencing in improving both genome assembly contiguity and completeness. The near-complete assembly of the A. ocellaris genome will be an invaluable molecular resource for supporting a range of genetic, genomic, and phylogenetic studies specifically for clownfish and

  14. Small Scale Genetic Population Structure of Coral Reef Organisms in Spermonde Archipelago, Indonesia

    Directory of Open Access Journals (Sweden)

    Janne Timm


    Full Text Available Small island archipelagos with fringing and dispersed reef systems represent special marine ecosystems, providing a patchy habitat for many coral reef organisms. Although geographic distances may be short, it is still unclear if such environments are inhabited evenly with panmictic conditions or if limited connectivity between marine populations, even on small geographic scales, leads to genetic differentiation between areas within the archipelago or even single reef structures. To study diversity patterns and connectivity between reefs of the Spermonde Archipelago, Indonesia, population genetic analyses of two reef organisms were performed by using the mitochondrial control region and microsatellite markers. A vertebrate (clown anemonefish and an invertebrate species (sea squirt were studied in parallel to investigate if there are general patterns of connectivity in Spermonde for sessile or site attached marine species, which can be extrapolated to a larger group. The genetic population structures revealed restrictions in gene flow in the clown anemone fish (Amphiprion ocellaris, especially between near-shore reefs in the South of the archipelago. This indicates very localized genetic exchange and may also reflect the high self-recruitment typical for these fish. The northern reefs show higher connectivity despite geographic distances being larger. The filter-feeding sessile sea squirt, Polycarpa aurata, features similar population patterns, especially in the southern area. However, connectivity is generally higher in the middle and shelf edge areas of Spermonde for this species. The results underline that there are restrictions to gene flow even on very small geographic scales in the studied organisms, with many barriers to gene flow in the southern shallower shelf area. Weaker currents in this area may lead to more influence of biological factors for dispersal, such as larval behavior, motility and competition for suitable habitat. The

  15. Na/sup +/ channels as sites of action of the cardioactive agent DPI 201-106 with agonist and antagonist enantiomers

    Energy Technology Data Exchange (ETDEWEB)

    Romey, G.; Quast, U.; Pauron, D.; Frelin, C.; Renaud, J.F.; Lazdunski, M.


    This paper shows the interaction of the cardiotonic agent 4-(3-(4-diphenylmethyl-1-piperazinyl)-2-hydroxypropoxy)-1H-indole-2-carbonitrile (DPI 201-106) and its optic enantiomers R-DPI (205-429) and S-DPI (205-430) with the Na/sup +/ channel of a variety of excitable cells. Voltage-clamp experiments show that DPI 201-106 acts on neuroblastoma cells and rat cardiac cells. S-DPI (205-430) increases the peak Na/sup +/ current, slows down the kinetics of Na/sup +/ channel inactivation, and is cardiotonic on heart cells. Conversely, R-DPI (205-429) reduces the peak Na/sup +/ current and blocks Na/sup +/ channel activity and cardiac contractions. Binding experiments using radioactively labeled toxins indicate that DPI 201-106 and its enantiomers do not interact with sites already identified for tetrodotoxin or sea anemone and scorpion toxins. DPI 201-106 and its enantiomers inhibit binding of a /sup 3/H-labeled batrachotoxin derivative, (/sup 3/H)batrachotoxinin A 20-..cap alpha..-benzoate, to brain membranes. The dissociation constant of the complex formed between the Na/sup +/ channel and both R-DPI and S-DPI is K/sub d/ approx. 100 nM. /sup 22/Na/sup +/ uptake experiments using different cell types have shown that R and S enantiomers of DPI 201-106 are active on the different Na/sup +/ channel subtypes with similar IC/sub 50/ values. These results are discussed in relation with the cardiotonic properties of DPI 201-106 that are not accompanied by cardiotoxic effects.

  16. Bleaching of reef coelenterates in the San Blas Islands, Panama (United States)

    Lasker, Howard R.; Peters, Esther C.; Coffroth, Mary Alice


    Starting in June 1983, 25 species of hermatypic corals, gorgonians, hydrocorals, anemones and zoanthids in the San Blas Islands, Panama, began showing signs of a loss of colour leading in some cases to a white “bleached” appearance. Histologic examination of six coral species indicated that bleaching was associated with drastic reductions in the density of zooxanthellae and with the atrophy and necrosis of the animal tissue. The severity of the bleaching varied among species and many species were unaffected. The species most extensively affected were: Agaricia spp., which became completely bleached and frequently died; Montastraea annularis which bleached and continued to survive; and Millepora spp. which bleached white but quickly regained their colouration. Shallow reefs dominated by Agaricia spp. suffered the most extensive bleaching. At one site, Pico Feo, 99% of the Agaricia (32% of the living cover) was bleached. On fore reers, which were dominated by Agaricia spp. and M. annularis, the proportion of M. annularis bleached ranged from 18 to 100% and that of Agaricia spp. from 30 to 53%. Transects at Sail Rock and House Reef were surveyed in August 1983 and January 1984. At those sites, 53% of the Agaricia cover died between August and January. The remaining living cover of Agaricia and of all other species exhibited normal colouration in January. Salinity and temperature were monitored every second day at 4 m depth between May 10 and August 28, 1983 at one of the localities. Bleaching was first observed within two weeks of a 2 °C rise in temperature which occurred in late May 1983. Temperatures remained at or above 31.5 °C for the following 3 weeks and were at or above 30 °C for an additional 4 weeks. The bleaching of corals in the San Blas was most likely due to those elevanted temperatures.

  17. Canines as sentinel species for assessing chronic exposures to air pollutants: part 2. Cardiac pathology. (United States)

    Calderón-Garcidueñas, L; Gambling, T M; Acuña, H; García, R; Osnaya, N; Monroy, S; Villarreal-Calderón, A; Carson, J; Koren, H S; Devlin, R B


    The principal objective of this study is to evaluate by light and electron microscopy (LM, EM) the heart tissues in stray southwest and northeast metropolitan Mexico City (SWMMC, NEMMC) dogs and compare their findings to those from 3 less polluted cities (Cuernavaca, Tlaxcala, and Tuxpam). Clinically healthy mongrel dogs, including 109 from highly polluted SWMMC and NEMMC, and 43 dogs from less polluted cities were studied. Dogs residing in cities with lower levels of pollutants showed little or no cardiac abnormalities. Mexico City and Cuernavaca dogs exhibited LM myocardial alterations including apoptotic myocytes, endothelial and immune effector cells, degranulated mast cells associated with scattered foci of mononuclear cells in left and right ventricles and interventricular septum, and clusters of adipocytes interspersed with mononuclear cells. Vascular changes included scattered polymorphonuclear leukocytes (PMN) margination and microthrombi in capillaries, and small venous and arteriolar blood vessels. Small veins exhibited smooth muscle cell hyperplasia, and arteriolar blood vessels showed deposition of particulate matter (PM) in the media and adventitia. Unmyelinated nerve fibers showed endoneural and epineural degranulated mast cells. EM examination of myocardial mast cells showed distended and abundant rough endoplasmic reticulum with few secretory granules. Myocardial capillaries exhibited fibrin deposition and their endothelial cells displayed increased luminal and abluminal pinocytic activity and the formation of anemone-like protrusions of the endothelium into the lumen. A close association between myocardial findings, lung epithelial and endothelial pathology, and chronic inflammatory lung changes was noted. The myocardial changes described in dogs exposed to ambient air pollutants may form the basis for developing hypothesis-driven mechanistic studies that might explain the epidemiological data of increased cardiovascular morbidity and mortality in

  18. Marine envenomations in returning French travellers seen in a tropical diseases unit, 2008-13. (United States)

    Henn, Aurélia; Pérignon, Alice; Monsel, Gentiane; Larréché, Sébastien; Caumes, Eric


    Travel and aquatic activities are increasing in tropical regions. The risk and the spectrum of marine envenomation are unknown in travellers. This work aims to evaluate the prevalence and the characteristics of marine envenomations in returning travellers. We retrospectively studied the medical charts of all returning travellers presenting with a health problem in a French tropical disease unit between 2008 and 2013, with focus on travellers complaining of marine envenomation. Characteristics of each type of envenomation are described. Of the 3315 travellers seen during the study period, 43 consulted for a presumed marine envenomation. Six patients were excluded, leaving 37 cases of confirmed marine envenomation. It corresponds to a prevalence of 1.1%. Sex ratio was balanced with 18 men and 19 women. Median age was 42 years (range 25-68 years). Median travel duration was 14 days (range: 6-62 days). The main travel destination was Southeast Asia in 10 cases, followed by islands of East Africa in seven cases. Median elapsed time between envenomation and consultation was 14 days (range: 2-130 days). The purpose of travel was tourism in all cases. The main clinical aspects were oedema, sting marks, cellulitis and flagellations. Eleven cases were presumably caused by corals, 10 by stonefish, 8 by jellyfish, 2 by weever fish, 2 by starfish, 2 by stingray, 1 by lionfish and 1 by sea anemone. Prevalence of marine envenomation is low in returning travellers. They are mostly caused by corals, stonefish and jellyfish. © International Society of Travel Medicine, 2016. All rights reserved. For permissions, please e-mail:

  19. The discovery of new deep-sea hydrothermal vent communities in the southern ocean and implications for biogeography.

    Directory of Open Access Journals (Sweden)

    Alex D Rogers


    Full Text Available Since the first discovery of deep-sea hydrothermal vents along the Galápagos Rift in 1977, numerous vent sites and endemic faunal assemblages have been found along mid-ocean ridges and back-arc basins at low to mid latitudes. These discoveries have suggested the existence of separate biogeographic provinces in the Atlantic and the North West Pacific, the existence of a province including the South West Pacific and Indian Ocean, and a separation of the North East Pacific, North East Pacific Rise, and South East Pacific Rise. The Southern Ocean is known to be a region of high deep-sea species diversity and centre of origin for the global deep-sea fauna. It has also been proposed as a gateway connecting hydrothermal vents in different oceans but is little explored because of extreme conditions. Since 2009 we have explored two segments of the East Scotia Ridge (ESR in the Southern Ocean using a remotely operated vehicle. In each segment we located deep-sea hydrothermal vents hosting high-temperature black smokers up to 382.8°C and diffuse venting. The chemosynthetic ecosystems hosted by these vents are dominated by a new yeti crab (Kiwa n. sp., stalked barnacles, limpets, peltospiroid gastropods, anemones, and a predatory sea star. Taxa abundant in vent ecosystems in other oceans, including polychaete worms (Siboglinidae, bathymodiolid mussels, and alvinocaridid shrimps, are absent from the ESR vents. These groups, except the Siboglinidae, possess planktotrophic larvae, rare in Antarctic marine invertebrates, suggesting that the environmental conditions of the Southern Ocean may act as a dispersal filter for vent taxa. Evidence from the distinctive fauna, the unique community structure, and multivariate analyses suggest that the Antarctic vent ecosystems represent a new vent biogeographic province. However, multivariate analyses of species present at the ESR and at other deep-sea hydrothermal vents globally indicate that vent biogeography is more

  20. Some anemonefish lack personality: a comparative assessment of behavioral variation and repeatability in relation to environmental and social factors (United States)

    Wong, Marian Y. L.; Beasley, Amanda L.; Douglass, Tasman; Whalan, Steve; Scott, Anna


    Determining the extent of repeatable differences in the behavior of animals and the factors that influence behavioral expression is important for understanding individual fitness and population processes, thereby aiding in species conservation. However, little is known about the causes of variation in the repeatability of behavioral differences among species because rarely have comparative studies been undertaken to examine the repeatability of behavioral differences among individuals within their natural ecological settings. Using two species of endemic subtropical anemonefishes, Amphiprion mccullochi and A. latezonatus at Lord Howe and North Solitary Islands, Australia, we conducted an in situ comparative analysis of personality traits, examining the repeatability of boldness, sociability and aggression as well as the potential role of environmental and social factors on behavioral expression. For A. mccullochi, only boldness and aggression were highly repeatable and these behaviors formed a behavioral syndrome. For A. latezonatus, none of the three behaviors were repeatable due to low-inter-individual variation in behavior. We suggest that the harsher and more variable environmental and social conditions experienced by A. latezonatus have resulted in reduced repeatability in behavior, in contrast to A. mccullochi which typically inhabits a more stable lagoonal reef environment. Additionally, group size and size rank, rather than nearest-neighbor distance and anemone size, influenced the expression of these behaviors in both species, suggesting that behavioral variation was more sensitive to social than environmental factors. Overall, differences in repeatability between these closely related species likely reflect adaptations to contrasting environmental and social conditions, although alternative explanations must be considered. The differences in behavioral consistency between these two endemic anemonefishes could lead to disparity in their resilience to

  1. SECOM: A novel hash seed and community detection based-approach for genome-scale protein domain identification

    KAUST Repository

    Fan, Ming


    With rapid advances in the development of DNA sequencing technologies, a plethora of high-throughput genome and proteome data from a diverse spectrum of organisms have been generated. The functional annotation and evolutionary history of proteins are usually inferred from domains predicted from the genome sequences. Traditional database-based domain prediction methods cannot identify novel domains, however, and alignment-based methods, which look for recurring segments in the proteome, are computationally demanding. Here, we propose a novel genome-wide domain prediction method, SECOM. Instead of conducting all-against-all sequence alignment, SECOM first indexes all the proteins in the genome by using a hash seed function. Local similarity can thus be detected and encoded into a graph structure, in which each node represents a protein sequence and each edge weight represents the shared hash seeds between the two nodes. SECOM then formulates the domain prediction problem as an overlapping community-finding problem in this graph. A backward graph percolation algorithm that efficiently identifies the domains is proposed. We tested SECOM on five recently sequenced genomes of aquatic animals. Our tests demonstrated that SECOM was able to identify most of the known domains identified by InterProScan. When compared with the alignment-based method, SECOM showed higher sensitivity in detecting putative novel domains, while it was also three orders of magnitude faster. For example, SECOM was able to predict a novel sponge-specific domain in nucleoside-triphosphatase (NTPases). Furthermore, SECOM discovered two novel domains, likely of bacterial origin, that are taxonomically restricted to sea anemone and hydra. SECOM is an open-source program and available at © 2012 Fan et al.

  2. Using Aiptasia as a Model to Study Metabolic Interactions in Cnidarian-Symbiodinium Symbioses

    KAUST Repository

    Radecker, Nils


    The symbiosis between cnidarian hosts and microalgae of the genus Symbiodinium provides the foundation of coral reefs in oligotrophic waters. Understanding the nutrient-exchange between these partners is key to identifying the fundamental mechanisms behind this symbiosis, yet has proven difficult given the endosymbiotic nature of this relationship. In this study, we investigated the respective contribution of host and symbiont to carbon and nitrogen assimilation in the coral model anemone Aiptaisa. For this, we combined traditional measurements with nanoscale secondary ion mass spectrometry (NanoSIMS) and stable isotope labeling to investigate patterns of nutrient uptake and translocation both at the organismal scale and at the cellular scale. Our results show that the rate of carbon and nitrogen assimilation in Aiptasia depends on the identity of the host and the symbiont. NanoSIMS analysis confirmed that both host and symbiont incorporated carbon and nitrogen into their cells, implying a rapid uptake and cycling of nutrients in this symbiotic relationship. Gross carbon fixation was highest in Aiptasia associated with their native Symbiodinium communities. However, differences in fixation rates were only reflected in the δ13C enrichment of the cnidarian host, whereas the algal symbiont showed stable enrichment levels regardless of host identity. Thereby, our results point toward a “selfish” character of the cnidarian—Symbiodinium association in which both partners directly compete for available resources. Consequently, this symbiosis may be inherently instable and highly susceptible to environmental change. While questions remain regarding the underlying cellular controls of nutrient exchange and the nature of metabolites involved, the approach outlined in this study constitutes a powerful toolset to address these questions.

  3. Global transcriptome analysis of the scorpion Centruroides noxius: new toxin families and evolutionary insights from an ancestral scorpion species.

    Directory of Open Access Journals (Sweden)

    Martha Rendón-Anaya

    Full Text Available Scorpion venoms have been studied for decades, leading to the identification of hundreds of different toxins with medical and pharmacological implications. However, little emphasis has been given to the description of these arthropods from cellular and evolutionary perspectives. In this report, we describe a transcriptomic analysis of the Mexican scorpion Centruroides noxius Hoffmann, performed with a pyrosequencing platform. Three independent sequencing experiments were carried out, each including three different cDNA libraries constructed from RNA extracted from the whole body of the scorpion after telson removal, and from the venom gland before and after venom extraction. Over three million reads were obtained and assembled in almost 19000 isogroups. Within the telson-specific sequences, 72 isogroups (0.4% of total unique transcripts were found to be similar to toxins previously reported in other scorpion species, spiders and sea anemones. The annotation pipeline also revealed the presence of important elements of the small non-coding RNA processing machinery, as well as microRNA candidates. A phylogenomic analysis of concatenated essential genes evidenced differential evolution rates in this species, particularly in ribosomal proteins and proteasome components. Additionally, statistical comparison of transcript abundance before and after venom extraction showed that 3% and 2% of the assembled isogroups had higher expression levels in the active and replenishing gland, respectively. Thus, our sequencing and annotation strategies provide a general view of the cellular and molecular processes that take place in these arthropods, allowed the discovery of new pharmacological and biotechnological targets and uncovered several regulatory and metabolic responses behind the assembly of the scorpion venom. The results obtained in this report represent the first high-throughput study that thoroughly describes the universe of genes that are expressed in

  4. Identification Of Some Strains Of Dinoflagellates Based On Morphology And Molecular Analysis

    Directory of Open Access Journals (Sweden)

    Hikmah Thoha


    Full Text Available Dinoflagellates are the important primary producers in aquatic environments. In oceans, they play interesting role in ecological functions such as red tide forming organisms, symbiont of coral reef or sea anemone and DSP (Diarrhetic Shellfish Poisoning or PSP (Paralytic Shellfish Poisoning producing organisms. Morphology and molecular analysis of dinoflagellates were conducted on November 2002 to March 2003. The phylogenetic studies based on 18S rDNA analyses, sequence have begun to appear more frequently in the literature, as attention has turned to relationships within the major eukaryotic lineages, particular importance for the taxonomy of the armored and unarmored genera of dinoflagellates (Gyrodinium sp., Cachonina sp., Gymnodinium sp., Amphidinium sp., because many of the genera cause extensive plankton blooms, fish kills and other harmful events, were studied used to amplify 18S rDNA, present in the total DNA extracted from algal pellet. The amplify approximately 1400 bp of the nuclear-encoded LSU rDNA gene using terminal primeirs DIR, products were cheked by 1.0 % agarose gel electrophoresis, then cloning with TA cloning KIT. Sequencing were analyzed by the GENETIX Mac Software, Homology search by Blast and Phylogenetic analysis. Results of hylogenetic analysis of 18S rDNA are: Strain no. 10893 (un identified from the genera, it is belonging Gymnodinium or Polarella. Strain no. 10795 is closely related other species Cachonina hallii. We tentatively named strain no 11151 and 11160 similar to Gyrodinium or Gymnodinium based on morphology, but these strain indepently position in this tree and is not a real of Gymnodinium sensu stricto. It is possible, we can establish the new genera for strain no. 11151; 11160 because this not cluster any other unarmored species.

  5. Molecular components and toxicity of the venom of the solitary wasp, Anoplius samariensis

    International Nuclear Information System (INIS)

    Hisada, Miki; Satake, Honoo; Masuda, Katsuyoshi; Aoyama, Masato; Murata, Kazuya; Shinada, Testuro; Iwashita, Takashi; Ohfune, Yasufumi; Nakajima, Terumi


    The solitary spider wasp, Anoplius samariensis, is known to exhibit a unique long-term, non-lethal paralysis in spiders that it uses as a food source for its larvae. However, neither detailed venom components nor paralytic compounds have ever been characterized. In this study, we examined the components in the low molecular weight fraction of the venom and the paralytic activity of the high molecular weight fraction. The major low molecular weight components of the venom were identified as γ-aminobutyric acid and glutamic acid by micro-liquid chromatography/electrospray ionization mass spectrometry and nuclear magnetic resonance spectrometry analysis. The sodium dodecyl sulfate-polyacrylamide gel electrophoresis and mass analysis revealed that the A. samariensis venom contained the various proteins with weights of 4-100 kDa. A biological assay using Joro spiders (Nephila clavata) clearly showed that the high molecular weight fraction of the venom prepared by ultrafiltration exerted as potent non-lethal long-term paralysis as the whole venom, whereas the low molecular weight fraction was devoid of any paralytic activity. These results indicated that several venomous proteins in the high molecular weight fraction are responsible for the paralytic activity. Furthermore, we determined the primary structure of one component designated As-fr-19, which was a novel multiple-cysteine peptide with high sequence similarity to several sea anemone and snake toxins including dendrotoxins, rather than any insect toxic peptides identified so far. Taken together, our data showed the unprecedented molecular and toxicological profiles of wasp venoms

  6. A Polychaete’s Powerful Punch: Venom Gland Transcriptomics of Glycera Reveals a Complex Cocktail of Toxin Homologs (United States)

    von Reumont, Björn M.; Richter, Sandy; Hering, Lars; Sykes, Dan; Hetmank, Jörg; Jenner, Ronald A.; Bleidorn, Christoph


    Glycerids are marine annelids commonly known as bloodworms. Bloodworms have an eversible proboscis adorned with jaws connected to venom glands. Bloodworms prey on invertebrates, and it is known that the venom glands produce compounds that can induce toxic effects in animals. Yet, none of these putative toxins has been characterized on a molecular basis. Here we present the transcriptomic profiles of the venom glands of three species of bloodworm, Glycera dibranchiata, Glycera fallax and Glycera tridactyla, as well as the body tissue of G. tridactyla. The venom glands express a complex mixture of transcripts coding for putative toxin precursors. These transcripts represent 20 known toxin classes that have been convergently recruited into animal venoms, as well as transcripts potentially coding for Glycera-specific toxins. The toxins represent five functional categories: Pore-forming and membrane-disrupting toxins, neurotoxins, protease inhibitors, other enzymes, and CAP domain toxins. Many of the transcripts coding for putative Glycera toxins belong to classes that have been widely recruited into venoms, but some are homologs of toxins previously only known from the venoms of scorpaeniform fish and monotremes (stonustoxin-like toxin), turrid gastropods (turripeptide-like peptides), and sea anemones (gigantoxin I-like neurotoxin). This complex mixture of toxin homologs suggests that bloodworms employ venom while predating on macroscopic prey, casting doubt on the previously widespread opinion that G. dibranchiata is a detritivore. Our results further show that researchers should be aware that different assembly methods, as well as different methods of homology prediction, can influence the transcriptomic profiling of venom glands. PMID:25193302

  7. A Polychaete's powerful punch: venom gland transcriptomics of Glycera reveals a complex cocktail of toxin homologs. (United States)

    von Reumont, Björn M; Campbell, Lahcen I; Richter, Sandy; Hering, Lars; Sykes, Dan; Hetmank, Jörg; Jenner, Ronald A; Bleidorn, Christoph


    Glycerids are marine annelids commonly known as bloodworms. Bloodworms have an eversible proboscis adorned with jaws connected to venom glands. Bloodworms prey on invertebrates, and it is known that the venom glands produce compounds that can induce toxic effects in animals. Yet, none of these putative toxins has been characterized on a molecular basis. Here we present the transcriptomic profiles of the venom glands of three species of bloodworm, Glycera dibranchiata, Glycera fallax and Glycera tridactyla, as well as the body tissue of G. tridactyla. The venom glands express a complex mixture of transcripts coding for putative toxin precursors. These transcripts represent 20 known toxin classes that have been convergently recruited into animal venoms, as well as transcripts potentially coding for Glycera-specific toxins. The toxins represent five functional categories: Pore-forming and membrane-disrupting toxins, neurotoxins, protease inhibitors, other enzymes, and CAP domain toxins. Many of the transcripts coding for putative Glycera toxins belong to classes that have been widely recruited into venoms, but some are homologs of toxins previously only known from the venoms of scorpaeniform fish and monotremes (stonustoxin-like toxin), turrid gastropods (turripeptide-like peptides), and sea anemones (gigantoxin I-like neurotoxin). This complex mixture of toxin homologs suggests that bloodworms employ venom while predating on macroscopic prey, casting doubt on the previously widespread opinion that G. dibranchiata is a detritivore. Our results further show that researchers should be aware that different assembly methods, as well as different methods of homology prediction, can influence the transcriptomic profiling of venom glands. © The Author(s) 2014. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  8. RAG1 core and V(DJ recombination signal sequences were derived from Transib transposons.

    Directory of Open Access Journals (Sweden)

    Vladimir V Kapitonov


    Full Text Available The V(DJ recombination reaction in jawed vertebrates is catalyzed by the RAG1 and RAG2 proteins, which are believed to have emerged approximately 500 million years ago from transposon-encoded proteins. Yet no transposase sequence similar to RAG1 or RAG2 has been found. Here we show that the approximately 600-amino acid "core" region of RAG1 required for its catalytic activity is significantly similar to the transposase encoded by DNA transposons that belong to the Transib superfamily. This superfamily was discovered recently based on computational analysis of the fruit fly and African malaria mosquito genomes. Transib transposons also are present in the genomes of sea urchin, yellow fever mosquito, silkworm, dog hookworm, hydra, and soybean rust. We demonstrate that recombination signal sequences (RSSs were derived from terminal inverted repeats of an ancient Transib transposon. Furthermore, the critical DDE catalytic triad of RAG1 is shared with the Transib transposase as part of conserved motifs. We also studied several divergent proteins encoded by the sea urchin and lancelet genomes that are 25%-30% identical to the RAG1 N-terminal domain and the RAG1 core. Our results provide the first direct evidence linking RAG1 and RSSs to a specific superfamily of DNA transposons and indicate that the V(DJ machinery evolved from transposons. We propose that only the RAG1 core was derived from the Transib transposase, whereas the N-terminal domain was assembled from separate proteins of unknown function that may still be active in sea urchin, lancelet, hydra, and starlet sea anemone. We also suggest that the RAG2 protein was not encoded by ancient Transib transposons but emerged in jawed vertebrates as a counterpart of RAG1 necessary for the V(DJ recombination reaction.

  9. The dynamically evolving nematocyst content of an anthozoan, a scyphozoan, and a hydrozoan. (United States)

    Rachamim, Tamar; Morgenstern, David; Aharonovich, Dikla; Brekhman, Vera; Lotan, Tamar; Sher, Daniel


    Nematocytes, the stinging cells of cnidarians, are the most evolutionarily ancient venom apparatus. These nanosyringe-like weaponry systems reach pressures of approximately 150 atmospheres before discharging and punching through the outer layer of the prey or predator at accelerations of more than 5 million g, making them one of the fastest biomechanical events known. To gain better understanding of the function of the complex, phylum-specific nematocyst organelle, and its venom payload, we compared the soluble nematocyst's proteome from the sea anemone Anemonia viridis, the jellyfish Aurelia aurita, and the hydrozoan Hydra magnipapillata, each belonging to one of the three basal cnidarian lineages which diverged over 600 Ma. Although the basic morphological and functional characteristics of the nematocysts of the three organisms are similar, out of hundreds of proteins identified in each organism, only six are shared. These include structural proteins, a chaperone which may help maintain venon activity over extended periods, and dickkopf, an enigmatic Wnt ligand which may also serve as a toxin. Nevertheless, many protein domains are shared between the three organisms' nematocyst content suggesting common proteome functionalities. The venoms of Hydra and Aurelia appear to be functionally similar and composed mainly of cytotoxins and enzymes, whereas the venom of the Anemonia is markedly unique and based on peptide neurotoxins. Cnidarian venoms show evidence for functional recruitment, yet evidence for diversification through positive selection, common to other venoms, is lacking. The final injected nematocyst payload comprises a mixture of dynamically evolving proteins involved in the development, maturation, maintenance, and discharge of the nematocysts, which is unique to each organism and potentially to each nematocyst type. © The Author 2014. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution. All rights reserved

  10. A toxin homology domain in an astacin-like metalloproteinase of the jellyfish Podocoryne carnea with a dual role in digestion and development. (United States)

    Pan, T; Gröger, H; Schmid, V; Spring, J


    Metalloproteinases of the astacin family such as tolloid play major roles in animal morphogenesis. Cnidarians are thought to be evolutionary simple organisms and, therefore, a metalloproteinase from the marine hydrozoan Podocoryne carnea was analysed to evaluate the role of this conserved gene familiy at the base of animal evolution. Surprisingly, the proteinase domain of Podocornyne PMP1 is more similar to human meprin than to HMP1 from another hydrozoan, the freshwater polyp Hydra vulgaris. However, PMP1 and HMP1 both contain a small C-terminal domain with six cysteines that distinguishes them from other astacin-like molecules. Similar domains have been described only recently from sea anemone toxins specific for potassium channels. This toxin homology (Tox1) domain is clearly distinct from epidermal growth factor (EGF)-like domains or other cysteine-rich modules and terminates with the characteristic pattern CXXXCXXC with three out of six cysteines in the last eight residues of the protein. PMP1 is transiently expressed at various sites of morphogenetic activity during medusa bud development. In the adult medusa, however, expression is concentrated to the manubrium, the feeding organ, where the PMP1 gene is highly induced upon feeding. These disparate expression patterns suggest a dual role of PMP1 comparable to tolloid in development and, like astacin in the crayfish, also for food digestion. The Tox1 domain of PMP1 could serve as a toxin to keep the pray paralysed after ingestion, but as a sequence module such Tox1 domains with six cysteines are neither restricted to cnidarians nor to toxins.

  11. Specialist and generalist symbionts show counterintuitive levels of genetic diversity and discordant demographic histories along the Florida Reef Tract (United States)

    Titus, Benjamin M.; Daly, Marymegan


    Specialist and generalist life histories are expected to result in contrasting levels of genetic diversity at the population level, and symbioses are expected to lead to patterns that reflect a shared biogeographic history and co-diversification. We test these assumptions using mtDNA sequencing and a comparative phylogeographic approach for six co-occurring crustacean species that are symbiotic with sea anemones on western Atlantic coral reefs, yet vary in their host specificities: four are host specialists and two are host generalists. We first conducted species discovery analyses to delimit cryptic lineages, followed by classic population genetic diversity analyses for each delimited taxon, and then reconstructed the demographic history for each taxon using traditional summary statistics, Bayesian skyline plots, and approximate Bayesian computation to test for signatures of recent and concerted population expansion. The genetic diversity values recovered here contravene the expectations of the specialist-generalist variation hypothesis and classic population genetics theory; all specialist lineages had greater genetic diversity than generalists. Demography suggests recent population expansions in all taxa, although Bayesian skyline plots and approximate Bayesian computation suggest the timing and magnitude of these events were idiosyncratic. These results do not meet the a priori expectation of concordance among symbiotic taxa and suggest that intrinsic aspects of species biology may contribute more to phylogeographic history than extrinsic forces that shape whole communities. The recovery of two cryptic specialist lineages adds an additional layer of biodiversity to this symbiosis and contributes to an emerging pattern of cryptic speciation in the specialist taxa. Our results underscore the differences in the evolutionary processes acting on marine systems from the terrestrial processes that often drive theory. Finally, we continue to highlight the Florida Reef

  12. Abyssal fauna of the UK-1 polymetallic nodule exploration area, Clarion-Clipperton Zone, central Pacific Ocean: Cnidaria. (United States)

    Dahlgren, Thomas G; Wiklund, Helena; Rabone, Muriel; Amon, Diva J; Ikebe, Chiho; Watling, Les; Smith, Craig R; Glover, Adrian G


    We present data from a DNA taxonomy register of the abyssal Cnidaria collected as part of the Abyssal Baseline (ABYSSLINE) environmental survey cruise 'AB01' to the UK Seabed Resources Ltd (UKSRL) polymetallic-nodule exploration area 'UK-1' in the eastern Clarion-Clipperton Zone (CCZ), central Pacific Ocean abyssal plain. This is the second paper in a series to provide regional taxonomic data for a region that is undergoing intense deep-sea mineral exploration for high-grade polymetallic nodules. Data were collected from the UK-1 exploration area following the methods described in Glover et al. (2015b). Morphological and genetic data are presented for 10 species and 18 records identified by a combination of morphological and genetic data, including molecular phylogenetic analyses. These included 2 primnoid octocorals, 2 isidid octocorals, 1 anemone, 4 hydroids (including 2 pelagic siphonophores accidentally caught) and a scyphozoan jellyfish (in the benthic stage of the life cycle). Two taxa matched previously published genetic sequences (pelagic siphonophores), two taxa matched published morphological descriptions (abyssal primnoids described from the same locality in 2015) and the remaining 6 taxa are potentially new species, for which we make the raw data, imagery and vouchers available for future taxonomic study. We have used a precautionary approach in taxon assignments to avoid over-estimating species ranges. The Clarion-Clipperton Zone is a region undergoing intense exploration for potential deep-sea mineral extraction. We present these data to facilitate future taxonomic and environmental impact study by making both data and voucher materials available through curated and accessible biological collections. For some of the specimens we also provide image data collected at the seabed by ROV, wich may facilitate more accurate taxon designation in coming ROV or AUV surveys.

  13. Development and short-term dynamics of macrofouling assemblages on fish-cage nettings in a tropical estuary (United States)

    Madin, John; Chong, V. C.; Basri, Badrulnizam


    A study was conducted at a fish culture farm in the Jaha River estuary, Malaysia, to examine the structure and development of macrofouling assemblages on floating net-cages. The study was conducted during the dry (August-October 2001) and wet (December-February 2002) seasons. Biofouling on 1.6 cm mesh net panels (size 0.2 m × 2 m) suspended inside (P, T) and outside (O) experimental net-cages was monitored every week until net openings were completely occluded by macrofouling organisms (8 wk and 12 wk for dry and wet seasons respectively). Seven species (6 phyla) of sessile organisms and 23 species (3 phyla) of non-sessile associates were recorded. Macro-colonization of net panels began with the hydroid Plumularia sp. irrespective of season and treatment (P, T, and O), while other species only appeared after 1 or 2 weeks of immersion. Inside net-cages where water flow was slow (mean < 6 cm s -1 at 0.50-0.75 m depth); macroalgae ( Polysiphonia sp.), anthozoans (unidentified anemone), barnacles ( Balanus amphitrite), amphipods ( Gammaropsis sp. & Photis sp.), and tanaids ( Leptognathia sp.) were dominant on the net panels during the dry season. In the wet season, hydroid ( Plumularia sp.), mussel ( Xenostrobus mangle), and nematode abundance were however significant. With stronger water flow (mean ≈ 20 cm s -1) as occurring outside the net-cages, macrofouling assemblages for both seasons comprised mainly Plumularia sp. and Gammaropsis sp. The macrofouling assemblage showed a clear succession of species that occupied different layers of the net panels. The study shows that while organic enrichment and retarded water flow together enhance the development of macrofouling assemblages, salinity, depth, substrate (net) area and species competition specifically influence community structure, colonization, and depth distribution of the macrofouling organisms.

  14. In situ respiration measurements of megafauna in the Kermadec Trench (United States)

    Nunnally, Clifton C.; Friedman, Jason R.; Drazen, Jeffrey C.


    The aim of this paper is to measure metabolic rates of megafauna living in depths greater than 6000 m. Echinoderms, actinarians and a polychaete were captured by remotely operated vehicle (ROV) and inserted into respiration chambers in situ at depths of 4049 m, 7140 m and 8074 m in the region of the Kermadec Trench SW Pacific Ocean. Hadal research has moved into a new frontier as technological improvements now allow for a meticulous investigation of trench ecology in depths greater than 6000 m. The development of an in situ respirometer for use in these studies was deployed in the Kermadec Trench to obtain the first ever rates of basal metabolic rates of hadal megafauna. Typical deep-sea experiments of individual animal physiology must deal with covarying factors of pressure, temperature, light and food supply in this study investigated the effects of pressure and increased food supply on overall animal metabolism. In the Kermadec Trench, holothurian respiration rates (n=4), 0.079±0.011 (mean±SE) μmol-O2 g-1 h-1, were higher than those captured at abyssal depths (n=2), 0.018±0.002 μmol-O2 g-1h-1, in the same region (p<0.001). When Q10 adjusted to a common temperature of 2.5 °C trench holothurian respiration rates ranged between 0.068 and 0.119 μmol-O2 g-1 h-1. Anemone respiration rates were remarkably similar between abyssal and hadal specimens, 0.110 and 0.111 μmol-O2 g-1 h-1, respectively. Our results on echinoderm respiration when corrected for temperature and mass fall below the slope regression when compared with other in situ measurements at shallower ocean depths.

  15. Semi-automated image analysis for the assessment of megafaunal densities at the Arctic deep-sea observatory HAUSGARTEN. (United States)

    Schoening, Timm; Bergmann, Melanie; Ontrup, Jörg; Taylor, James; Dannheim, Jennifer; Gutt, Julian; Purser, Autun; Nattkemper, Tim W


    Megafauna play an important role in benthic ecosystem function and are sensitive indicators of environmental change. Non-invasive monitoring of benthic communities can be accomplished by seafloor imaging. However, manual quantification of megafauna in images is labor-intensive and therefore, this organism size class is often neglected in ecosystem studies. Automated image analysis has been proposed as a possible approach to such analysis, but the heterogeneity of megafaunal communities poses a non-trivial challenge for such automated techniques. Here, the potential of a generalized object detection architecture, referred to as iSIS (intelligent Screening of underwater Image Sequences), for the quantification of a heterogenous group of megafauna taxa is investigated. The iSIS system is tuned for a particular image sequence (i.e. a transect) using a small subset of the images, in which megafauna taxa positions were previously marked by an expert. To investigate the potential of iSIS and compare its results with those obtained from human experts, a group of eight different taxa from one camera transect of seafloor images taken at the Arctic deep-sea observatory HAUSGARTEN is used. The results show that inter- and intra-observer agreements of human experts exhibit considerable variation between the species, with a similar degree of variation apparent in the automatically derived results obtained by iSIS. Whilst some taxa (e. g. Bathycrinus stalks, Kolga hyalina, small white sea anemone) were well detected by iSIS (i. e. overall Sensitivity: 87%, overall Positive Predictive Value: 67%), some taxa such as the small sea cucumber Elpidia heckeri remain challenging, for both human observers and iSIS.

  16. Semi-automated image analysis for the assessment of megafaunal densities at the Arctic deep-sea observatory HAUSGARTEN.

    Directory of Open Access Journals (Sweden)

    Timm Schoening

    Full Text Available Megafauna play an important role in benthic ecosystem function and are sensitive indicators of environmental change. Non-invasive monitoring of benthic communities can be accomplished by seafloor imaging. However, manual quantification of megafauna in images is labor-intensive and therefore, this organism size class is often neglected in ecosystem studies. Automated image analysis has been proposed as a possible approach to such analysis, but the heterogeneity of megafaunal communities poses a non-trivial challenge for such automated techniques. Here, the potential of a generalized object detection architecture, referred to as iSIS (intelligent Screening of underwater Image Sequences, for the quantification of a heterogenous group of megafauna taxa is investigated. The iSIS system is tuned for a particular image sequence (i.e. a transect using a small subset of the images, in which megafauna taxa positions were previously marked by an expert. To investigate the potential of iSIS and compare its results with those obtained from human experts, a group of eight different taxa from one camera transect of seafloor images taken at the Arctic deep-sea observatory HAUSGARTEN is used. The results show that inter- and intra-observer agreements of human experts exhibit considerable variation between the species, with a similar degree of variation apparent in the automatically derived results obtained by iSIS. Whilst some taxa (e. g. Bathycrinus stalks, Kolga hyalina, small white sea anemone were well detected by iSIS (i. e. overall Sensitivity: 87%, overall Positive Predictive Value: 67%, some taxa such as the small sea cucumber Elpidia heckeri remain challenging, for both human observers and iSIS.

  17. The role of marine reserves in the replenishment of a locally-impacted population of anemonefish on the Great Barrier Reef

    KAUST Repository

    Bonin, Mary C.


    The development of parentage analysis to track the dispersal of juvenile offspring has given us unprecedented insight into the population dynamics of coral reef fishes. These tools now have the potential to inform fisheries management and species conservation, particularly for small fragmented populations under threat from exploitation and disturbance. In this study we resolve patterns of larval dispersal for a population of the anemonefish Amphiprion melanopus in the Keppel Islands (southern Great Barrier Reef). Habitat loss and fishing appear to have impacted this population and a network of no-take marine reserves currently protects 75% of the potential breeders. Using parentage analysis, we estimate that 21% of recruitment in the island group was generated locally, and that breeding adults living in reserves were responsible for 79% (31 out of 39) of these of locally-produced juveniles. Overall, the network of reserves was fully connected via larval dispersal; however one reserve was identified as a critical source of larvae for the island group. The population in the Keppel Islands also appears to be well-connected to other source populations at least 60 km away, given that 79% (145 out of 184) of the juveniles sampled remained unassigned in the parentage analysis. We estimated the effective size of the A. melanopus metapopulation to be 745 (582-993 95% CI) and recommend continued monitoring of its genetic status. Maintaining connectivity with populations beyond the Keppel Islands and recovery of local recruitment habitat, potentially through active restoration of host anemone populations, will be important for its long-term persistence.

  18. High salinity conveys thermotolerance in the coral model Aiptasia

    KAUST Repository

    Gegner, Hagen M.


    The endosymbiosis between dinoflagellate algae of the genus Symbiodinium and stony corals provides the foundation of coral reef ecosystems. Coral bleaching, the expulsion of endosymbionts from the coral host tissue as a consequence of heat or light stress, poses a threat to reef ecosystem functioning on a global scale. Hence, a better understanding of the factors contributing to heat stress susceptibility and tolerance is needed. In this regard, some of the most thermotolerant corals also live in particularly saline habitats, but possible effects of high salinity on thermotolerance in corals are anecdotal. Here we test the hypothesis that high salinity may lead to increased thermotolerance. We conducted a heat stress experiment at low, intermediate, and high salinities using a set of host-endosymbiont combinations of the coral model Aiptasia. As expected, all host-endosymbiont combinations showed reduced photosynthetic efficiency and endosymbiont loss during heat stress, but the severity of bleaching was significantly reduced with increasing salinities for one of the host-endosymbiont combinations. Our results show that higher salinities can convey increased thermotolerance in Aiptasia, although this effect seems to be dependent on the particular host strain and/or associated symbiont type. This finding may help explain the extraordinarily high thermotolerance of corals in high salinity environments such as the Red Sea and the Persian/Arabian Gulf and provides novel insight regarding factors that contribute to thermotolerance. Since our results are based on a salinity effect in symbiotic sea anemones, it remains to be determined whether this salinity effect can also be observed in stony corals.

  19. Are Hox genes ancestrally involved in axial patterning? Evidence from the hydrozoan Clytia hemisphaerica (Cnidaria.

    Directory of Open Access Journals (Sweden)

    Roxane Chiori

    Full Text Available BACKGROUND: The early evolution and diversification of Hox-related genes in eumetazoans has been the subject of conflicting hypotheses concerning the evolutionary conservation of their role in axial patterning and the pre-bilaterian origin of the Hox and ParaHox clusters. The diversification of Hox/ParaHox genes clearly predates the origin of bilaterians. However, the existence of a "Hox code" predating the cnidarian-bilaterian ancestor and supporting the deep homology of axes is more controversial. This assumption was mainly based on the interpretation of Hox expression data from the sea anemone, but growing evidence from other cnidarian taxa puts into question this hypothesis. METHODOLOGY/PRINCIPAL FINDINGS: Hox, ParaHox and Hox-related genes have been investigated here by phylogenetic analysis and in situ hybridisation in Clytia hemisphaerica, an hydrozoan species with medusa and polyp stages alternating in the life cycle. Our phylogenetic analyses do not support an origin of ParaHox and Hox genes by duplication of an ancestral ProtoHox cluster, and reveal a diversification of the cnidarian HOX9-14 genes into three groups called A, B, C. Among the 7 examined genes, only those belonging to the HOX9-14 and the CDX groups exhibit a restricted expression along the oral-aboral axis during development and in the planula larva, while the others are expressed in very specialised areas at the medusa stage. CONCLUSIONS/SIGNIFICANCE: Cross species comparison reveals a strong variability of gene expression along the oral-aboral axis and during the life cycle among cnidarian lineages. The most parsimonious interpretation is that the Hox code, collinearity and conservative role along the antero-posterior axis are bilaterian innovations.

  20. Identification and in vivo characterization of NvFP-7R, a developmentally regulated red fluorescent protein of Nematostella vectensis.

    Directory of Open Access Journals (Sweden)

    Aissam Ikmi


    Full Text Available In recent years, the sea anemone Nematostella vectensis has emerged as a critical model organism for comparative genomics and developmental biology. Although Nematostella is a member of the anthozoan cnidarians (known for producing an abundance of diverse fluorescent proteins (FPs, endogenous patterns of Nematostella fluorescence have not been described and putative FPs encoded by the genome have not been characterized.We described the spatiotemporal expression of endogenous red fluorescence during Nematostella development. Spatially, there are two patterns of red fluorescence, both restricted to the oral endoderm in developing polyps. One pattern is found in long fluorescent domains associated with the eight mesenteries and the other is found in short fluorescent domains situated between tentacles. Temporally, the long domains appear simultaneously at the 12-tentacle stage. In contrast, the short domains arise progressively between the 12- and 16-tentacle stage. To determine the source of the red fluorescence, we used bioinformatic approaches to identify all possible putative Nematostella FPs and a Drosophila S2 cell culture assay to validate NvFP-7R, a novel red fluorescent protein. We report that both the mRNA expression pattern and spectral signature of purified NvFP-7R closely match that of the endogenous red fluorescence. Strikingly, the red fluorescent pattern of NvFP-7R exhibits asymmetric expression along the directive axis, indicating that the nvfp-7r locus senses the positional information of the body plan. At the tissue level, NvFP-7R exhibits an unexpected subcellular localization and a complex complementary expression pattern in apposed epithelia sheets comprising each endodermal mesentery.These experiments not only identify NvFP-7R as a novel red fluorescent protein that could be employed as a research tool; they also uncover an unexpected spatio-temporal complexity of gene expression in an adult cnidarian. Perhaps most

  1. Evidence that glucose is the major transferred metabolite in dinoflagellate–cnidarian symbiosis (United States)

    Burriesci, Matthew S.; Raab, Theodore K.; Pringle, John R.


    SUMMARY Reef-building corals and many other cnidarians are symbiotic with dinoflagellates of the genus Symbiodinium. It has long been known that the endosymbiotic algae transfer much of their photosynthetically fixed carbon to the host and that this can provide much of the host's total energy. However, it has remained unclear which metabolite(s) are directly translocated from the algae into the host tissue. We reexamined this question in the small sea anemone Aiptasia using labeling of intact animals in the light with 13C-bicarbonate, rapid homogenization and separation of animal and algal fractions, and analysis of metabolite labeling by gas chromatography-mass spectrometry. We found labeled glucose in the animal fraction within 2 min of exposure to 13C-bicarbonate, whereas no significant labeling of other compounds was observed within the first 10 min. Although considerable previous evidence has suggested that glycerol might be a major translocated metabolite, we saw no significant labeling of glycerol within the first hour, and incubation of intact animals with 13C-labeled glycerol did not result in a rapid production of 13C-glucose. In contrast, when Symbiodinium cells freshly isolated from host tissue were exposed to light and 13C-bicarbonate in the presence of host homogenate, labeled glycerol, but not glucose, was detected in the medium. We also observed early production of labeled glucose, but not glycerol, in three coral species. Taken together, the results suggest that glucose is the major translocated metabolite in dinoflagellate–cnidarian symbiosis and that the release of glycerol from isolated algae may be part of a stress response. PMID:22956249

  2. Asymmetric developmental potential along the animal-vegetal axis in the anthozoan cnidarian, Nematostella vectensis, is mediated by Dishevelled. (United States)

    Lee, Patricia N; Kumburegama, Shalika; Marlow, Heather Q; Martindale, Mark Q; Wikramanayake, Athula H


    The relationship between egg polarity and the adult body plan is well understood in many bilaterians. However, the evolutionary origins of embryonic polarity are not known. Insight into the evolution of polarity will come from understanding the ontogeny of polarity in non-bilaterian forms, such as cnidarians. We examined how the axial properties of the starlet sea anemone, Nematostella vectensis (Anthozoa, Cnidaria), are established during embryogenesis. Egg-cutting experiments and sperm localization show that Nematostella eggs are only fertilized at the animal pole. Vital marking experiments demonstrate that the egg animal pole corresponds to the sites of first cleavage and gastrulation, and the oral pole of the adult. Embryo separation experiments demonstrate an asymmetric segregation of developmental potential along the animal-vegetal axis prior to the 8-cell stage. We demonstrate that Dishevelled (Dsh) plays an important role in mediating this asymmetric segregation of developmental fate. Although NvDsh mRNA is ubiquitously expressed during embryogenesis, the protein is associated with the female pronucleus at the animal pole in the unfertilized egg, becomes associated with the unipolar first cleavage furrow, and remains enriched in animal pole blastomeres. Our results suggest that at least one mechanism for Dsh enrichment at the animal pole is through its degradation at the vegetal pole. Functional studies reveal that NvDsh is required for specifying embryonic polarity and endoderm by stabilizing beta-catenin in the canonical Wnt signaling pathway. The localization of Dsh to the animal pole in Nematostella and two other anthozoan cnidarians (scleractinian corals) provides a possible explanation for how the site of gastrulation has changed in bilaterian evolution while other axial components of development have remained the same and demonstrates that modifications of the Wnt signaling pathway have been used to pattern a wide variety of metazoan embryos.

  3. Wnt signaling in the early sea urchin embryo. (United States)

    Kumburegama, Shalika; Wikramanayake, Athula H


    Wnt signaling regulates a remarkably diverse array of cellular and developmental events during animal embryogenesis and homeostasis. The crucial role that Wnt signaling plays in regulating axial patterning in early embryos has been particularly striking. Recent work has highlighted the conserved role that canonical Wnt signaling plays in patterning the animal-vegetal (A-V) axis in sea urchin and sea anemone embryos. In sea urchin embryos, the canonical Wnt signaling pathway is selectively turned on in vegetal cells as early as the 16-cell stage embryo, and signaling through this pathway is required for activation of the endomesodermal gene regulatory network. Loss of nuclear beta-catenin signaling animalizes the sea urchin embryo and blocks pattern formation along the entire A-V axis. Nuclear entry of beta-catenin into vegetal cells is regulated cell autonomously by maternal information that is present at the vegetal pole of the unfertilized egg. Analysis of Dishevelled (Dsh) regulation along the A-V axis has revealed the presence of a cytoarchitectural domain at the vegetal pole of the unfertilized sea urchin egg. This vegetal cortical domain appears to be crucial for the localized activation of Dsh at the vegetal pole, but the precise mechanisms are unknown. The elucidation of how Dsh is selectively activated at the vegetal cortical domain is likely to provide important insight into how this enigmatic protein is regulated during canonical Wnt signaling. Additionally, this information will shed light on the origins of embryonic polarity during animal evolution. This chapter examines the roles played by the canonical Wnt signaling pathway in the specification and patterning of the A-V axis in the sea urchin. These studies have led to the identification of a novel role for canonical Wnt signaling in regulating protein stability, and continued studies of Wnt signaling in this model system are likely to reveal additional roles for this pathway in regulating early

  4. Gene discovery in the threatened elkhorn coral: 454 sequencing of the Acropora palmata transcriptome.

    Directory of Open Access Journals (Sweden)

    Nicholas R Polato

    Full Text Available BACKGROUND: Cnidarians, including corals and anemones, offer unique insights into metazoan evolution because they harbor genetic similarities with vertebrates beyond that found in model invertebrates and retain genes known only from non-metazoans. Cataloging genes expressed in Acropora palmata, a foundation-species of reefs in the Caribbean and western Atlantic, will advance our understanding of the genetic basis of ecologically important traits in corals and comes at a time when sequencing efforts in other cnidarians allow for multi-species comparisons. RESULTS: A cDNA library from a sample enriched for symbiont free larval tissue was sequenced on the 454 GS-FLX platform. Over 960,000 reads were obtained and assembled into 42,630 contigs. Annotation data was acquired for 57% of the assembled sequences. Analysis of the assembled sequences indicated that 83-100% of all A. palmata transcripts were tagged, and provided a rough estimate of the total number genes expressed in our samples (~18,000-20,000. The coral annotation data contained many of the same molecular components as in the Bilateria, particularly in pathways associated with oxidative stress and DNA damage repair, and provided evidence that homologs of p53, a key player in DNA repair pathways, has experienced selection along the branch separating Cnidaria and Bilateria. Transcriptome wide screens of paralog groups and transition/transversion ratios highlighted genes including: green fluorescent proteins, carbonic anhydrase, and oxidative stress proteins; and functional groups involved in protein and nucleic acid metabolism, and the formation of structural molecules. These results provide a starting point for study of adaptive evolution in corals. CONCLUSIONS: Currently available transcriptome data now make comparative studies of the mechanisms underlying coral's evolutionary success possible. Here we identified candidate genes that enable corals to maintain genomic integrity despite

  5. Gene discovery in the threatened elkhorn coral: 454 sequencing of the Acropora palmata transcriptome. (United States)

    Polato, Nicholas R; Vera, J Cristobal; Baums, Iliana B


    Cnidarians, including corals and anemones, offer unique insights into metazoan evolution because they harbor genetic similarities with vertebrates beyond that found in model invertebrates and retain genes known only from non-metazoans. Cataloging genes expressed in Acropora palmata, a foundation-species of reefs in the Caribbean and western Atlantic, will advance our understanding of the genetic basis of ecologically important traits in corals and comes at a time when sequencing efforts in other cnidarians allow for multi-species comparisons. A cDNA library from a sample enriched for symbiont free larval tissue was sequenced on the 454 GS-FLX platform. Over 960,000 reads were obtained and assembled into 42,630 contigs. Annotation data was acquired for 57% of the assembled sequences. Analysis of the assembled sequences indicated that 83-100% of all A. palmata transcripts were tagged, and provided a rough estimate of the total number genes expressed in our samples (~18,000-20,000). The coral annotation data contained many of the same molecular components as in the Bilateria, particularly in pathways associated with oxidative stress and DNA damage repair, and provided evidence that homologs of p53, a key player in DNA repair pathways, has experienced selection along the branch separating Cnidaria and Bilateria. Transcriptome wide screens of paralog groups and transition/transversion ratios highlighted genes including: green fluorescent proteins, carbonic anhydrase, and oxidative stress proteins; and functional groups involved in protein and nucleic acid metabolism, and the formation of structural molecules. These results provide a starting point for study of adaptive evolution in corals. Currently available transcriptome data now make comparative studies of the mechanisms underlying coral's evolutionary success possible. Here we identified candidate genes that enable corals to maintain genomic integrity despite considerable exposure to genotoxic stress over long life

  6. Poisons, toxungens, and venoms: redefining and classifying toxic biological secretions and the organisms that employ them. (United States)

    Nelsen, David R; Nisani, Zia; Cooper, Allen M; Fox, Gerad A; Gren, Eric C K; Corbit, Aaron G; Hayes, William K


    Despite extensive study of poisonous and venomous organisms and the toxins they produce, a review of the literature reveals inconsistency and ambiguity in the definitions of 'poison' and 'venom'. These two terms are frequently conflated with one another, and with the more general term, 'toxin.' We therefore clarify distinctions among three major classes of toxins (biological, environmental, and anthropogenic or man-made), evaluate prior definitions of venom which differentiate it from poison, and propose more rigorous definitions for poison and venom based on differences in mechanism of delivery. We also introduce a new term, 'toxungen', thereby partitioning toxic biological secretions into three categories: poisons lacking a delivery mechanism, i.e. ingested, inhaled, or absorbed across the body surface; toxungens delivered to the body surface without an accompanying wound; and venoms, delivered to internal tissues via creation of a wound. We further propose a system to classify toxic organisms with respect to delivery mechanism (absent versus present), source (autogenous versus heterogenous), and storage of toxins (aglandular versus glandular). As examples, a frog that acquires toxins from its diet, stores the secretion within cutaneous glands, and transfers the secretion upon contact or ingestion would be heteroglandular-poisonous; an ant that produces its own toxins, stores the secretion in a gland, and sprays it for defence would be autoglandular-toxungenous; and an anemone that produces its own toxins within specialized cells that deliver the secretion via a penetrating wound would be autoaglandular-venomous. Adoption of our scheme should benefit our understanding of both proximate and ultimate causes in the evolution of these toxins. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

  7. Using Nematostella vectensis to study the interactions between genome, epigenome and bacteria in a changing environment

    Directory of Open Access Journals (Sweden)

    Sebastian Fraune


    Full Text Available The phenotype of an animal cannot be explained entirely by its genes. It is now clear that factors other than the genome contribute to the ecology and evolution of animals. Two fundamentally important factors are the associated microbiota and epigenetic regulations. Unlike the genes and regulatory regions of the genome, epigenetics and microbial composition can be rapidly modified, and may thus represent mechanisms for rapid acclimation to a changing environment. At present, the individual functions of epigenetics, microbiomes, and genomic mutations are largely studied in isolation, particularly for species in marine ecosystems. This single variable approach leaves significant questions open for how these mechanisms intersect in the acclimation and adaptation of organisms in different environments. Here, we propose that the starlet sea anemone, Nematostella vectensis, is a model of choice to investigate the complex interplay between adaptation as well as physiological and molecular plasticity in coastal ecosystems. N. vectensis’ geographic range spans four distinct coastlines, including a wide thermocline along the Atlantic coast of North America. N. vectensis is a particularly powerful invertebrate model for studying genome-environment interactions due to (1 the availability of a well-annotated genome, including preexisting data on genome methylation, histone modifications and miRNAs, (2 an extensive molecular toolkit including well-developed protocols for gene suppression and transgenesis, and (3 the simplicity of culture and experimentation in the laboratory. Taken together, N. vectensis has the tractability to connect the functional relationships between a host animal, microbes, and genome modifications to determine mechanisms underlying phenotypic plasticity and local adaptation.

  8. Putative cross-kingdom horizontal gene transfer in sponge (Porifera mitochondria

    Directory of Open Access Journals (Sweden)

    Ilan Micha


    Full Text Available Abstract Background The mitochondrial genome of Metazoa is usually a compact molecule without introns. Exceptions to this rule have been reported only in corals and sea anemones (Cnidaria, in which group I introns have been discovered in the cox1 and nad5 genes. Here we show several lines of evidence demonstrating that introns can also be found in the mitochondria of sponges (Porifera. Results A 2,349 bp fragment of the mitochondrial cox1 gene was sequenced from the sponge Tetilla sp. (Spirophorida. This fragment suggests the presence of a 1143 bp intron. Similar to all the cnidarian mitochondrial introns, the putative intron has group I intron characteristics. The intron is present in the cox1 gene and encodes a putative homing endonuclease. In order to establish the distribution of this intron in sponges, the cox1 gene was sequenced from several representatives of the demosponge diversity. The intron was found only in the sponge order Spirophorida. A phylogenetic analysis of the COI protein sequence and of the intron open reading frame suggests that the intron may have been transmitted horizontally from a fungus donor. Conclusion Little is known about sponge-associated fungi, although in the last few years the latter have been frequently isolated from sponges. We suggest that the horizontal gene transfer of a mitochondrial intron was facilitated by a symbiotic relationship between fungus and sponge. Ecological relationships are known to have implications at the genomic level. Here, an ecological relationship between sponge and fungus is suggested based on the genomic analysis.

  9. The role of marine reserves in the replenishment of a locally impacted population of anemonefish on the Great Barrier Reef. (United States)

    Bonin, Mary C; Harrison, Hugo B; Williamson, David H; Frisch, Ashley J; Saenz-Agudelo, Pablo; Berumen, Michael L; Jones, Geoffrey P


    The development of parentage analysis to track the dispersal of juvenile offspring has given us unprecedented insight into the population dynamics of coral reef fishes. These tools now have the potential to inform fisheries management and species conservation, particularly for small fragmented populations under threat from exploitation and disturbance. In this study, we resolve patterns of larval dispersal for a population of the anemonefish Amphiprion melanopus in the Keppel Islands (southern Great Barrier Reef). Habitat loss and fishing appear to have impacted this population and a network of no-take marine reserves currently protects 75% of the potential breeders. Using parentage analysis, we estimate that 21% of recruitment in the island group was generated locally and that breeding adults living in reserves were responsible for 79% (31 of 39) of these of locally produced juveniles. Overall, the network of reserves was fully connected via larval dispersal; however, one reserve was identified as a critical source of larvae for the island group. The population in the Keppel Islands also appears to be well-connected to other source populations at least 60 km away, given that 79% (145 of 184) of the juveniles sampled remained unassigned in the parentage analysis. We estimated the effective size of the A. melanopus metapopulation to be 745 (582-993 95% CI) and recommend continued monitoring of its genetic status. Maintaining connectivity with populations beyond the Keppel Islands and recovery of local recruitment habitat, potentially through active restoration of host anemone populations, will be important for its long-term persistence. © 2015 John Wiley & Sons Ltd.

  10. Novel ssDNA Viruses Detected in the Virome of Bleached, Habitat-Forming Kelp Ecklonia radiata

    Directory of Open Access Journals (Sweden)

    Douglas T. Beattie


    Full Text Available Kelp forests provide essential habitats for organisms in temperate rocky shores. Loss of kelp forests has occurred over large areas in a number of temperate regions, including in Australia, where the dominant kelp Ecklonia radiata has been lost from substantial areas of the shoreline. Loss of E. radiata has been associated with environmental stressors, including increased temperature and anthropogenic contaminants, as well as biological factors, such as herbivory. Disease may also play a role, but there is little information on the role of disease in the loss of kelp from coastal ecosystems or on the potential role of pathogenic microorganisms, such as viruses. E. radiata across much of its distribution in Australia can develop a “bleached” phenotype, which may be a disease. To investigate whether the phenotype was associated with a potential viral agent, we shotgun sequenced viral particles that were isolated from kelp with normal (healthy and bleached phenotypes. Each virome consisted of ~380,000 reads, of which ~25% were similar to known viruses. All samples were dominated by bacteriophages, but novel ssDNA virus sequences were detected that were almost exclusively in viromes from the bleached kelp phenotype. These ssDNA viruses are covered by 11 contigs that contained complete capsids and characteristic rep genes that were 30–60% similar to those of circular, Rep-encoding ssDNA viruses (CRESS-DNA viruses. CRESS-DNA viruses have not previously been described from macroalgae, and the rep genes were similar to CRESS-DNA viruses from marine water samples, snails, crabs, anemones, but also dragonflies. This raises the interesting possibility that the kelp could be a vector of the CRESS-DNA viruses to other organisms that are associated with the bleached state.

  11. A critical assessment of marine aquarist biodiversity data and commercial aquaculture: identifying gaps in culture initiatives to inform local fisheries managers.

    Directory of Open Access Journals (Sweden)

    Joanna M Murray

    Full Text Available It is widely accepted that if well managed, the marine aquarium trade could provide socio-economic stability to local communities while incentivising the maintenance of coral reefs. However, the trade has also been implicated as having potentially widespread environmental impacts that has in part driven developments in aquaculture to relieve wild collection pressures. This study investigates the biodiversity in hobbyist aquaria (using an online survey and those species currently available from an aquaculture source (commercial data and hobbyist initiatives in the context of a traffic light system to highlight gaps in aquaculture effort and identify groups that require fisheries assessments. Two hundred and sixty nine species including clown fish, damsels, dotty backs, angelfish, gobies, sea horses and blennies, have reported breeding successes by hobbyists, a pattern mirrored by the European and US commercial organisations. However, there is a mismatch (high demand and low/non-existent aquaculture for a number of groups including tangs, starfish, anemones and hermit crabs, which we recommend are priority candidates for local stock assessments. Hobbyist perception towards the concept of a sustainable aquarium trade is also explored with results demonstrating that only 40% of respondents were in agreement with industry and scientists who believe the trade could be an exemplar of a sustainable use of coral reefs. We believe that a more transparent evidence base, including the publication of the species collected and cultured, will go some way to align the concept of a sustainable trade across industry stakeholders and better inform the hobbyist when purchasing their aquaria stock. We conclude by proposing that a certification scheme established with government support is the most effective way to move towards a self-regulating industry. It would prevent industry "greenwashing" from multiple certification schemes, alleviate conservation concerns

  12. Carbon translocation in zooanthaellae-coelenterate symbioses

    International Nuclear Information System (INIS)

    Battey, J.F.


    When host and algal triglycerides synthesized in the symbiotic sea anemone Condylactis gigantea during light and dark incubations in 14 C-bicarbonate and 14 C-acetate were deacylated, more then 80% of the radioactivity was found in the fatty acid moiety. In contrast, triglycerides isolated from zooxanthellae and host incubated in 14 C-glycerol in the dark were found to have more then 95% of their radioactivity in the glycerol moiety. During 14 C-glycerol incubations in the light, radioactivity in the fatty acid moiety of zooxanthellae triglyceride fatty acid moiety stayed below 5% during 14 C-glycerol incubations in the light. These results show neither the zooxanthellae nor host can rapidly convert glycerol to fatty acid. Radioactivity from 14 C-glycerol that does eventually appear in host lipid may have been respired to 14 CO 2 then photosynthetically fixed by the zooxanthellae and synthesized into lipid fatty acid. The isolated zooxanthellae of C. gigantea contained 3.62 +/- 0.33 mM glycerol, which was 26x the 0.141 +/- 0.02 mM found in the coelenterate tissue. Aposymbiotic coelenterate tissue contained 0.169 +/- 0.05 mM glycerol. The metabolic inhibitors, sodium cyanide, aminooxyacetic acid and cerulenin were used to try and uncouple the production of glycerol by the zooxanthellae from its utilization by the coelenterate host. 10 -5 M NaCN increased the ratio of cross photosynthesis to respiration in both intact tentacles and isolated zooxanthellae, increased translocation from 17.7 +/- 3.5% of total fixed carbon in controls to 43.5 +/- 5.79%, and doubled the amount of photosynthetically fixed carbon accumulating in the coelenterate host over that in controls

  13. ATX-II effects on the apparent location of M cells in a computational model of a human left ventricular wedge. (United States)

    Dos Santos, Rodrigo Weber; Otaviano Campos, Fernando; Neumann Ciuffo, Leandro; Nygren, Anders; Giles, Wayne; Koch, Hans


    The apparent location of the myocytes (M cells) with the longest action potential duration (APD) in a canine left ventricular (LV) wedge have been reported to shift after application of a sea anemone toxin, ATX-II. This toxin slows inactivation of I(Na) and thus prolongs APD. Thus, M cells may exhibit dynamic functional states, rather than being a static, anatomically discrete, myocyte population. In this study, we attempted to further define and understand this phenomenon using a mathematical model of the human ventricular myocyte action potential incorporated into an in silico "wedge" preparation. Our simulations demonstrate that even under conditions of a fixed population and ratio of epicardial, M, and endocardial myocytes, the apparent anatomical position (transmural location) of the myocytes with the longest APD can shift following ATX-II treatment. This arises because the ATX-II effect, modeled as a small increase in the late or persistent Na(+) current, and consequent prolongation of APD significantly changes the electrotonic interactions between ventricular myocytes in this LV wedge preparation. This LV wedge model is based on bidomain equations. It corresponds to a rectangular tissue immersed in a passive and isotropic medium that represents the superfusion bath. In this theoretical work, the three known different and discrete populations of myocytes in the human left ventricle have been included: the epicardial, M, and endocardial cells. The effects of ATX-II on I(Na) were simulated by altering the voltage-dependent steady-state inactivation of the parameters h (fast gate) and j (slow gate). As a result, in these ATX-II simulations a persistent late Na(+) current was generated in all three types of ventricular myocytes. However, the APDs were prolonged in a heterogeneous pattern. Our simulations demonstrate that after the ATX-II effects develop, alterations in transmural electrotonic interactions can produce changes in the transmural location of myocytes

  14. Automated Image Analysis of Offshore Infrastructure Marine Biofouling

    Directory of Open Access Journals (Sweden)

    Kate Gormley


    Full Text Available In the UK, some of the oldest oil and gas installations have been in the water for over 40 years and have considerable colonisation by marine organisms, which may lead to both industry challenges and/or potential biodiversity benefits (e.g., artificial reefs. The project objective was to test the use of an automated image analysis software (CoralNet on images of marine biofouling from offshore platforms on the UK continental shelf, with the aim of (i training the software to identify the main marine biofouling organisms on UK platforms; (ii testing the software performance on 3 platforms under 3 different analysis criteria (methods A–C; (iii calculating the percentage cover of marine biofouling organisms and (iv providing recommendations to industry. Following software training with 857 images, and testing of three platforms, results showed that diversity of the three platforms ranged from low (in the central North Sea to moderate (in the northern North Sea. The two central North Sea platforms were dominated by the plumose anemone Metridium dianthus; and the northern North Sea platform showed less obvious species domination. Three different analysis criteria were created, where the method of selection of points, number of points assessed and confidence level thresholds (CT varied: (method A random selection of 20 points with CT 80%, (method B stratified random of 50 points with CT of 90% and (method C a grid approach of 100 points with CT of 90%. Performed across the three platforms, the results showed that there were no significant differences across the majority of species and comparison pairs. No significant difference (across all species was noted between confirmed annotations methods (A, B and C. It was considered that the software performed well for the classification of the main fouling species in the North Sea. Overall, the study showed that the use of automated image analysis software may enable a more efficient and consistent

  15. Biofouling community pattern on various metallic surfaces in the coastal waters of Kalpakkam, Southwestern Bay of Bengal

    International Nuclear Information System (INIS)

    Sahu, Gouri; Satpathy, K.K.; Mohanty, A.K.; Bindu, V.K.


    . 100 cm -2 . The major fouling organisms such as, barnacle, green mussel and ascidian constituted ∼ 70-80% of the total fouling. In the present study, sequence of fouling succession was as follows, barnacle - hydroid - sea anemone - ascidian and finally green mussel (Perna viridis Linn. 1758). The paper also discusses species diversity indices (diversity, richness and evenness) in detail. (author)

  16. Sediment Burial Intolerance of Marine Macroinvertebrates.

    Directory of Open Access Journals (Sweden)

    Vicki J Hendrick

    Full Text Available The marine environment contains suspended particulate matter which originates from natural and anthropogenic sources. Settlement of this material can leave benthic organisms susceptible to smothering, especially if burial is sudden i.e. following storms or activities such as dredging. Their survival will depend on their tolerance to, and their ability to escape from burial. Here we present data from a multi-factorial experiment measuring burial responses incorporating duration, sediment fraction and depth. Six macroinvertebrates commonly found in sediment rich environments were selected for their commercial and/or conservation importance. Assessments revealed that the brittle star (Ophiura ophiura, the queen scallop (Aequipecten opercularis and the sea squirt (Ciona intestinalis were all highly intolerant to burial whilst the green urchin (Psammichinus miliaris and the anemone (Sagartiogeton laceratus, showed intermediate and low intolerance respectively, to burial. The least intolerant, with very high survival was the Ross worm (Sabellaria spinulosa. With the exception of C. intestinalis, increasing duration and depth of burial with finer sediment fractions resulted in increased mortality for all species assessed. For C. intestinalis depth of burial and sediment fraction were found to be inconsequential since there was complete mortality of all specimens buried for more than one day. When burial emergence was assessed O. ophiura emerged most frequently, followed by P. miliaris. The former emerged most frequently from the medium and fine sediments whereas P. miliaris emerged more frequently from coarse sediment. Both A. opercularis and S. laceratus showed similar emergence responses over time, with A. opercularis emerging more frequently under coarse sediments. The frequency of emergence of S. laceratus increased with progressively finer sediment and C. intestinalis did not emerge from burial irrespective of sediment fraction or depth. Finally

  17. Baseline seabed habitat and biotope mapping for a proposed marine reserve

    Directory of Open Access Journals (Sweden)

    Sonny T.M. Lee


    Full Text Available Seabed mapping can quantify the extent of benthic habitats that comprise marine ecosystems, and assess the impact of fisheries on an ecosystem. In this study, the distribution of seabed habitats in a proposed no-take Marine Reserve along the northeast coast of Great Barrier Island, New Zealand, was mapped using underwater video combined with bathymetry and substratum data. As a result of the boundary extending to the 12 nautical mile Territorial Limit, it would have been the largest coastal Marine Reserve in the country. Recreational and commercial fisheries occur in the region and would be expected to affect species’ abundance. The seabed of the study area and adjacent coastal waters has been trawled up to five times per year. Benthic communities were grouped by multivariate cluster analysis into four biotope classes; namely (1 shallow water macroalgae Ecklonia sp. and Ulva sp. on rocky substrata (Eck.Ulv; and deeper (2 diverse epifauna of sponges and bryozoans on rocky substrata (Por.Bry, (3 brittle star Amphiura sp. and sea anemone Edwardsia sp. on muddy sand (Amph.Edw, and (4 hydroids on mud (Hyd. In biotopes Por.Bry, Amph.Edw and Hyd, there where boulders and rocks were present, and diverse sponge, bryozoan and coral communities. Fifty species were recorded in the deep water survey including significant numbers of the shallow-water hexactinellid glass sponges Symplectella rowi Dendy, 1924 and Rossella ijimai Dendy, 1924, the giant pipe demosponge Isodictya cavicornuta Dendy, 1924, black corals, and locally endemic gorgonians. The habitats identified in the waters to the northeast of Great Barrier Island are likely to be representative of similar depth ranges in northeast New Zealand. This study provides a baseline of the benthic habitats so that should the area become a Marine Reserve, any habitat change might be related to protection from fishing activities and impacts, such as recovery of epifauna following cessation of trawling. The

  18. Early evolution of the LIM homeobox gene family

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, Mansi; Larroux, Claire; Lu, Daniel R; Mohanty, Kareshma; Chapman, Jarrod; Degnan, Bernard M; Rokhsar, Daniel S


    LIM homeobox (Lhx) transcription factors are unique to the animal lineage and have patterning roles during embryonic development in flies, nematodes and vertebrates, with a conserved role in specifying neuronal identity. Though genes of this family have been reported in a sponge and a cnidarian, the expression patterns and functions of the Lhx family during development in non-bilaterian phyla are not known. We identified Lhx genes in two cnidarians and a placozoan and report the expression of Lhx genes during embryonic development in Nematostella and the demosponge Amphimedon. Members of the six major LIM homeobox subfamilies are represented in the genomes of the starlet sea anemone, Nematostella vectensis, and the placozoan Trichoplax adhaerens. The hydrozoan cnidarian, Hydra magnipapillata, has retained four of the six Lhx subfamilies, but apparently lost two others. Only three subfamilies are represented in the haplosclerid demosponge Amphimedon queenslandica. A tandem cluster of three Lhx genes of different subfamilies and a gene containing two LIM domains in the genome of T. adhaerens (an animal without any neurons) indicates that Lhx subfamilies were generated by tandem duplication. This tandem cluster in Trichoplax is likely a remnant of the original chromosomal context in which Lhx subfamilies first appeared. Three of the six Trichoplax Lhx genes are expressed in animals in laboratory culture, as are all Lhx genes in Hydra. Expression patterns of Nematostella Lhx genes correlate with neural territories in larval and juvenile polyp stages. In the aneural demosponge, A. queenslandica, the three Lhx genes are expressed widely during development, including in cells that are associated with the larval photosensory ring. The Lhx family expanded and diversified early in animal evolution, with all six subfamilies already diverged prior to the cnidarian-placozoan-bilaterian last common ancestor. In Nematostella, Lhx gene expression is correlated with neural

  19. El arrecife coralino de Punta Cocles, costa Caribe de Costa Rica

    Directory of Open Access Journals (Sweden)

    Cindy Fernández


    Full Text Available Este estudio describe al arrecife de Punta Cocles (Limón, Costa Rica. Los datos se obtienen por medio de un muestreo con nueve transectos, paralelos a la costa y por observaciones directas durante buceos a pulmón entre los meses de setiembre y noviembre del 2002. Este arrecife consta aproximadamente de 10.5 hectáreas, en las que se identifican 13 especies de corales, 39 de macroalgas, dos de pastos marinos, dos de zoántidos, una anémona, un coralimorfario y una esponja. Se observa un incremento en la cobertura de corales vivos (16% con respecto a otros años (5% en 1985, y 13.2% en 1995, y una baja cobertura de coral muerto (0.2%. Las macroalgas presentan la cobertura más alta (59%, particularmente las algas pardas con una distribución en parches de Sargassum y Padina. Laurencia brongniartii (Rhodophyta constituye una nueva adición para la flora ficológica de Costa Rica. El arrecife de Punta Cocles, funciona como un refugio para los organismos, debido a la ausencia de centros de población y desembocaduras de los ríos, además, del tipo de formación costera, lo que se