WorldWideScience

Sample records for andrew zoltan fenves

  1. A Conversation with Zoltan P. Dienes

    Science.gov (United States)

    Sriraman, Bharath; Lesh, Richard

    2007-01-01

    The name of Zoltan P. Dienes (1916- ) stands with those of Jean Piaget, Jerome Bruner, Edward Begle, and Robert Davis as a legendary figure whose work left a lasting impression on the field of mathematics education. Dienes' name is synonymous with the multibase blocks that he invented for the teaching of place value. Among numerous other things,…

  2. Andrew Ng 谈 Deep Learning

    Institute of Scientific and Technical Information of China (English)

    卢鸫翔

    2014-01-01

    Andrew Ng是Deep Learning领域最富盛名的科学家之一,他也是斯坦福人工智能实验室主任,在线教育平台Coursera的创始人之一。2014年5月,他加入百度,负责“百度大脑”计划,并担任百度首席科学家。目前,他接受了《程序员》的专访。

  3. Safety and design impact of hurricane Andrew

    International Nuclear Information System (INIS)

    Turkey Point completed the IPE in June of 1991. Hurricane Andrew landed at Turkey Point on August 24, 1992. Although the safety related systems, components and structures were not damaged by the Hurricane Andrew, certain nonsafety related components and the neighboring fossil plant sustained noticeable damage. Among the major components that were nonsafety related but would affect the PRA of the plant included the service water pumps and the high tower. This paper discusses the safety and design impact of Hurricane Andrew on Turkey Point Nuclear Power Plant. The risk of hurricanes on the interim and evolving plant configurations are briefly described. The risk of the plant from internal events as a result of damage incurred during Hurricane Andrew are discussed. The design change as the result of Hurricane Andrew and its impact on the PRA are presented. (author)

  4. Obituary: Andrew Stephen Wilson, 1947-2008

    Science.gov (United States)

    Veilleux, Sylvain

    2009-01-01

    On 24 May 2008, Andrew Stephen Wilson passed away at the age of 61, in his home in Silver Spring, Maryland, from complications resulting from a painful spinal illness. Andrew was arguably one of the first truly multi-wavelength astronomers of his generation. His scientific work on active galactic nuclei [AGN] spanned the entire electromagnetic spectrum from the radio to the X-rays. Andrew was born in Doncaster, Yorkshire, England, on 26 March 1947. He was the younger of two brothers whose births were separated by the Second World War. His father, Norman, came from a relatively affluent family who were coal merchants. His mother, Mary, came from a less comfortable background, one of seven children, daughter of a skilled cabinet maker/French polisher, who went through a very hard time during the depression. As a teacher, she placed enormous value on hard work and education as a way of gaining advancement in life. When Andrew was four, the family moved to Skipton, a nice market town in the Yorkshire dales. Andrew went to a small village school until age eleven when he entered Ermysted's Grammar School. He was an enthusiastic soccer and cricket player. He never lost his enthusiasm for soccer and supported the local soccer team, Leeds United, for all his life. Andrew also followed the Yorkshire county cricket team. Andrew's interest in astronomy stemmed from the fact that at Ermysted's Grammar School someone donated a four-inch refracting telescope, so he and his friends used to go back in the evenings to investigate the rings of Saturn, the moons of Jupiter, and various nebulae. While an undergraduate at Cambridge, Andrew joined the astronomy club and ground an 8-inch mirror by hand as a part of a telescope that he set up in the backyard of his parents' house. Andrew spent hours observing with this telescope, and it was the wonder of the family. At Cambridge, Andrew obtained his bachelor's degree with first-class honors in 1969. During a short visit in London with his

  5. Stars over St Andrews : 75 years of observational astronomy at the University Observatory, St Andrews, Scotland

    OpenAIRE

    Hilditch, R. W.

    2015-01-01

    This document (© Ron Hilditch, University Observatory, St Andrews, Scotland) gives an account of the observational astronomy conducted at the University Observatory, St Andrews, from its inauguration in 1940 through to the present day, some 75 years later. It is concerned with describing the telescopes constructed and used at the Observatory, the instruments that were made and mounted on those telescopes, and the observational programmes that were conducted for the purposes of ...

  6. Obituary: Andrew Lange (1957-2010)

    Science.gov (United States)

    Kamionkowski, Marc

    2011-12-01

    The worlds of physics and astrophysics were stunned to learn on 22 January 2010 that Andrew Lange, the Marvin L. Goldberger Professor of Physics at Caltech, had taken his own life the night before. He had succumbed to the severe depression that he had suffered from for many years, unbeknownst to even his closest colleagues. Lange will perhaps be best remembered as the co-leader of Boomerang, the balloon-borne experiment that provided the first high-angular-resolution map of the cosmic microwave background (CMB). And while this was certainly his most notable achievement, Andrew amassed a record of accomplishment as an instrumentalist, leader, mentor, and communicator that extended much further. Andrew was born in Urbana, Illinois on July 23, 1957, the son of an architect and a librarian, and raised primarily in Connecticut. His family and early friends remember him as a serious and extremely intelligent child and young man. Andrew Lange's lifelong interest in the CMB was nurtured as an undergraduate at Princeton University by David Wilkinson, and he recalled fondly a summer spent working with John Mather at Goddard Space Flight Center. Andrew Lange went to graduate school in physics at Berkeley where he worked in Paul Richards' group. Although his thesis project, the Berkeley-Nagoya rocket experiment, showed an anomalous sub-millimeter excess in the CMB spectrum that was shortly thereafter shown by a later flight of the same rocket and COBE-FIRAS to be incorrect, Lange's talents were recognized by the physics department at Berkeley who appointed him shortly after his PhD (1987) to their faculty. While on the Berkeley faculty, Andrew obtained early detections of the Sunyaev-Zeldovich effect, upper limits to small-angle CMB fluctuations, and important infrared constraints to the interstellar medium. He also led a pioneering instrument operating 300 mK detectors for a small infrared satellite experiment. This early work showed high ambition and daring, and it pioneered

  7. A History of the Andrew File System

    CERN Document Server

    CERN. Geneva; Altman, Jeffrey

    2011-01-01

    Derrick Brashear and Jeffrey Altman will present a technical history of the evolution of Andrew File System starting with the early days of the Andrew Project at Carnegie Mellon through the commercialization by Transarc Corporation and IBM and a decade of OpenAFS. The talk will be technical with a focus on the various decisions and implementation trade-offs that were made over the course of AFS versions 1 through 4, the development of the Distributed Computing Environment Distributed File System (DCE DFS), and the course of the OpenAFS development community. The speakers will also discuss the various AFS branches developed at the University of Michigan, Massachusetts Institute of Technology and Carnegie Mellon University.

  8. Fred Plaut in conversation with Andrew Samuels. Interview by Andrew Samuels.

    Science.gov (United States)

    Plaut, Fred

    2010-02-01

    This is a reprint of an interview of Fred Plaut (who died in June 2009) conducted by Andrew Samuels in mid-1988 and first published in April 1989 in the Journal, 34, 2, pp. 159-83. The interview covers Plaut's early life, his career, and historical observations of the development of the Society of Analytical Psychology from its beginnings, and of the wider community of Jungian analysis. Plaut reflects uninhibitedly on such topics as the role of leadership in analytical psychology, discussing the parts played by Michael Fordham in London and Hannes Dieckmann in Berlin. Plaut explains his thinking concerning individuation. PMID:20433496

  9. Environmental Contaminants Evaluation of St. Andrew Bay, Florida: Volume 1

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Between 1985 and 1997, a general survey of St. Andrew Bay, Florida, was conducted to measure chemical contaminant concentrations in the sediments and selected...

  10. Open Access & the St Andrews Digital Research Repository

    OpenAIRE

    Upton, Jeremy

    2008-01-01

    Presentation outlining the reasons behind why the University of St Andrews Library has developed a Digital Research Repository and the benefits the service can offer to individual academics and the institution Postprint

  11. LOCH/ARMA Open Access Good Practice - St Andrews University

    OpenAIRE

    Aucock, Janet

    2015-01-01

    Presentation delivered by Janet Aucock at ARMA Open Access Good Practice event (London 19-03-2015). These slides detail St Andrews University's approach to implementing Open Access requirements for the post-2014 REF.

  12. Andrew Smith: peame leidma tee majanduskasvuni, mis põhineb säästmisel, investeeringutel ja ekspordil / Andrew Smith

    Index Scriptorium Estoniae

    Smith, Andrew

    2010-01-01

    KPMG (UK) peaökonomist Andrew Smith vastab küsimustele, mis puudutavad majanduskriisi tekkimist, olukorra paranemist, majandusolukorda Suurbritannias, erinevusi Euroopa ja muude maailma piirkondade vahel, sarnasusi Eesti ja Suurbritannia majandusolukorra vahel ning prognoose edaspidiste arengute osas

  13. The Physics of Beams: The Andrew Sessler Symposium

    International Nuclear Information System (INIS)

    These proceedings represent papers presented at the Andrew Sessler Symposium held at the Lawrence Berkeley National Laboratory in honor of Andrew Sessler close-quote s over forty years of major scientific contributions to accelerator and beam physics as well as in celebration of his 65th birthday. The symposium was sponsored by the United States Department of Energy. The topics discussed include linear colliders, past history and future speculations, ELOISATRON at 100 TeV beam, manipulating charged particle beams by means of plasma and collective instabilities in accelerator and storage rings. There were 10 papers presented and 8 have been abstracted for the Energy Science and Technology database

  14. Appreciating Unity in Diversity: An Interview with Andrew Solomon

    Science.gov (United States)

    Peters, Dane L.

    2014-01-01

    The theme of the AMS 2014 Annual Conference is "Unity in Diversity," a concept that also describes the work of conference keynote speaker Andrew Solomon. Solomon is a writer and lecturer on psychology and politics; winner of the National Book Award; and an activist for LGBT [lesbian, gay, bisexual, and transgender] rights, mental health,…

  15. Virasoro character identities from the Andrews-Bailey construction

    CERN Document Server

    Foda, O E; Foda, Omar; Quano, Yas Hiro

    1994-01-01

    We prove q-series identities between bosonic and fermionic representations of certain Virasoro characters. These identities include some of the conjectures made by the Stony Brook group as special cases. Our method is a direct application of Andrews' extensions of Bailey's lemma to recently obtained polynomial identities.

  16. Virasoro character identities from the Andrews--Bailey construction

    OpenAIRE

    Foda, Omar; Quano, Yas-Hiro

    1994-01-01

    We prove $q$-series identities between bosonic and fermionic representations of certain Virasoro characters. These identities include some of the conjectures made by the Stony Brook group as special cases. Our method is a direct application of Andrews' extensions of Bailey's lemma to recently obtained polynomial identities.

  17. Impact of Hurricane Andrew on FPL generation facilities

    International Nuclear Information System (INIS)

    In the pre-dawn hours of August 25, 1992, Hurricane Andrew made landfall in southern Dade County, Florida. The storm approached directly from the east and moved rapidly across the State and into the Gulf of Mexico. Andrew's intense winds caused unprecedented devastation to structures and facilities in its path. Not surprisingly, Florida Power and Light's (FPL) generation, transmission and distribution facilities in south Florida also suffered extensive damage. Two of FPL's electrical generating sites were located in the direct path of the storm and received its full brunt. This paper presents a review of the damage sustained by those plants, an overview of the unique recovery challenges encountered and a summary of the lessons learned from this experience

  18. Martin Simon, Andrew Lambirth and Jane Stevenson, Edward Burra

    OpenAIRE

    Adrien, Muriel

    2015-01-01

    The first full-scale monograph on Edward Burra (1905-1975) accompanied an exhibition of Burra’s paintings and drawings at Pallant House Gallery. The authors include Simon Martin, head of Curatorial Services at Pallant House Gallery, curator of the exhibition, and Jane Stevenson and Andrew Lambirth as other contributors. Far from the restrained abstraction of modernism, Burra went for men’s foibles and eccentricities (he was not afraid of coming out as a gay personality and as a painter of dra...

  19. Revisiting the BAN-modified Andrew Secure RPC protocol

    OpenAIRE

    Gugel, Alberto; Aziz, Benjamin; Hamilton, Geoff

    2014-01-01

    We have analysed the well-known BAN modified Andrew Secure RPC authentication protocol by means of the AVISPA Web tool considering all the available back-ends and with the basic configurations of sessions. The protocol has been found vulnerable to a replay/mutation attack based on homomorphism by one of the back-ends. In order to fix it, we integrated into the protocol a common solution, including a new addition to the original protocol and the solution proposed by Liu, Ma and Yang, who earli...

  20. Lattice paths, q-multinomials and two variants of the Andrews-Gordon identities

    OpenAIRE

    Berkovich, Alexander; Paule, Peter

    2001-01-01

    A few years ago Foda, Quano, Kirillov and Warnaar proposed and proved various finite analogs of the celebrated Andrews-Gordon identities. In this paper we use these polynomial identities along with the combinatorial techniques introduced in our recent paper to derive Garrett, Ismail, Stanton type formulas for two variants of the Andrews-Gordon identities.

  1. 33 CFR 334.761 - Naval Support Activity Panama City; St. Andrews Bay; restricted areas.

    Science.gov (United States)

    2010-07-01

    ... City; St. Andrews Bay; restricted areas. 334.761 Section 334.761 Navigation and Navigable Waters CORPS... REGULATIONS § 334.761 Naval Support Activity Panama City; St. Andrews Bay; restricted areas. (a) The areas—(1... intercepting any waterbased activity occurring within the active military security zone/s and...

  2. Experimental investigation of sanding propensity for the Andrew completion

    Energy Technology Data Exchange (ETDEWEB)

    Venkitaraman, A.; Li, H. [Schlumberger Perforating and Testing Center (United Kingdom); Leonard, A. J.; Bowden, P. R. [BP Exploration (United Kingdom)

    1998-12-31

    A series of laboratory experiments were performed on three reservoir core samples selected from two plot wells to confirm the likelihood of sand production during the completion phase of the planned Andrew horizontal wells, and to perform risk analysis of formation failure at the time of underbalance perforation, and expected producing conditions. CT scans revealed no perforation failure, and the core samples did not show any propensity to produce sand during single-phase oil flow. Transient sand production was observed when water cut was introduced, but sand production declined as the percentage of water cut was increased. There was no evidence of sand production in the core samples during depletion testing either, and the wells were subsequently completed with perforated cemented liners without sand control. No sand problems have been encountered in two years of production, with some wells in water cut and declined reservoir pressure of 200 psi. 8 refs., 3 tabs., 5 figs.

  3. Andrew J. Rotter, Hiroshima – The Word’s Bomb

    OpenAIRE

    Pinto, André

    2015-01-01

    O livro Hiroshima – The world’s bomb de Andrew J. Rotter descreve, sob várias perspetivas, um dos incidentes mais marcantes do século XX. O alcance das bombas atómicas lançadas sobre o Japão deu a conhecer ao mundo uma arma com um poder destrutivo de tal ordem que Estados em guerra se poderiam destruir mutuamente em segundos. A ameaça atómica esteve no centro de um dos conflitos mais longos do século XX – a Guerra Fria – e está, ainda hoje, no centro de vários conflitos entre potências region...

  4. A transnational conference romance: Elsie Andrews, Hildegarde Kneeland, and the Pan-Pacific Women's Association.

    Science.gov (United States)

    Laurie, Alison J

    2009-01-01

    Elsie Andrews, a feminist activist from New Zealand, met Dr. Hildegarde Kneeland, a progressive economist from the United States, at the 1934 Pan-Pacific Women's Association conference in Honolulu. Andrews wrote diaries of her attendance at conferences, and in these writes openly of her attraction and romantic feelings for Kneeland, despite her own long-term domestic partnership back in New Plymouth with Muriel Kirton. This article considers the role conference romances may have played for Andrews and others in encouraging their interest in women's organizations, in the context of literature on romantic friendships and lesbianism. PMID:19830617

  5. Wie was Andrew Murray (1828-1917 in werklikheid?

    Directory of Open Access Journals (Sweden)

    T.G. Mahne

    1999-08-01

    Full Text Available Murray (1828-1917 was an emissary of God. In the Dutch Reformed Church in South Africa, where he served as a full time minister for fifty eight years, he was elected Moderator six times. His influence, however, was not limited to the Dutch Reformed Church. Of the two hundred and fifty books (more than 20 000 pages he wrote, some were translated into more than twenty languages. In spite of his intention not to write theological works, Murray was granted a doctorate degree in Theology by the University of Aberdeen in 1898. He was a man of prayer who published approximately thirty books about prayer. Murray, a mystic and peifectionist, was reared in an extremely legalistic home. As a student he joined the Secor Dabar association which was an offspring of the legalistic Reveil movement in the first half of the nineteenth century. At the age of roundabout 65, Murray was impressed by the writings of William Law (1686-1761, which fitted his mindset like a glove. But who was Andrew Murray actually? Other similar questions concerning his influence in the Dutch Reformed Church are equally important. First and foremost however: Who was this man? Was he possibly a "tossed salad" theologian? Still today we find traces of Murrayism in the Dutch Reformed Church. Fortunately his full-time service of fifty eight years has left behind a positive heritage of Scottish Calvinism.

  6. Mida mõtleb professor Andrew Mayo? / Anne-Mari Ernesaks

    Index Scriptorium Estoniae

    Ernesaks, Anne-Mari

    2005-01-01

    PARE koordinaator tutvustab tuntud inimkapitali ideoloogi Andrew Mayo raamatut "Ettevõtte inimväärtus". Raamatu autori hinnangul on tänapäeva organisatsioonides juhtimise olulisim ülesanne inimese juhtimine varana. Lisa: Konverents

  7. Regional context of the climate of H.J. Andrews Experimental Forest, Oregon

    OpenAIRE

    Greenland, David

    1994-01-01

    H.J. Andrews Experimental Forest is a 6400 ha forest of Douglas fir, western hemlock, and Pacific silver fir located in, and typical of, the central portion of the western slope of the Cascade mountain range of Oregon. The forest is one of 19 sites in the Long-Term Ecological Research (LTER) program sponsored by the National Science Foundation. ... Because of the scientific significance of Andrews Forest, it is important to investigate the temporal variability of annual and seasonal temperatu...

  8. The beginnings of the concept of corporate social responsibility and Andrew Carnegie’s writings

    OpenAIRE

    Radu LOLESCU

    2010-01-01

    This article presents the beginnings of corporate social responsibility. In my opinion Andrew Carnegie is among the first ones who presented the difference between philanthropy and corporate social responsibility. From Andrew Carnegie and up to the present this concept went under different changes both for the benefit of the community and for the sake of the companies, but what is very important is the beginning of this process.

  9. Andrew Sexton Gray (1826-1907). A founder of Australian ophthalmology: his life and times.

    Science.gov (United States)

    Lowe, R F

    1985-11-01

    Andrew Sexton Gray was born in Limerick, Ireland, medically trained in Dublin, and was assistant to William Wilde, the distinguished oculist and aurist. He migrated to Victoria in 1859, was surgeon to a railway's construction company, then in 1862 began practice as a surgeon and oculist in Melbourne. In 1863 he founded a charitable eye and ear hospital, and had a very active, long life devoted mostly to ophthalmology. The hospital progressively expanded and became the centre for training for many ophthalmologists, as well as the nucleus for the cohesion of Victorian ophthalmology. History shows Andrew Sexton Gray to have been a founder of Australian ophthalmology. PMID:3914312

  10. Traditional values and Inglehart constructs / Zoltan Lakatos

    Index Scriptorium Estoniae

    Lakatos, Zoltan

    2015-01-01

    Autor väidab, et Ronald Ingleharti kolm kõige mõjukamat kultuuriväärtuste mõõtmise instrumenti – postmaterialismi indeks, eneseväljenduslikud väärtused ja traditsioonilised vs sekulaarsed väärtused – võivad hägustada väärtusi indiviidi tasandil ning pakub välja alternatiivse meetodi, teiste riikide seas käsitletakse ka Eestit

  11. 33 CFR 334.760 - Naval Support Activity Panama City and Alligator Bayou, a tributary of St. Andrew Bay, Fla...

    Science.gov (United States)

    2010-07-01

    ... City and Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. 334.760 Section... Alligator Bayou, a tributary of St. Andrew Bay, Fla.; naval restricted area. (a) The area. The waters within... the south side of the entrance to Alligator Bayou; thence directly across the entrance to a point...

  12. Because Everyone Has a Story to Tell: Interview with Andrew Wright

    Science.gov (United States)

    Floris, Flora Debora

    2016-01-01

    This article presents an interview with Andrew Wright, a widely recognized author, illustrator, storyteller, and teacher trainer. Wright has published many ELT books, authored six "Spellbinder" graded readers (1992-1994), and a collection of short stories. As a teacher trainer, Wright worked extensively with both teachers and students in…

  13. 77 FR 59163 - Andrew Pickens Ranger District; South Carolina; AP Loblolly Pine Removal and Restoration Project

    Science.gov (United States)

    2012-09-26

    ..., 2010, in FR/Vol. 75, No. 44, on page 10459, in the second column, correct the ``Reforestation... Acres In stands where reforestation by planting is proposed, native shortleaf pine would be planted on a... off-site loblolly pine plantations and restoring native vegetation on portions of the Andrew...

  14. 76 FR 57043 - Andrew N. Finkel; Analysis of Proposed Consent Order to Aid Public Comment

    Science.gov (United States)

    2011-09-15

    ..., or customer names. If you want the Commission to give your comment confidential treatment, you must... service. Visit the Commission Web site at http://www.ftc.gov to read this Notice and the news release... Andrew N. Finkel; Analysis of Proposed Consent Order to Aid Public Comment AGENCY: Federal...

  15. Sensory awareness and social work [Michelle Evans and Andrew Whittaker; review of

    OpenAIRE

    Watling, Sue

    2012-01-01

    Sensory Awareness and Social Work by Michelle Evans and Andrew Whittaker; Book Review for Practice: Social Work in Action Journal, Sensory Awareness and Social Work M. Evans and A. Whittaker Exeter: Learning Matters, 2010 144 pp. £17.99 (pb), ISBN: 978 1 84445 291 0

  16. Managing open access (OA) workflows at the University of St Andrews: challenges and Pathfinder solutions

    OpenAIRE

    Aucock, Janet

    2014-01-01

    © 2014. Janet Aucock. This is an open access article distributed under the Creative Commons Attribution Licence, which permits unrestricted use and distribution provided the original author and source are credited. This article arose out of a presentation given to the UKSG seminar on ‘Managing Open Access: pain points and workflows’. It presents a case study on the workflows in place at the University of St Andrews and how these are developing to meet funder compliance policies and the cha...

  17. Video produced for Andrew Lankford's talk at Google's Zeitgeist event on 2010.

    CERN Multimedia

    ATLAS Experiment

    2011-01-01

    A video made for the ATLAS talk at Google's Zeitgeist event during fall 2010, given by deputy spokesperson Andrew Lankford. The event, organized by Google, invited leaders of our time to discuss perspectives on global issues. For more information about the event go to http://www.zeitgeistminds.com/about/. The recording of the talk is available at: http://www.youtube.com/watch?v=VjIJS8zUimU

  18. Increasing uptake at St Andrews: Strategies for developing the research repository

    OpenAIRE

    Proven, Jackie; Aucock, Janet

    2011-01-01

    This paper describes the repository services that have been developed at the University of St Andrews and our aim to maximise the benefits of a full text open access repository. We describe the integration with the University's Current Research Information System (CRIS) and the various strands of activity that make up the service. We conclude with our strategy to embed our repository services within the research community of the University.

  19. Reciprocal Fire Protection Agreement between Fields/Andrews Rangeland Fire Protection Association and Burns Interagency Fire Zone

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This is the Reciprocal Fire Protection Agreement between the Fields/Andrews Rangeland Fire Protection Association and the Burns Interagency Fire Zone. The...

  20. Geographic Information System (GIS) characterization of historical seagrass coverage in St. Andrew Bay, Florida, 1953 (NODC Accession 0000608)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Graphical representation of historical seagrass coverage in St. Andrew Bay from United States Geological Survey/National Wetlands Research Center (USGS/NWRC) in...

  1. A comment on Andrew C. Papanicolaou's "Beyond Eddington's argument": pragmatism in scientific knowledge and perception.

    Science.gov (United States)

    Kono, Tetsuya

    2015-03-01

    I agree with Andrew C. Papanicolaou's claim that human beings' cognitive ability can reach to the real world, but don't agree with his claim that the order of this world is akin to our thought. In this commentary paper, I will first defend a recent pragmatic scientific realism called as "entity realism" or "referential realism" which affirms that we are able to reach the real world not by inference but by technological, engineering settings. In the second half of this paper, I will also affirm that our perceptual ability directly reaches the reality too, in referring to the ecological psychology of James J. Gibson. PMID:24986382

  2. Jane Jordan and Andrew King, dir. Ouida and Victorian Popular Culture

    OpenAIRE

    Saudo-Welby, Nathalie

    2016-01-01

    Although largely forgotten by the general public today, Ouida (Marie Louise de la Ramée, 1839–1908) was immensely popular in her time and was read by a broad spectrum of readers. Her fame extended to France and, in the early twentieth century, she was the only English female author on the French National Curriculum for the English exam set for children aged 14, ranking first before Wordsworth, Scott and Keats. The essays in Jane Jordan and Andrew King’s collection explain such immense popular...

  3. Rosa gallica l. var. officinalis (hort. ex Andrews) Ser. en el norte de Alicante (Comunidad Valenciana)

    OpenAIRE

    Ríos Ruiz, Segundo; Martinez-Frances, Vanessa

    2015-01-01

    Se ha localizado en el margen de la carretera comarcal CV 795 en su kilómetro 17 próximo a Ulls de Canals y dentro del término de Banyeres de Mariola, una buena población asilvestrada de Rosa gallica L. var. officinalis (hort. ex Andrews) Ser., que corresponde a la segunda población localizada en Alicante, puesto que se conocía una población pero situada próxima al litoral en la comarca de la Marina Alta. La llamada rosa de Provins o provincialis (de Provenza) es una de las rosas cultivadas e...

  4. Analysis and Improvement of the BAN Modified Andrew Secure RPC Protocol

    OpenAIRE

    Weibo Liu; Wenping Ma; Yuanyuan Yang

    2011-01-01

    In this paper, We have found a new man-in-the-middle attack on the BAN modified Andrew Secure RPC protocol with a protocol model-checker based on SAT. The man-in-the-middle attack, during which an intruder can impersonate an honest agent and forge a set of messages to communicate with another honest agent, destroys the assumed authentication of the protocol, one of the important properties of security protocol. Subsequently, we have reasoned about vulnerability of the protocol and proposed a ...

  5. Analysis and Improvement of the BAN Modified Andrew Secure RPC Protocol

    Directory of Open Access Journals (Sweden)

    Weibo Liu

    2011-04-01

    Full Text Available In this paper, We have found a new man-in-the-middle attack on the BAN modified Andrew Secure RPC protocol with a protocol model-checker based on SAT. The man-in-the-middle attack, during which an intruder can impersonate an honest agent and forge a set of messages to communicate with another honest agent, destroys the assumed authentication of the protocol, one of the important properties of security protocol. Subsequently, we have reasoned about vulnerability of the protocol and proposed a remedial method to overcome the weakness of the protocol. The method, simple and effective, can be helpful to analyze and design other security protocols.

  6. Ecological evaluation of proposed dredged material from St. Andrew Bay, Florida

    International Nuclear Information System (INIS)

    The US Army Corps of Engineers (USACE), Mobile District, requested that the Battelle/Marine Sciences Laboratory (MSL) conduct field sampling and chemical and biological testing to determine the suitability of potential dredged material for open ocean disposal. Sediment from St. Andrew Bay was chemically characterized and evaluated for biological toxicity and bioaccumulation of contaminants. The Tier III guidance for ocean disposal testing requires tests of water column effects (following dredged material disposal), deposited sediment toxicity, and bioaccumulation of contaminants from deposited sediment (dredged material). To meet these requirements, the MSL conducted suspended-particulate-phase (SPP) toxicity tests, solid-phase toxicity tests, and bioaccumulation testing on sediment representing potential dredged material from Panama City Harbor. Physical and chemical characterization of sediment to support toxicity and bioaccumulation results was also conducted on both the test and reference sediments. The MSL collected sediment samples from five sites in St. Andrew Bay and one reference site near Lands End Peninsula. The five test sediments and the reference sediment were analyzed for physical and chemical sediment characteristics, SPP chemical contaminants, solid-phase toxicity, SPP toxicity, and bioaccumulation of contaminants

  7. Ecological evaluation of proposed dredged material from St. Andrew Bay, Florida

    Energy Technology Data Exchange (ETDEWEB)

    Mayhew, H.L.; Word, J.Q.; Kohn, N.P.; Pinza, M.R.; Karle, L.M.; Ward, J.A. [Battelle/Marine Sciences Lab., Sequim, WA (United States)

    1993-10-01

    The US Army Corps of Engineers (USACE), Mobile District, requested that the Battelle/Marine Sciences Laboratory (MSL) conduct field sampling and chemical and biological testing to determine the suitability of potential dredged material for open ocean disposal. Sediment from St. Andrew Bay was chemically characterized and evaluated for biological toxicity and bioaccumulation of contaminants. The Tier III guidance for ocean disposal testing requires tests of water column effects (following dredged material disposal), deposited sediment toxicity, and bioaccumulation of contaminants from deposited sediment (dredged material). To meet these requirements, the MSL conducted suspended-particulate-phase (SPP) toxicity tests, solid-phase toxicity tests, and bioaccumulation testing on sediment representing potential dredged material from Panama City Harbor. Physical and chemical characterization of sediment to support toxicity and bioaccumulation results was also conducted on both the test and reference sediments. The MSL collected sediment samples from five sites in St. Andrew Bay and one reference site near Lands End Peninsula. The five test sediments and the reference sediment were analyzed for physical and chemical sediment characteristics, SPP chemical contaminants, solid-phase toxicity, SPP toxicity, and bioaccumulation of contaminants.

  8. The concurrent validity of the MacAndrew Alcoholism Scale among at-risk adolescent females.

    Science.gov (United States)

    Moore, R H

    1988-11-01

    This study investigated the empirical validity of the MacAndrew Alcoholism Scale as a measure of alcohol abuse, marijuana use, and related multiple substance use in a sample of N = 160. Classification accuracy was 45% for alcohol abuse, 48.8% for marijuana use, and 66% for related multiple substance use (n = 12). There were few differences in personality functioning as measured by the California Psychological Inventory between true positives and false negatives. Both groups exhibited adolescent qualities, i.e., irresponsibility, attraction to pleasure seeking, and minor rebelliousness. False negatives appeared to be slightly less impulsive and somewhat less secure about themselves. Both groups were also similar in terms of reported use of alcohol. They used alcohol to enhance a sense of well-being, i.e., to gain pleasure and to reduce dysphoric affect, but not to reduce inhibitions in social relationships. However, true positives tended to use alcohol to help cope with problems in personal relationships, such as rejection. Some limitations of the study, especially in relation to recent formulations of female alcoholism by MacAndrew (1986), were discussed. PMID:3216005

  9. Prosthetic rehabilitation of severe Siebert′s Class III defect with modified Andrews bridge system

    Directory of Open Access Journals (Sweden)

    Manu Rathee

    2015-01-01

    Full Text Available Prosthetic dentistry involves the replacement of missing and contiguous tissues with artificial substitutes to restore and maintain the oral functions, appearance, and health of the patient. The treatment of edentulous areas with ridge defects poses a challenging task for the dentist. Management of such cases involves a wide range of treatment options comprising mainly of surgical interventions and non surgical techniques such as use of removable, fixed or fixed- removable partial dentures. But each treatment plan undertaken should be customized according to patient needs. A variety of factors such as quality and quantity of existing contiguous hard and soft tissues, systemic condition and economic status of the patient play an important role in treatment planning, clinical outcome and prognosis. This case report presents the restoration of a Seibert′s Class III ridge defect by an economical modification of Andrews Bridge in a 32 Year old patient.

  10. Prosthetic rehabilitation of severe Siebert's Class III defect with modified Andrews bridge system.

    Science.gov (United States)

    Rathee, Manu; Sikka, Neha; Jindal, Sahil; Kaushik, Ashutosh

    2015-03-01

    Prosthetic dentistry involves the replacement of missing and contiguous tissues with artificial substitutes to restore and maintain the oral functions, appearance, and health of the patient. The treatment of edentulous areas with ridge defects poses a challenging task for the dentist. Management of such cases involves a wide range of treatment options comprising mainly of surgical interventions and non surgical techniques such as use of removable, fixed or fixed- removable partial dentures. But each treatment plan undertaken should be customized according to patient needs. A variety of factors such as quality and quantity of existing contiguous hard and soft tissues, systemic condition and economic status of the patient play an important role in treatment planning, clinical outcome and prognosis. This case report presents the restoration of a Seibert's Class III ridge defect by an economical modification of Andrews Bridge in a 32 Year old patient. PMID:25821362

  11. Protocols for Biotechnological Interventions in Improvement of Vanilla (Vanilla planifolia Andrews.).

    Science.gov (United States)

    Divakaran, Minoo; Babu, K Nirmal; Peter, K V

    2016-01-01

    Vanilla (Vanilla planifolia Andrews (syn. V. fragrans Salisb.), a native of Central America, is the primary source of natural vanillin and plays a major role in the global economy. The gene pool of vanilla is threatened by deforestation and overcollection that has resulted in disappearance of natural habitats and wild species. Continuous vegetative propagation and lack of natural seed set and sufficient variations in the gene pool hamper crop improvement programs. In vitro techniques, one of the key tools of plant biotechnology, can be employed for overcoming specific problems, viz. production of disease-free clones, inducing somaclonal variations, developing hybrids, gene pool conservation, incorporating desired traits by distant hybridization, genetic engineering, etc. However, realization of these objectives necessitates standardization of protocols. This chapter describes the various protocols optimized for crop improvement in Vanilla species. PMID:27108309

  12. Book Review of 'Evolutionary and Interpretive Archaeologies' Edited by Ethan E. Cochrane and Andrew Gardner

    CERN Document Server

    Gabora, Liane

    2015-01-01

    Evolutionary and Interpretive Archaeologies, edited by Ethan E. Cochrane and Andrew Gardner, grew out of a seminar at the Institute for Archaeology at University College London in 2007. It consists of 15 chapters by archaeologists who self-identify themselves as practitioners who emphasize the benefits of evolutionary or interpretive approaches to the study of the archaeological record. While the authors' theoretical views are dichotomous, the editors' aim for the book as a whole is not to expound on the differences between these two kinds of archaeology but to bring forward a richer understanding of the discipline and to highlight areas of mutual concern. Some chapters come across as a bit of a sales pitch, but the majority of the contributions emphasize how each approach can be productively used to address the goals of the other. The book seeks to contribute to a mutually beneficial and more productive discipline, and overall, it succeeds in this effort.

  13. General Andrew Wauchope of Niddrie Marischal. A character sketch and brief historical tribute

    Directory of Open Access Journals (Sweden)

    Eric McPherson

    2012-02-01

    Full Text Available Two months after the outbreak of the Anglo-Boer War a series of battles took place which shook Britain. These were Stormberg (10 December1899, Magersfontein (11 December 1899 and Colenso (15 December 1899. All had been reverses for the British army and had taken place within a week which became known as Black Week - a phrase coined by the British Liberal Party politician Asquith. Great Britain was regarded as having the world's most powerful army at the time and the losses suffered against the Boers resulted in humiliation and anguish for the British nation. However, nowhere was the anguish greater than in Scotland for at Magersfontein the Highland Brigade had fared badly suffering severe losses including their commander, Major-General Andrew Wauchope, killed in action. As Conan Doyle put it, "Never has Scotland had a more grievous day than this at Magersfontein. She had always given her best blood with lavish generosity for the Empire, but it may be doubted if any single battle has ever put' so many families of high and low, into mourning from the Tweed to Caithness shore." (Doyle, 1900:24 In the words of biographer William Baird "the empire has lost one of its noblest and best, a hero has gone down to his rest ere his full life's work was done". (Baird, 1902:196 Although these statements may seem somewhat flowery and were expressed during a period of much patriotic fervour, they nevertheless indicate the emotional reaction to Andrew Wauchope's untimely death.

  14. A Comparison of Two Procedures, the Mahalanobis Distance and the Andrews-Pregibon Statistic, for Identifying Multivariate Outliers.

    Science.gov (United States)

    Jarrell, Michele Glanker

    1994-01-01

    Computer simulations used to compare the Mahalanobis distance procedure with the Andrews-Pregibon statistic for identifying multivariate outliers result in the conclusion that the choice of procedure is not critical, since both identified valid data points as outliers. Results with false outliers as the dependent variable suggest the importance of…

  15. 75 FR 81637 - Endangered and Threatened Wildlife and Plants; Notice of Availability of the St. Andrew Beach...

    Science.gov (United States)

    2010-12-28

    ... live out their life cycle. They dig their burrows into the face of the dunes near vegetative cover... (63 FR 70053). The endangered St. Andrew beach mouse is now found in two populations: East Crooked..., nonnative predators, and recreational activities associated with development and tourism that weaken...

  16. Unsaturated flow modeling for performance assessment of a radioactive waste disposal facility in Andrews County, Texas

    Science.gov (United States)

    Martinez Baquero, G. F.; Singh, A.; Holt, R. M.; grisak, G. E.

    2011-12-01

    Quantitifying infiltration rates is a key component of the performance assessment for radioactive waste disposal facilities. In arid regions with scarce infiltration data, this is a challenging problem because of the computational limitations of available numerical implementations to solve water flow and transport equations. This work summarizes methodology and analysis performed to overcome some of these challenges and to generate infiltration scenarios for a low level waste disposal site in Andrews County, Texas. The work presented here includes preparation of a two dimensional finite element model in HYDRUS that includes the cover system and adjacent geologic units, calibration of hydraulic properties and root water uptake parameters based on soft information, preparation of atmospheric forcings based on current and hypothesized future climatic conditions, evaluation of impacts related to temporal and spatial discretization of forcings and model domain, and definition of scenarios for cover degradation and wetter climate conditions. Results of this work include a sensitivity analysis of infiltration rates to changes in boundary conditions under quasi-steady state, evaluation of the impact of temporal discretization of the atmospheric forcings in terms of water balance error and computational efficiency, and the estimation of infiltration rates under different scenarios. Infiltration rates from this work are being incorporated into a transport model to estimate potential radiological doses based on performance assessment modeling analyses. Findings from this work seek to contribute towards robust approaches to estimate infiltration in arid regions.

  17. Genomewide scan for adaptive differentiation along altitudinal gradient in the Andrew's toad Bufo andrewsi.

    Science.gov (United States)

    Guo, Baocheng; Lu, Di; Liao, Wen Bo; Merilä, Juha

    2016-08-01

    Recent studies of humans, dogs and rodents have started to discover the genetic underpinnings of high altitude adaptations, yet amphibians have received little attention in this respect. To identify possible signatures of adaptation to altitude, we performed a genome scan of 15 557 single nucleotide polymorphisms (SNPs) obtained with restriction site-associated DNA sequencing of pooled samples from 11 populations of Andrew's toad (Bufo andrewsi) from the edge of the Tibetan Plateau, spanning an altitudinal gradient from 1690 to 2768 m.a.s.l. We discovered significant geographic differentiation among all sites, with an average FST   = 0.023 across all SNPs. Apart from clear patterns of isolation by distance, we discovered numerous outlier SNPs showing strong associations with variation in altitude (1394 SNPs), average annual temperature (1859 SNPs) or both (1051 SNPs). Levels and patterns of genetic differentiation in these SNPs were consistent with the hypothesis that they have been subject to directional selection and reflect adaptation to altitudinal variation among the study sites. Genes with footprints of selection were significantly enriched in binding and metabolic processes. Several genes potentially related to high altitude adaptation were identified, although the identity and functional significance of most genomic targets of selection remain unknown. In general, the results provide genomic support for results of earlier common garden and low coverage genetic studies that have uncovered substantial adaptive differentiation along altitudinal and latitudinal gradients in amphibians. PMID:27289071

  18. Occurrence of Cucumber mosaic virus on vanilla (Vanilla planifolia Andrews) in India

    Indian Academy of Sciences (India)

    R Madhubala; V Bhadramurthy; A I Bhat; P S Hareesh; S T Retheesh; R S Bhai

    2005-06-01

    Cucumber mosaic virus (CMV) causing mosaic, leaf distortion and stunting of vanilla (Vanilla planifolia Andrews) in India was characterized on the basis of biological and coat protein (CP) nucleotide sequence properties. In mechanical inoculation tests, the virus was found to infect members of Chenopodiaceae, Cucurbitaceae, Fabaceae and Solanaceae. Nicotiana benthamiana was found to be a suitable host for the propagation of CMV. The virus was purified from inoculated N. benthamiana plants and negatively stained purified preparations contained isometric particles of about 28 nm in diameter. The molecular weight of the viral coat protein subunits was found to be 25.0 kDa. Polyclonal antiserum was produced in New Zealand white rabbit, immunoglobulin G (IgG) was purified and conjugated with alkaline phosphatase enzyme. Double antibody sandwich-enzyme linked immunosorbent assay (DAS-ELISA) method was standardized for the detection of CMV infection in vanilla plants. CP gene of the virus was amplified using reverse transcriptase-polymerase chain reaction (RT-PCR), cloned and sequenced. Sequenced region contained a single open reading frame of 657 nucleotides potentially coding for 218 amino acids. Sequence analyses with other CMV isolates revealed the greatest identity with black pepper isolate of CMV (99%) and the phylogram clearly showed that CMV infecting vanilla belongs to subgroup IB. This is the first report of occurrence of CMV on V. planifolia from India.

  19. Cylindric partitions, W_r characters and the Andrews-Gordon-Bressoud identities

    CERN Document Server

    Foda, O

    2015-01-01

    We study the Andrews-Gordon-Bressoud (AGB) generalisations of the Rogers-Ramanujan q-series identities in the context of cylindric partitions. We recall the definition of r-cylindric partitions, and provide a simple proof of Borodin's product expression for their generating functions, that can be regarded as a limiting case of an unpublished proof by Krattenthaler. We also recall the relationships between the r-cylindric partition generating functions, the principal characters of affine sl_r algebras, the M^{r, r+d}_r minimal model characters of W_r algebras, and the r-string abaci generating functions, as well as the relationships between them, providing simple proofs for each. We then set r=2, and use 2-cylindric partitions to re-derive the AGB identities as follows. Firstly, we use Borodin's product expression for the generating functions of the 2-cylindric partitions with infinitely-long parts, to obtain the product sides of the AGB identities, times a factor (q; q)_{\\infty}^{-1}, which is the generating ...

  20. Towards an improved information utilization in design decisionmaking: a case study of the Hurricane Andrew recovery efforts

    OpenAIRE

    Langendorf, R.

    1995-01-01

    This paper is a review of the experiences at the computer laboratory of the School of Architecture at the University of Miami in contributing to recovery efforts in the aftermath of Hurricane Andrew and a reflection upon these experiences with regard to the ways computer- based information can contribute to improved design decisionmaking. It begins with background on the hurricane and the active role in recovery that the school and, in particular, the computer laboratory assumed. Case histori...

  1. National Status and Trends: Bioeffects Program - Magnitude and Extent of Sediment Toxicity in Four Bays of the Florida Panhandle: Pensacola, Choctawhatchee, St. Andrew and Apalachicola

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The toxicity of sediments in Pensacola, Choctawhatchee, St. Andrew and Apalachicola Bays was determined as part of bioeffects assessments performed by NOAA's...

  2. ANDREW LANG, COMPARATIVE ANTHROPOLOGY AND THE CLASSICS IN THE AFRICAN ROMANCES OF RIDER HAGGARD

    Directory of Open Access Journals (Sweden)

    J.L. Hilton

    2012-03-01

    Full Text Available The long-standing friendship between Andrew Lang (1844-19121 and Henry RiderHaggard (1856-19252 is surely one of the most intriguing literary relationships ofthe Victorian era.3 Lang was a pre-eminent literary critic and his support forHaggard’s earliest popular romances, such as King Solomon’s mines (1885 andShe (1887, helped to establish them as leading models of the new genre ofimperial adventure fiction.4 Lang and Haggard co-authored The world’s desire(18905 and the ideas of Lang, who was also a brilliant Classics scholar, can beseen in many of Haggard’s works. There are some significant similarities betweenthe two men: both were approximate contemporaries who lived through the mostaggressive phase of British imperialism, both were highly successfully writers whoearned their living by their pens, both wrote prolifically and fluently on a wide range of subjects,6 both were largely self-educated, both were interested in thesupernatural, both had had unhappy experiences in love at first but later maintainedlong-lasting marriages, and both were men with powerful faculties of imagination.There are, of course, significant differences also: Lang was a gifted intellectualwho had won a fellowship at Oxford, a Homeric scholar, a poet with a gift forirony and humour, and one of the earliest exponents of the new science ofanthropological mythology; Haggard was less well educated and more seriousminded,he preferred action to ideas, was personally involved in the extension ofBritish rule in Southern Africa,7 and had a close experience of African tribal life.This article sets out to investigate the relationship between these two men, and toassess the extent to which Lang’s classical and anthropological thinking shaped thenarratives of Haggard, especially those set in his imperialistic fantasy of theAfrican continent.

  3. Construction, Startup and Operation of a New LLRW Disposal Facility in Andrews County, Texas - 12151

    International Nuclear Information System (INIS)

    During this last year, Waste Control Specialists LLC (WCS) completed construction and achieved start of operations of a new low level radioactive waste (LLRW) disposal facility in Andrews County Texas. Disposal operations are underway for commercial LLRW, and start up evolutions are in progress for disposal of Department of Energy (DOE) LLRW. The overall approach to construction and start up are presented as well as some of the more significant challenges and how they were addressed to achieve initial operations of the first new commercial low level radioactive waste disposal facility in more than 30 years. The WCS disposal facility consists of two LLRW disposal cells, one for Texas Compact waste, and a separate disposal cell for DOE waste. Both disposal cells have very robust and unique designs. The cells themselves are constructed entirely in very low permeability red bed clay. The cell liners include a 0.91 meter thick clay liner meeting unprecedented permeability limits, 0.3 meter thick reinforced concrete barriers, as well as the standard geo-synthetic liners. Actions taken to meet performance criteria and install these liners will be discussed. Consistent with this highly protective landfill design, WCS chose to install a zero discharge site water management system. The considerations behind the design and construction of this system will be presented. Other activities essential to successful start of LLRW disposal operations included process and procedure development and refinement, staffing and staff development, and training. Mock ups were built and used for important evolutions and functions. Consistent with the extensive regulation of LLRW operations, engagement with the Texas Commission on Environmental Quality (TCEQ) was continuous and highly interactive. This included daily activity conference calls, weekly coordination calls and numerous topical conference calls and meetings. TCEQ staff and consultants frequently observed specific construction

  4. Low-Frequency Response Following the Passage of Hurricane Andrew on the Texas-Louisiana Shelf

    Science.gov (United States)

    Pearce, S. M.; Smith, D. C.; Dimarco, S. F.

    2009-12-01

    During August 24th through 27th in 1992, Hurricane Andrew passed through the Gulf Of Mexico almost directly over several moorings on the easternmost Louisiana shelf portion of the Texas-Louisiana Shelf (LATEX) coastal ocean monitoring program. Examination of the current meter time-series showed the existence of fast moving, long shelf waves over the entire Texas-Louisiana shelf west of the storm passage for up to 12 days after direct forcing ceased. The LATEX program featured 31 moorings each with 3 current meters over the 10, 20, 50, and 200 meter isobaths in 5 cross sectional lines with additional coverage on the 200 meter isobath from the Louisiana-Mississippi River delta, to Corpus Christi, Texas. Additionally, several pressure records from LATEX and several NOAA historical coastal tide gauge data from Sabine Pass to Port Isabella, Texas were incorporated. Raw, 3-hour low pass filtered, and 40-hour low pass filtered versions of the current data were analyzed. The pressure data used were detided using a least squares fit, and the tidal records were detided using the NOAA predicted tides for that location. All data were analyzed using a wavelet analysis to determine the spectra over time. The analyzed data shows that the shelf response was largely dominated in the internal Kelvin wave mode. The wave propagated towards the west on the shelf at approximately 400 km/day. These results are contrasted and compared with wave modes predicted for coastal trapped wave solutions. The output of a coastal ocean model simulation using a forced wind field similar to the storm are also contrasted and compared with the observed data.

  5. Effect of Hurricane Andrew on the Turkey Point Nuclear Generating Station from August 20--30, 1992. [Final report

    Energy Technology Data Exchange (ETDEWEB)

    Hebdon, F.J. [Institute of Nuclear Power Operations, Atlanta, GA (United States)

    1993-03-01

    On August 24, 1992, Hurricane Andrew, a Category 4 hurricane, struck the Turkey Point Electrical Generating Station with sustained winds of 145 mph (233 km/h). This is the report of the team that the US Nuclear Regulatory Commission (NRC) and the Institute of Nuclear Power Operations (INPO) jointly sponsored (1) to review the damage that the hurricane caused the nuclear units and the utility`s actions to prepare for the storm and recover from it, and (2) to compile lessons that might benefit other nuclear reactor facilities.

  6. Effect of Hurricane Andrew on the Turkey Point Nuclear Generating Station from August 20--30, 1992

    International Nuclear Information System (INIS)

    On August 24, 1992, Hurricane Andrew, a Category 4 hurricane, struck the Turkey Point Electrical Generating Station with sustained winds of 145 mph (233 km/h). This is the report of the team that the US Nuclear Regulatory Commission (NRC) and the Institute of Nuclear Power Operations (INPO) jointly sponsored (1) to review the damage that the hurricane caused the nuclear units and the utility's actions to prepare for the storm and recover from it, and (2) to compile lessons that might benefit other nuclear reactor facilities

  7. A tale of two storms: Surges and sediment deposition from Hurricanes Andrew and Wilma in Florida’s southwest coast mangrove forests: Chapter 6G in Science and the storms-the USGS response to the hurricanes of 2005

    Science.gov (United States)

    Smith, Thomas J., III; Anderson, Gordon H.; Tiling, Ginger

    2007-01-01

    Hurricanes can be very different from each other. Here we examine the impacts that two hurricanes, Andrew and Wilma, had in terms of storm surge and sediment deposition on the southwest coast of Florida. Although Wilma was the weaker storm, it had the greater impact. Wilma had the higher storm surge over a larger area and deposited more sediment than did Andrew. This effect was most likely due to the size of Wilma's eye, which was four times larger than that of Andrew.

  8. Plant phenology patterns at three sites on the H.J. Andrews Experimental Forest, Oregon, 1987 to 2007.

    Science.gov (United States)

    Shaw, D. C.; Creel, C.; Downing, G.; Remillard, S.; O'Connell, K.

    2007-12-01

    Plant phenology data has been collected at three sites on the H.J. Andrews Experimental Forest, Oregon since the late 1970's. The sites were visited once every three weeks year-round. Current efforts to clean and archive this data are on-going. Here we present on a 20 year data set from 1987 to 2007. The three sites are located at Watersheds (WS) 10, 8, and 7/6, at an elevation of 466 m, 993 m, and 905/950 m respectively. Forests were old growth (WS 8) and regenerating clearcuts (WS 6, 10), or shelterwood clearcut with overstory removed in 1984 (WS 7) dominated by Douglas-fir, western hemlock, true firs, and western redcedar. One tree (Douglas-fir), two evergreen shrubs, three deciduous shrubs, and four herbs were followed for vegetative and flowering phenology, including bud swell, bud bread, leaf expansion, leaf color change, leaf fall, flower bud swell, blooming, petal loss, fruit formation, and seed dispersal. Weather stations are located at each site and tied into a network of stations in this LTER site. Physical factors such as snow depth, snow coverage, freeze-thaw activity, as well as lichen condition were also noted. We are asking two key questions regarding plant phenology patterns. 1. Has the growing season lengthened in the mountainous watershed of the HJ Andrews, and is this similar for a low elevation site (WS 10) versus a mid elevation site (WS 8, 7/6)? 2. Do snow-pack dynamics influence plant phenology more so than temperature (degree days)?

  9. 33 CFR 334.770 - Gulf of Mexico and St. Andrew Sound, south of East Bay, Fla., Tyndall Drone Launch Corridor...

    Science.gov (United States)

    2010-07-01

    ... Sound, south of East Bay, Fla., Tyndall Drone Launch Corridor, Tyndall Air Force Base, Fla.; restricted.... Andrew Sound, south of East Bay, Fla., Tyndall Drone Launch Corridor, Tyndall Air Force Base, Fla... referred to as the “Tyndall Drone Launch Corridor.” (b) The regulations. (1) Military usage of areas...

  10. 33 CFR 334.680 - Gulf of Mexico, southeast of St. Andrew Bay East Entrance, small-arms firing range, Tyndall Air...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Gulf of Mexico, southeast of St. Andrew Bay East Entrance, small-arms firing range, Tyndall Air Force Base, Fla. 334.680 Section 334.680..., small-arms firing range, Tyndall Air Force Base, Fla. (a) The danger zones—(1) Area No. 1. The waters...

  11. Apocalyptic Kingship, Harmony and Political Expediency: the Challenges and Paradoxes of Andrew Marvell’s “First Anniversary”

    Directory of Open Access Journals (Sweden)

    Jajtner Tomáš

    2015-07-01

    Full Text Available The following paper deals with the interpretation of one of the major “Cromwellian” poems of Andrew Marvell (1621-1678, “The First Anniversary of the Government under His Highness the Lord Protector”, 1655. The poem is first set in the context of Marvell’s poetry and his public career in the period between 1637 and 1660. The article then identifies and analyses three main themes of “The First Anniversary”: the notion of a new aeon starting with Cromwell’s rule and the apocalyptical imagery related to his Protectorate, the concept of his power and authority between liberty and tyranny, and the relation between the harmony established by Cromwell and classical Pythagorean harmonious lore. The author argues that the imagery Marvell uses to describe the nature of the regime (especially the concept of Cromwell’s “no-kingship” shows a deeply paradoxical structure, which uncovers the frailty and insecurity of Cromwell’s dictatorship as well as the circular logic of its justification. In that sense, the poem can be read as a vivid manifestation of the dilemmas and tensions of this period.

  12. The Impact of Structural Break(s on the Validity of Purchasing Power Parity in Turkey: Evidence from Zivot-Andrews and Lagrange Multiplier Unit Root Tests

    Directory of Open Access Journals (Sweden)

    Hakan Kum

    2012-01-01

    Full Text Available This study examines the validity of the purchasing power parity (PPP in Turkey for annual data from 1953 to 2009. While results from both the ADF unit root and the DF-GLS unit root test indicate mixed results, PPP holds for Turkey with the presence of structural breaks which are obtained by Zivot and Andrews and Lagrange Multiplier unit root tests.

  13. Will natural disasters accelerate neighborhood decline? A discrete-time hazard analysis of residential property vacancy and abandonment before and after Hurricane Andrew in Miami-Dade County (1991–2000)

    OpenAIRE

    Yang Zhang

    2012-01-01

    This study examines the impact of an abrupt catastrophic natural disaster on residential property vacancy and abandonment. Using the discrete-time hazard model with parcel-level land-use data in Miami-Dade County, Florida, from two years prior to and eight years after Hurricane Andrew (1991–2000), the analysis shows that Hurricane Andrew triggered widespread property vacancy and abandonment in its impact area, especially in neighborhoods already in decline. Occurrence of vacancy and abandonme...

  14. Inhibition of the gastric H+,K+ -ATPase by plectrinone A, a diterpenoid isolated from Plectranthus barbatus Andrews.

    Science.gov (United States)

    Schultz, Carla; Bossolani, Myllene P; Torres, Luce M B; Lima-Landman, Maria Teresa R; Lapa, Antonio J; Souccar, Caden

    2007-04-20

    This work assessed the mechanism underlying the antisecretory gastric acid effect of Plectranthus barbatus Andrews (Lamiaceae) and active constituents. Popularly known as "false-boldo", this plant is used in Brazilian folk medicine to treat gastrointestinal and hepatic ailments. The plant aqueous extract (AE) and isolated compounds were assayed in vivo in pylorus-ligated mice, and in vitro on acid secretion measured as [(14)C]-aminopyrine ([(14)C]-AP) accumulation in rabbit gastric glands and gastric H(+),K(+)-ATPase preparations. Injected into the duodenal lumen, the AE of the plant leaves (0.5 and 1.0 g/kg) decreased the volume (62 and 76%) and total acidity (23 and 50%) of gastric acid secretion in pylorus-ligated mice. Bioguided purification of the AE yielded an active fraction (IC(50)=24 microg/ml) that inhibited acid secretion in rabbit gastric glands with a potency 10 to 18 times greater than that of the originating extract, on both the basal and stimulated acid secretion by histamine (His) (1 microM) or bethanechol (100 microM). At the same concentrations the gastric H(+),K(+)-ATPase activity was also inhibited. The active constituent was chemically identified as the abietanoid dienedione plectrinone A which reduced the H(+),K(+)-ATPase activity with IC(50)=171 microM. The results indicate that inhibition of the gastric proton pump by this diterpenoid may account for the antisecretory acid effect and reputed anti ulcer activity of Plectranthus barbatus. PMID:17166678

  15. Hurricane Andrew causes major oil spill at Florida Power ampersand Light Company's Turkey Point Power Plant, Homestead, Florida

    International Nuclear Information System (INIS)

    On August 24, 1992, Hurricane Andrew slammed into South Florida with wind gusts in excess of 160 mph. At 4:00 a.m. that day, the eye of this category four storm passed over Florida Power ampersand Light Company's Turkey Point power plant, south of Miami. Although the plant's two nuclear units escaped any significant damage, the storm caused extensive destruction to buildings and transmission facilities, and damaged two 400 foot tall emission stacks associated with the site's two fossil fuel generating units. In addition, a 90,000 to 110,000 gallon spill of No. 6 fuel oil resulted when a piece of wind-blown debris punctured the steel of the unit One 12,000 barrel fuel oil metering tank approximately 30 feet up from the tank bottom. Despite the presence of a secondary containment structure around the tank, the intense wind blew oil throughout the plant site. The damage to the metering tank apparently occurred during the first half hour of the hurricane. As the tank's oil level fell due to the puncture, transfer pumps from the bulk oil storage tanks received a low level alarm which automatically began transferring oil to the damaged metering tank. To prevent the further discharge of oil, plant personnel entered the power block and secured the pumps during the passage of the hurricane eye. Immediately following the storm, facility personnel deployed booms across the barge canal and the Units 1 and 2 intake canal to contain the oil which had entered the water. The response strategy and implementation is described in detail. The remediation costs were approximately $14/gallon spilled, including 54,000 gallons recovered for electricity generation

  16. Fuel to the nuclear debate : [Rezension von:] Nuclear power in crisis, Andrew Blowers and David Pepper (editors), New York, Nichols; London ..., Croom Helm, 1987

    OpenAIRE

    Renn, Ortwin

    1988-01-01

    Nuclear energy is one of the most popular topics of today’s publication market. The literature about the pros and cons of nuclear power may easily fill a whole library. Is there anything new to add to this voluminous body of arguments and contra-arguments that would justify editing another book on nuclear energy? Andrew Blowers and David Pepper obviously felt that way and published a reader on Nuclear Power in Crisis. The book consists of 13 articles covering mainly the political, social and ...

  17. Maaleht soovitab : Anu Tali dirigeerib Vanemuises "Toscat". Vivaldi, Casanova ja Veneetsia. "Uinuv kaunitar" Vanemuises. Andrew Lloyd Webberi juubelikontserdid. Pärimusmuusika lõiluspidu

    Index Scriptorium Estoniae

    2008-01-01

    27. sept. juhatab Anu Tali Vanemuise teatris Mikk Mikiveri lavastatud ja Ervin Õunapuu taastatud Puccini ooperilavastust "Tosca". Barokkansambel Corelli Consort ja Raivo Järvi esitavad kava "Vivaldi, Casanova ja Veneetsia" 15. okt. Maardu mõisa muusikasalongis, 18. okt. Pärnus sarjas "Café Grand muusikasalong" ja 19. okt. Eesti Teaduste Akadeemia majas sarjas "Toompea muusikasalong". Vanemuisees esietendub 4. okt. Pjotr Tshaikovski ballett "Uinuv kaunitar". Tallinnas Saku Suurhallis toimuvad 18. okt. briti muusikalihelilooja Andrew Lloyd Webberi 60. sünnipäevale pühendatud juubelikontserdid. Viljandi Pärimusmuusika Aidas peetakse 10.-11. okt. "Pärimusmuusika lõikuspidu"

  18. Public health assessment for Wheeling Disposal Service Company Landfill, Amazonia, Andrew County, Missouri, Region 7, CERCLIS number MOD000830554. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-08-25

    The Wheeling Disposal Service Company, Inc., (Wheeling Disposal) site is a closed municipal and industrial waste landfill, approximately 1 mile southeast of Amazonia, Andrew County, Missouri. On-site shallow groundwater is contaminated with Volatile Organic Compounds (VOCs) (methylene chloride, carbon tetrachloride, trichloroethylene) and metals; however, no one is using that water for potable purposes at present. Isolated farm houses are situated in the vicinity of the site, but the houses that would most likely be affected are connected to the public water system. From the information reviewed, DOH concludes that the Wheeling Disposal site currently poses no apparent public health hazard. No exposures are known to be occurring at this time. Potential exposure pathways have been identified, but remedial actions eliminated them.

  19. Observations on some of the plates used to illustrate the Lymphatics section of Andrew Fyfe's Compendium of the Anatomy of the Human Body, Published in 1800.

    Science.gov (United States)

    Kaufman, M H

    1999-01-01

    An engraving displaying A General View of the Absorbent System was used as one of many plates illustrating the Lymphatics section of Andrew Fyfe's Compendium of the Anatomy of the Human Body published in 1800. It is a scaled-down version of a life-size engraving displayed in the museum of the Department of Anatomy at the University of Edinburgh, and is based on a cadaver specially dissected and injected with mercury in 1788 by Alexander Monro secundus, probably with the assistance of Fyfe, who was his 'dissector'. Only recently has the relationship between these two engravings been established, and the Figure Legend in Fyfe's Compendium now provides the missing key to the features illustrated in the life-size engraving. The source and very variable quality of some of Fyfe's other plates, both in the Lymphatics section and elsewhere in the book, are discussed. PMID:9890727

  20. Die erediens as fees of die fees as erediens?: �n Andrew Murray pryswenner �n kwarteeu later herlees

    Directory of Open Access Journals (Sweden)

    Cas Wepener

    2014-08-01

    Full Text Available Worship as feast or feast as worship? Re-reading an Andrew Murray prizewinner one quarter of a century later. The aim of this contribution is to bring the book Die erediens as fees into discussion with the surrounding culture almost one quarter of a century after its publication. The surrounding culture, we shall call, following Martin Stringer and his so-called discourse of globalisation and consumerism, �the feast as worship service�. Based on this discussion, our research question pertains to the value of Die erediens as fees for the field of Liturgical Studies today. An answer is attempted by, firstly, sketching the liturgical landscape as well as national and international liturgical-scientific developments in our day and, secondly, providing a liturgical-aesthetical exploration and positioning Die erediens as fees within these developments and exploration.

  1. Anti-trypanosomal activity of 1,2,3,4,6-penta-O-galloyl-? -D-glucose isolated from Plectranthus barbatus Andrews (Lamiaceae)

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Roberta T. dos; Hiramoto, Liliane L.; Lago, Joao Henrique G.; Sartorelli, Patricia [Universidade Federal de Sao Paulo (UNIFESP), Diadema, SP (Brazil). Inst. de Ciencias Ambientais, Quimicas e Farmaceuticas; Tempone, Andre G.; Pinto, Erika G. [Instituto Adolfo Lutz, Sao Paulo, SP (Brazil). Dept. de Parasitologia; Lorenzi, Harri, E-mail: psartorelli@unifesp.br [Instituto Plantarum de Estudos da Flora, Nova Odessa, SP (Brazil)

    2012-07-01

    MeOH extract from the leaves of Plectranthus barbatus Andrews (Lamiaceae), showed in vitro anti-trypanosomal activity. The bioassay-guided fractionation resulted in the isolation of a gallic acid derivative, identified as 1,2,3,4,6-penta-O-galloyl-{beta}-D-glucose (PGG), after thorough NMR and MS spectral analysis. Finally, this compound was tested against trypomastigote forms of T. cruzi and displayed an EC{sub 50} value of 67 {mu}M, at least 6.6-fold more effective than the standard drug benznidazole. This is the first occurrence of PGG in the Plectranthus genus and the first anti-parasitic activity described for PGG in the literature (author)

  2. The impact of Hurricane Andrew on deviant behavior among a multi-racial/ethnic sample of adolescents in Dade County, Florida: a longitudinal analysis.

    Science.gov (United States)

    Khoury, E L; Warheit, G J; Hargrove, M C; Zimmerman, R S; Vega, W A; Gil, A G

    1997-01-01

    Findings from a longitudinal study are presented on the relationships between the problems and stresses resulting from Hurricane Andrew and posthurricane minor deviant behavior. The sample (N = 4,978) included Hispanic, African-American, and White non-Hispanic middle school students enrolled in Dade County, Florida public schools. Two waves of data were collected prior to the hurricane; a third was obtained approximately 6 months following the storm. Results indicated that females were likely to report higher levels of hurricane-related stress symptoms than males. After controlling for prehurricane levels of minor deviance, family support, and race/ethnicity, hurricane stress symptom level remained a significant predictor of posthurricane minor deviant behavior. The findings lend support to stress theories of social deviance. PMID:9018678

  3. Anti-trypanosomal activity of 1,2,3,4,6-penta-O-galloyl-β -D-glucose isolated from Plectranthus barbatus Andrews (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Roberta T. dos Santos

    2012-01-01

    Full Text Available MeOH extract from the leaves of Plectranthus barbatus Andrews (Lamiaceae, showed in vitro anti-trypanosomal activity. The bioassay-guided fractionation resulted in the isolation of a gallic acid derivative, identified as 1,2,3,4,6-penta-O-galloyl-β-D-glucose (PGG, after thorough NMR and MS spectral analysis. Finally, this compound was tested against trypomastigote forms of T. cruzi and displayed an EC50 value of 67 µM, at least 6.6-fold more effective than the standard drug benznidazole. This is the first occurrence of PGG in the Plectranthus genus and the first anti-parasitic activity described for PGG in the literature.

  4. Coordination of Trade Secret and Freedom of Speech——Analysis of Case on DVD COPY CONTROL ASSOCIATION v. ANDREW BUNNER%商业秘密与表达自由的协调——DVD COPY CONTROL ASSOCIATION v.ANDREW BUNNER案评析

    Institute of Scientific and Technical Information of China (English)

    万志前

    2006-01-01

    2000年美国加利福尼亚州初审和上诉法院对DVD复制控制协会诉ANDREW BUNNER的判决,涉及到了保护商业秘密与保护表达自由的关系问题.商业秘密和表达自由都是受法律保护的权利,协调两者的关系,需要进行合法性和利益衡量的考察.

  5. Principal component and Tucker3 analyses of high performance liquid chromatography with diode-array detection fingerprints of crude extracts of Erythrina speciosa Andrews leaves

    International Nuclear Information System (INIS)

    Highlights: ► Simultaneous chromatographic, spectroscopic and mixture proportion correlations. ► Tucker3 analysis of chromatographic, spectral and solvent mixture proportions. ► HPLC-DAD spectral characterization of chromatographic peaks. - Abstract: Mixtures of ethanol, dichloromethane, hexane and acetone obtained according to a statistical design have been used to extract substances from Erythrina speciosa Andrew leaves for chromatographic fingerprinting. The plant extracts from each mixture were analyzed by HPLC-DAD providing UV–vis spectra for each chromatographic peak. These chromatograms and spectra for the design mixtures were then treated with principal component (PCA), Tucker3 and PARAFAC analyses. PCA indicated the existence of five different chromatographic fingerprints for the leave extracts depending on the solvent mixture composition. Different chromatographic peak areas were strongly correlated with the mixture proportions of acetone, dichloromethane and ethanol. Tucker3 and PARAFAC analyses were very useful for identifying simultaneous correlations between chromatographic peak areas, spectral band absorbances and solvent proportions. The acetone proportion was highly correlated with the area of the 3.69 min retention time peak and the spectral absorbances between 250 and 260 nm, consistent with the presence of natural polyphenols. The dichloromethane mixture proportion was strongly correlated with the 12.19 min chromatographic peak area and a single spectral absorbance at 201 nm. This spectral absorption is characteristic of the electronic structures of terpenes and alkaloids.

  6. Principal component and Tucker3 analyses of high performance liquid chromatography with diode-array detection fingerprints of crude extracts of Erythrina speciosa Andrews leaves

    Energy Technology Data Exchange (ETDEWEB)

    Kaori Soares, Patricia [Instituto de Quimica, Universidade Estadual de Campinas, CP 6154, 13083-970 Campinas, SP (Brazil); Bruns, Roy Edward, E-mail: bruns@iqm.unicamp.br [Instituto de Quimica, Universidade Estadual de Campinas, CP 6154, 13083-970 Campinas, SP (Brazil); Spacino Scarminio, Ieda [Laboratorio de Quimiometria em Ciencias Naturais, Departamento de Quimica, Universidade Estadual de Londrina, CP 6001, 86051-990 Londrina, PR (Brazil)

    2012-07-29

    Highlights: Black-Right-Pointing-Pointer Simultaneous chromatographic, spectroscopic and mixture proportion correlations. Black-Right-Pointing-Pointer Tucker3 analysis of chromatographic, spectral and solvent mixture proportions. Black-Right-Pointing-Pointer HPLC-DAD spectral characterization of chromatographic peaks. - Abstract: Mixtures of ethanol, dichloromethane, hexane and acetone obtained according to a statistical design have been used to extract substances from Erythrina speciosa Andrew leaves for chromatographic fingerprinting. The plant extracts from each mixture were analyzed by HPLC-DAD providing UV-vis spectra for each chromatographic peak. These chromatograms and spectra for the design mixtures were then treated with principal component (PCA), Tucker3 and PARAFAC analyses. PCA indicated the existence of five different chromatographic fingerprints for the leave extracts depending on the solvent mixture composition. Different chromatographic peak areas were strongly correlated with the mixture proportions of acetone, dichloromethane and ethanol. Tucker3 and PARAFAC analyses were very useful for identifying simultaneous correlations between chromatographic peak areas, spectral band absorbances and solvent proportions. The acetone proportion was highly correlated with the area of the 3.69 min retention time peak and the spectral absorbances between 250 and 260 nm, consistent with the presence of natural polyphenols. The dichloromethane mixture proportion was strongly correlated with the 12.19 min chromatographic peak area and a single spectral absorbance at 201 nm. This spectral absorption is characteristic of the electronic structures of terpenes and alkaloids.

  7. Spatial distribution and compositional variation of APS minerals related to uranium deposits in the Kiggavik-Andrew Lake structural trend, Nunavut, Canada

    Science.gov (United States)

    Riegler, Thomas; Quirt, Dave; Beaufort, Daniel

    2016-02-01

    The Kiggavik-Andrew Lake structural trend consists of four mineralized zones, partially outcropping, lying 2 km south of the erosional contact with the unmetamorphosed sandstone and basal conglomerates of the Paleoproterozoic Thelon Formation. The mineralization is controlled by a major E-W fault system associated with illite and sudoite alteration halos developed in the Archean metagraywackes of the Woodburn Lake Group. Aluminum phosphate sulfate (APS) minerals from the alunite group crystallized in association with the clay minerals in the basement alteration halo as well as in the overlying sandstones, which underwent mostly diagenesis. APS minerals are Sr- and S-rich (svanbergite end-member) in the sedimentary cover overlying the unconformity, whereas they are light rare earth elements (LREE)-rich (florencite end-member) in the altered basement rocks below the unconformity. The geochemical signature of each group of APS minerals together with the petrography indicates three distinct generations of APS minerals related to the following: (1) paleoweathering of continental surfaces prior to the basin occurrence, (2) diagenetic processes during the burial history of the lower unit of the Thelon sandstones, and (3) hydrothermal alteration processes which accompanied the uranium deposition in the basement rocks and partially overlap the sedimentary-diagenetic mineral parageneses. In addition, the association of a first generation of APS minerals with both detrital cerium oxide and aluminum oxy-hydroxide highlights the fact that a part of the detrital material of the basal Thelon Formation originated from eroded paleolaterite (allochthonous regolith). The primary rare earth element (REE)-bearing minerals (e.g., monazite, REE carbonates, and allanite) of the host rocks were characterized to identify the potential sources of REE. The REE chemical composition highlights a local re-incorporation of the REE released from the alteration processes in the APS minerals of

  8. FLOODPLAIN, ANDREW COUNTY, MISSOURI, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...

  9. HYDRAULICS, Andrew COUNTY, MISSOURI, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  10. Spatial and Temporal Trends in the Carbon, Nitrogen, and Sulfur Isotopes of Stream DOM From 10 Watersheds at the HJ Andrews Experimental Forest.

    Science.gov (United States)

    Frentress, J.; Kendall, C.; Lajtha, K.; Jones, J.

    2008-12-01

    In order to better understand sources of dissolved organic matter (DOM) in streams from the small to large watershed scales, we initiated a one-year investigation of the chemical and isotopic characteristics of DOM at the HJ Andrews Experimental Forest (HJA) in Blue River, OR. DOM is a biologically significant loss from these watersheds, but its sources (forest floor, mineral soil, riparian zones, stream biota) are debated. Traditional chemical characterizations of DOM like SUVA and FI have been useful in conceptualizing and modeling streamflow sources, however, an improved method for assessing DOM quality is needed to adequately differentiate DOM from sources within the watershed. The isotopic characterization of inorganic molecules like nitrate has provided insight to the role of subsurface and surface processes governing the production and transport of critical nutrients, and yet to date, little work has been done to examine the usefulness of isotopic characterization of organically bound nutrients. We apply the isotopic characterization approach to DOM in order to better understand DOM production, transformation, and transport to streams in a range of watershed sizes. Major questions addressed in this research are: 1) Where in the watershed does stream DOM come from? 2) How do DOM sources vary temporally? 3) How do physical attributes of the watershed mediate DOM quality? A relatively new solid-phase extraction technique using C-18 resin was used to isolate DOM in water samples from 10 watersheds, ranging in size from 10 to 6200 hectares, on 3-week intervals from May 2007 to June 2008. The modified technique allowed for small (1 Liter) sample sizes and short processing times to reduce the costs of analysis. The capacity of carbon, nitrogen and sulfur isotopic characterizations of DOM, as well as traditional methods like SUVA and C:N, to predict physical watershed attributes (i.e. mean residence time, soil depth, elevation, gradient) and land use history (timber

  11. IDENTIFICACIÓN DE LAS CARACTERÍSTICAS DE UNA OCLUSIÓN IDEAL AL TÉRMINO DEL TRATAMIENTO DE ORTODONCIA SIN EXTRACCIONES, MEDIANTE LAS LLAVES DE LA OCLUSIÓN DE ANDREWS.

    OpenAIRE

    Contreras Alvarado, Karla

    2012-01-01

    Antecedentes: A principios de los años setenta el Dr. Lawrence F. Andrews publicó un artículo en el que discute seis características significativas que se encontraron constantemente en un estudio realizado a 120 pacientes no ortodóncicos con una oclusión normal. El autor se refirió a estas cualidades como las Seis llaves de la oclusión normal (Six keys to normal occlusion) Hoy día siguen vigentes e importantes en el éxito de un tratamiento ortodóntico. Objetivo: Identific...

  12. A Quantum of Solace: Guzman on the Classical Mechanics of International Law - Book Review: Andrew Guzman, How International Law Works. A Rational Choice Theory (2008

    Directory of Open Access Journals (Sweden)

    Matthias Goldmann

    2009-02-01

    in mind in order to assess the quantum of solace that Andrew Guzman’s new book provides.

  13. A comparison of mercury burdens between St. Marks National Wildlife Refuge and St. Andrew Bay, Florida: Evaluation of fish body burdens and physiological responses in largemouth bass, spotted seatrout, striped mullet, and sunfish

    Science.gov (United States)

    Huge, D.H.; Rauschenberger, R.H.; Wieser, F.M.; Hemming, J.M.

    2011-01-01

    Musculature from the dorsal region of 130 largemouth bass (Micropterus salmoides), 140 sunfish (Lepomis sp.), 41 spotted seatrout (Cynoscion nebulosus) and 67 striped mullet (Mugil cephalus) were collected from five estuarine and five freshwater sites within the St. Marks National Wildlife Refuge and two estuarine and two freshwater sites from St. Andrew Bay, Florida, United States of America. Musculature was analyzed for total mercury content, sagittal otoliths were removed for age determination and physiological responses were measured. Largemouth bass and sunfish from the refuge had higher mercury concentrations in musculature than those from the bay. Male spotted seatrout, male striped mullet, male and female sunfish and female largemouth bass had mercury burdens positively correlated with length. The majority of all four species of fish from both study areas contained mercury levels below 1.5 part per million, the limit for safe consumption recommended the Florida Department of Health. In comparison, a significant percentage of largemouth bass and sunfish from several sampled sites, most notably Otter Lake and Lake Renfroe within St. Marks National Wildlife Refuge, had mercury levels consistent with the health department's guidelines of 'limited consumption' or 'no consumption guidelines.'

  14. The Future of the Andrew File System

    CERN Document Server

    CERN. Geneva; Altman, Jeffrey

    2011-01-01

    The talk will discuss the ten operational capabilities that have made AFS unique in the distributed file system space and how these capabilities are being expanded upon to meet the needs of the 21st century. Derrick Brashear and Jeffrey Altman will present a technical road map of new features and technical innovations that are under development by the OpenAFS community and Your File System, Inc. funded by a U.S. Department of Energy Small Business Innovative Research grant. The talk will end with a comparison of AFS to its modern days competitors.

  15. Conceito de educação musical de Zoltan Kodály e teoria de aprendizagem musical de Edwin Gordon: uma abordagem comparativa

    OpenAIRE

    Cruz, Cristina Brito da

    1995-01-01

    Escrever um artigo que, sem a pretensão de ser exaustivo, apontasse semelhanças no modo de pensar a Educação e a Aprendizagem Musicais de Kodály e Gordon, tornou-se para mim uma necessidade quase compulsiva, depois de frequentar o Seminário promovido pela APEM e ministrado pelo próprio Prof. Gordon nos dias 3 e 4 de Novembro de 1995.

  16. Andrew Johnson National Historic Site Tract and Boundary Data

    Data.gov (United States)

    National Park Service, Department of the Interior — These ESRI shape files are of National Park Service tract and boundary data that was created by the Land Resources Division. Tracts are numbered and created by the...

  17. Tensions at EU-Russia Summit / Andrew Rettman

    Index Scriptorium Estoniae

    Rettman, Andrew

    2009-01-01

    Enne Euroopa Liidu-Venemaa tippkohtumist Kaug-Idas ütles Tšehhi president Vaclav Klaus päevalehes Lidove Noviny, et ta ei näe Venemaas ohtu, vaid suurt, tugevat ja ambitsioonikat riiki, millele tuleb rohkem tähelepanu pöörata kui riikidele nagu Eesti ja Leedu. President Toomas Hendrik Ilves väljendas üllatust, et selliste kahetsusväärsete sõnadega - mis jagavad Euroopa riigid olulisteks ja ebaolulisteks - esines just tšehh

  18. USA hiiglane GE Healthcare korraldab meditsiinis revolutsiooni / Andrew Jack

    Index Scriptorium Estoniae

    Jack, Andrew

    2006-01-01

    General Electricu tütarettevõte GE Healthcare võttis üle Briti diagnostika- ja bioteaduse uurimisfirma Amersham, firma strateegia tuum on võimsa skaneerimistehnoloogia ja meditsiinilise diagnostika üksteisele lähendamine. Lisa: Aeg sorteerida andmeid infotehnoloogia abil

  19. "On the margins": A dialogue with Andrew Greeley.

    Science.gov (United States)

    Moss, D M

    1990-12-01

    This dialogue is between two priests who share common interests from different perspectives. One is an Episcopalian and a psychoanalytic psychotherapist. The other is a Roman Catholic and a sociologist widely known for his controversial novels and political commentaries. Their conversation primarily focuses on the latter's ministry-especially his investigations into paranormal experiences and his use of fiction as a homiletical avenue. They also discuss: Christian atheism; the Resurrection as a metaphor; Real Presence and liturgical sensibility; contemporary ecumenical trends; celibacy and tenures of active ministry; sexual equality and population control; religious addiction; and examples of the mythic impact of cinema. PMID:24277223

  20. Building Points - MO 2014 Andrew Structure Points (SHP)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — Staff at the Geographic Resources Center placed attributed points on all roofed structures visible at a scale of 1:2000 using MSDIS-DOQQ 2008 2-foot aerial imagery...

  1. Speaking Unassisted: Comments on a Paper by Andrews et al.

    Science.gov (United States)

    Wingate, Marcel E.

    1983-01-01

    In a reply to a review of replicated findings on stuttering, the author adds 14 points concerning symptoms, prevalence, incidence, stutterer-nonstutterer differences, and variability of stuttering. He takes exception to the review's statements on treatment and theories of stuttering. (CL)

  2. DIGITAL FLOOD INSURANCE RATE MAP DATABASE, ANDREW COUNTY, MISSOURI, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...

  3. Verification procedures to ensure consistent energy measurements / Luke Andrew Meijsen

    OpenAIRE

    Meijsen, Luke Andrew

    2014-01-01

    The majority of energy conservation measures (ECM) implemented by South African Energy Service Companies (ESCOs), are funded by the Eskom Demand Side Management (DSM) initiative. In 2013 Eskom reported a total DSM savings of 595 MW. To measure this effect power usage data needs to be recorded. A slight variance with the accuracy of measurement will however have a significant impact on the reported savings. It is therefore of critical importance to ensure consistent energy measurements through...

  4. SINK OR SWIM? DEBT REVIEW'S AMBIVALENT "LIFELINE" ---- A SECOND SEQUEL TO "… A TALE OF TWO JUDGMENTS" NEDBANK V ANDREWS (240/2011 2011 ZAECPEHC 29 (10 May 2011; FIRSTRAND BANK LTD V EVANS 2011 4 SA 597 (KZD AND FIRSTRAND BANK LTD V JANSE VAN RENSBURG 2012 2 All SA 186 (ECP

    Directory of Open Access Journals (Sweden)

    L Steyn

    2012-11-01

    Full Text Available The interface between the National Credit Act 34 of 2005 and the Insolvency Act 24 of 1936 has been the object of our courts' attention in a number of recent cases including Ex parte Ford and Two Similar Cases 2009 3 SA 376 (WCC, Investec Bank Ltd v Mutemeri 2010 1 SA 265 (GSJ, Naidoo v ABSA Bank Ltd 2010 4 SA 597 (SCA and, more recently, Nedbank v Andrews (240/2011 2011 ZAECPEHC 29 (10 May 2011, FirstRand Bank Ltd v Evans 2011 4 597 (KZD and FirstRand Bank Ltd v Janse van Rensburg 2012 2 All SA 186 (ECP. The question raised in all of the three most recent cases was whether or not a debtor's application for debt review in terms of the National Credit Act constitutes an "act of insolvency" in terms of section 8 of the Insolvency Act, upon which a creditor may rely in an application for the compulsory sequestration of the debtor's estate. If it does, it would mean that by resorting to the debt relief measures provided by the National Credit Act a debtor commits the very act on which a creditor may base an application for a sequestration order which, if granted, will render the debtor's estate insolvent and bring about the liquidation of his assets. From the debtor's perspective, this is probably precisely the situation that he seeks to avert by applying for debt review. Further, sequestration would frustrate the stated purpose of the National Credit Act, which is that debtors should take responsibility for their debts by satisfying them in full. Concurrent creditors might also ultimately receive a dividend which falls far short of what is due to them. The question of whether a debtor's resorting to debt review may or should be the very act that triggers his estate's sequestration and its attendant consequences is an important issue, the treatment of which impacts significantly on the efficacy of the South African consumer debt relief system. This article analyses the most recent judgments and considers whether or not statutory regulation of the

  5. Andrew Smith: Lääne ja Aasia firmad reageerivad kriisile erinevalt / Andrew Smith ; intervjueerinud Mikk Salu

    Index Scriptorium Estoniae

    Smith, Andrew

    2009-01-01

    Intervjuu KPMG peaökonomistiga majanduslangusest Euroopas, Eesti ja Suurbritannia käitumisest kriisi ajal, lääneriikide ja Aasia erinevast reageeringust majanduskriisile, Suurbritannia mitteliitumisest euroga, peaminister Gordon Brownist

  6. OPTIMASI PROSES MASERASI VANILI (Vanilla planifolia Andrews) HASIL MODIFIKASI PROSES KURING [Maceration Process Optimation of Vanili (Vanilla Planifolia Andrews) from Modified Curing

    OpenAIRE

    Ika Mariska3); Melawati2); Meika S. Rusli1); Dwi Setyaningsih1)

    2006-01-01

    Modified cured vanilla was processed to vanilla extract by maceration method. The aim of this research were to optimize the method of maceration, type of vanilla bean with highest vanillin content, extraction solvent composition,and other variables that could optimize the vanillin content and characterize the extract from half dried cured vanilla. The optimation used response surface method with 22 factorial and 23 factorial. One step of maceration could extract vanillin (average 2.3 g/l) muc...

  7. Special Interview With Andrew Hale, a keyboard player of 'Sade' Band%特别采记Andrew Hale--Sade乐队键盘手

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ 对于"rock"这个词,我们也许可以理解为如岩石般"毫不动摇而始终存在于某处"的一种东西 Sade在沉寂了一段时间之后,终于推出了一张新的专辑.那么,为什么这张专辑花费了这么长的时间呢?

  8. Ungari uuemad filmid Tartus ja Tallinnas / Viia-Kadi Raudalainen

    Index Scriptorium Estoniae

    Raudalainen, Viia-Kadi

    2003-01-01

    Ungari instituut esitles Tallinnas ja Tartus viit uuemat Ungari filmi - Zoltan Kamondi "Kiusatused", Gabor Dettre "Pilv Gangese kohal", Peter Bacso "Kustuv sigaretikoni", Agnes Incze "I love Budapest"

  9. Abitane diterpenoids isolation from Plectranthus barbatus; Diterpenos tipo abietano isolados de Plectranthus barbatus Andrews

    Energy Technology Data Exchange (ETDEWEB)

    Albuquerque, Roberto L. de; Kentopff, Marta R.; Machado, Maria Iracema L.; Silva, Maria Goretti V.; Matos, Francisco Jose de A. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Quimica Analitica e Fisico-Quimica; Morais, Selene M. [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil); Braz-Filho, Raimundo [Universidade Estadual do Norte Fluminense (UENF), Campos dos Goytacazes, RJ (Brazil). Centro de Ciencia e Tecnologia. Setor de Quimica de Produtos Naturais]. E-mail: braz@uenf.br

    2007-07-01

    Plectranthus barbatus is largely used in the Northeast region of Brazil by the local population for treatment of digestive problems as substitute of boldo (Pneumus boldus). Phytochemical analysis of the leaf extracts of Plectranthus barbatus (Labiatae) cultivated in this region yielded two abietane diterpenoids, cyclobubatusin (1) and barbatusin (2) and a new one named 7beta-acetyl-12-deacetoxycyclobutatusin (3). The structures of the isolated compounds were established by spectral analysis, using mainly mass spectra and {sup 1}H and {sup 13}CNMR (1D and 2D). These procedures permitted the assignment of all chemical shifts in the diterpenoids. (author)

  10. Diterpenos tipo abietano isolados de Plectranthus barbatus Andrews Abitane diterpenoids isolation from Plectranthus barbatus

    Directory of Open Access Journals (Sweden)

    Roberto L. de Albuquerque

    2007-01-01

    Full Text Available Plectranthus barbatus is largely used in the Northeast region of Brazil by the local population for treatment of digestive problems as substitute of boldo (Pneumus boldus. Phytochemical analysis of the leaf extracts of Plectranthus barbatus (Labiatae cultivated in this region yielded two abietane diterpenoids, cyclobubatusin (1 and barbatusin (2 and a new one named 7beta-acetyl-12-deacetoxycyclobutatusin (3. The structures of the isolated compounds were established by spectral analysis, using mainly mass spectra and ¹H and 13CNMR (1D and 2D. These procedures permitted the assignment of all chemical shifts in the diterpenoids.

  11. Surprising similarities: Recent monetary regimes of small economies / Andrew K. Rose

    Index Scriptorium Estoniae

    Rose, Andrew K.

    2014-01-01

    Artikkel keskendub väikese majandusega riikide (sh Eesti) rahapoliitikale enne ja pärast ülemaailmset finantskriisi. Kokku analüüsitakse 170 riigi näitajaid aastatest 2007-2012 ning jõutakse järeldusele, et riikide rahapoliitika mõju makromajanduslikele ja finantstagajärgedele on tegelikult üllatavalt väike

  12. A systems engineering approach for the deployment of an atmospheric monitoring station / Andrew Derick Venter

    OpenAIRE

    Venter, Andrew Derick

    2015-01-01

    Atmospheric monitoring is a vital part of environmental management. Monitoring temporal changes in atmospheric pollution on a local, regional and global scale is important in order to mitigate adverse effects on health and the environment. Currently there is general agreement that atmospheric pollution should be monitored, however, less emphasis is often placed on what should be achieved and the specific monitoring that should be included. Atmospheric pollution monitoring is often hampered by...

  13. Detecting Outliers in Marathon Data by Means of the Andrews Plot

    Science.gov (United States)

    Stehlík, Milan; Wald, Helmut; Bielik, Viktor; Petrovič, Juraj

    2011-09-01

    For an optimal race performance, it is important, that the runner keeps steady pace during most of the time of the competition. First time runners or athletes without many competitions often experience an "blow out" after a few kilometers of the race. This could happen, because of strong emotional experiences or low control of running intensity. Competition pace of half marathon of the middle level recreational athletes is approximately 10 sec quicker than their training pace. If an athlete runs the first third of race (7 km) at a pace that is 20 sec quicker than is his capacity (trainability), he would experience an "blow out" in the last third of the race. This would be reflected by reducing the running intensity and inability to keep steady pace in the last kilometers of the race and in the final time as well. In sports science, there are many diagnostic methods ([3], [2], [6]) that are used for prediction of optimal race pace tempo and final time. Otherwise there is lacking practical evidence of diagnostics methods and its use in the field (competition, race). One of the conditions that needs to be carried out is that athletes have not only similar final times, but it is important that they keep constant pace as much as possible during whole race. For this reason it is very important to find outliers. Our experimental group consisted of 20 recreational trained athletes (mean age 32,6 years±8,9). Before the race the athletes were instructed to run on the basis of their subjective feeling and previous experience. The data (running pace of each kilometer, average and maximal heart rate of each kilometer) were collected by GPS-enabled personal trainer Forerunner 305.

  14. Pepsi kerkib Coca-Cola varjust / Andrew Ward ; tõlk. Erik Aru

    Index Scriptorium Estoniae

    Ward, Andrew

    2005-01-01

    Firma PepsiCo edust viimastel aastatel. Autori sõnul on suurim firma ees seisev väljakutse Põhja-Ameerika ja Lääne-Euroopa tarbija üha kasvav mure ülekaalu pärast, firma juht Steve Reinemund näeb selles firmale pigem võimalusi kui ohtu. Firma on USA-s kasutusele võtnud märgisüsteemi, et näidata, millised tooted on tervislikumad. Diagrammid: Kasumiallikad; Turuliidrid. Lisa: Vastasseis

  15. 75 FR 10457 - Andrew Pickens Ranger District; South Carolina; AP Loblolly Pine Removal and Restoration Project

    Science.gov (United States)

    2010-03-08

    ... density of trees in these stands range from sparse to a dense stocking basal area of 160 square feet per... naturally growing desirable native shortleaf pine, pitch pine, oak, American chestnut and hickory... (BA) of 30-40 ft\\2\\/acre. All oak, hickory, and shortleaf pine would be left where the BA is...

  16. Estonia still keen on single currency / Andrew Ward, Peter Spiegel, Joshua Chaffin

    Index Scriptorium Estoniae

    Ward, Andrew

    2010-01-01

    Eesti üleminekust eurole. President Toomas Hendrik Ilvese sõnul kõnnib Eesti teiste väiksemate põhjamaiste riikide jälgedes. Tema sõnul on väikese riigi ainus võimalus ellujäämiseks reeglite järgimine ning nõudmine, et ka teised seda teeksid

  17. Seize the Day:Awareness of Time in You, Andrew Marvell

    Institute of Scientific and Technical Information of China (English)

    龚园媛

    2013-01-01

    Based on the alternation of scenes, awareness of time is analyzed from three perspectives. The common one is to be aware of time flow in the change of scenes. The outstanding ones include the psychological and philosophical perception of time. Being aware of the temporality of life, the individual need to take an open and unforced attitude toward death —“carpe diem!”.

  18. e-Textbooks Usage by Students at Andrews University: A Study of Attitudes, Perceptions, and Behaviors

    OpenAIRE

    Marques, Silas

    2012-01-01

    Although e-books have been incorporated into the academic library’s collection for over a decade now, it has not been, until today, without question. It is still, as the literature reveals, a controversial topic for librarians, publishers, and users around the globe. Although many researches indicate that patrons still prefer the printed format over the electronic version, the tipping point seems to be reaching us earlier then many might think. The growing availability of e-books to users has...

  19. Kas sinu firma on oskuslikult üles ehitatud? / Michael Goold, Andrew Campbell

    Index Scriptorium Estoniae

    Goold, Michael

    2002-01-01

    Londoni Ashridge Strategic Management Centre-i direktorid kirjeldavad üheksat testi, millest juhil ettevõtte struktuuri loomisel kasu on - turu eeliste, emafirma eeliste, inimeste, teostatavuse, subkultuuride, raskete lülide, üleliigse hierarhia, vastutuse ning paindlikkuse test. Lisad: Kuidas emafirmad väärtusi loovad; Kuidas üksused suhtlevad; Probleemide kõrvaldamine

  20. Kashechewan First Nation St. Andrews School oil remediation project: a case study

    International Nuclear Information System (INIS)

    Case study of the remediation of an oil seepage into a school building in a First Nations community, on the shores of the Albany River, in the James Bay region of northern Ontario, was discussed. The spill has created significant health hazards as manifested by nausea, vomiting and severe headaches among both students and teachers. Investigation determined that the O-ring fittings of the pipe joints, used during the installation of the oil pipeline linking the above-ground oil tank farm and the school building, were unsuitable for the intended use. They subsequently failed, allowing heating oil to leak from the pipes along the building and migrating into the gymnasium. A variety of remediation alternatives have been considered. The remedial actions taken include: in-situ containment using an impermeable membrane with passive venting and continuous air quality monitoring for the area below the recreation complex, excavation to create draining trenches, replacement of contaminated soil around the building and from the building to the river, and installation of a clay collar and oil/water separator in each drain line. The work was completed in January 1996. To date, all systems function satisfactorily

  1. BBC rajab üleilmset internetibrändi / Andrew Edgecliffe-Johnson

    Index Scriptorium Estoniae

    Edgecliffe-Johnson, Andrew

    2006-01-01

    Suurbritannias on riik mitte ainult toetanud, vaid ka nõudnud BBC kujunemist Suurbritannia tugevaimaks kodumaiseks internetibrändiks. BBC võrguväljaande kasvust. Tabel: Maailma populaarseimad uudisteportaalid jaanuaris 2006

  2. Fremantle Media ekspordib seriaale kogu maailma / Andrew Edgecliffe-Johnson ; tõlk. Erik Aru

    Index Scriptorium Estoniae

    Edgecliffe-Johnson, Andrew

    2007-01-01

    Teleproduktsioonifirmast Fremantle Media. Saateformaatide eksportimisel saavutatud edu teeb firmast õpikunäite, kuidas viia tooteid üle maailma, muutes neid just piisavalt, et sobida kohaliku maitsega, jäädes samas truuks algideele. Edu ei vaja tõlget

  3. Graafika, graafika! / Jan Kenneth Weckman, Sue Gollifer, Andrew Atkinson...[jt.] ; interv. Kaisa Puustak, Ando Pajus

    Index Scriptorium Estoniae

    2001-01-01

    II rahvusvahelisest vabagraafika konverentsist "Impact" Helsingis 29. VIII-2. IX. Tutvuti ka Tallinnas eesti graafikute loominguga, Tallinna Graafikakoja ja Tallinna XII graafikatriennaaliga. Eesti ja euroopa graafikast, Tallinna graafikatriennaalist

  4. Kuus turundusüksuse tüüpi / Edward Landry, Andrew Tipping, Brodie Dixon

    Index Scriptorium Estoniae

    Landry, Edward

    2005-01-01

    Konsultatsioonifirma Booz Allen Hamilton ja Association of National Advertisers välja töötatud turundusüksuste tüüpidest ja asjaoludest, mida peaks arvesse võtma firma olemasoleva turundusüksuse välja selgitamiseks

  5. 78 FR 78349 - Andrew Peklo III; Notice of Availability of Draft Environmental Assessment

    Science.gov (United States)

    2013-12-26

    ... Commission's (Commission) regulations, 18 CFR Part 380 (Order No. 486, 52 FR 47897), the Office of Energy....gov/docs-filing/efiling.asp . Commenters can submit brief comments up to 6,000 characters,...

  6. Localization of β‐d‐Glucosidase Activity and Glucovanillin in Vanilla Bean (Vanilla planifolia Andrews)

    OpenAIRE

    ODOUX, E.; ESCOUTE, J.; VERDEIL, J. ‐L.; BRILLOUET, J. ‐M.

    2003-01-01

    The morphology, anatomy and histology of mature green vanilla beans were examined by light and transmission electron microscopy. Beans have a triangular cross‐section with a central cavity containing seeds. Each angle is lined with tubular cells, or papillae, while the cavity sides consist of placental laminae. The epicarp and endocarp are formed by one or two layers of very small cells, while the mesocarp contains large, highly vacuolarized cells, the cytoplasm being restricted to a thin lay...

  7. Introduction: Andrew Thomson and the Centre for Metalloprotein Spectroscopy and Biology at the University of East Anglia.

    Science.gov (United States)

    Wilson, Michael T

    2008-12-01

    The present article briefly relates the early history and growth of the Centre for Metalloprotein Spectroscopy and Biology at UEA (University of East Anglia) under the joint directorship of A.J. Thomson and C. Greenwood, and charts the exceptional success that this centre has had in fostering bioinorganic chemistry in the U.K. and the impact that it has had internationally. PMID:19021505

  8. Self-Esteem and Academic Performance of 4th Graders in two Elementary Schools in Kingston and St. Andrew, Jamaica

    OpenAIRE

    L.K. Colquhoun; P.A. Bourne

    2012-01-01

    In 2005, 62% of pupils who sat the 4th grade literacy and numeracy examination attained mastery, which increased to 67% in 2009 from 50% in 2001. No study has examined the role of self-esteem on the academic performance of Jamaican 4th graders. The main objectives were, 1) evaluate the influence of selfesteem on academic performance, 2) determine factors that account for changes in self-esteem, and 3) examine factors of academic performance. The sample for this research was one hundred and tw...

  9. Self-Esteem and Academic Performance of 4th Graders in two Elementary Schools in Kingston and St. Andrew, Jamaica

    Directory of Open Access Journals (Sweden)

    L.K. Colquhoun

    2012-02-01

    Full Text Available In 2005, 62% of pupils who sat the 4th grade literacy and numeracy examination attained mastery, which increased to 67% in 2009 from 50% in 2001. No study has examined the role of self-esteem on the academic performance of Jamaican 4th graders. The main objectives were, 1 evaluate the influence of selfesteem on academic performance, 2 determine factors that account for changes in self-esteem, and 3 examine factors of academic performance. The sample for this research was one hundred and twenty (120 respondents. Multiple repression techniques were conducted to identify variables explaining performance, with self-esteem being among the variables. A p-value ≤0.10 was used to indicate statistical significance. There is a positive correlation between self-esteem and academic performance (rs = 0.611, p<0.0001. Four variables emerged as statistical significant factors of self-esteem-academic performance, age of respondents, gender and parental behaviour, which explain 64.4% of the variability in self-esteem. Boys had a lower self-esteem (b = -3.911 than their female counterparts. Self-esteem is the most influential factor that account for academic performance. Of the nine variables used, four emerged as explaining academic performance, which explained 73.6% of the variability in academic performance. The emerging findings and knowledge gleaned from this work present a critical guide and a framework for policy practitioners to implement measure that can effectively address low performance among 4th graders.

  10. "Show Me Where You Study!"--An Interactive Project between German Language Students in Nottingham and St Andrews

    Science.gov (United States)

    Hartung, Insa; Reisenleutner, Sandra

    2016-01-01

    Interactive projects among students of a Common European Framework of Reference for languages (CEFR) A1+/A2 level seem difficult to set up due to the limited language repertoire of the students. Thus, our aim was to take up the challenge and start a project with the objective of applying their language skills. We chose a collaborative approach to…

  11. Assessing the skill of hydrology models at simulating the water cycle in the HJ Andrews LTER: Assumptions, strengths and weaknesses

    Science.gov (United States)

    Simulated impacts of climate on hydrology can vary greatly as a function of the scale of the input data, model assumptions, and model structure. Four models are commonly used to simulate streamflow in model assumptions, and model structure. Four models are commonly used to simu...

  12. 77 FR 15600 - Special Local Regulation; Emerald Coast Super Boat Grand Prix; Saint Andrew Bay; Panama City, FL

    Science.gov (United States)

    2012-03-16

    ... SECURITY Coast Guard 33 CFR Part 100 RIN 1625-AA08 Special Local Regulation; Emerald Coast Super Boat Grand... crews, vessels, and persons on navigable waters during the Emerald Coast Super Boat Grand Prix high... the Emerald Coast Super Boat Grand Prix high speed boat races. Basis and Purpose On January 31,...

  13. A Study of the modern Scottish Higher Education Based on the Case of University of St.Andrews

    Institute of Scientific and Technical Information of China (English)

    王佳妮

    2014-01-01

    <正>1.Introduction The Scottish higher educational system is one of the oldest in the world,and it is now still changing.The status of higher education now in the Scotland is the product of the generations of the thoughtful reflection,experimentation and evaluation.Therefore,it is not so much different in quality and reputation compared with England,Welsh and Northern Ireland.Scotland’s universities are at the forefront of teaching and research play a

  14. 78 FR 27126 - East Bay, St. Andrews Bay and the Gulf of Mexico at Tyndall Air Force Base, Florida; Restricted...

    Science.gov (United States)

    2013-05-09

    ... Gulf of Mexico and Apalachicola Bay south of Apalachicola, Fla., Drone Recovery Area, Tyndall Air Force... at Tyndall Air Force Base, Florida; Restricted Areas AGENCY: U.S. Army Corps of Engineers, DoD... establishing six new restricted areas along the Tyndall Air Force Base (AFB) facility shoreline. Tyndall AFB...

  15. AcEST: BP914589 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000060_F12 590 Adiantum capillus-veneris mRNA. clone: YMU001_000060_F12. BP914589 - Show ... IPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFE KLKAL 492 Query: 316 XXXXXXXXXXNVCSPFEVQSNACGDCLELF ... (65%) Frame = +2 Query: 242 ICCPLHDLTKKNVKYSWTAKVQEAFE ... 319 + PL+ LTK++ ++W + Q AFE ... Sbjct: 438 LAAPLYALTKE ... STPFTWQTEHQLAFE ... 463 >sp|P31792|POL_FENV1 Pol polyprotein (Fragment ... (65%) Frame = +2 Query: 242 ICCPLHDLTKKNVKYSWTAKVQEAFE ... 319 + PL+ LTK++ ++W K Q AFE ... Sbjct: 295 LAAPLYALTKE ...

  16. Society News: RAS Awards 2012; Prof. Andy Fabian; Prof. John C Brown; Prof. Andrew Fazakerley; Dr. Mike Irwin; Joss Bland-Hawthorn

    Science.gov (United States)

    2012-02-01

    Each year the RAS recognizes outstanding achievement in astronomy and geophysics by the award of medals and prizes. Candidates are nominated by Fellows and the awards made by a committee of Fellows, ensuring that these scientists have earned the respect and admiration of their peers in the research community.

  17. À propos de (Re)inventing the Internet : Critical Case Studies, par Andrew Feenberg et Norm Friesen (éd.)

    OpenAIRE

    Laboissière, Anna-Katharina

    2014-01-01

    Depuis sa toute première incarnation sous la forme du réseau Arpanet, l’internet est devenu le lieu de débats intenses et fortement polarisés portant sur la signification et la valeur, les dangers et les possibilités de son utilisation. Des visions utopiques initiales de l’internet comme source d’une communauté globale plus égalitaire et engagée aux évaluations plus pessimistes désignant l’internet comme pure extension du capitalisme néolibéral, les positions adoptées dans ce débat tendent so...

  18. Testing the Andrews Framework of Strategy Formulation and Implementation: Case Study of the University of Cape Coast Digital Library in Ghana

    OpenAIRE

    Nesba Yaa Anima Adzobu

    2014-01-01

    This paper investigates how strategy formulation and implementation processes used by the University of Cape Coast (UCC) in building its digital collections compare with the Andrew’s strategic formulation and implementation theoretical framework. Theory-testing case study methodology was used. The data collection instruments were the key informant interview technique and document reviews. During the formulation phase, two aspects (resources and aspirations of senior management) were emergent....

  19. Testing the Andrews Framework of Strategy Formulation and Implementation: Case Study of the University of Cape Coast Digital Library in Ghana

    Directory of Open Access Journals (Sweden)

    Nesba Yaa Anima Adzobu

    2014-12-01

    Full Text Available This paper investigates how strategy formulation and implementation processes used by the University of Cape Coast (UCC in building its digital collections compare with the Andrew’s strategic formulation and implementation theoretical framework. Theory-testing case study methodology was used. The data collection instruments were the key informant interview technique and document reviews. During the formulation phase, two aspects (resources and aspirations of senior management were emergent. During the implementation phase, five aspects (achieving results, processes and behaviour, standards, motivation, personal were emergent. All other elements of building the UCC digital collections were planned during both the formulation and implementation phases. Although the emphasis on students and learning is laudable and apt, there seems to be lack of focus on research support beyond digital collection building, despite the fact that research excellence is one of the UCC’s key priorities. Opportunities exist for improving feedback mechanisms between the users, digital library staff and the university management; and inclusion of social media tools in the digital library project. Since only the experience of a single institution of higher learning is considered, it cannot be definitively stated that strategy formulation and implementation will be similar in every institutional context. However, the results provide a basis for academic digital libraries to draw lessons from this case. In African public universities, there is little earlier research on strategy formulation and implementation in digital library management. Strategy formulation and implementation is a critical issue for higher education academic libraries especially in developing countries like Ghana, due to limited financial resources and the rapid change in the information environment during the last several decades.

  20. Sombra artificial y aplicación de thidiazurón en el crecimiento y fisiología de la vainilla (Vanilla planifolia Andrews).

    OpenAIRE

    Olivares Soto, Héctor Miguel

    2011-01-01

    El objetivo de esta investigación es documentar el efecto de diferentes niveles de sombra artificial y la aplicación de TDZ sobre el número y crecimiento de brotes laterales, en la producción y distribución de la materia seca en la planta de vainilla así como el efecto en parámetros fisiológicos del intercambio de gases. Para ello, se trabajó con esquejes de vainilla, con ocho yemas. Los niveles de sombra fueron 30, 50 y 70 % y 0, 500 y 1000 mg-litro-1 de Thidiazurón. Se midió longitud y...

  1. Economic strain and perceptions of social cohesion in Europe: does institutional trust matter? / Rhys Andrews, Sebastian Jilke, Steven van de Walle

    Index Scriptorium Estoniae

    Andrews, Rhys

    2014-01-01

    Artikkel analüüsib, kuidas eurooplased tajuvad sotsiaalset ühtekuuluvust, võttes sealjuures arvesse majandussurvet ja institutsionaalset usaldust. Aluseks on Eurobaromeetri uuring vaesusest ja sotsiaalsest tõrjutusest (2010), mis haaras 27 liikmesriiki (sh Eesti)

  2. Environmental magnetic implications of greigite (Fe3S4) formation in a 3 m.y. lake sediment record from Butte Valley, northern California Andrew

    Science.gov (United States)

    Roberts, P.; Reynolds, R.L.; Verosub, K.L.; Adam, D.P.

    1996-01-01

    Authigenic greigite (Fe3S4) has been identified in several horizons of lake beds in a 102-m core from Butte Valley, northern California, using mineral magnetic methods and x-ray diffraction analysis. The presence of greigite has several implications for the paleoenvironmental record from Butte Valley. First, its occurrence in 2.5 - 3.0 Ma strata confirms that greigite can persist in the geological record for long periods of time. Second, the detrital mineral magnetic record may be partially obscured by the presence of authigenic greigite and care must be taken in interpreting magnetic variations in the greigite-bearing zones as paleoclimate proxies. Third, differences in the timing of remanence acquisition for authigenic and detrital phases may compromise studies of high-frequency geomagnetic field variations. Fourth, greigite may also be significant as a paleoenvironmental indicator of lake and sediment chemistry. The magnetic detection of greigite may therefore provide important information about palcolimnological conditions. Copyright 1996 by the American Geophysical Union.

  3. Investing in Canada's energy future : getting the framework right : submission to the Council of Energy Ministers, St. Andrews, New Brunswick, September 20, 2005

    International Nuclear Information System (INIS)

    The Energy Dialogue Group (EDG) was created in 2004 to advance the issues identified at the 2003 Council of Energy Ministers (CEM) meeting. The EDG includes 18 member associations who joined forces to advance energy efficiency, public understanding and smart regulation and technology. This paper reviewed the need for developing an Energy Framework in Canada and presented a status update. In particular, it focused on the fact that Canada has many programs to meet its international obligations to climate change, but it has no policy. At the previous CEM meeting, the EDG addressed the challenges facing energy management and encouraged Canadians to look for better, more efficient ways to develop energy resources, expand the delivery infrastructure and develop better ways of using energy services. The EDG also suggested that Canadians find ways to adapt to the new, higher price reality by maximizing energy choices, accelerating improvements in energy efficiency and ensuring that vulnerable consumers are not left behind. Since then, the speed at which energy resources and the associated infrastructure have been developed, continues to lag behind demand growth. Prices have increased for all energy forms. The EDG has suggested that Canada must act on its international commitments to the Kyoto Protocol by investing in new supply capacity, improvements in energy efficiency and investment in the longer-term future. In 2004, the International Energy Agency (IEA) stated that the only viable approach in addressing Canada's important energy challenges is that of intensive dialogue to achieve a national consensus on the goals of energy policies. EDG wants all levels of government in Canada to articulate their energy policies to include a wide range of issues such as the role of energy markets and prices in determining investor and consumer behaviour; committing to long-term environmental goals such as reducing GHG emissions; and explaining the need for public acceptance of new energy supply investments

  4. Sports Law by Simon Gardiner, Mark James, John O’L eary and Roger Welch (with Ian Blackshaw, Simon Boyes and Andrew Caiger)

    OpenAIRE

    Anderson, Dr Jack

    2006-01-01

    The third edition of this market-leading textbook on sports law remains as determinedly informed by a socio-legal approach as previous editions. Outwardly, the key developments in sports law encapsulated by this latest volume are the impact of the Human Rights Act 1998 on UK sport, the repercussions of the European Court of Justice’s decision in Deutscher Handballbund eV v Maros Kolpak (Case C-438/00) [2003] ECR I-4135 and the expansion of the World Anti-Doping Agency. Those issues reflect th...

  5. ANDREW P. DERICK, Historia de la poesía española del siglo XX. Desde la modernidad hasta el presente. Madrid, Gredos, 1994

    OpenAIRE

    Ruedas de la Serna, Jorge

    2013-01-01

    Producto de casi medio siglo de actividad crítica y docente del autor, distinguido hispanista profesor de la Universidad de Kansas, este libra constituye una de las más promisorias contribuciones teórico-prácticas al intenso debate actual sobre la historia literaria. Desde los modernistas españoles (1915-1928) basta los "novísimos" (1966-1980) y los "postmodernos" (1978-1990), se nos ofrece un caleidoscopio, a través del cual gradualmente se acentúan rasgos estéticos predominantes que, confor...

  6. Disainikaart : Ungari

    Index Scriptorium Estoniae

    2008-01-01

    Ungari disaini esindavad Ernö Rubiku kuubik, Ungari vabadussamba autor Zsigmond Kisfaludi Strobl, disainerid Andras Göczey, Gabor Szilasi, Zoltan Lonovics ja Kormos Balint, orgaanilise arhitektuuri esindaja Imre Makovecz, mootorrattamargi Danuvia looja Biczo Levente, moedisainer Mester D̤ra ning ehtekunstnik Gera Noémi

  7. Keila vabrikuala ideevõistluse võitsid noored Leedu arhitektid / Piret Peensoo

    Index Scriptorium Estoniae

    Peensoo, Piret

    2007-01-01

    Keila endise riidevabriku kinnistu planeerimise võistluse võitsid Leedu arhitektid Andrius Uogintas, Margarita Podagelyte ja Matas Cirtautas ("Active edge"), teise koha sai PiKaSch Architecture Studio Zoltan Schrammeli juhtimisel Ungarist ("Keila 14") ja kolmanda koha Hannes Koppel ja Sander Aas ("Kegel") arhitektuuribüroost Asum Arhitektid

  8. Kodaly, Literacy, and the Brain: Preparing Young Music Students to Read Pitch on the Staff

    Science.gov (United States)

    Jacobi, Bonnie S.

    2012-01-01

    The principles of Hungarian music educator Zoltan Kodaly can be particularly useful not only in teaching children how to read music notation but also in creating curiosity and enjoyment for reading music. Many of Kodaly's ideas pertaining to music literacy have been echoed by educators such as Jerome Bruner and Edwin Gordon, as well as current…

  9. Dicty_cDB: CHE433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE433 (Link to dictyBase) - - - Contig-U14976-1 CHE433P (Link to Original ... sticklw*kcnpfyn*ilsrsw*l*fif*ickssy*in**sr*r*t*kyc*ngs *fck*i igs**kfkcy*yn*vingk--- ---LFQVVXXHLDPKYSVSIY ... FENV Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CHE433 (CHE433 ... 009. 4. 4 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AE017197 |AE ... 9.21 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value CP001193_372( ...

  10. Letter to the Editor Re: Andrew Turner, Emily R. Kearl, Kevin R. Solman Lead and other toxic metals in playground paints from South West England Science of the Total Environment 544 (2016) 460-466.

    Science.gov (United States)

    Gottesfeld, Perry; Jacobs, David E

    2016-08-15

    Turner's paper emphasizes "oral bioaccessibility" instead of focusing solely on total lead content. There is no evidence that solubility testing for lead levels in paint correlates with absorption or blood lead levels in exposed children. There are many considerations in determining exposure hazards to paint that are not evaluated in assessing solubility. Although we strongly support the conclusions and recommendations of the study, we are concerned that by reporting "oral bioaccessibility" others will focus on solubility in developing regulatory standards for lead levels in paint or in conducting exposure assessments. Standards for lead in paint should continue to be based on total lead content, not "oral bioaccessibility." PMID:27260620

  11. Improving the Load Balancing Performance of Vlasiator

    CERN Document Server

    Turk, Ata; Demirci, G Vehbi; von Alfthan, Sebastian; Honkonen, Ilja

    2011-01-01

    This whitepaper describes the load-balancing performance issues that are observed and tackled during the petascaling of the Vlasiator codes. Vlasiator is a Vlasov-hybrid simulation code developed in Finnish Meteorological Institute (FMI). Vlasiator models the communications associated with the spatial grid operated on as a hypergraph and partitions the grid using the parallel hypergraph partitioning scheme (PHG) of the Zoltan partitioning framework. The result of partitioning determines the distribution of grid cells to processors. It is observed that the partitioning phase takes a substantial percentage of the overall computation time. Alternative (graph-partitioning-based) schemes that perform almost as well as the hypergraph partitioning scheme and that require less preprocessing overhead and better balance are proposed and investigated. A comparison in terms of effect on running time, preprocessing overhead and load-balancing quality of Zoltan's PHG, ParMeTiS, and PT-SCOTCH are presented. Test results on ...

  12. LDRD report : parallel repartitioning for optimal solver performance.

    Energy Technology Data Exchange (ETDEWEB)

    Heaphy, Robert; Devine, Karen Dragon; Preis, Robert (University of Paderborn, Paderborn, Germany); Hendrickson, Bruce Alan; Heroux, Michael Allen; Boman, Erik Gunnar

    2004-02-01

    We have developed infrastructure, utilities and partitioning methods to improve data partitioning in linear solvers and preconditioners. Our efforts included incorporation of data repartitioning capabilities from the Zoltan toolkit into the Trilinos solver framework, (allowing dynamic repartitioning of Trilinos matrices); implementation of efficient distributed data directories and unstructured communication utilities in Zoltan and Trilinos; development of a new multi-constraint geometric partitioning algorithm (which can generate one decomposition that is good with respect to multiple criteria); and research into hypergraph partitioning algorithms (which provide up to 56% reduction of communication volume compared to graph partitioning for a number of emerging applications). This report includes descriptions of the infrastructure and algorithms developed, along with results demonstrating the effectiveness of our approaches.

  13. New technology update: femtosecond laser in cataract surgery

    OpenAIRE

    Nagy ZZ

    2014-01-01

    Zoltan Z NagyDepartment of Ophthalmology, Semmelweis University, Budapest, HungaryAbstract: Femtosecond lasers represent a new frontier in cataract surgery. Since their ­introduction and first human treatment in 2008, a lot of new developments have been achieved. In this review article, the physical principle of femtolasers is discussed, together with the indications and side effects of the method in cataract surgery. The most important clinical results are also presented regarding c...

  14. New technology update: femtosecond laser in cataract surgery

    OpenAIRE

    Nagy, Zoltan

    2014-01-01

    Zoltan Z NagyDepartment of Ophthalmology, Semmelweis University, Budapest, HungaryAbstract: Femtosecond lasers represent a new frontier in cataract surgery. Since their ­introduction and first human treatment in 2008, a lot of new developments have been achieved. In this review article, the physical principle of femtolasers is discussed, together with the indications and side effects of the method in cataract surgery. The most important clinical results are also presented reg...

  15. Webberi juubel algab Tallinnas / Ülle Hallik

    Index Scriptorium Estoniae

    Hallik, Ülle, 1963-

    2008-01-01

    Kahest kontserdist "The Music of Andrew Lloyd Webber" 18. okt. Tallinnas Saku Suurhallis, mis on pühendatud Briti muusikalihelilooja Sir Andrew Lloyd Webberi 60. sünnipäevale ja on avalöögiks juubeliturneele

  16. Strength and Fatigue of NT551 Silicon Nitride and NT551 Diesel Exhaust Valves

    Energy Technology Data Exchange (ETDEWEB)

    Andrews, M.J.; Wereszczak, A.A.; Kirkland, T.P.; Breder, K.

    2000-02-01

    The content of this report is excerpted from Mark Andrew's Ph.D. Thesis (Andrews, 1999), which was funded by a DOEYOTT High Temperature Materials Laboratory Graduate Fellowship. It involves the characterization of NT551 and valves fabricated with it. Greater detail of the described issues may be found in that reference or through communications with Andrew Wereszczak.

  17. Razonamiento lógico-matemático en las escuelas

    OpenAIRE

    Oscar Gómez Berrocal; Rocío Berrocal Mora

    2002-01-01

    Resumen. Fundamentados en el desarrollo de su tesis de licenciatura “Estrategia metodológica para el desarrollo del razonamiento lógico-matemático”, presentado ante la División de Educación Rural del CIDE, los autores explican las seis etapas propuestas por el matemático alemán Zoltan Pier Dienes y proponen una alternativa para profundizar y lograr un mejor rendimiento en el desarrollo del pensamiento fáctico.

    El lector encontrará una p...

  18. BIALGEBRAIC STRUCTURES AND SMARANDACHE BIALGEBRAIC STRUCTURES

    OpenAIRE

    Vasantha, Kandasamy

    2003-01-01

    The study of bialgebraic structures started very recently. Till date there are no books solely dealing with bistructures. The study of bigroups was carried out in 1994-1996. Further research on bigroups and fuzzy bigroups was published in 1998. In the year 1999, bivector spaces was introduced. In 2001, concept of free De Morgan bisemigroups and bisemilattices was studied. It is said by Zoltan Esik that these bialgebraic structures like bigroupoids, bisemigroups, binea...

  19. Comment on "Nanosecond laser textured superhydrophobic metallic surfaces and their chemical sensing applications" by Duong V. Ta, Andrew Dunn, Thomas J. Wasley, Robert W. Kay, Jonathan Stringer, Patrick J. Smith, Colm Connaughton, Jonathan D. Shephard (Appl. Surf. Sci. 357 (2015) 248-254)

    Science.gov (United States)

    Boinovich, L. B.; Emelyanenko, A. M.; Emelyanenko, K. A.; Domantovsky, A. G.; Shiryaev, A. A.

    2016-08-01

    Nowadays the problem of design of durable ecologically friendly superhydrophobic surfaces is of great importance for science and technology. A recent paper in Applied Surface Science reports the method of fabricating the superhydrophobic metallic surfaces by infrared nanosecond laser surface texturing without using hydrophobic agents. Since this method of surface texturing can be considered as one of the most suitable for various industrial applications, the nature of superhydrophobic state of surfaces produced by laser texturing in the abovementioned paper deserves to be analyzed in detail. Authors of the commented paper attributed the change in wettability to the partial deoxidation of CuO into Cu2O on the surface during storage in atmosphere. However, such interpretation of the results contradicts to the basic notions in the theory of wetting and to more accurate and detailed data. In our Comment we discuss these contradictions point by point.

  20. IMPACT OF CRITICAL ANION SOIL SOLUTION CONCENTRATION ON ALUMINUM ACTIVITY IN ALPINE TUNDRA SOIL Andrew Evans, Jr.1 , Michael B. Jacobs2, and Jason R. Janke1, (1) Metropolitan State University of Denver, Dept. of Earth and Atmospheric Sciences, (2) Dept. of Chemistry, Denver, CO, United States.

    Science.gov (United States)

    Evans, A.

    2015-12-01

    Soil solution anionic composition can impact both plant and microbial activity in alpine tundra soils by altering biochemical cycling within the soil, either through base cation leaching, or shifts in aluminum controlling solid phases. Although anions play a critical role in the aqueous speciation of metals, relatively few high altitude field studies have examined their impact on aluminum controlling solid phases and aluminum speciation in soil water. For this study, thirty sampling sites were selected on Trail Ridge Road in Rocky Mountain National Park, Estes Park, CO, and sampled during July, the middle of the growing season. Sampling elevations ranged from approximately 3560 - 3710 m. Soil samples were collected to a depth of 15.24 cm, and the anions were extracted using a 2:1 D.I. water to soil ratio. Filtered extracts were analyzed using IC and ICP-MS. Soil solution NO3- concentrations were significantly higher for sampling locations east of Iceberg Pass (EIBP) (mean = 86.94 ± 119.8 mg/L) compared to locations west of Iceberg Pass (WIBP) (mean 1.481 ± 2.444 mg/L). Both F- and PO43- soil solution concentrations, 0.533 and 0.440 mg/L, respectively, were substantially lower, for sampling sites located EIBP, while locations WIBP averaged 0.773 and 0.829 mg/L respectively, for F- and PO43-. Sulfate concentration averaged 3.869 ± 3.059 mg/L for locations EIBP, and 3.891 ± 3.1970 for locations WIBP. Geochemical modeling of Al3+ in the soil solution indicated that a suite of aluminum hydroxyl sulfate minerals controlled Al3+ activity in the alpine tundra soil, with shifts between controlling solid phases occurring in the presence of elevated F- concentrations.

  1. Surfaces are different: A perspective on structural, energetic and electronic properties of (001) surfaces of alkaline earth metal oxides as calculated with hybrid density functional theory by Andrew J. Logsdail, David Mora-Fonz, David O. Scanlon, C. Richard A. Catlow, Alexey A. Sokol

    Science.gov (United States)

    Illas, Francesc; Pacchioni, Gianfranco

    2015-12-01

    Surfaces are difficult objects and Surface Science readers know this very well; surfaces exposed to vacuum are often unstable and gain stabilization through relaxation or reconstruction. Surfaces display a positive work function, the extra energy required for a free electron in the solid to go through the surface dipole layer to the vacuum; surfaces are also behind the band bending phenomenon exhibited by semiconductors; i.e. the band gap at the surface is usually smaller than for the bulk material [1].

  2. Long term monitoring of currents, conductivity, temperature, salinity, sigma-theta, pressure, waves, chlorophyll A, oxygen, and meteorology from moorings deployed at two locations in Massachusetts Bay from the platforms WHITE HEATH, ASTERIAS, CHRISTOPHER ANDREW, MARCUS HANNA, ABBIE BURGESS, LOONEY, and ARGO MAINE from January 1, 1986 to February 8, 2006 (NODC Accession 0060062)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Measurements of currents and other oceanographic properties were made at two locations to understand the transport and long-term fate of sediments and associated...

  3. 77 FR 74013 - Granting of Request for Early Termination of the Waiting Period Under the Premerger Notification...

    Science.gov (United States)

    2012-12-12

    ... Farrell and Catherine Farrell; Robert E. Rich, Jr. 20130210 G Starbucks Corporation; Andrew T. Mack; Starbucks Corporation. 20130214 G Westerman Interests, Inc.; Enerven Compression LLC; Westerman...

  4. 78 FR 46948 - Proposed Agreement Regarding Site Costs and Covenants Not To Sue for American Lead and Zinc Mill...

    Science.gov (United States)

    2013-08-02

    ... FURTHER INFORMATION CONTACT: Richard Sisk, Senior Enforcement Attorney, Environmental Protection Agency... electric mail at sisk.richard@epa.gov . Dated: July 23, 2013. Andrew M. Gaydosh, Assistant...

  5. Flexible Transpiration Cooled Thermal Protection System for Inflatable Atmospheric Capture and Entry Systems Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Andrews Space, Inc. proposes an innovative transpiration cooled aerobrake TPS design that is thermally protective, structurally flexible, and lightweight. This...

  6. Measures for Measures

    DEFF Research Database (Denmark)

    Jørgensen, Sune Lehman; A.D., Jackson; Lautrup, B.E.

    2006-01-01

    Are some ways of measuring scientific quality better than others? Sune Lehmann, Andrew D. Jackson and Benny E. Lautrup analyse the reliability of commonly used methods for comparing citation records.......Are some ways of measuring scientific quality better than others? Sune Lehmann, Andrew D. Jackson and Benny E. Lautrup analyse the reliability of commonly used methods for comparing citation records....

  7. Cinema and Culture in Theory

    DEFF Research Database (Denmark)

    Christensen, Ove

    Om Philip Simpson, Andrew Utterson and K.J. Shepherdson (ed.), Film Theory. Critical Concepts in Media and Cultural Studies vols. 1–4.......Om Philip Simpson, Andrew Utterson and K.J. Shepherdson (ed.), Film Theory. Critical Concepts in Media and Cultural Studies vols. 1–4....

  8. Health behaviour of a representative Czech population sample

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva; Kebza, Vladimír

    St. Andrews: European Health Psychology Society, 2001. s. 146. [Health Psychology 2001. 20.04.2001-22.04.2001, St. Andrews] R&D Projects: GA AV ČR IAA8025902 Keywords : SES * gender * self-reported health Subject RIV: AN - Psychology

  9. 78 FR 52943 - Changes in Flood Hazard Determinations

    Science.gov (United States)

    2013-08-27

    ... www.bakeraecom.com/ City of Dothan North St. index.php/alabama/ ,P.O. Box 2128, Andrews, Dothan..., North St. index.php/alabama/ P.O. Box 2128, Andrews, Dothan, houston/. Dothan, AL 36302. AL 36303...-2273P). Strange, Mayor, Department, 25 www.bakeraecom.com/ City of Washington...

  10. Mitrohhini arhiiv / Boris Merilain

    Index Scriptorium Estoniae

    Merilain, Boris

    2008-01-01

    KGB ohvitserist Vassili Mitrohhinist (1922-2004), tema arhiividest ja nende kohta ilmunud raamatutest: Andrew, Christopher. Mitrohhini arhiiv. [I], KGB Euroopas ja mujal läänemaailmas. Tallinn : Sinisukk, 2002 ; Andrew, Christopher. Mitrohhini arhiiv. II, KGB ja maailm. Tallinn : Sinisukk, 2007

  11. Creating a Shared Definition of Good and Bad Writing through Revision Strategies

    Science.gov (United States)

    Baer, Allison L.

    2008-01-01

    This article describes how the author, in an effort to build some common language about "good writing" and to teach effective revision strategies, involved her students in an action research project using the Worse/Better Writing Strategy developed by Andrews-Beck. In her dissertation, Andrews-Beck described a worse/better writing strategy that…

  12. Preconditioner and convergence study for the Quantum Computer Aided Design (QCAD) nonlinear poisson problem posed on the Ottawa Flat 270 design geometry.

    Energy Technology Data Exchange (ETDEWEB)

    Kalashnikova, Irina

    2012-05-01

    A numerical study aimed to evaluate different preconditioners within the Trilinos Ifpack and ML packages for the Quantum Computer Aided Design (QCAD) non-linear Poisson problem implemented within the Albany code base and posed on the Ottawa Flat 270 design geometry is performed. This study led to some new development of Albany that allows the user to select an ML preconditioner with Zoltan repartitioning based on nodal coordinates, which is summarized. Convergence of the numerical solutions computed within the QCAD computational suite with successive mesh refinement is examined in two metrics, the mean value of the solution (an L{sup 1} norm) and the field integral of the solution (L{sup 2} norm).

  13. Combinatorial Algorithms to Enable Computational Science and Engineering: The CSCAPES Institute

    Energy Technology Data Exchange (ETDEWEB)

    Pothen, Alex [Purdue University

    2015-01-16

    This final progress report summarizes the work accomplished at the Combinatorial Scientific Computing and Petascale Simulations Institute. We developed Zoltan, a parallel mesh partitioning library that made use of accurate hyeprgraph models to provide load balancing in mesh-based computations. We developed several graph coloring algorithms for computing Jacobian and Hessian matrices and organized them into a software package called ColPack. We developed parallel algorithms for graph coloring and graph matching problems, and also designed multi-scale graph algorithms. Three PhD students graduated, six more are continuing their PhD studies, and four postdoctoral scholars were advised. Six of these students and Fellows have joined DOE Labs (Sandia, Berkeley, as staff scientists or as postdoctoral scientists. We also organized the SIAM Workshop on Combinatorial Scientific Computing (CSC) in 2007, 2009, and 2011 to continue to foster the CSC community.

  14. Time, Cost, Information Seeking Skills and Format of Resources Present Barriers to Information Seeking by Primary Care Practitioners in a Research Environment. A review of: Andrews James E., Kevin A. Pearce, Carol Ireson, and Margaret M. Love. “Information‐Seeking Behaviors of Practitioners in a Primary Care Practice‐Based Research Network (PBRN.” Journal of the Medical Library Association 93.2 (Apr. 2005: 206‐12.

    Directory of Open Access Journals (Sweden)

    Martha Ingrid Preddie

    2007-09-01

    Full Text Available Objective – To determine the information seeking behaviors of primary care practitioners in order to inform future efforts towards the design of information services that would support quality inprimary care.Design – A cross‐sectional survey.Setting – A primary care practice based research network (PBRN of caregivers who serve a broad population while simultaneously studying and disseminating innovations aimed at improvements in quality, efficiency and/or safety of primaryhealth care in the United States.Subjects – All primary care practitioners in the PBRN including family practitioners, general practitioners, nurse practitioners and physician assistants.Methods – A questionnaire comprising twenty‐six questions was distributed to 116 practitioners. Practitioners attached to academic centres (who were also members of the PBRN were excluded in order “to achieve a sample of practices more representative of the primary care practising population” (208. Descriptive data were collected and analyzed. SPSS v11.5 was used for statistical analyses.Main results – There was a response rate of 51% (59 of 116. Fifty‐eight percent of the respondents stated that they sought information (excluding drug dosing or drug interactions information to support patient care several times a week. Sixty‐eight per cent sought this information while the patient waited. Almost half of therespondents had access to a small medical library (48% or a hospital library (46%, while 21% used a university medical library.Approximately 14% had no immediate access to a medical library. Almost 60% of practitioners stated that they had an e‐mail account. Thirty‐four percent agreed that the use of e‐mail to communicate with patients enhanced medical practice, while 24% disagreed. There was frequent prescribing of Internet‐based consumer health information to patients by only 16% of the practitioners, while Internet support groups were frequently recommended by 5%. Themain barriers to information seeking were lack of time (76%, cost (33%, information seeking skills (25%, and format of information sources (22%. The use of EBM resources was fairly low, while there was a high preference for ready reference and interpersonal sources. When compared with print information resources, the use ofonline resources was moderate. A significant correlation was found between use of online sources and use of print sources, namely, that practitioners who used online sources more frequently, also soughtinformation from print sources more frequently, with the inverse being true for those who sought information less frequently from either electronic or print sources.Conclusion – Primary care practitioners in this rural PBRN used print and interpersonal sources more than online sources. Practitioners who are more likely to use print sources are also more likely to seek online information. Librarians working in PBRN environments will need to identify interventions that address barriers such as time, cost, and information‐seeking skills.

  15. Human immunodeficiency virus type- 1 subtypes of infected patients in Espírito Santo, Brazil

    Directory of Open Access Journals (Sweden)

    Valéria P Cabral

    2006-12-01

    Full Text Available Genetic variability of human immunodeficiency virus type - 1(HIV-1 is a potential threat for both diagnosis and treatment of HIV/AIDS, as well as the development of effective vaccines. Up to now, HIV subtypes circulating among HIV-positive patients in the state of Espírito Santo were not known. In the present study, blood samples from 100 therapy-naïve HIV-1 infected patients were collected and the HIV subtype was determined through the Heteroduplex Mobility Assay (HMA. Ninety-seven out of 100 studied samples were subtyped by HMA, 73 samples (75.2% were from subtype B, 9 (9.3% from subtype F, 3 (3.1% from subtype C, 6 (6.2% Benv/Fgag, and another 6 (6.2% Fenv/Bgag, what suggests that recombinant viruses were present in the studied samples. Twenty-eight percent of the subtype B samples were represented by the Brazilian B" subtype, which were identified by RFLP with Fok I. Data presented here demonstrate that the epidemiological characteristics of the HIV epidemic in the state of Espírito Santo are similar to those from the other Southeastern states and helped to better understand the genetic polymorphism of HIV in Brazil.

  16. Viral startup a guide to designing viral loops : if you're interested in what it takes to grow a business from 10 users to 10 million

    CERN Document Server

    Chen, Andrew

    2013-01-01

    Andrew Chen is a blogger and entrepreneur focused on consumer internet, metrics and user acquisition. He is an advisor/angel for early-stage startups including Appsumo, Cardpool (acquired by Safeway), Catchfree, Gravity, Mocospace, Launchbit, Qik (acquired by Skype), WeeWorld, Votizen, and is also a 500 Startups mentor. In his blog, Andrew shares his best advice for a viral startup. This eBook includes the most interesting, popular, and relevant advice from Andrew's blog (www.andrewchenblog.com) and organizes it into actionable advice for readers. Linking to additional resources and further

  17. RNA Interference

    Science.gov (United States)

    ... in healthy cells. Two longtime NIGMS grantees, Andrew Fire and Craig Mello, were awarded the 2006 Nobel ... an infection. RNAi may also have evolved to combat the spread of genetic elements called transposons within ...

  18. Algkoolilastega kinno!

    Index Scriptorium Estoniae

    2008-01-01

    Lühike arvustus järjefilmile "Narnia lood : prints Caspian" ("The Chronicles of Narnia : Prince Caspian") C.S. Lewise muinasjutu ainetel : režissöör Andrew Adamson : Ameerika Ühendriigid - Suurbritannia 2008

  19. 77 FR 54927 - Comment Request for Information Collection for Unemployment Insurance (UI) Benefit Accuracy...

    Science.gov (United States)

    2012-09-06

    ... Employment and Training Administration Comment Request for Information Collection for Unemployment Insurance... written comments to Andrew Spisak, Office of Unemployment Insurance, Room S-4524, Employment and Training... UI benefit payments in three programs: State UI, Unemployment Compensation for Federal...

  20. Third International Workshop on Ichnotaxonomy (WIT-Ⅲ)

    Institute of Scientific and Technical Information of China (English)

    Radek Mikulá(s); Andrew K.Rindsberg

    2007-01-01

    @@ Scientists working on classification, namingand general understanding of trace fossils(ichnofossils) held a workshop in the Czech Republic, convened by Radek Mikulás(Prague) and Andrew K. Rindsberg (USA).

  1. Acute Human Lethal Toxicity of Agricultural Pesticides: A Prospective Cohort Study

    OpenAIRE

    Miller, Matthew; Bhalla, Kavi

    2010-01-01

    Matthew Miller and Kavi Bhalla discuss new research findings from Andrew Dawson and colleagues on the human toxicity of pesticides in Sri Lanka, and call for urgent reclassification of agricultural pesticides to help reduce suicides by poisonings.

  2. The (nano) entrepreneur's dilemma

    Science.gov (United States)

    Maynard, Andrew D.

    2015-03-01

    Emerging technologies need to be developed responsibly if their benefits are to outweigh any potential risks. Yet do entrepreneurs really have the luxury of grappling with future consequences from the get-go, asks Andrew D. Maynard.

  3. CPAP Tips

    Medline Plus

    Full Text Available ... how to safely and effectively use your CPAP device. Category Education License Standard YouTube License ... Philips Respironics System One CPAP Overview by Carolina's Home Medical Equipment - Duration: 11:57. Andrew Trammell 78,568 ...

  4. Pop / Tristan Priimägi

    Index Scriptorium Estoniae

    Priimägi, Tristan, 1976-

    2007-01-01

    Heliplaatidest: Rufus Wainwright "Release The Stars", Poiskõsõ "Tii päält iist!", Mice Parade "Mice Parade", John Martyn "BBC Live In Concert", Feedle "Leave Now for Adventure", Korpi Ensemble "Trails", Michael Andrews "Hand On String"

  5. Exploring the Uses of RNAi — Gene Knockdown and the Nobel Prize

    NARCIS (Netherlands)

    Bernards, R.A.

    2006-01-01

    The Nobel Prize in Physiology or Medicine was awarded this year to Andrew Fire (Stanford University School of Medicine) and Craig Mello (University of Massachusetts Medical School) for their discovery of a new form of gene silencing.

  6. 78 FR 11126 - Receipt of Several Pesticide Petitions Filed for Residues of Pesticide Chemicals in or on Various...

    Science.gov (United States)

    2013-02-15

    ... using capillary gas liquid chromatography (GLC) with flame ionization detector (FID). Contact: Andrew...) purification. Detection and quantitation are conducted by gas chromatograph equipped with nitrogen phosphorus detector (GC/NPD), electron capture detector (ECD) or mass spectrometry detection (MSD). Contact:...

  7. Pot Habit Early in Life May Alter Brain, Study Suggests

    Science.gov (United States)

    ... New York City; Mitch Earleywine, Ph.D., professor, psychology, State University of New York at Albany; Andrew Adesman, M.D., chief, developmental and behavioral pediatrics, Cohen Children's Medical Center, New ...

  8. Feministid põõsas / Olev Remsu

    Index Scriptorium Estoniae

    Remsu, Olev, 1947-

    1996-01-01

    Feminismist seoses ameerika filmiga 'Striptiis' ("Striptease", re̓issöör Andrew Bergman, USA 1996). Vastukaja: Kivimaa, Katrin. Feminist tuleb põõsast välja // Eesti Päevaleht. - 1996. - 4. dets. - Lk. 7

  9. First Person Past: American Autobiographies, Volume 2

    DEFF Research Database (Denmark)

    American literature, biography, Tunis Campbell, Black Elk, Andrew Carnegie, Booker T. Washington, Mary Antin, Mary Jones, Frederic Howe, Anna Howard Shaw, Woody Guthrie, Monica Sone, Anne Moody, Ron Kovic...

  10. Narnia 1300 aastat hiljem / Timo Diener

    Index Scriptorium Estoniae

    Diener, Timo

    2008-01-01

    Mängufilm "Narnia lood : prints Caspian" ("The Chronicles of Narnia : Prince Caspian") C.S. Lewise muinasjutu ainetel : peaosas Ben Barnes : režissöör Andrew Adamson : Ameerika Ühendriigid - Suurbritannia 2008

  11. 76 FR 20757 - Self-Regulatory Organizations; C2 Options Exchange, Incorporated; Notice of Designation of a...

    Science.gov (United States)

    2011-04-13

    ... CFR 240.19b-4. \\3\\ See Securities Exchange Act Release No. 64011 (March 2, 2011), 76 FR 12775..., Commission, dated March 18, 2011; letter from Andrew Stevens, Legal Counsel, IMC Chicago, LLC, to Elizabeth...

  12. DEVELOPMENTAL ATRAZINE EXPOSURE SUPPRESSES IMMUNE FUNCTION IN MALE, BUT NOT FEMALE SPRAGUE-DAWLEY RATS

    Science.gov (United States)

    Developmental Atrazine Exposure Suppresses Immune Function in Male, but not Female Sprague-Dawley Rats Andrew A. Rooney,*,1 Raymond A. Matulka,? and Robert Luebke? *College of Veterinary Medicine, Anatomy, Physiological Sciences and Radiology, NCSU, Raleigh, North...

  13. Genetics Home Reference: hereditary folate malabsorption

    Science.gov (United States)

    ... Children Living with Inherited Metabolic Diseases (CLIMB) National Organization for Rare Disorders (NORD): Megaloblastic ... Andrews NC. When is a heme transporter not a heme transporter? When it's a folate transporter. Cell Metab. 2007 Jan;5(1):5-6. Citation ...

  14. 76 FR 27175 - Quarterly Publication of Individuals Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2011-05-10

    ... KAY WADE COWDY KATHARINE JANE CRAIG GRENVILLE VERNON CRAMER JOSEPH CARL CRISSEY CHARLES ANDREW CUIC... CAROLE STEPHANS SIN YON STETON HONEY C. STEWART JAMES ROBERT STOESSEL PATRICK STRESEMANN WALTER C...

  15. Normal Pressure Hydrocephalus (NPH)

    Science.gov (United States)

    ... TDP43-related Dementia 2013 Andrew Watt Characterisation of Tau Imaging Ligands for Alzheimer's Disease and other Dementias 2010 Marco Prado The Prion Protein as a Therapeutic Target in Alzheimer's Disease 2007 ...

  16. Creutzfeldt-Jakob Disease

    Science.gov (United States)

    ... TDP43-related Dementia 2013 Andrew Watt Characterisation of Tau Imaging Ligands for Alzheimer's Disease and other Dementias 2010 Marco Prado The Prion Protein as a Therapeutic Target in Alzheimer's Disease 2007 ...

  17. Mixed Dementia

    Science.gov (United States)

    ... TDP43-related Dementia 2013 Andrew Watt Characterisation of Tau Imaging Ligands for Alzheimer's Disease and other Dementias 2010 Marco Prado The Prion Protein as a Therapeutic Target in Alzheimer's Disease 2007 ...

  18. Parkinson's Disease Dementia

    Science.gov (United States)

    ... TDP43-related Dementia 2013 Andrew Watt Characterisation of Tau Imaging Ligands for Alzheimer's Disease and other Dementias 2010 Marco Prado The Prion Protein as a Therapeutic Target in Alzheimer's Disease 2007 ...

  19. Down Syndrome and Alzheimer's Disease

    Science.gov (United States)

    ... TDP43-related Dementia 2013 Andrew Watt Characterisation of Tau Imaging Ligands for Alzheimer's Disease and other Dementias 2010 Marco Prado The Prion Protein as a Therapeutic Target in Alzheimer's Disease 2007 ...

  20. Mild Cognitive Impairment

    Science.gov (United States)

    ... TDP43-related Dementia 2013 Andrew Watt Characterisation of Tau Imaging Ligands for Alzheimer's Disease and other Dementias 2010 Marco Prado The Prion Protein as a Therapeutic Target in Alzheimer's Disease 2007 ...

  1. Benefit of joint response in a mental health crisis.

    Science.gov (United States)

    2016-07-27

    Andrew Lancaster writes in Mental Health Practice about the critical role mobile crisis teams (MCTs) can play in delivering a joint response from the police and mental health services to people in a mental health crisis. PMID:27461336

  2. The Intersection of Advertising and Antitrust in New Zealand

    OpenAIRE

    Andrew Matthews; Gus Stewart

    2014-01-01

    The enforcement fusion of (some) advertising and antitrust law, coupled with other advertising law, provide a powerful toolkit for New Zealand’s regulator and competitors alike. Andrew Matthews & Gus Stewart (Matthews Law)

  3. When will Summer Arctic Sea Ice Disappear?

    OpenAIRE

    Maslowski, Wieslaw

    2008-01-01

    Collaborators: Jaclyn Clement Kinney, Andrew Miller, Terry McNamara , John Whelan - Naval Postgraduate School Jay Zwally - NASA / GSFC Jaromir Jakacki, Waldemar Walczowski - Institute of Oceanology, PAS Agnieszka Beszczynska-Möller - AWI Ron Kwok - NASA / JPL Marika Holland - NCAR

  4. Kas müürilill prooviruumi nurgas või kardetud politseinik? / Maris Peters

    Index Scriptorium Estoniae

    Peters, Maris

    2008-01-01

    Andrew James Hartley raamatust "The Shakespearean dramaturg: a theoretical and practical guide" (2005). Raamat annab ülevaate dramaturgi võimalikest tööülesannetest, dramaturgia teoreetilisetest põhimõtetest ja praktilisest osast

  5. Book review: Foucault on politics, security and war

    OpenAIRE

    Packman, Carl

    2011-01-01

    Carl Packman reviews an undeniably timely introduction to Michel Foucault’s complex research on political modernity. Foucault on Politics, Security and War. Michael Dillon and Andrew W Neal. Palgrave Macmillan. January 2011.

  6. What Is Prostate Cancer?

    Medline Plus

    Full Text Available ... a visit to their urologist. John Bertini, M.D.: It's a wide variety of reasons why they ... sperm during intercourse. Andrew C. von Eschenbach, M.D.: There's no such thing as one type of ...

  7. Sõjaväeeksootika jäi omaette / Anneli Remme

    Index Scriptorium Estoniae

    Remme, Anneli, 1968-

    1999-01-01

    West End Musicals ja Eesti Riiklik Sümfooniaorkester, Oratooriumikoor ja Urmas Lattikase ansambel esitamas Andrew Lloyd Webberi ja Leonard Bernsteini laule muusikalidest Paldiski Sõjaväebaasi riviväljakul 29. augustil

  8. Webberi muusika Paldiskis

    Index Scriptorium Estoniae

    1999-01-01

    West End Musicals ja Eesti Riiklik Sümfooniaorkester, Oratooriumikoor ja Urmas Lattikase ansambel esitamas Andrew Lloyd Webberi ja Leonard Bernsteini laule muusikalidest Paldiski Sõjaväebaasi riviväljakul 29. augustil

  9. Paremad filmid 6 : Põrgulik amet / Jaanus Noormets

    Index Scriptorium Estoniae

    Noormets, Jaanus

    2006-01-01

    Hongkongi põnevusfilm "Põrgulik amet" ("Mou gaan dou") : režissöörid Andrew Lau, Alan Mak : 2002. Film on aluseks Martin Scorsese uuele filmile "Kahe tule vahel" ("The Departed"). Lisa "Originaali tegija kiitis uut filmi"

  10. Visuaalne uurimus ja uued jutustusviisid graafikas = Visual Analysis and a New Means of Narration in the Graphic Arts / Martin Rünk

    Index Scriptorium Estoniae

    Rünk, Martin, 1982-

    2011-01-01

    Tallinna XV graafikatriennaal "Armastuse, mitte raha pärast" Kumu Kunstimuuseumis. Peapreemia Edmunds Jansonsi tööle "Väikese linnukese päevik". Andrew Raftery suureformaadilistest vasegravüüridest

  11. The African Women's Protocol: Bringing Attention to Reproductive Rights and the MDGs

    OpenAIRE

    Gerntholtz, Liesl; Gibbs, Andrew; Willan, Samantha

    2011-01-01

    Andrew Gibbs and colleagues discuss the African Women's Protocol, a framework for ensuring reproductive rights are supported throughout the continent and for supporting interventions to improve women's reproductive health, including the MDGs.

  12. Fundamentals of Industrial Crystallization: an Overview

    Czech Academy of Sciences Publication Activity Database

    Nývlt, Jaroslav

    Association Andrew van Hook, 1996, s. 11-17. - (Compte-rendus du 3eme Symposium International organisé le 14 Mars 1996 a Reims.) [La cristallisation du sucre. Sugar Crystallization. Reims (FR), 14.03.1996

  13. Oceanographic station data from bottle casts from the SACKVILLE in the North Atlantic Ocean from 15 January 1963 to 18 January 1963 (NODC Accession 7600961)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Oceanographic station data were collected from the SACKVILLE in the North Atlantic Ocean. Data were collected by the St. Andrews Biological Station from 15 January...

  14. Reinforcement learning an introduction

    CERN Document Server

    Sutton, Richard S

    1998-01-01

    Richard Sutton and Andrew Barto provide a clear and simple account of the key ideas and algorithms of reinforcement learning. Their discussion ranges from the history of the field's intellectual foundations to the most recent developments and applications.

  15. University upgrades SGI computing capacity

    OpenAIRE

    Trulove, Susan

    2005-01-01

    A new 64-processor SGI computer from Silicon Graphics Inc. will be delivered to Andrews Information Systems Building on April 22 and should be available to university researchers within 30 days, announced Terry Herdman, director of research computing.

  16. CPAP Tips

    Medline Plus

    Full Text Available ... Andrew Trammell 69,297 views 11:57 Cool New Tool Helps Cure Sleep Apnea - As Featured on ... Terms Privacy Policy & Safety Send feedback Try something new! Loading... Working... Sign in to add this to ...

  17. 77 FR 59004 - Membership of the Senior Executive Service Standing Performance Review Boards

    Science.gov (United States)

    2012-09-25

    ... LAUNDERING SECTION. CARROLL, OVIE DIRECTOR, CYBERCRIME LABORATORY, COMPUTER CRIME AND INTELLECTUAL PROPERTY SECTION. CARWILE, P. KEVIN CHIEF, CAPITAL CASE UNIT. LYNCH JR., JOHN T CHIEF, COMPUTER CRIME, AND... TRANSNATIONAL ORGANIZED CRIME AND INTERNATIONAL AFFAIRS. OOSTERBAAN, ANDREW CHIEF, CHILD EXPLOITATION...

  18. 75 FR 56578 - Renewal of the Advisory Committee on Apprenticeship (ACA), and an Open Meeting

    Science.gov (United States)

    2010-09-16

    ..., Executive Director, Association for Career and Technical Education, Alexandria, Virginia. Mr. Andrew Cort s..., Vocational and Adult Education (OVAE), U.S. Department of Education, Washington, DC. Mr. Barry Johnson..., Employment and Training Administration. BILLING CODE 4510-FR-P...

  19. Puitpilvelõhkuja!

    Index Scriptorium Estoniae

    2007-01-01

    Londonisse ehitatava 9-korruselise korterelamu projektist. Hoone ehitatakse ristlamineeritud puitpaneelidest (jumbo plywood), fassaadidel olevad pikseldatud mustrid on inspireeritud Gerhard Richteri maalikunstist. Arhitektid: Sophie Goldhill, Chris Gray, Kristen Haggart, Andrew Waugh. Projekteerija: Waugh Thistleton

  20. Spatial and dietary overlap between red snapper and vermilion snapper (NCEI Accession 0130920)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains abundance data for nine species of reef fish observed at 40 reef sites between Mobile Bay, Alabama and Saint Andrews Bay, Florida, during...

  1. Seiklused kapitaguses maailmas / Karin Hansson

    Index Scriptorium Estoniae

    Hansson, Karin

    2007-01-01

    C.S. Lewise 1950.a. ilmunud romaani järgi "Narnia lood : Lõvi, nõid ja riidekapp" ("Chronicles of Narnia : The Lion, the Witch and the Wardrobe") valminud Andrew Adamsoni samanimelisest mängufilmist

  2. Pop / Tõnu Kaalep

    Index Scriptorium Estoniae

    Kaalep, Tõnu, 1966-

    2003-01-01

    Heliplaatidest: Mihkel Kleis "Quest For Fire/Visit To Minotaur", Andrew W. K. "The Wolf",Client "Client", Bubba Sparxxx "Deliverance", Yes "The Ultimate Yes - 35th Anniversary Collection", Joseph Suchy "calabi.yau", Luomo "Present Lover"

  3. Multfilm "V poiskah Nemo" delajet detei ubiitsami rõbok

    Index Scriptorium Estoniae

    2004-01-01

    Animafilm "Kalapoeg Nemo" : režissöör Andrew Stanton : Ameerika Ühendriigid 2003. Filmi vaatamise järgselt on tuhanded lapsed lasknud oma akvaariumikalad vabadusse, põhjustades sellega nende huku või keskkonnaprobleeme

  4. The New York Review of Books : (1998, 14. mai), nr. 8 : [ülevaade] / vahendanud Anne Lange

    Index Scriptorium Estoniae

    1998-01-01

    Ka John Keatsi käsitlusest: Nicholase Roe' 'John Keats and the culture of dissent' ja Andrew Motioni 'Keats : a biography'; Nadine Gordimer romaanist 'The house of gun'; Franz Kafka 'Lossi' uustõlkest inglise keelde

  5. Puitpilvelõhkuja on valmis!

    Index Scriptorium Estoniae

    2008-01-01

    Üheksakorruseline ristkihtpuitpaneelidest korterelamu Londonis. Arhitektid: Sophie Goldhill, Chris Gray, Kristen Haggart, Andrew Waugh arhitektuuribüroost Waugh Thistleton. Konstruktorid: Megan Yates, Matthew Linegar, Bruno Dujič. Ristlamineeritud puitpaneelid valmistas Austria firma KLH

  6. Tuna & täna / Mati Soomre

    Index Scriptorium Estoniae

    Soomre, Mati, 1944-2015

    2007-01-01

    1981 esietendus Londonis New Londoni teatris Andrew Lloyd Webberi muusikal "Kassid" Viimane, 8950. etendus oli 11. mail 2002, lavastuse 21. sünnipäeval. Kokku nägi seda lavastust 8 miljonit inimest

  7. Aiming high but keeping costs low.

    Science.gov (United States)

    Hough, Steve; Nicholls, Andrew

    2010-04-01

    Steve Hough, national sales manager, CEP Claddings, and Andrew Nicholls, sales director, CEP Ceilings, explain how modern cladding and ceiling materials can enhance the appearance of modern hospital buildings while offering practical, cost-saving, and environmental advantages. PMID:20446486

  8. Open access to large scale datasets is needed to translate knowledge of cancer heterogeneity into better patient outcomes.

    Directory of Open Access Journals (Sweden)

    Andrew H Beck

    2015-02-01

    Full Text Available In this guest editorial, Andrew Beck discusses the importance of open access to big data for translating knowledge of cancer heterogeneity into better outcomes for cancer patients.

  9. Jewish community indignant over press, legislation

    Index Scriptorium Estoniae

    2005-01-01

    Ameerika Juudikomitee rahvusvaheliste küsimuste direktor Andrew Baker avaldas pahameelt, et prokuratuur lõpetas uurimise Leedu päevalehe antisemitistlike artiklite suhtes. Leedu juudi kogukond esitas valitsusele nimekirja ehitistest, mille tagastamist nad soovivad

  10. Could we 3D print an artificial mind?

    Science.gov (United States)

    Maynard, Andrew D.

    2014-12-01

    3D printing is allowing more complex three-dimensional structures to be manufactured than ever before. Could the convergence between this technology and nanotechnology eventually usher in a new era of artificial intelligence, asks Andrew D. Maynard.

  11. Anti-angiogenesis therapies: their potential in cancer management

    OpenAIRE

    Andrew Eichholz; Shairoz Merchant; Gaya, Andrew M

    2010-01-01

    Andrew Eichholz, Shairoz Merchant, Andrew M GayaDepartment of Clinical Oncology, Guy’s and St. Thomas’ NHS Foundation Trust, London, United KingdomAbstract: Angiogenesis plays an important role in normal animal growth and development. This process is also vital for the growth of tumors. Angiogenesis inhibitors have a different mechanism of action to traditional chemotherapy agents and radiation therapy. The angiogenesis inhibitors can act synergistically with conventional ...

  12. Indira Gandhi sattus KGB konksu otsa / ref. Ralf R. Parve

    Index Scriptorium Estoniae

    2005-01-01

    29. jaanuaril suri Londonis 1984. aastani Moskvas KGB arhiivis töötanud erumajor Vassili Mitrohhin, kes koostas koos Christopher Andrew'ga KGB arhiivist kaasa võetud dokumentide alusel raamatu "Mitrohhini arhiiv". Septembris ilmus raamatu II osa "KGB ja kogu maailm", mille tegevustik toimub Indias. Professor Andrew püüab raamatus tõestada India endiste peaministrite Indira ja Radjiv Gandhi täielikku sõltuvust KGB-st. Lisad: Indira Priyadarashani Gandhi; Radjiv Gandhi

  13. Eesti noored tulid harrastusfilmide festivalilt kolme karva medalitega / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2010-01-01

    Šveitsis Einsiedelnis toimunud 72. rahvusvahelisel sõltumatute filmide festivalil UNICA võitis kuldmedali Andrew Bond Balti Filmi- ja Meediakoolist lühimängufilmiga "Vene suurus", hõbemedali Vallo Toomla Balti Filmi- ja Meediakoolist lühimängufilmiga "Koolja" ja pronksmedali Katre Haav Eesti Kunstiakadeemiast animafilmiga "Valel poolel". Riikide arvestuses saavutas Eesti filmikava teise koha. 2011. a. ekraanile jõudvast Andrew Bondi lühifilmist "Legend vägevast seebist"

  14. The IQ domain drives nuclear translocation of Nuclear myosin I

    Czech Academy of Sciences Publication Activity Database

    Dzijak, Rastislav; Kahle, Michal; Přidalová, Jarmila; Moško, Tibor; Hozák, Pavel

    St Andrews : Wilhelm Bernhard Workshop, 2007. ---. [Wilhelm Bernhard Workshop on the Cell Nucleus /20./. 27.08.2007-31.08.2007, St. Andrews] R&D Projects: GA MŠk LC545; GA ČR(CZ) GA204/07/1592; GA ČR GD204/05/H023 Institutional research plan: CEZ:AV0Z50520514 Keywords : nucleus * nuclear myosin * calmodulin Subject RIV: EB - Genetics ; Molecular Biology

  15. Teaching safe prescribing to medical students: perspectives in the UK

    OpenAIRE

    Nazar H; Nazar M; Rothwell C; Portlock J; Chaytor A; Husb; De, A.

    2015-01-01

    Hamde Nazar,1 Mahdi Nazar,2 Charlotte Rothwell,1 Jane Portlock,3 Andrew Chaytor,1 Andrew Husband1 1School of Medicine, Pharmacy and Health, Durham University, UK; 2Cumberland Infirmary, North Cumbria University Hospitals NHS Trust, UK; 3School of Pharmacy and Biomedical Sciences, University of Portsmouth, UK Abstract: Prescribing is a characteristic role of a medical practitioner. On graduating from medical school, students are presumed to have acquired the necessary pharmacology knowledge un...

  16. Book review: The limits of institutional reform in development

    OpenAIRE

    Kuecken, Maria

    2013-01-01

    "The Limits of Institutional Reform in Development: Changing Rules for Realistic Solutions." Matt Andrews. Cambridge University Press. February 2013. --- Developing countries commonly adopt reforms to improve their governments yet they usually fail to produce more functional and effective governments. In this book Matt Andrews argues that reforms often fail to make governments better because unrealistic initiatives do not fit developing country contexts and are not considered relevant by impl...

  17. Razonamiento lógico-matemático en las escuelas

    Directory of Open Access Journals (Sweden)

    Oscar Gómez Berrocal

    2002-07-01

    Full Text Available

    Resumen. Fundamentados en el desarrollo de su tesis de licenciatura “Estrategia metodológica para el desarrollo del razonamiento lógico-matemático”, presentado ante la División de Educación Rural del CIDE, los autores explican las seis etapas propuestas por el matemático alemán Zoltan Pier Dienes y proponen una alternativa para profundizar y lograr un mejor rendimiento en el desarrollo del pensamiento fáctico.

    El lector encontrará una propuesta metodológica, amparada en los presupuestos teóricos del presente artículo, en el suplemento EDUCARE en el aula en esta edición.

     

    Abstract. Based on the results of their licenciatura thesis "Methodological strategy for the development of logical-mathematical reasoning”, presented to the Division of Rural Education, CIDE the authors explain the six phases developed by the German mathematician, Zotan Pier Dienes. They propose an alternative strategy to deepen and accomplish a better achievement in the development of factual thinking.

    The reader will find, in the section "EDUCARE in the classroom" that appears in this edition, a methodological proposal, founded in the theoretical postulates presented and discussed in this article.

  18. Orienteering Club

    CERN Multimedia

    Club d'orientation

    2010-01-01

    COURSE D’ORIENTATION La finale de la coupe de printemps Après avoir remporté le challenge club, samedi 29 juin lors du relais inter-club à Lausanne, le Club d’orientation du CERN organisait la dernière étape de la coupe genevoise de printemps samedi 5 juin à Saint-Cergue dans les bois de Monteret (Canton de Vaud). Plus de 100 participants se sont déplacés pour venir participer à la finale et découvrir une toute nouvelle carte dans une forêt vallonnée. Les résultats pour chaque circuit de cette étape sont : Technique long : 1. Jurg Niggli du club O’Jura, 2. Clément Poncet, 3. Oystein Midttun. Technique moyen : 1. Zoltan Trocsanyi CO CERN, 2. Christophe Ingold, 3. Christina Falga. Technique court : 1. Pierre-Andre Baum, CARE Vevey, 2. Emese Szunyog, 3. Solène Balay. Facile moyen : 1. Elisa P...

  19. Adobe Photoshop Elements 11 for photographers

    CERN Document Server

    Andrews, Philip

    2013-01-01

    To coincide with some of the biggest changes in Photoshop Elements for years, Philip Andrews completely revises his bestselling title to include all the new features of this release. See how the new interface works alongside new tools, techniques and workflows to make editing, enhancing and sharing your pictures easier than ever. And as always, he introduces the changed and improved features with colorful illustrations and the clear step-by-step instruction that has made his books the go-to titles for photographers the world over. ????In this edition Andrews highlights followi

  20. New representations for $\\sigma(q)$ via reciprocity theorems

    OpenAIRE

    Banerjee, Koustav; Dixit, Atul

    2016-01-01

    Two new representations for Ramanujan's function $\\sigma(q)$ are obtained. The proof of the first one uses the three-variable reciprocity theorem due to Soon-Yi Kang and a transformation due to R.P. Agarwal while that of the second uses the four-variable reciprocity theorem due to George Andrews and a generalization of a recent transformation of Andrews, Schultz, Yee and the second author. The advantage of these representations is that they involve free complex parameters - one in the first r...

  1. The evolution of teachers’ language awareness

    OpenAIRE

    Andrews, SJ

    2006-01-01

    The paper focuses on the development of teacher thinking, specifically L2 teachers’ subject-matter cognitions, i.e. their Teacher Language Awareness (TLA) (see e.g. Andrews 2001, 2003). The study examines the evolving TLA, as it relates to grammar, of three teachers, each a graduate with more than 10 years’ experience of teaching English in Hong Kong secondary schools. All three teachers took part in a previous TLA study conducted in 1996–97 (see Andrews, 1999a), when they were in their early...

  2. Arrays of microscopic organic LEDs for high resolution optogenetics

    OpenAIRE

    Steude, Anja; Witts, Emily Charlotte; Miles, Gareth Brian; Gather, Malte Christian

    2016-01-01

    We thank A. Morton and C. Murawski (both University of St Andrews) and B.Richter (Fraunhofer FEP, Dresden) for fruitful discussions. HEK-293 cells that were stably transfected with ChR2-H134R-EYFP DNA were provided by M. Antkowiak and F. J. Gunn-Moore (both University of St Andrews). Funding: This work was supported by the Scottish Funding Council (via Scottish Universities Physics Alliance), the Human Frontier Science Program (RGY0074/2013), and the RS Macdonald Charitable Trust. Author cont...

  3. Advanced Computer Algebra for Determinants

    CERN Document Server

    Koutschan, Christoph

    2011-01-01

    We prove three conjectures concerning the evaluation of determinants, which are related to the counting of plane partitions and rhombus tilings. One of them has been posed by George Andrews in 1980, the other two are by Guoce Xin and Christian Krattenthaler. Our proofs employ computer algebra methods, namely the holonomic ansatz proposed by Doron Zeilberger and variations thereof. These variations make Zeilberger's original approach even more powerful and allow for addressing a wider variety of determinants. Finally we present, as a challenge problem, a conjecture about a closed form evaluation of Andrews's determinant.

  4. On the death of a baby.

    OpenAIRE

    Stinson, R; Stinson, P

    1981-01-01

    Andrew was a desperately premature baby weighing under two pounds. He died after months of "heroic' efforts in an intensive care facility. The story of his short cruel institutionalised life is a case study in the limits and excesses of modern medicine. The night he told us our son Andrew was about to die the doctor who had taken charge of him six months before also told us we were "intellectually tight' that we had "no feelings only thoughts and words and strategies'. We were "bad parents'. ...

  5. Strength and fatigue of NT551 silicon nitride and NT551 diesel exhaust valves

    Energy Technology Data Exchange (ETDEWEB)

    Andrews, M.J.; Werezczak, A.A.; Kirkland, T.P.; Breder, K.

    2000-02-01

    The content of this report is excerpted from Mark Andrew's Ph.D. Thesis (Andrews, 1999), which was funded by a DOE/OTT High Temperature Materials Laboratory Graduate Fellowship. It involves the characterization of NT551 and valves fabricated with it. The motivations behind using silicon nitride (Si{sub 3}N{sub 4}) as an exhaust valve for a diesel engine are presented in this section. There are several economic factors that have encouraged the design and implementation of ceramic components for internal combustion (IC) engines. The reasons for selecting the diesel engine valve for this are also presented.

  6. MMS

    International Nuclear Information System (INIS)

    This paper reports that two more months could be needed to restore Gulf of Mexico oil and gas production shut in because of Hurricane Andrew, Minerals Management Service estimates. Hurricane Andrew swept west across South Florida into the gulf, then turned north and struck the Louisiana coast Aug. 25. Operators last week continued filing with MMS district offices in the New Orleans region reports of newly discovered damage to offshore oil and gas structures. By midweek, MMS listed more that 241 platforms, well satellites, and other offshore structures and 135 pipelines damaged by the storm

  7. Gulf of Mexico production still recovering

    International Nuclear Information System (INIS)

    This paper reports that the extent of damage caused by Hurricane Andrew to Gulf of Mexico oil and gas installations continues coming into focus. A preliminary tally by Minerals Management Service offers a reasonably complete summary of gulf production and pipeline systems damage detectable at the surface. MMS requires Outer Continental Shelf operators to inspect for underwater damage all platforms, pipelines, risers, and other structures within an 85 mile corridor along the path of Andrew's eye as it churned through the gulf. OCS operators have until Oct. 16 to submit plans for the Level II surveys

  8. A tale of three theorems

    International Nuclear Information System (INIS)

    Noether's theorem relates symmetries and conservation laws of Hamiltonians systems. Arnol'd's theorem uses those integrals of motion for the construction of sufficient stability conditions of hydrodynamical problems, which are Hamiltonian with a singular Poisson bracket. Finally, Andrews' theorem imposes restriction on the existence of Arnol'd stable solutions of symmetric systems. It is shown that denial of Andrews'theorem implies the divergence of the velocity component normal to the symmetric coordinate. This proof by reductio ad absurdum may be used to determine the strength of the symmetry breaking elements, necessary to overcome the limitations imposed by this theorem (Author)

  9. A bidirectional coupling procedure applied to multiscale respiratory modeling

    Energy Technology Data Exchange (ETDEWEB)

    Kuprat, A.P., E-mail: andrew.kuprat@pnnl.gov [Fundamental and Computational Sciences Directorate, Pacific Northwest National Laboratory, Richland, WA (United States); Kabilan, S., E-mail: senthil.kabilan@pnnl.gov [Fundamental and Computational Sciences Directorate, Pacific Northwest National Laboratory, Richland, WA (United States); Carson, J.P., E-mail: james.carson@pnnl.gov [Fundamental and Computational Sciences Directorate, Pacific Northwest National Laboratory, Richland, WA (United States); Corley, R.A., E-mail: rick.corley@pnnl.gov [Fundamental and Computational Sciences Directorate, Pacific Northwest National Laboratory, Richland, WA (United States); Einstein, D.R., E-mail: daniel.einstein@pnnl.gov [Fundamental and Computational Sciences Directorate, Pacific Northwest National Laboratory, Richland, WA (United States)

    2013-07-01

    In this study, we present a novel multiscale computational framework for efficiently linking multiple lower-dimensional models describing the distal lung mechanics to imaging-based 3D computational fluid dynamics (CFDs) models of the upper pulmonary airways in order to incorporate physiologically appropriate outlet boundary conditions. The framework is an extension of the modified Newton’s method with nonlinear Krylov accelerator developed by Carlson and Miller [1], Miller [2] and Scott and Fenves [3]. Our extensions include the retention of subspace information over multiple timesteps, and a special correction at the end of a timestep that allows for corrections to be accepted with verified low residual with as little as a single residual evaluation per timestep on average. In the case of a single residual evaluation per timestep, the method has zero additional computational cost compared to uncoupled or unidirectionally coupled simulations. We expect these enhancements to be generally applicable to other multiscale coupling applications where timestepping occurs. In addition we have developed a “pressure-drop” residual which allows for stable coupling of flows between a 3D incompressible CFD application and another (lower-dimensional) fluid system. We expect this residual to also be useful for coupling non-respiratory incompressible fluid applications, such as multiscale simulations involving blood flow. The lower-dimensional models that are considered in this study are sets of simple ordinary differential equations (ODEs) representing the compliant mechanics of symmetric human pulmonary airway trees. To validate the method, we compare the predictions of hybrid CFD–ODE models against an ODE-only model of pulmonary airflow in an idealized geometry. Subsequently, we couple multiple sets of ODEs describing the distal lung to an imaging-based human lung geometry. Boundary conditions in these models consist of atmospheric pressure at the mouth and intrapleural

  10. Feasibility study for GCOM-C/SGLI: Retrieval algorithms for carbonaceous aerosols

    Science.gov (United States)

    Mukai, Sonoyo; Sano, Itaru; Yasumoto, Masayoshi; Fujito, Toshiyuki; Nakata, Makiko; Kokhanovsky, Alexander

    2016-04-01

    possibility of GCOM-C1 / SGLI related to remote sensing for aerosols and/or clouds can be examined. [1] Mukai, S., M. Yasumoto and M. Nakata, 2014: Estimation of biomass burning influence on air pollution around Beijing from an aerosol retrieval model. The Scientific World Journal, Article ID 649648. [2] Mukai, S., M. Nakata, M. Yasumoto, I. Sano and A. Kokhanovsky, 2015:A study of aerosol pollution episode due to agriculture biomass burning in the east-central China using satellite data, Front. Environ. Sci., 3:57, doi: 10.3389/fenvs.2015.00057.

  11. A bidirectional coupling procedure applied to multiscale respiratory modeling

    Science.gov (United States)

    Kuprat, A. P.; Kabilan, S.; Carson, J. P.; Corley, R. A.; Einstein, D. R.

    2013-07-01

    In this study, we present a novel multiscale computational framework for efficiently linking multiple lower-dimensional models describing the distal lung mechanics to imaging-based 3D computational fluid dynamics (CFDs) models of the upper pulmonary airways in order to incorporate physiologically appropriate outlet boundary conditions. The framework is an extension of the modified Newton's method with nonlinear Krylov accelerator developed by Carlson and Miller [1], Miller [2] and Scott and Fenves [3]. Our extensions include the retention of subspace information over multiple timesteps, and a special correction at the end of a timestep that allows for corrections to be accepted with verified low residual with as little as a single residual evaluation per timestep on average. In the case of a single residual evaluation per timestep, the method has zero additional computational cost compared to uncoupled or unidirectionally coupled simulations. We expect these enhancements to be generally applicable to other multiscale coupling applications where timestepping occurs. In addition we have developed a "pressure-drop" residual which allows for stable coupling of flows between a 3D incompressible CFD application and another (lower-dimensional) fluid system. We expect this residual to also be useful for coupling non-respiratory incompressible fluid applications, such as multiscale simulations involving blood flow. The lower-dimensional models that are considered in this study are sets of simple ordinary differential equations (ODEs) representing the compliant mechanics of symmetric human pulmonary airway trees. To validate the method, we compare the predictions of hybrid CFD-ODE models against an ODE-only model of pulmonary airflow in an idealized geometry. Subsequently, we couple multiple sets of ODEs describing the distal lung to an imaging-based human lung geometry. Boundary conditions in these models consist of atmospheric pressure at the mouth and intrapleural

  12. A bidirectional coupling procedure applied to multiscale respiratory modeling

    International Nuclear Information System (INIS)

    In this study, we present a novel multiscale computational framework for efficiently linking multiple lower-dimensional models describing the distal lung mechanics to imaging-based 3D computational fluid dynamics (CFDs) models of the upper pulmonary airways in order to incorporate physiologically appropriate outlet boundary conditions. The framework is an extension of the modified Newton’s method with nonlinear Krylov accelerator developed by Carlson and Miller [1], Miller [2] and Scott and Fenves [3]. Our extensions include the retention of subspace information over multiple timesteps, and a special correction at the end of a timestep that allows for corrections to be accepted with verified low residual with as little as a single residual evaluation per timestep on average. In the case of a single residual evaluation per timestep, the method has zero additional computational cost compared to uncoupled or unidirectionally coupled simulations. We expect these enhancements to be generally applicable to other multiscale coupling applications where timestepping occurs. In addition we have developed a “pressure-drop” residual which allows for stable coupling of flows between a 3D incompressible CFD application and another (lower-dimensional) fluid system. We expect this residual to also be useful for coupling non-respiratory incompressible fluid applications, such as multiscale simulations involving blood flow. The lower-dimensional models that are considered in this study are sets of simple ordinary differential equations (ODEs) representing the compliant mechanics of symmetric human pulmonary airway trees. To validate the method, we compare the predictions of hybrid CFD–ODE models against an ODE-only model of pulmonary airflow in an idealized geometry. Subsequently, we couple multiple sets of ODEs describing the distal lung to an imaging-based human lung geometry. Boundary conditions in these models consist of atmospheric pressure at the mouth and intrapleural

  13. Uplifting Leadership

    Science.gov (United States)

    Hargreaves, Andy; Boyle, Alan

    2015-01-01

    To find out how organizations turn failure into success, Andrew Hargreaves and his colleagues studied more than 15 business, sports, and education organizations. They found that the secret to these organizations' success came down to just two words: uplifting leadership. Uplifting leadership, write Hargreaves and Boyle in this article, raises…

  14. John Forbes (ca. 1568-1634)

    NARCIS (Netherlands)

    Jong, Christiaan George Frederik de

    1987-01-01

    This book deals sith the life and work of the Scotsman John Forbes (c.1568-1634), who studied at the University of Saint Andrews and then served as a minister of the Church of Scotland (1593-1605). During his ministy he witnessed and later became a victim of the fierce battle between the Calvinistic

  15. Generative Perspectives on Language Acquisition: Empirical Findings, Theoretical Considerations, and Crosslinguistic Comparisons.

    Science.gov (United States)

    Clahsen, Harald, Ed.

    The collection of essays and studies concerning generative grammar and first and second language acquisition includes: "The Optional-Infinitive Stage in Child English: Evidence from Negation" (Tony Harris, Ken Wexler); "Towards a Structure-Building Model of Acquisition" (Andrew Radford); "The Underspecification of Functional Categories in Early…

  16. Impact of Future Trends on Marketing Strategy

    OpenAIRE

    Dr R. K. Srivastava; S.T. Sakunke

    2011-01-01

    This paper describes how impact of product range, price level, product positioning and technological change can help in formulating optimal business strategy for automotive manufacturers. A key aspect of identifying future trend of market is the key gradient to formulate proper marketing strategy - Mr. Andrew Young (2008).

  17. Viewpoint: Transatlantic Scholarship on Victorian Literature and Culture

    OpenAIRE

    Isobel Armstrong

    2009-01-01

    This viewpoint offers a comparison of recent British and American criticism of Victorian literature and culture, encompassing Dickens, Tennyson, the epic and ethical criticism. Discussion centres on recent studies by Sally Ledger, Rosemarie Bodenheimer, Cornelia Pearsall, Kirstie Blair, Simon Dentith, Herbert Tucker, Andrew Miller and Mike Sanders.

  18. In Defense of Clarity in the Study of Personal Epistemology

    Science.gov (United States)

    Sandoval, William A.

    2009-01-01

    Andrew Elby (this issue) argues that researchers in the field of personal epistemology should beware insistence on a narrow definition of epistemology to guide this work. His argument is a response to suggestions (Hofer & Pintrich, 1997; Sandoval, 2005) that the study of personal epistemology should focus on people's views about knowledge and…

  19. A Perspective on Carnegie Corporation's Program, 1983-1997.

    Science.gov (United States)

    Hamburg, David A.

    The Carnegie Corporation's mission is to continue Andrew Carnegie's philanthropic preoccupations with promoting education and world peace. In this essay, retiring Carnegie Corporation President David A. Hamburg provides a detailed accounting of his stewardship of the foundation since 1983, when he set forth new program directions in the context of…

  20. Should Actuarial Risk Assessments Be Used with Sex Offenders Who Are Intellectually Disabled?

    Science.gov (United States)

    Harris, Andrew J. R.; Tough, Susan

    2004-01-01

    Background: Objective actuarial assessments are critical for making risk decisions, determining the necessary level of supervision and intensity of treatment ( Andrews & Bonta 2003). This paper reviews the history of organized risk assessment and discusses some issues in current attitudes towards sexual offenders with intellectual disabilities.…

  1. Animeeritud Sookoll ruulib : Kolmas festivalikiri maailma praeguse hetke filmipealinnast Cannes'ist / Jaak Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Jaak

    2001-01-01

    Huvitavamad seninähtud filmid : täispikk animatsioon "Shrek" : režissöörid Andrew Adamson ja Vicky Jenson : Ameerika Ühendriigid, dokumentaalfilm "ABC Africa" : režissöör Abbas Kiarostami : Iraan ja mängufilm "Päikesevarjutus" ("Kandahar") : režissöör Mohsen Makhmalbaf : Iraan

  2. Comparison of Quality of Life Perceptions of Caregivers of Individuals with Intellectual Disabilities in the United States and the Czech Republic

    Science.gov (United States)

    Raver, Sharon A.; Michalek, Anne M.; Michalik, Jan; Valenta, Milan

    2010-01-01

    Caregivers of individuals with disabilities in the United States have been reported to experience additional hardships than families with typical children as they attempt to balance family and work (Parish, Rose, Grinstein-Weiss, Richman, & Andrews, 2008). In this study, 31 caregivers of individuals with intellectual disabilities from the United…

  3. 75 FR 69158 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2010-11-10

    ... Atterbury Phounsavan Saylom Phounsayan Saylom Piccinin Andrea Prenoveau Guy Joseph Prenoveau Lucile Marie... Besner Rejean Besson William Thomas Lim Bider Marc Daniel Bignell Carl Black Johanna Marie Blackwell... Lee Green Ronald Milner Guerrero Tempest Manzano Haag Toralf Andrew Haberstich Anne Hahr Thomas...

  4. CCPIT and USCBC,Bridging Sino-US Trade

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ On November 4,Mr.Wan Jifei,President of CCPIT met the del egation of the US-China Business Council,Inc.(USCBC)led by Mr.Andrew Liveris,President of USCBC and chairman& CEO of the America's Dow Chemical.

  5. Commensal Bacteria Control Cancer Response to Therapy by Modulating the Tumor Microenvironment | Poster

    Science.gov (United States)

    Noriho Iida, Amiran Dzutsev, C. Andrew Stewart, Loretta Smith, Nicolas Bouladoux, Rebecca A. Weingarten, Daniel A. Molina, Rosalba Salcedo, Timothy Back, Sarah Cramer, Ren-Ming Dai, Hiu Kiu, Marco Cardone, Shruti Naik, Anil K. Patri, Ena Wang, Francesco M. Marincola, Karen M. Frank, Yasmine Belkaid, Giorgio Trinchieri, Romina S. Goldszmid Science 342(6161):967-970, 2013

  6. JSTOR: The Development of a Cost-Driven, Value-Based Pricing Model.

    Science.gov (United States)

    Guthrie, Kevin M.

    JSTOR (Journal STORage project) began as a project of The Andrew W. Mellon Foundation designed to help libraries address growing persistent space problems. JSTOR was established as an independent not-for-profit organization with its own Board of Trustees in August 1995. This paper summarizes how JSTOR's economic model was developed, lessons…

  7. 77 FR 60450 - Senior Executive Service Performance Review Board

    Science.gov (United States)

    2012-10-03

    .... Andrews, John Armstrong, Charles R. Athmann, Ronald Barber, Delores Baroukh, Nader Barrett, Lawerence.... Dolan, Mark E. Dorko, Jeffrey J. Duong, Anh Durham, Debra Edge, Peter T. Edwards, Eric L. Elias, Richard..., Matthew L. Kruger, Mary Kubiak, Lev J. Langlois, Joseph E. Lederer, Calvin M. Legomsky, Stephen H....

  8. Muusikauudiseid maailmast / Nele-Eva Steinfeld

    Index Scriptorium Estoniae

    Steinfeld, Nele-Eva

    2015-01-01

    Lühisõnumeid maailmast: Pariisis avati uus kontserdimaja. Pärt enim esitatud helilooja. Preemia John Luther Adamsile. Andrew Litton ja New York City Ballet. Naxos avas uue striimimisteenuse. Fanny Waterman lõpetab tegevuse Leedsi konkursi juures. Vanim mitmehäälne muusikanäide?

  9. 76 FR 39358 - Receipt of Several Pesticide Petitions Filed for Residues of Pesticide Chemicals in or on Various...

    Science.gov (United States)

    2011-07-06

    .... The sample was brought to final volume with water and mixed in preparation for liquid chromatography... performance liquid chromatography (HPLC) with ultraviolet (UV) detection or confirmatory LC/MS. Contact... bifenazate in or on raw agricultural commodities. Contact: Andrew Ertman, (703) 308-9367, e-mail...

  10. The Fifth Wave: Using the Internet To Teach the Industrial Revolution.

    Science.gov (United States)

    Franzen, Sarah

    2000-01-01

    Provides an annotated list of websites pertaining to the Industrial Revolution. Topics include the Boott Cotton Mills in Massachusetts, coal mining in the Gilded Age and Progressive Era, labor conflicts of the Progressive Era, Andrew Carnegie, and the Triangle Shirtwaist Factory fire. (CMK)

  11. ANALYSIS OF DNA DAMAGE AND REPAIR IN SKIN FIBROBLASTS OF INFANT AND OLDER CHILDREN USING THE IN VITRO ALKALINE COMET ASSAY

    Science.gov (United States)

    ANALYSIS OF DNA DAMAGE AND REPAIR IN SKIN FIBROBLASTS OF INFANT AND OLDER CHILDREN USING THE IN VITRO ALKALINE COMET ASSAY, Alan H. Tennant1, Geremy W. Knapp1 and Andrew D. Kligerman1, 1Environmental Carcinogenesis Division, National Health and Environmental Effects Research Lab...

  12. Siim Nestor soovitab : Reel People. Selffish. Xploding Plastix / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2005-01-01

    Popmuusika üritustest: briti ansambel Reel People ja ansambel Hinkus 28. apr. Rock Café's Tallinnas Jazzkaare raames, läti diskor ja produtsent Andrew Eigus (Selffish) koos eesti diskoritega 29. apr. peol Pirita jõe suudmes laeval Monica, norra duo Xpoding Plastix ja ansambel Kismabande 29. apr. Sakala keskuse suures saalis Jazzkaare raames

  13. Sindi tähistab kunstniku 110. sünniaastapäeva / Anu Jürisson

    Index Scriptorium Estoniae

    Jürisson, Anu

    2002-01-01

    Sindist pärit ja Ameerikas tuntuks saanud kunstnikust ja akadeemikust Andrew Winterist (surn. 27. okt. 1958). Kunstniku 110. sünniaastapäeva (päeva moto: "Noorus Sindis, tuntuks Ameerikas") puhul kuulutasid Sindi muuseum ja kool välja noorte joonistusvõistluse "Pilte kodukandist"

  14. Academic Training Lecture 2011

    CERN Multimedia

    PH Department

    2011-01-01

    Regular Programme 22 & 23 February 2011 Mr. Derrick Brashear, Jeffrey Altman (Your File System Inc.) from 11:00 to 12:00 - Bldg. 222-R-001 - Filtration Plant Tuesday 22 February 2011 A History of the Andrew File System Derrick Brashear and Jeffrey Altman will present a technical history of the evolution of Andrew File System starting with the early days of the Andrew Project at Carnegie Mellon through the commercialization by Transarc Corporation and IBM and a decade of OpenAFS. The talk will be technical with a focus on the various decisions and implementation trade-offs that were made over the course of AFS versions 1 through 4, the development of the Distributed Computing Environment Distributed File System (DCE DFS), and the course of the OpenAFS development community. The speakers will also discuss the various AFS branches developed at the University of Michigan, Massachusetts Institute of Technology and Carnegie Mellon University. Wednesday 23 February The Future of the Andrew File System T...

  15. Ülesande lahendamise eest saab miljon dollarit / Harli Uljas

    Index Scriptorium Estoniae

    Uljas, Harli

    2000-01-01

    Maailma tippmatemaatikutele pakutakse seitset miljonit dollarit seitsme raske võrduse lahendamise eest. Clay Mathematics Institute pani probleemi üles oma internetileheküljele ja teatas sellest Pariisis toimunud konverentsil. Princetoni ülikooli matemaatikaprofessori Andrew Wilesi sõnul on need seitse matemaatilist probleemi selle ala kõige suuremad lahendamata väljakutsed

  16. Balancing the books

    OpenAIRE

    Foster, Allen

    2007-01-01

    Technically the US Food and Drug Administration goes out of business at the end of September, when legislation authorising it expires. The US Congress is working on a new law to address some of the controversies that have dogged the agency in recent years. FDA commissioner Andrew von Eschenbach talks to Bob Roehr

  17. Harvard Education Letter. Volume 28, Number 2, March-April 2012

    Science.gov (United States)

    Chauncey, Caroline T., Ed.

    2012-01-01

    "Harvard Education Letter" is published bimonthly at the Harvard Graduate School of Education. This issue of "Harvard Education Letter" contains the following articles: (1) Course Credits on the Quick: Controversial Online Recovery Programs Speed the Path to Graduation (Andrew Brownstein); (2) Collaborating to Make Schools More Inclusive…

  18. A Place to Call Home——Rescued moon bears get to live a decent life

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    On February 8, 2006, a piece of sad news came out of the Moon Bear Rescue Center in Chengdu, capital city of southwest China's Sichuan Province. Andrew, the first moon bear rescued by the Animals Asia Foundation, which sponsors the center, died of liver cancer, thought to have arisen from the massive infec-

  19. The Influence of Relational Complexity and Strategy Selection on Children's Reasoning in the Latin Square Task

    Science.gov (United States)

    Perret, Patrick; Bailleux, Christine; Dauvier, Bruno

    2011-01-01

    The present study focused on children's deductive reasoning when performing the Latin Square Task, an experimental task designed to explore the influence of relational complexity. Building on Birney, Halford, and Andrew's (2006) research, we created a version of the task that minimized nonrelational factors and introduced new categories of items.…

  20. Jane Austen: A Collection of Critical Essays. Twentieth Century Views Series.

    Science.gov (United States)

    Watt, Ian, Ed.

    One of a series of works aimed at presenting contemporary critical opinion on major authors, this collection includes essays by Virginia Woolf, C. S. Lewis, Edmund Wilson, Ian Watt, Alan D. McKillop, Reuben A. Brower, Marvin Mudrick, Mark Schorer, Arnold Kettle, Lionel Trilling, Kingsley Amis, Andrew H. Wright, Donald J. Greene, and D. W.…

  1. Policy interventions designed to increase household savings rates should be based on high quality evidence of saving behaviour

    OpenAIRE

    Crossley, Thomas F.; Emmerson, Carl; Leicester, Andrew

    2012-01-01

    The Institute for Fiscal Studies (IFS) recently released new research relating to the efficacy of policies aimed at increasing household saving rates. The authors, Thomas F. Crossley, Carl Emmerson and Andrew Leicester, find that there are significant gaps in the evidence base, and more research is needed to isolate the causal effects of different approaches.

  2. Financial Measures Conference: Uses of College and University Financial Assessment in Institutional Management and Public Policy Analysis. Proceedings of the 1980 Working Conference (Annapolis, Maryland, October 23-24, 1980).

    Science.gov (United States)

    Stich, Judith, Ed.

    Proceedings of the 1980 Financial Measures Conference are presented. Papers and authors are as follows: "Ratio Analysis in Higher Education" (John Minter); "Computerized Application of Financial Assessment Technology" (Daniel Updegrove and Stephen D. Campbell); "The Uses and Utility of HEGIS Financial Data" (Loyd Andrew and James Hyatt); "Problems…

  3. Interaction-round-a-face models with fixed boundary conditions the ABF fusion hierarchy

    CERN Document Server

    Behrend, R E; O'Brien, D L; Behrend, Roger E; Pearce, Paul A; O'Brien, David L

    1995-01-01

    We use boundary weights and reflection equations to obtain families of commuting double-row transfer matrices for interaction-round-a-face models with fixed boundary conditions. In particular, we consider the fusion hierarchy of the Andrews-Baxter-Forrester models, for which we find that the double-row transfer matrices satisfy functional equations with an su(2) structure.

  4. Väike kala kohaneb paremini

    Index Scriptorium Estoniae

    2015-01-01

    Lauren Sallan Pennsylvania ülikoolist ja Andrew Galimberti Kalamazoo koledžist uurisid Devoni väljasuremislaine eelsete ja järgsete fauna esindajate, peamiselt kalade, kehapikkust ning leidsid, et väikesed liigid kohanevad uute oludega kiiremini kui suuremad liigid, mis on pikemaealised ja väikese paljunemiskiirusega

  5. Pop / Raul Saaremets

    Index Scriptorium Estoniae

    Saaremets, Raul

    2006-01-01

    Heliplaatidest: Giant Drag "Hearts and Unicorns", Speak Low "I'm Gonna Groove YA!!", Agent M "Šokolaad EP", A.F.I. "Decemberunderground", Angels & Airwaves "We Don't Need To Whisper", Andrew Liles "In My Father's House are Many Mansions"

  6. A comparison of graphical design techniques for parallel, distributed software

    NARCIS (Netherlands)

    M. Polman; M.R. van Steen

    1994-01-01

    textabstractWe have compared three graphical design techniques, OMT, ADL, and PARSE, on their suitability for the development of parallel/distributed applications. Our method has been to use all three of them in modeling one, existing, application: a backup facility running within the Andrew File Sy

  7. The Genus Antirrhinum (Snapdragon): A Flowering Plant Model for Evolution and Development

    OpenAIRE

    sprotocols

    2014-01-01

    Authors: Andrew Hudson, Joanna Critchley and Yvette Erasmus Corresponding author ([]()) ### INTRODUCTION The *Antirrhinum* species group comprises approximately 20 morphologically diverse members that are able to form fertile hybrids. It includes the cultivated snapdragon *Antirrhinum majus*, which has been used as a model for biochemical and developmental genetics for more than 75 yr. The research infrastructure for *A. majus*, together...

  8. Napier [Napeir, Nepair, Nepeir, Neper, Napare, Naper, Naipper], John [Jhone] (1550-1617)

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    Born in Merchiston Castle, Edinburgh, Scotland, educated in protestant theology at St Andrews University, and on the continent of Europe (Paris, Italy and the Netherlands). Invented logarithms, formulae used in solving spherical triangles (Napier's analogies) and Napier's bones, an `analog computer' used for multiplying dividing and taking square and cube roots. Logarithms were a breakthrough...

  9. The relationship between political donations and peerages shows the need for party finance and House of Lords reform

    OpenAIRE

    Mell, Andrew

    2015-01-01

    Allegations that membership of the House of Lords and large political donations go hand-in-hand stretch back hundreds of years, with Tony Blair at one point questioned by police on the issue. Here Andrew Mell illustrates a direct statistical link, and argues that it shows the need for reform of both the House of Lords and our party funding system.

  10. Emergency Preparedness – Working in Partnership

    Directory of Open Access Journals (Sweden)

    Simon Lewis

    2012-07-01

    Full Text Available I had the immense privilege to provide a presentation of the above title to a conference at the University of St. Andrews in February of this year. The conference, entitled ‘Assessing the Emergency Response to Terrorism’, was hosted by the University’s Centre for the Study of Terrorism and Political Violence (CSTPV.

  11. Eilne, tänane ja homne ehtekunst Marzees / Eilve Manglus

    Index Scriptorium Estoniae

    Manglus, Eilve, 1977-

    2004-01-01

    Euroopa ehtekunstikoolide lõputööde väljapanek Marzee galeriis kuni 6. X. Kuraator Manuel Vilhena. Eestit esindanud Kertu Tubergi, Maarja Niinemäe ja Epp Perteli ning Bas Boumani, Jantine Bindelsi (Holland) ja Andrew Lambi (London) töödest. Marzee kollektsiooni kuuluvad EKA lõpetanud ehtekunstnike Villu Plingi, Piret Hirve ja Kristiina Lauritsa ehted

  12. Re-skilling the Social Practices: Open Source and Life-Towards a Commons-Based Peer Production in Agro-biotechnology?

    NARCIS (Netherlands)

    Nicolosi, G.; Ruivenkamp, G.T.P.

    2013-01-01

    Inspired by the thinking of authors such as Andrew Feenberg, Tim Ingold and Richard Sennett, this article sets forth substantial criticism of the 'social uprooting of technology' paradigm, which deterministically considers modern technology an autonomous entity, independent and indifferent to the so

  13. 75 FR 54957 - Qualification of Drivers; Exemption Applications; Vision

    Science.gov (United States)

    2010-09-09

    ... deficiency: James R. Bodine, Robert L. Borsh, Larry E. Carter, Albert M. DiVella, Steven Gahart, Martin E... following 15 applicants had no experience operating a CMV: Leon Andrews, Clay Burns, Tracy E. Duke, James R... the 3-year period: Adam O. Carson, Joe H. Saine, Joseph W. Schmit. One applicant, James McKnight,...

  14. Pop / Mart Juur

    Index Scriptorium Estoniae

    Juur, Mart, 1964-

    2002-01-01

    Heliplaatidest Andrew WK "I Get Wet". Dan The Automator "Wanna Buy A Monkey". Erinevad esitajad "Futurism". Tony Levin "Pieces of the Sun". Angelique Kidjo "Black Ivory Soul". Electric Wizard "Let Us Prey". Bad Religion "Punk Rock Songs (The Epic Years)". Soft Cell "The Very Best Of Soft Cell"

  15. Carl Von Clausewitz's on War A Modern-Day Interpretation of a Strategy Classic

    CERN Document Server

    Holmes, Andrew

    2010-01-01

    Here, Andrew Holmes' interpretation of On War illustrates the timeless nature of von Clausewitz's insights by bringing them to life through 52 modern case studies of business and society. This brilliant interpretation of On War is an entertaining accompaniment to one of the most famous strategy books ever written.

  16. Pop nädal : popsündmus. POPtabel : DAC Deutsche Alternative Charts

    Index Scriptorium Estoniae

    2002-01-01

    13.-14. juulil toimuvast Baltimaade suurimast tantsumuusika festivalist Sun Dance Music Festivalist. Augustis tuleb müüki George Michaeli uus singel "Shoot the Dog". Ansambli Depeche Mode liige Andrew Fletcher loob oma plaadifirma. Ansambli Duran Duran uuest albumist

  17. Nursing Students' Attitudes toward Science in the Nursing Curricula

    Science.gov (United States)

    Maroo, Jill Deanne

    2013-01-01

    The nursing profession combines the art of caregiving with scientific concepts. Nursing students need to learn science in order to start in a nursing program. However, previous research showed that students left the nursing program, stating it included too much science (Andrew et al., 2008). Research has shown a correlation between students'…

  18. 77 FR 12892 - Medley Capital Corporation, et al.; Notice of Application

    Science.gov (United States)

    2012-03-02

    ...)(19) of the Act (the ``Independent Directors''). Each of Andrew Fentress, Brooke Taube and Seth Taube... will ensure that the Independent Directors will act independently in evaluating the Co-Investment Program, because the ability of the Adviser or the Principals to influence the Independent Directors by...

  19. 78 FR 65728 - Medley Capital Corporation, et al.; Notice of Application

    Science.gov (United States)

    2013-11-01

    ... meaning of section 2(a)(19) of the Act (the ``Independent Directors''). Each of Andrew Fentress, Brooke...'') currently consists of five members, three of whom are Independent Directors. Two of the Principals, Brook... condition will ensure that the Independent Directors will act independently in evaluating the Co-...

  20. 78 FR 5514 - Supplemental Environmental Assessment and Finding of No Significant Impact for License Renewal...

    Science.gov (United States)

    2013-01-25

    ... Commission. Andrew Persinko, Deputy Director, Decommissioning and Uranium Recovery Licensing Directorate... Uranium One USA, Inc., Willow Creek Uranium In-Situ Recovery Project, Johnson and Campbell Counties, WY... Materials License SUA-1341 for continued uranium production operations and in-situ recovery (ISR) of...

  1. 78 FR 25484 - License Amendment for Anadarko Petroleum Corporation, Bear Creek Facility, Converse County, Wyoming

    Science.gov (United States)

    2013-05-01

    ... Register Notice (77 FR 24993) requesting comments on the licensee's proposed amendment. No comments were... Regulatory Commission. Andrew Persinko, Deputy Director, Decommissioning and Uranium Recovery Licensing... compliance (POC) wells and the deletion of License Condition (LC) No. 47 for its Bear Creek Uranium...

  2. 78 FR 70077 - Issuance of Materials License for U.S. Army Installation Management Command

    Science.gov (United States)

    2013-11-22

    ... license was previously noticed in the Federal Register on August 13, 2009 (74 FR 40855), with a notice of... Board (ASLBP) was established to preside over the proceeding (74 FR 62830). On January 13, 2010, the... Nuclear Regulatory Commission. Andrew Persinko, Deputy Director, Decommissioning and Uranium...

  3. 78 FR 11688 - Notice of Issuance of Amendment to Facility License R-77 Incorporating a Decommissioning Plan for...

    Science.gov (United States)

    2013-02-19

    ..., 2012 (77 FR 27487). No comments were received in response to this notice. Subsequently, the NRC.... Andrew Persinko, Deputy Director Decommissioning and Uranium Recovery, Licensing Directorate, Division of... COMMISSION Notice of Issuance of Amendment to Facility License R-77 Incorporating a Decommissioning Plan...

  4. Narnia - imedemaa riidekapis / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare

    2006-01-01

    Eestik. ilm.: Lewis, Clive Staples. Lõvi, nõid ja riidekapp ; Prints Caspian ; Imetegija õepoeg ; Hobune ja tema poiss : [jutustused lastele. Tallinn] : Logos, 1995-2000. (Narnia lood). Ka2005.a. USA-s Andrew Adamsoni lavastatud samanimelisest mängufilmist

  5. Examining the Construct Validity of the Psychopathic Personality Inventory-Revised: Preferential Correlates of Fearless Dominance and Self-Centered Impulsivity

    Science.gov (United States)

    Edens, John F.; McDermott, Barbara E.

    2010-01-01

    Although the construct of psychopathy is frequently construed as a unitary syndrome, the Psychopathic Personality Inventory (PPI; Lilienfeld & Andrews, 1996) and its revision, the PPI-R (Lilienfeld & Widows, 2005), are composed of 2 scales, termed Fearless Dominance (FD) and Self-Centered Impulsivity (SCI), which appear to reflect orthogonal…

  6. 77 FR 17478 - Change in Bank Control Notices; Acquisitions of Shares of a Bank or Bank Holding Company

    Science.gov (United States)

    2012-03-26

    ... L. Spector GST Family Trust, the Walter W. Spector, Steven D. Spector, Andrew M. Spector, and Nancy S. Spector Dynasty Trusts, and two Phillip J. Spector GST Trusts and as a group acting in concert... S. Spector, Chicago, Illinois, the Phillip J. Spector GST Trust--FBO Michael Spector,...

  7. Notes on Contributors

    Directory of Open Access Journals (Sweden)

    The Editors

    2011-06-01

    Full Text Available Ayesha Abdullah, Anthony C. Alessandrini, Bernadette Cailler, Sonia Dayan-Herzbrun, John E. Drabinski, Nigel C. Gibson, Jane Anna Gordon, Lewis R. Gordon, David-Olivier Gougelet, Janine Jones, Leonard Lawlor, Filippo Del Lucchese, Andrew Poe, Anjali Prabhu, and Matthieu Renault.

  8. A Future Uncertain:Why Brexit Would Leave Scotland More Dependent on Westminster

    OpenAIRE

    GLENCROSS, Andrew

    2015-01-01

    If the UK votes to the leave the EU, it will most likely establish a Swiss-style trade relationship to replace EU membership, writes Andrew Glencross. He suggests that future UK governments would be unable to change this relationship unilaterally without risking retaliation, leaving Scotland more dependent on the UK government for good relations with the EU.

  9. Second nuclear era: a new start for nuclear power

    International Nuclear Information System (INIS)

    The thrust of this book is that nuclear power should be fixed, not buried. It is based on a study sponsored by the Andrew W. Mellon Foundation at Oak Ridge National Laboratory. This book is a sober, technically based study of how to make the second nuclear era safe and successful

  10. Hämmastavad esikteosed / Aita Kivi

    Index Scriptorium Estoniae

    Kivi, Aita, 1954-

    2002-01-01

    Sisu : Andrew Miller. Salakaval valu; Helen Dewitt. Viimane samurai; Michel Faber. Naha all; Ana̐s Nin. Venuse delta; Eeva Park. Vaba langemine; Henri Troyat. Kohutavad keisrinnad; 11. september : terrorirünnaku tagamaad : / [koost. Stefan Aust, Cordt Schnibben... jt.]; Deepak Chopra. Täiuslik tervis; Charlie Jones. Elu on võrratu; Matt Ridley, Matt. Vooruse lätted

  11. Hamilton,Sir William Rowan(1805-1865)

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Shortly after Hamilton submitted his paper and while still an undergraduate,Trinity College elected him to the post of Andrews professor of astronomy and royal astronomer of Ireland’ to succeed Brinkley,who had been made a bishop. Thus an undergraduate(not quite 22years old) became ex officio an examiner of graduates who were candidates

  12. 互操性是王道

    Institute of Scientific and Technical Information of China (English)

    Jonathan Erickson Dr.Dobb‘sJournaf

    2009-01-01

    商业领域中的交流是频繁的。1993年,Andrew Schulman就在Dr.Dobb中撰文《Examining the Windows AARD Detection Code》指出,Microsoft和Novell正在不遗余力地进行合作。Microsoft正在尝试将其beta版的Windows运行在Novell的DRDOS上。

  13. Medication-assisted therapy for opioid addiction

    OpenAIRE

    Tai, Betty; Saxon, Andrew J.; Ling, Walter

    2013-01-01

    The “Medication-Assisted Therapy for Opioid Addiction” session was chaired by Dr. Betty Tai and had three presenters. The presenters (and their topics) were: Dr. Andrew J. Saxon (Methadone and Buprenorphine for Treatment of Opioid Addiction and HIV Risk Reduction), Dr. Walter Ling (Opioid Antagonist Treatment for Opioid Addiction), and Dr. Betty Tai (Chronic Care Model for Substance Use Disorder).

  14. Surviving the Legitimacy Challenge.

    Science.gov (United States)

    Yinger, Robert J.; Nolen, Amanda L.

    2003-01-01

    Uses Andrew Abbott's sociological analysis of the professionalization process and the legal term "jurisdiction" to explore the legitimacy of the teaching profession. Discusses professional jurisdiction, knowledge jurisdiction, and social jurisdiction. Offers recommendations for universities to gain jurisdiction and legitimacy in the education of…

  15. The Grief Account: Dimensions of a Contemporary Bereavement Genre

    Science.gov (United States)

    Dennis, Michael Robert

    2008-01-01

    The genre of the grief account is identified to include published narratives of surviving grief. Thematic analysis of Andrew Holleran's (2006) "Grief: A Novel," Lolly Winston's (2004) "Good Grief: A Novel," Joan Didion's (2005) "The Year of Magical Thinking," and J. Canfield and M. V. Hansen's (2003) "Chicken Soup for the Grieving Soul: Stories…

  16. What the White "Squaws" Want from Black Hawk: Gendering the Fan-Celebrity Relationship

    Science.gov (United States)

    Helton, Tena L.

    2010-01-01

    Americans in the East were great fans of Black Hawk, whose popularity on tour overtook that of Andrew Jackson's parallel tour of the Northeast. Undoubtedly, then, Black Hawk was a celebrity. He remained popular even in 1837, when he attended Catlin's gallery opening in New York, which included his 1832 painting of Black Hawk. Black Hawk may also…

  17. Design Thinking for Life

    Science.gov (United States)

    Watson, Andrew D.

    2015-01-01

    According to Vande Zande (2007), understanding the Design Process can help students become stronger critical thinkers. With this in mind, Andrew Watson decided to undertake an observational case study in which he focused directly on Design Thinking and addressed it more intentionally in his teaching. The hope was to understand how students saw…

  18. 77 FR 17501 - Agency Information Collection Activities: Information Collection Renewal; Comments Requested...

    Science.gov (United States)

    2012-03-26

    ... Information Collection. The Department of Justice (DOJ), Criminal Division, Child Exploitation and Obscenity... contact Andrew G. Oosterbaan, Chief, Child Exploitation and Obscenity Section, Criminal Division, United... Sexually Explicit Performances. (3) Agency form number, if any: None. (4) Affected public who will be...

  19. Types of Dementia

    Science.gov (United States)

    ... beta-amyloid (plaques) and twisted strands of the protein tau (tangles) as well as evidence of nerve cell ... TDP43-related Dementia 2013 Andrew Watt Characterisation of Tau Imaging Ligands for ... Prion Protein as a Therapeutic Target in Alzheimer's Disease 2007 ...

  20. Sõrmuste isand. Sünopsis / ref. Erkki Luuk

    Index Scriptorium Estoniae

    2003-01-01

    J.R.R. Tolkieni "Sõrmuste isanda" järgi loodud Peter Jacksoni kaks filmi - "Sõrmuste isand : Sõrmuste vennaskond" ("The Lord of the Rings : The Fellowship of the Ring") ja "Kaks kantsi" ("The Lord of the Rings : The Two Towers"). Ekraniseeringute lühitutvustus ning operaatori Andrew Lesnie ja režissööri raskustest teose ekraniseerimisel

  1. 75 FR 25212 - Federal Advisory Committee; Advisory Panel on Department of Defense Capabilities for Support of...

    Science.gov (United States)

    2010-05-07

    ... at the RAND Corporation, 1200 South Hayes Street, Arlington, Virginia 22202, 4th floor conference... Center (FFRDC): Andrew Morral, Principal Investigator, telephone 703-413-1100, x5119, e-mail: morral@rand.org ; The RAND Corporation, 1200 South Hayes Street, Arlington, Virginia, 22202. Advisory...

  2. 75 FR 9588 - Advisory Panel on Department of Defense Capabilities for Support of Civil Authorities After...

    Science.gov (United States)

    2010-03-03

    ... held at the RAND Corporation, 1200 South Hayes Street, Arlington, Virginia 22202, 4th floor conference... Research and Development Center (FFRDC): Andrew Morral, Principal Investigator, telephone 703-413-1100, x5119, e-mail: morral@rand.org ; The RAND Corporation, 1200 South Hayes Street, Arlington,...

  3. IRA Award-Winning Research.

    Science.gov (United States)

    Seifert, Mary

    1984-01-01

    Summarizes award-winning research produced by Andrew M.Hess, Sirkka-Liisa Rauramo, Richard L. Allington, Donna E. Alvermann and David A. Hayes, Lesley M. Morrow and Carol S. Weinstein, Taffy E. Raphael and Bonnie B. Armbruster, Nancy Nelson Spivey, and Courtney B. Cazden. (FL)

  4. 75 FR 36372 - Advisory Panel on Department of Defense Capabilities for Support of Civil Authorities After...

    Science.gov (United States)

    2010-06-25

    ... RAND Corporation, 1200 South Hayes Street, Arlington, Virginia 22202, 4th floor conference facilities... Research and Development Center (FFRDC) Andrew Morral, Principal Investigator, telephone 703-413-1100, x5119, e-mail: morral@rand.org ; The RAND Corporation, 1200 South Hayes Street, Arlington, VA...

  5. Eksperdi-usk ja amatööri hirm / Urmo Kübar

    Index Scriptorium Estoniae

    Kübar, Urmo, 1978-

    2009-01-01

    Autor võrdleb erinevusi ja sarnasusi ekspertide ja kodanikualgatuse korras koondunud rühmituste poolt koostatud tegevusjuhiste ja arengukavade eripärasid. Hinnangud põhinevad Andrew Keeni raamatul "Amatöörikultus" (The Cult of the amateur)

  6. If the Intelligence and Security Committee is to be an effective scrutineer, it must be able to rely on the accuracy of the information provided by the security services

    OpenAIRE

    Defty, Andrew

    2014-01-01

    Recent events at the Intelligence and Security Committee (ISC), the Parliamentary body tasked with holding MI5, MI6, and GCHQ to account, have shown the difficulty of knowing fully the activities of these organisations. Andrew Defty explores the possibility that representatives from GCHQ may have recently given a misleading impression to the ISC.

  7. Religious Imagery in Popular Music Theatre

    DEFF Research Database (Denmark)

    Eigtved, Michael

    2007-01-01

    Artiklen undersøger hvordan religiøse billeder, narrative strategier og andre elementer er en del af musicalgenren. Der foretages en mere indgående analyse af Richard Rodgers' og Oscar Hammersteins forestilling Carousel samt af Andrew LLoyd Webber og Tim Rices forestilling Evita....

  8. Annual Report 2009

    OpenAIRE

    2010-01-01

    CONTENTS: Chairman’s Statement / Mr. Eddie Sullivan, Chief Executive’s Statement / Bryan Andrews, Public Appointments Service 6, Our Strategy 2008 - 2010 9, Highest Standard of Recruitment and Selection Systems 11, Focused Candidate Relationship Management 19, Education, Research, Development and Benchmarking 22, Internal Supporting Strategies 25, Appendices 31

  9. Annual Report 2008

    OpenAIRE

    2009-01-01

    CONTENTS: Chairman’s Statement / Mr. Eddie Sullivan, Chief Executive’s Statement / Bryan Andrews, Public Appointments Service 6, Our Strategy 2008 - 2010 9, Highest Standard of Recruitment and Selection Systems 11, Focused Candidate Relationship Management 18, Education, Research, Development and Benchmarking 22, Internal Supporting Strategies 26, Appendices 32

  10. Annual Report 2010

    OpenAIRE

    2011-01-01

    CONTENTS: Chief Executive’s Statement / Bryan Andrews, Public Appointments Service 5, Our Strategy 2008 - 2010 8, Highest Standard of Recruitment and Selection Systems 10, Focused Candidate Relationship Management 18, Education, Research, Development and Benchmarking 22, Internal Supporting Strategies 25, Appendices 30

  11. Tigers with Artistic Style.

    Science.gov (United States)

    Holt, Maureen

    2003-01-01

    Presents an art lesson used with sixth-grade students in which they painted their school mascot (a tiger) in the style of a famous artist. Explains that students selected an artist, such as Andrew Wyeth or Edvard Munch. Describes how the students created their tigers. (CMK)

  12. 77 FR 52695 - National Sea Grant Advisory Board

    Science.gov (United States)

    2012-08-30

    ... in the areas of program evaluation, strategic planning, education and extension, science and... Program Web site at http://www.seagrant.noaa.gov/leadership/advisory_board.html . DATES: The announced....seagrant.noaa.gov/leadership/advisory_board.html . Dated: August 24, 2012. Andrew Baldus, Acting...

  13. Ameerika keskkool probleemidega silmitsi / Edgar Krull

    Index Scriptorium Estoniae

    Krull, Edgar

    2001-01-01

    USA-s on hakatud tegema etteheiteid keskkooli (high school) lõpuklassi õppesisule ja töökorraldusele. Ajalehes "The Atlanta Journal-Constitution" ilmus 18. jaan. Andrew Mollisoni artikkel "Liiga palju keskkooli viimase klassi õpilasi tegeleb aja raiskamisega". Kirjutis seab kahtluse alla nii 12. klassi otstarbekuse kui ka keskkooli kui haridusinstitutsiooni üldised põhimõtted

  14. The Social Relevance of Montessori in the First Plane

    Science.gov (United States)

    Andrews, Sarah Werner

    2015-01-01

    This article represents an amazing reversal of linguistic analysis. Usually Montessori language is translated into "state" terminology. In this case, Sarah Werner Andrews puts state quality assessment terms into Montessori language. For example, domains for school readiness include 1) physical wellbeing and motor development, 2) social…

  15. 33 CFR 100.1301 - Seattle seafair unlimited hydroplane race.

    Science.gov (United States)

    2010-07-01

    ... hydroplane race. 100.1301 Section 100.1301 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... unlimited hydroplane race. (a) This section is in effect annually during the last week in July and the first... hydroplane race course and then to the northerly tip of Ohlers Island in Andrews Bay. The western zone...

  16. Enhancing International Business Education through Restructuring Business Schools

    Science.gov (United States)

    Jain, Subhash C.

    2009-01-01

    Many scholars have found fault with the way business schools conduct their business (Pfeffer & Fong, 2002; Mintzberg, 2004; Bennis & O'Toole, 2005; Andrews & Tyson, 2006). This article argues that B-schools should overhaul their curriculum and encourage faculty to undertake research which is useful for practitioners. Suggestions are made for…

  17. Transforming Schools with Technology: How Smart Use of Digital Tools Helps Achieve Six Key Education Goals

    Science.gov (United States)

    Zucker, Andrew A.

    2008-01-01

    In this timely and thoughtful book, Andrew Zucker argues that technology can and will play a central role in efforts to achieve crucial education goals, and that it will be an essential component of further improvement and transformation of schools. The book is marked not only by Zucker's cutting-edge sophistication about digital technologies, but…

  18. Paljastus : Briti tipp-poliitikud mehkeldavad Vene esimiljardäriga / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2008-01-01

    Väidetavalt käisid George Osborne ja Briti konservatiivide rahakoguja Andrew Feldman Vene oligarhilt Oleg Deripaskalt annetust taotlemas. Analüütik Edward Lucas on teinud järelduse, et Venemaa oligarhid on asunud Suurbritanniat kokku ostma

  19. ATLAS TV PROJECT

    CERN Multimedia

    2005-01-01

    Budker Nuclear Physics Institute, Novosibirsk Sequence 1 Shots of aircraft factory where machining for ATLAS is done Shots of aircraft Work on components for ATLAS big wheel Discussions between Tikhonov and Nordberg in workshop Sequence 2 Shots of downtown Novosibirsk, including little church which is mid-point of Russian Federation Sequence 3 Interview of Yuri Tikhonov by Andrew Millington

  20. More than Carpe Diem On the Theme of To his Coy Mistress

    Institute of Scientific and Technical Information of China (English)

    赵金凤

    2008-01-01

    Andrew Marvell's famous poem To his Coy Mistress is commonly considered a seduction poem with the theme of carpe diem.The poet's massive dependence on the sexual imagery,the images of time,eternity,and the decomposition,however,transcends the tradition of the usual carpe diem theme of seduction poem,unfolding the pessimism clad in the erotic overcoat.

  1. Derivative operator and harmonic number identities

    OpenAIRE

    Wei, Chuanan; Gong, Dianxuan

    2011-01-01

    By applying the derivative operator to the corresponding hypergeometric form of a $q$-series transformation due to Andrews [1,Theorem 4], we establish a general harmonic number identity. As the special cases of it, several interesting Chu-Donno type identities and Paule-Schneider type identities are displayed.

  2. 78 FR 39725 - Grenada Lake Hydroelectric Project; Notice Of Proposed Restricted Service List for a Programmatic...

    Science.gov (United States)

    2013-07-02

    ... Choctaw State Street, Jackson, MS 39201. Indians, P.O. Box 6257, Choctaw, MS 39350. Andrew Tomlinson, U.S..., 5681 South Clay Street, Vicksburg, MS 39183. 630 Road, Quapaw, OK 74363. Thomas M. Feldman or... Street, Suite 300, Boston, MA Melacon Drive, Marksville, LA 02114. 71351. Dr. Ian Thompson, THPO,...

  3. 78 FR 39727 - FFP Missouri 2, LLC; Notice of Proposed Restricted Service List for a Programmatic Agreement

    Science.gov (United States)

    2013-07-02

    ... Band of Choctaw State Street, Jackson, MS 39201. Indians, P.O. Box 6257, Choctaw, MS 39350. ] Andrew... Oklahoma, 5681 South Clay Street, Vicksburg, MS 39183. 630 Road, Quapaw, OK 74363. Thomas M. Feldman or... Street, Suite 300, Boston, MA Melacon Drive, Marksville, LA 02114. 71351. Dr. Ian Thompson, THPO,...

  4. 78 FR 41058 - FFP Missouri 2, LLC; Notice of Proposed Restricted Service List For a Programmatic Agreement

    Science.gov (United States)

    2013-07-09

    ... State Street, Jackson, MS 39201 Andrew Tomlinson, U.S. Army Corps Kenneth H. Carlton, THPO, of Engineers..., Choctaw, 39183 MS 39350. Thomas M. Feldman or Jean Ann Lambert, THPO, Quapaw Representative, Free Flow... 300, Boston, MA 02114 Dr. Ian Thompson, THPO, Choctaw Earl Barbry, Jr., Tunica-Biloxi Nation...

  5. Ethics of Gene Therapy Debated.

    Science.gov (United States)

    Borman, Stu

    1991-01-01

    Presented are the highlights of a press conference featuring biomedical ethicist LeRoy Walters of Georgetown University and attorney Andrew Kimbrell of the Foundation on Economic Trends. The opposing points of view of these two speakers serve to outline the pros and cons of the gene therapy issue. (CW)

  6. 78 FR 45535 - Change in Bank Control Notices; Acquisitions of Shares of a Bank or Bank Holding Company

    Science.gov (United States)

    2013-07-29

    ... 30309: 1. P. Bruce Culpepper, Tallahassee, Florida; Richard R. Dostie, Jacksonville, Florida; Charles E. Hughes, Jr., Jacksonville, Florida; J. Malcolm Jones, Jr., Jacksonville, Florida; James T. Katsur, Longwood, Florida; W. Andrew Krusen, Jr., Tampa, Florida; Allan S. Martin, Tampa, Florida; Linda C....

  7. Structural disputes

    Science.gov (United States)

    Donald, Athene

    2013-06-01

    In March this year, the author of a well-regarded science website was revealed to be - wait for it - a woman. The identification of Elise Andrew as the founder of the provocatively titled Facebook page "I Fucking Love Science" was greeted with astonishment, tinged in some cases with outrage.

  8. Disabilities Information Flow: A Disabilities Information Management System

    Science.gov (United States)

    Ling, Bin; Allison, Colin; Nicholl, J. Ross; Moodley, Luke; Roberts, Dave

    2006-01-01

    The Disabilities Information Flow (DIF) project at the University of St Andrews has sought to provide a means of efficiently managing all student disabilities information within the institution and provide appropriate role-based service interfaces for all staff who need to routinely interact with this information. This paper describes the software…

  9. Cracking the Credit Hour

    Science.gov (United States)

    Laitinen, Amy

    2012-01-01

    The basic currency of higher education--the credit hour--represents the root of many problems plaguing America's higher education system: the practice of measuring time rather than learning. "Cracking the Credit Hour" traces the history of this time-based unit, from the days of Andrew Carnegie to recent federal efforts to define a credit hour. If…

  10. Roundtable Audio Discussion

    Directory of Open Access Journals (Sweden)

    Chris Bigum

    2007-01-01

    Full Text Available RoundTable on Technology, Teaching and Tools. This is a roundtable audio interview conducted by James Farmer, founder of Edublogs, with Anne Bartlett-Bragg (University of Technology Sydney and Chris Bigum (Deakin University. Skype was used to make and record the audio conference and the resulting sound file was edited by Andrew McLauchlan.

  11. 75 FR 47624 - U.S. Coral Reef Task Force Public Meeting and Public Comment

    Science.gov (United States)

    2010-08-06

    ... Fish and Wildlife Service U.S. Coral Reef Task Force Public Meeting and Public Comment AGENCY: Fish and... U.S. Fish and Wildlife Service (Service), announce a public meeting of the U.S. Coral Reef Task...: Andrew_Gude@fws.gov ); or Liza Johnson, U.S. Coral Reef Task Force Department of the Interior Liaison,...

  12. 76 FR 7579 - U.S. Coral Reef Task Force Public Meeting and Public Comment

    Science.gov (United States)

    2011-02-10

    ... Fish and Wildlife Service U.S. Coral Reef Task Force Public Meeting and Public Comment AGENCY: Fish and... U.S. Fish and Wildlife Service (Service), announce a public business meeting of the U.S. Coral Reef...-mail: Andrew_Gude@fws.gov ); or Liza Johnson, U.S. Coral Reef Task Force Department of the...

  13. Pop / Mart Juur

    Index Scriptorium Estoniae

    Juur, Mart, 1964-

    2002-01-01

    Heliplaatidest Kiss "The Very Best of Kiss". Andrew Lloyd Webber presents: "A R Rahman's Bombay Dreams". Naughty By Nature "Ilkons". Erinevad esinejad "One word one sound". Diana King "Respect". Caater "Club Space (Estonian Edition)". J.M.K.E. "Ainult planeet". Collage "Parimad lood 1970-1976". Cinematic Orchestra "Every Day". Catatonia "Greatest Hits". Boards of Canada "Geogaddi"

  14. The ERIC Guidebook to the Background Papers for "A Call for Change in Teacher Education: The Report of the National Committee on Excellence in Teacher Education."

    Science.gov (United States)

    ERIC Clearinghouse on Teacher Education, Washington, DC.

    This guidebook contains abstracts of papers by the following authors: (1) Michael D. Andrew; (2) Herman E. Behling, Jr.; (3) Ken Carlson; (4) Frederic R. Cyphert and John E. Nichelson; (5) Barbara Dubitsky; (6) David H. Florio; (7) Eva C. Galambos; (8) Hendrik D. Gideonse; (9) Gary A. Griffin; (10) Martin Haberman; (11) Gene Hall, Walter Doyle,…

  15. Foundation for PSP/CBD and Related Brain Diseases

    Science.gov (United States)

    ... Now Vimeo Facebook Twitter YouTube LinkedIn Forum CurePSP PSP/CBD/MSA EDUCATION PSP CBD MSA Related Brain Diseases FAQ Healthcare Professionals ... Volunteer In Honor of Andrew Szczerba and Supporting PSP Research Sykes and Cooper Farms Corn Maze Wine ...

  16. Can This Marriage Be Saved? The Future of "Neuro-Education"

    Science.gov (United States)

    Schrag, Francis

    2013-01-01

    Neuro-education, a new frontier for educational researchers, has its passionate advocates and equally passionate detractors. Some philosophers, including Noel Purdy and Hugh Morrison, Andrew Davis, and Ralph Schumacher, have argued that the entire enterprise is misguided. I evaluate and challenge their arguments. This permits me to articulate my…

  17. NRV Tweets and RSS feeds

    OpenAIRE

    Roble, Benjamin; Cheng, Justin; Sbitani, Marwan

    2014-01-01

    This collection contains the source code, programs, documentation, and example data used in the project. Please review the "Final Report and Technical Manual" for a comprehensive overview of the project. The open source library Mallet was used and is referenced here: McCallum, Andrew Kachites. "MALLET: A Machine Learning for Language Toolkit." http://mallet.cs.umass.edu. 2002.

  18. CPAP Tips

    Medline Plus

    Full Text Available ... 201,495 views 8:46 Choosing a CPAP BiPAP xPAP Mask: Some Good Masks To Start With - ... 57. Andrew Trammell 71,186 views 11:57 BiPAP Training - Duration: 25:54. FMH Employees 82,543 ...

  19. Student-Loan Inquiry Expands to Examine Issues of Race

    Science.gov (United States)

    Basken, Paul

    2007-01-01

    Federal and state officials investigating the student-loan industry are turning their attention to matters of race, hoping to protect students of the nation's historically black colleges. But the colleges themselves are not sure they want the help. New York's attorney general, Andrew M. Cuomo, and the chairman of the U.S. House education…

  20. Chelsea lillenäitus 2006 / Merilen Mentaal

    Index Scriptorium Estoniae

    Mentaal, Merilen, 1972-

    2006-01-01

    Lille- ja aiandusnäitusel Londonis võistles 46 aeda. Parim aed - The Daily Telegraph Garden, kujundaja Tom Stuart-Smith. Intervjuu Chelsea Flower Show 2006 žürii liikme, inglise maastikuarhitekti Andrew Wilsoniga (foto). 10 värv. ill.

  1. Multiple Sclerosis and Vitamin D

    Science.gov (United States)

    ... Editors David C. Spencer, MD Steven Karceski, MD Multiple sclerosis and vitamin D Andrew J. Solomon, MD WHAT IS VITAMIN ... 133:1869 –1888. 8. Solomon AJ, Whitham RH. Multiple sclerosis and vitamin D: a review and recommendations. Curr Neurol Neurosci ...

  2. Developing and Evaluating Animations for Teaching Quantum Mechanics Concepts

    Science.gov (United States)

    Kohnle, Antje; Douglass, Margaret; Edwards, Tom J.; Gillies, Alastair D.; Hooley, Christopher A.; Sinclair, Bruce D.

    2010-01-01

    In this paper, we describe animations and animated visualizations for introductory and intermediate-level quantum mechanics instruction developed at the University of St Andrews. The animations aim to help students build mental representations of quantum mechanics concepts. They focus on known areas of student difficulty and misconceptions by…

  3. Does Neuroscience Matter for Education?

    Science.gov (United States)

    Schrag, Francis

    2011-01-01

    In this review essay, Francis Schrag focuses on two recent anthologies dealing completely or in part with the role of neuroscience in learning and education: The "Jossey-Bass Reader on the Brain and Learning", edited by Jossey-Bass Publishers, and "New Philosophies of Learning", edited by Ruth Cigman and Andrew Davis. Schrag argues that…

  4. Corruption, Development and the Curse of Natural Resources

    NARCIS (Netherlands)

    Pendergast, S.M.; Clarke, J.A.; Kooten, van G.C.

    2011-01-01

    In 1995, Jeffrey Sachs and Andrew Warner found a negative relationship between natural resources and economic growth, and claimed that natural resources are a curse. Their work has been widely cited, with many economists now accepting the curse of natural resources as a welldocumented explanation of

  5. Contested Terrain: Accreditation and the Future of the Profession of Librarianship

    Science.gov (United States)

    Burnett, Kathleen M.; Bonnici, Laurie J.

    2006-01-01

    This article explores the future trajectory of librarianship and its status as a profession in the context of the contested terrain of the information professions and particularly the development of a differentiated information technology workforce. Andrew Abbott's theory of the system of professions informs the historical comparison and future…

  6. New England Wind Forum: A Wind Powering America Project, Volume 1, Issue 3 -- October 2007 (Newsletter)

    Energy Technology Data Exchange (ETDEWEB)

    Grace, R. C.; Gifford, J.

    2007-10-01

    The New England Wind Forum electronic newsletter summarizes the latest news in wind energy development activity, markets, education, and policy in the New England region. It also features an interview with a key figure influencing New England's wind energy development. Volume 1, Issue 3 features an interview with Andrew Dzykewicz, Commissioner of the Rhode Island Office of Energy Resources.

  7. Kesse ütles, et Darwin on surnud? / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2011-01-01

    Arvustus: Roberts, Andrew. Sõjatorm : uus II maailmasõja ajalugu. Tallinn : Varrak, 2011 ; Tannberg, Tõnu. Eesti mees Vene kroonus : uurimusi Baltikumi ja Venemaa sõjaajaloost impeeriumi perioodil 1721–1917. Tartu : Ilmamaa, 2011 ; Dennett, Daniel Clement. Darwini ohtlik idee. Tallinn : Varrak, 2011

  8. University Press Meeting Dominated by Donor Proposal and Digital Publishing

    Science.gov (United States)

    Howard, Jennifer

    2007-01-01

    A surprise request for proposals from the Andrew W. Mellon Foundation and a forthcoming report on university publishing in the digital age were among topics discussed at the annual meeting of the Association of American University Presses. The offer from the Mellon Foundation concerns support for collaborative, monograph-centered projects in…

  9. Oh, We've Got Trouble! Right Here in Ravenna City: It Starts with "G," and Has an "S," and Ends in "A" (With Apologies to Meredith Wilson)

    Science.gov (United States)

    Tooms, Autumn; Lugg, Catherine A.

    2008-01-01

    Currently in his second year as assistant principal, Jack Andrews is facing conflicting pressures of leadership related to his perception of career mobility and the tensions caused by a pervasively heterosexist, sexist, and homophobic culture in his school. This case raises questions regarding the purpose of school in terms of social justice,…

  10. Nemot kummitab plagiaadisüüdistus

    Index Scriptorium Estoniae

    2003-01-01

    Animafilm "Kalapoeg Nemo" ("Finding Nemo") : režissöör Andrew Stanton : Ameerika Ühendriigid 2003. Prantsuse lastekirjanik Franck Le Calvez käib kohut filmi tegijate ja levitajatega autoriõiguste rikkumise pärast

  11. 77 FR 66084 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2012-11-01

    ... ELISABETH KIM CHUL HO KIM DIANE DOHEE KIM ELLEN EUN-YOUNG KIM HAILEY HYUN KYUNG KIM HEEYON KIM HYUN JUNG KIM NO SU KIM SEONG YONG KIM SOOKWON KIM SUNG HYUN KIRK KIM WON KLINDER THOMAS WILLIAM KOLLER CHRISTIAN... MAGNESON ROGER WAYNE MANOCCHIO DOMENICO STEFANO MARDON ANDREW SYDNEY DAMPIER MARSHALL THOMAS...

  12. Professors of the New Economy.

    Science.gov (United States)

    Wilson, Robin

    2000-01-01

    Profiles four professors who epitomize the increasing influence of academe on new technology-driven Internet business: a start-up maven, Steven Kaplan; a social psychologist, Michael Ray; a cyberlawyer, David Post; and an e-commerce expert, Andrew B. Whinston. (DB)

  13. Soda and Tobacco Industry Corporate Social Responsibility Campaigns: How Do They Compare?

    OpenAIRE

    Lori Dorfman; Andrew Cheyne; Friedman, Lissy C; Asiya Wadud; Mark Gottlieb

    2012-01-01

    In an article that forms part of the PLoS Medicine series on Big Food, Andrew Cheyne and colleagues compare soda companies' corporate social responsibility (CSR) campaigns - which are designed to bolster the image and popularity of their products and to prevent regulation - with the tobacco industry's CSR campaigning.

  14. The London Mayoral election will be won by the most effective orator – and this currently favours Boris Johnson

    OpenAIRE

    Crines, Andrew

    2012-01-01

    Electoral success depends on the delivery of political messages and analysing the comparative oratorical skills of Ken Livingstone and Boris Johnson provides an insight into who will emerge as the victor in the upcoming mayoral election. Andrew Crines argues that Boris has the edge, but Ken still has cards to play.

  15. Cumulative impacts of hurricanes on Florida mangrove ecosystems: Sediment deposition, storm surges and vegetation

    Science.gov (United States)

    Smith, T. J., III; Anderson, G.H.; Balentine, K.; Tiling, G.; Ward, G.A.; Whelan, K.R.T.

    2009-01-01

    Hurricanes have shaped the structure of mangrove forests in the Everglades via wind damage, storm surges and sediment deposition. Immediate effects include changes to stem size-frequency distributions and to species relative abundance and density. Long-term impacts to mangroves are poorly understood at present. We examine impacts of Hurricane Wilma on mangroves and compare the results to findings from three previous storms (Labor Day, Donna, Andrew). Surges during Wilma destroyed ??? 1,250 ha of mangroves and set back recovery that started following Andrew. Data from permanent plots affected by Andrew and Wilma showed no differences among species or between hurricanes for stem mortality or basal area lost. Hurricane damage was related to hydro-geomorphic type of forest. Basin mangroves suffered significantly more damage than riverine or island mangroves. The hurricane by forest type interaction was highly significant. Andrew did slightly more damage to island mangroves. Wilma did significantly more damage to basin forests. This is most likely a result of the larger and more spatially extensive storm surge produced by Wilma. Forest damage was not related to amount of sediment deposited. Analyses of reports from Donna and the Labor Day storm indicate that some sites have recovered following catastrophic disturbance. Other sites have been permanently converted into a different ecosystem, namely intertidal mudflats. Our results indicate that mangroves are not in a steady state as has been recently claimed. ?? 2009 The Society of Wetland Scientists.

  16. Short- and longterm impacts of Acacia longifolia invasion on belowground processes of a Mediterranean coastal dune ecosystem

    DEFF Research Database (Denmark)

    Marchante, Elizabete; Kjøller, Annelise; Struwe, Sten; Freitas, Helena

    2008-01-01

    Many coastal dune ecosystems in Portugal are invaded by the leguminous tree Acacia longifolia (Andrews) Willd. This exotic species was first introduced over one hundred years ago in an effort to mitigate dune erosion and loss of coastal landscapes. However, since then A. longifolia has spread to...

  17. 78 FR 48773 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2013-08-09

    ... SUSAN CARLA ELDAMATTY WALEED ABDULGHAFFAR ELLISON KERRY LYNN ENNS CAROL RUTH EPASINGHE VARUNA NISHANTHA... MARY ETTLIN-THRUELSEN MARY KAREN EU ANDREW DOUGLAS EVELIN CAROL LINDSEY FADI CHRISTINE MARIE FAID CAROL... PATRICK FLOYD BARBARA FLOYD JON MARC FONG CHUNG YAN GARDIAN FONTAINE BRIGITTE FORRER CAROL JOY...

  18. 78 FR 32673 - Changes in Flood Hazard Determinations

    Science.gov (United States)

    2013-05-31

    ... Dothan, North St. Andrews index.php/alabama/ P.O. Box 2128, Street, Dothan, houston/. Dothan, AL 36302....com/ Mayor, City of Authority, 76 index.php/colorado/ Centennial, 13133 Inverness Drive arapahoe..., 1777 www.bakeraecom.com/ Appelbaum, Mayor, Broadway Street, index.php/colorado/ City of...

  19. Krasota kak blagotvaritelnost / Igor Saveljev

    Index Scriptorium Estoniae

    Saveljev, Igor

    2008-01-01

    Eesti Sportlaste Ühenduse 9. heategevuslik kunstioksjon Tallinnas Nordic Hotel Forumi restoranis Monaco 20. detsembril 2008. Korraldab galerii Rios. Müügis ligi 30 maali Eesti kunstnikelt. Esile toodud Andrew George Winteri (Sindist pärit Andres Jüri Vinter) maali "Purjelaev merel" ja Franz Karl Eduard von Gebhardti "Kristus haigeid tervendamas". Autoritest

  20. Mi Lengua: Spanish as a Heritage Language in the United States.

    Science.gov (United States)

    Roca, Ana, Ed.; Colombi, M. Cecilia, Ed.

    This collection of papers includes the following: (1) "Insights from Research and Practice in Spanish as a Heritage Language" (M. Cecilia Colombi and Ana Roca); (2) "Toward a Theory of Heritage Language Acquisition: Spanish in the United States" (Andrew Lynch); (3) "Profiles of SNS Students in the Twenty-First Century: Pedagogical Implications of…

  1. Smart and intelligent sensor payload project

    Science.gov (United States)

    2009-01-01

    Engineers working on the smart and intelligent sensor payload project include (l to r): Ed Conley (NASA), Mark Mitchell (Jacobs Technology), Luke Richards (NASA), Robert Drackett (Jacobs Technology), Mark Turowski (Jacobs Technology) , Richard Franzl (seated, Jacobs Technology), Greg McVay (Jacobs Technology), Brianne Guillot (Jacobs Technology), Jon Morris (Jacobs Technology), Stephen Rawls (NASA), John Schmalzel (NASA) and Andrew Bracey (NASA).

  2. Lessons in Higher Education: Five Pedagogical Practices that Promote Active Learning for Faculty and Students

    Science.gov (United States)

    Cook-Sather, Alison

    2011-01-01

    Active learning by faculty members complements and promotes active learning for students. Through The Andrew W. Mellon Teaching and Learning Institute at Bryn Mawr College, faculty members actively engage with one another and with undergraduate students positioned as pedagogical consultants to explore and to practice a wide range of pedagogies. In…

  3. Statement before the Committee on Health, Education, Labor and Pensions (HELP) on Reauthorization of the Higher Education Act: Exploring Institutional Risk-Sharing

    Science.gov (United States)

    Kelly, Andrew P.

    2015-01-01

    Andrew Kelly, the director of the Center on Higher Education Reform at the American Enterprise Institute, shares his views on the concept of risk-sharing in higher education. The author presents the question: How would a risk-sharing policy--where colleges bear some financial responsibility for a portion of the federal loans that their students do…

  4. Petroleum industry assists hurricane relief

    International Nuclear Information System (INIS)

    This paper reports that the petroleum industry is aiding victims of last month's Hurricane Andrew with cash, clothing, food, water, and other supplies. Cash contributions announced as of last week totaled more than $2.7 million for distribution in South Florida and South Louisiana. Petroleum industry employees were collecting relief items such as bottled water and diapers for distribution in those areas

  5. Carrots, Sticks, and the Bully Pulpit: Lessons from a Half-Century of Federal Efforts to Improve America's Schools

    Science.gov (United States)

    Hess, Frederick M., Ed.; Kelly, Andrew P., Ed.

    2012-01-01

    This timely book brings together a remarkable group of authors who examine the federal role in education policy and reform during the past fifty years. As Frederick M. Hess and Andrew P. Kelly note in their introduction, the book represents a determined effort to move beyond familiar and predictable debates and instead to focus on a number of…

  6. Personal healthcare budgets: What can England learn from the Netherlands?

    NARCIS (Netherlands)

    Ginneken, E. van; Groenewegen, P.P.; McKee, M.

    2012-01-01

    The English Department of Health wants to give patients more control over the care they receive. One way they propose to do this is through personal healthcare budgets for people eligible for NHS continuing care. The health secretary, Andrew Lansley, says the “budgets will give them more control ove

  7. Viewpoint: Transatlantic Scholarship on Victorian Literature and Culture

    Directory of Open Access Journals (Sweden)

    Isobel Armstrong

    2009-11-01

    Full Text Available This viewpoint offers a comparison of recent British and American criticism of Victorian literature and culture, encompassing Dickens, Tennyson, the epic and ethical criticism. Discussion centres on recent studies by Sally Ledger, Rosemarie Bodenheimer, Cornelia Pearsall, Kirstie Blair, Simon Dentith, Herbert Tucker, Andrew Miller and Mike Sanders.

  8. Promoting Economic Development through Entrepreneurship Training and Education. A Selection of Speeches from the Seminar (Hawaii, February 16-17, 1984).

    Science.gov (United States)

    1984

    The influence of entrepreneurship training and education on economic development is considered in four seminar papers. In "Profile of Hawaii's Economic Development Environment," Andrew J. Gerakas claims that there is no real thrust for growth in Hawaii. He mentions the importance of small business, venture capital and liberalized loan making.…

  9. The Turn of the Century. Tenth Grade Lesson. Schools of California Online Resources for Education (SCORE): Connecting California's Classrooms to the World.

    Science.gov (United States)

    Bartels, Dede

    In this 10th grade social studies and language arts interdisciplinary unit, students research and report on historical figures from the turn of the 20th century. Students are required to work in pairs to learn about famous and common individuals, including Andrew Carnegie, Samuel Gompers, Susan B. Anthony, Thomas Edison, Theodore Roosevelt, Booker…

  10. Soft Machines and the Design of Perception

    DEFF Research Database (Denmark)

    Christiansen, Steen Ledet

    designates instructions for the production of the signified. In other words, we need to pay close attention to how technology is designed because with it comes also a mode of perception, a way of making sense of the world. We can paraphrase Andrew Feenberg, and say that the design of technology is a site...

  11. Serratia pneumonia presenting as hemoptysis in a patient with sarcoidosis: a case report

    OpenAIRE

    Zarogoulidis P; Porpodis K; Konoglou M; Saroglou M; Mitrakas A; Matthaios D; Touzopoulos P; Archontogeorgis K; Koulelidis A; Zarogoulidis K; Tryfon S

    2011-01-01

    Paul Zarogoulidis1, Konstantinos Porpodis1, Maria Konoglou2, Maria Saroglou2, Alexandros Mitrakas1, Dimitrios Matthaios3, Panagiotis Touzopoulos1, Konstantinos Archontogeorgis4, Andrew Koulelidis4, Konstantinos Zarogoulidis1, Stavros Tryfon21Pulmonary Department, “G. Papanikolaou” General Hospital, Aristotle University of Thessaloniki, Greece; 21st Pulmonary Clinic, “G. Papanikolaou” General Hospital, Thessaloniki, Greece; 31st Internal Medicine Departm...

  12. Kaja Vunder kõndis kokaiinijoonel

    Index Scriptorium Estoniae

    1998-01-01

    Äsja St. Martins'i lõpetanud Andrew Groves'i show'st 'Cocaine Nites' lõppenud Londoni moenädalal. Eesti modell Kaja Vunder kandis 1000 zhiletiteradest valmistatud kleiti ning peeglikildudest näomaski

  13. New Flu Virus in Pigs Exhibited at Fairs in Ohio

    Centers for Disease Control (CDC) Podcasts

    2013-05-21

    Dr. Andrew Bowman, a graduate research assistant in the Department of Veterinary Preventive Medicine at The Ohio State University, discusses his study about flu virus in pigs at agricultural fairs.  Created: 5/21/2013 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 5/23/2013.

  14. Romanticism, Representations of Religion and Critical Religious Education

    Science.gov (United States)

    Barnes, L. Philip; Wright, Andrew

    2006-01-01

    Geoff Teece has recently (in "BJRE", 27, 2005, pp. 29-40) come to the defence of modern religious education and contended that many of the criticisms brought against it are based on mistaken interpretations. More particularly, Teece accuses Andrew Wright of misinterpreting the position of Professor John Hick and of failing to appreciate the…

  15. Protein Laboratories in Single Location | Poster

    Science.gov (United States)

    By Andrew Stephen, Timothy Veenstra, and Gordon Whiteley, Guest Writers, and Ken Michaels, Staff Writer The Laboratory of Proteomics and Analytical Technologies (LPAT), Antibody Characterization Laboratory (ACL), and Protein Chemistry Laboratory (PCL), previously located on different floors or in different buildings, are now together on the first floor of C wing in the ATRF.

  16. Maximizing Student Assistants' Contributions to the Library System: Student Workers Use Slow Times To Make a Small Branch Music Library Possible.

    Science.gov (United States)

    Mack, Linda

    The Music Materials Center (MMC) of the James White Library at Andrews University (Berrien Springs, Michigan) is organized to assist in such projects as: participating in the cataloging work flow, evaluating and processing gifts, creating and maintaining specialized lists, ordering new materials, updating printed reference sources, OPAC music…

  17. CERN celebrated the first year in space for the Alpha Magnetic Spectrometer (AMS) with a visit from the crew of the shuttle mission, STS-134, who successfully delivered AMS to the International Space Station (ISS) last year.

    CERN Multimedia

    Laurent Egli

    2012-01-01

    During the celebrations at CERN, the astronauts unveiled a commemorative plaque on the lawn outside the POCC to mark the occasion and later gave a public lecture at CERN. Picture 28 : STS-134 astronauts (left to right) Andrew Feustel, Gregory Chamitoff, Gregory Johnson, Michael Fincke and Mark Kelly in the AMS Payload Operations Centre at CERN.

  18. Transition IV in Alabama: A Profile of Commitment. Proceedings of the Annual Statewide Conference on Transition (4th, Auburn, Alabama, January 1995).

    Science.gov (United States)

    Browning, Philip, Ed.

    This proceedings document provides the texts of 23 presentations given at a conference in 1994 which focused on policies, materials, programs, and activities being implemented in Alabama to foster the successful transition of youth with disabilities to adult life. An initial paper compares the definition of transition developed by Andrew Halpern…

  19. Common Ground. Feminist Collaboration in the Academy.

    Science.gov (United States)

    Peck, Elizabeth G., Ed.; Mink, JoAnna Stephens, Ed.

    The fifteen articles in this anthology examine the process of collaboration as it fits into questions of gender. Articles include: "Educate, Organize, and Agitate: A Historical Overview of Feminist Collaboration in Great Britain and America, 1640-1930" (Melodie Andrews); "Beyond Feminism: An Intercultural Challenge for Transforming the Academy"…

  20. ATLAS Story

    CERN Multimedia

    Nordberg, Markus

    2012-01-01

    This film produced in July 2012 explains how fundamental research connects to Society and what benefits collaborative way of working can and may generate in the future, using ATLAS Collaboration as a case study. The film is intellectually inspired by the book "Collisions and Collaboration" (OUP) by Max Boisot (ed.), see: collisionsandcollaboration.com. The film is directed by Andrew Millington (OMNI Communications)

  1. "Teachers' Voices for School Change": An Introduction to Educative Research.

    Science.gov (United States)

    Jacobs, Mary-Ellen

    1993-01-01

    Reviews a book, "Teachers' Voices for School Change" by Andrew Gitlin, on educative research and teacher voice, examining the educative research process which grounds reflection in the life histories of teacher researchers, presenting four case studies on educative research, and reflecting on the educative research process itself. Teacher voice…

  2. DVD. Kaimar Palts soovitab : "Narnia" / Kaimar Palts

    Index Scriptorium Estoniae

    Palts, Kaimar

    2006-01-01

    DVD mängufilmist "Narnia lood : lõvi, nõid ja riidekapp" ("Chronicles of Narnia : The Lion, the Witch and the Wardrobe") C.S. Lewise muinasjutu ainetel : režissöör Andrew Adamson : Ameerika Ühendriigid 2005. Ka filmi lisadest DVD-l

  3. Konservativnaja metshta Narnii / Sven Vabar

    Index Scriptorium Estoniae

    Vabar, Sven

    2006-01-01

    Ekraniseering C.S. Lewise 1950.a. ilmunud romaanist "Narnia lood : Lõvi, nõid ja riidekapp" ("Chronicles of Narnia : The Lion, the Witch and the Wardrobe") : režissöör Andrew Adamson : Ameerika Ühendriigid 2005

  4. Narnia konservatiivne unelm / Sven Vabar

    Index Scriptorium Estoniae

    Vabar, Sven

    2006-01-01

    Ekraniseering C.S. Lewise 1950.a. ilmunud romaanist "Narnia lood : Lõvi, nõid ja riidekapp" ("Chronicles of Narnia : The Lion, the Witch and the Wardrobe") : režissöör Andrew Adamson : Ameerika Ühendriigid 2005

  5. Narnija, ili V platjanoi shkaf i obratno / Nikolai Karajev

    Index Scriptorium Estoniae

    Karajev, Nikolai, 1978-

    2005-01-01

    Ekraniseering C.S. Lewise 1950.a. ilmunud romaanist "Narnia lood : Lõvi, nõid ja riidekapp" ("Chronicles of Narnia : The Lion, the Witch and the Wardrobe") : režissöör Andrew Adamson : Ameerika Ühendriigid 2005

  6. From Self-Flying Helicopters to Classrooms of the Future

    Science.gov (United States)

    Young, Jeffrey R.

    2012-01-01

    On a summer day four years ago, a Stanford University computer-science professor named Andrew Ng held an unusual air show on a field near the campus. His fleet of small helicopter drones flew under computer control, piloted by artificial-intelligence software that could teach itself to fly after watching a human operator. By the end of the day,…

  7. Peer Review in Academic Promotion and Publishing: Its Meaning, Locus, and Future

    Science.gov (United States)

    Harley, Diane; Acord, Sophia Krzys; Earl-Novell, Sarah

    2010-01-01

    As part of its Andrew W. Mellon Foundation-funded Future of Scholarly Communication Project, the Center for Studies in Higher Education (CSHE) has hosted two meetings to explore how peer review relates to scholarly communication and academic values. In preparation for an April 2010 workshop, four working papers were developed and circulated. They…

  8. 75 FR 70083 - Emergency Forest Restoration Program and Emergency Conservation Program

    Science.gov (United States)

    2010-11-17

    ... Hurricanes Andrew and Iniki in 1993 and Hurricanes Katrina and Rita in 2005 where the extent and magnitude of... From the Federal Register Online via the Government Publishing Office #0; #0;Rules and Regulations... practices. Sec. 701.32 Failure to comply with Sec. 701.32. program provisions. Sec. 701.33...

  9. 1281 krooni eest Eestit nädalas / Sten Hansson

    Index Scriptorium Estoniae

    Hansson, Sten

    2009-01-01

    Autor tutvustab populaarset Michael Blastlandi ja Andrew Dilnot' poolt raamatus The tiger that is'nt: seeing through a world of numbers (2007) avaldatud statistikaandmete tõlgendamise meetodeid, et majandusnäitajatest paremini aru saada. Näiteid Eesti riigieelarves toodud arvude mõistmiseks

  10. Cell Phones and Sun Shadows: Exploring the Equation of Time

    Science.gov (United States)

    Madden, Sean P.

    2010-01-01

    For thousands of years before the invention of reliable clocks, humans measured their days by the motion of the sun. Astronomically, one day was the length of time it took for the sun to return to the same position in the sky. With the advent of precise mechanical chronometers such as Harrison's timekeepers (Sobel and Andrewes 1998), which ran at…

  11. Mis jääb kunstist lõpuks sõelale? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2011-01-01

    15. Tallinna graafikatriennaalist "Armastuse, mitte raha pärast" Kumu Kunstimuuseumis. Triennaali kuraatorid: Simon Rees, Eve Kask, Eha Komissarov, kujundajad: Neeme Külm, Ralf Lõoke. Óskar Muñoze (Colombia), Ellie Daviesi (Suurbritannia), Andrew Raftery (USA), Kai Kuusingu ja Anu Kalmu töödest

  12. HOTEL INFORMATION

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Kerry Center Hotel, Beijing Kerry Sports of Shangri-la's Kerry Center Hotel, Beijing, participated in the annual Terry Fox Charity Run fundraiser for cancer research recently. Seen here is Andrew West, the Kerry Sports Manager, pictured with Zhang Guozheng, former world weight lifting champion.

  13. Biomarkers of asbestos-induced lung injury: the influence of fiber characteristics and exposure methodology

    Science.gov (United States)

    ATS 2013 Biomarkers of asbestos-induced lung injury: the influence of fiber characteristics and exposure methodology Urmila P Kodavanti, Debora Andrews, Mette C Schaldweiler, Jaime M Cyphert, Darol E Dodd, and Stephen H Gavett NHEERL, U.S. EPA, Research Triangle Park, NC; NIEH...

  14. Big Data, Small Media

    Directory of Open Access Journals (Sweden)

    Grant Bollmer

    2014-08-01

    Andrew Dubber Radio in the Digital Age Polity, Cambridge, 2013   Charles Ess Digital Media Ethics, Second Edition Polity, Cambridge, 2014   Graeme Kirkpatrick Computer Games and the Social Imaginary Polity, Cambridge, 2013   Dhiraj Murthy Twitter: Social Communication in the Twitter Age Polity, Cambrige, 2013   Jill Walker Rettberg Blogging, Second Edition Polity, Cambridge, 2014

  15. Preventing Acute Malnutrition among Young Children in Crises: A Prospective Intervention Study in Niger

    OpenAIRE

    Kerac, M; Seal, A.

    2014-01-01

    Marko Kerac and Andrew Seal comment on the study by Langendorf and colleagues about the effectiveness of different strategies to prevent malnutrition in young children and discuss the implications of this study for food programs worldwide. Please see later in the article for the Editors' Summary.

  16. Agency and the art of interactive digital storytelling

    NARCIS (Netherlands)

    N. Knoller

    2010-01-01

    Taking seriously Andrew Stern’s aspiration that IDS become a premier art form for the 21st century, this paper re-examines agency, understood as the ability to freely control the plot, as a key concept in IDS aesthetics. Tracing the origins of this notion in IDS theory, this paper suggests that "tru

  17. Monetarism in Retrospect — and Prospect

    OpenAIRE

    Andrew G. Haldane

    2004-01-01

    Andrew Haldane responds to the article by Thomas Mayer and Patrick Minford, ‘Monetarism: A Retrospective’ that appeared in World Economics, Vol. 5, No. 2 (April–June), 2004, pp. 147–185.

  18. Parallel grid library for rapid and flexible simulation development

    Science.gov (United States)

    Honkonen, I.; von Alfthan, S.; Sandroos, A.; Janhunen, P.; Palmroth, M.

    2013-04-01

    We present an easy to use and flexible grid library for developing highly scalable parallel simulations. The distributed cartesian cell-refinable grid (dccrg) supports adaptive mesh refinement and allows an arbitrary C++ class to be used as cell data. The amount of data in grid cells can vary both in space and time allowing dccrg to be used in very different types of simulations, for example in fluid and particle codes. Dccrg transfers the data between neighboring cells on different processes transparently and asynchronously allowing one to overlap computation and communication. This enables excellent scalability at least up to 32 k cores in magnetohydrodynamic tests depending on the problem and hardware. In the version of dccrg presented here part of the mesh metadata is replicated between MPI processes reducing the scalability of adaptive mesh refinement (AMR) to between 200 and 600 processes. Dccrg is free software that anyone can use, study and modify and is available at https://gitorious.org/dccrg. Users are also kindly requested to cite this work when publishing results obtained with dccrg. Catalogue identifier: AEOM_v1_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/AEOM_v1_0.html Program obtainable from: CPC Program Library, Queen’s University, Belfast, N. Ireland Licensing provisions: GNU Lesser General Public License version 3 No. of lines in distributed program, including test data, etc.: 54975 No. of bytes in distributed program, including test data, etc.: 974015 Distribution format: tar.gz Programming language: C++. Computer: PC, cluster, supercomputer. Operating system: POSIX. The code has been parallelized using MPI and tested with 1-32768 processes RAM: 10 MB-10 GB per process Classification: 4.12, 4.14, 6.5, 19.3, 19.10, 20. External routines: MPI-2 [1], boost [2], Zoltan [3], sfc++ [4] Nature of problem: Grid library supporting arbitrary data in grid cells, parallel adaptive mesh refinement, transparent remote neighbor data updates and

  19. Strong Coupling Gauge Theories in LHC ERA

    Science.gov (United States)

    Fukaya, H.; Harada, M.; Tanabashi, M.; Yamawaki, K.

    2011-01-01

    Higgs, or techni-dilaton - composite Higgs near conformality / Koichi Yamawaki -- Phase diagram of strongly interacting theories / Francesco Sannino -- Resizing conformal windows / O. Antipin and K. Tuominen -- Nearly conformal gauge theories on the lattice / Zoltan Fodor ... [et al.] -- Going beyond QCD in lattice gauge theory / G. T. Fleming -- Phases of QCD from small to large N[symbol]: (some) lattice results / A. Deuzeman, E. Pallante and M. P. Lombardo -- Lattice gauge theory and (quasi)-conformal technicolor / D. K. Sinclair and J. B. Kogut -- Study of the running coupling constant in 10-flavor QCD with the Schrodinger functional method / N. Yamada ... [et al.] -- Study of the running coupling in twisted Polyakov scheme / T. Aoyama ... [et al.].Running coupling in strong gauge theories via the lattice / Zoltan Fodor ... [et al.] -- Higgsinoless supersymmetry and hidden gravity / Michael L. Graesser, Ryuichiro Kitano and Masafumi Kurachi -- The latest status of LHC and the EWSB physics / S. Asai -- Continuum superpartners from supersymmetric unparticles / Hsin-Chia Cheng -- Review of minimal flavor constraints for technicolor / Hidenori S. Fukano and Francesco Sannino -- Standard model and high energy Lorentz violation / Damiano Anselmi -- Dynamical electroweak symmetry breaking and fourth family / Michio Hashimoto -- Holmorphic supersymmetric Nambu-Jona-Lasino model and dynamical electroweak symmetry breaking / Dong-Won Jung, Otto C. W. Kong and Jae Sik Lee -- Ratchet model of Baryogenesis / Tatsu Takeuchi, Azusa Minamizaki and Akio Sugamoto -- Classical solutions of field equations in Einstein Gauss-Bonnet gravity / P. Suranyi, C. Vaz and L. C. R. Wijewardhana -- Black holes constitute all dark matter / Paul H. Frampton -- Electroweak precision test and Z [symbol] in the three site Higgsless model / Tomohiro Abe -- Chiral symmetry and BRST symmetry breaking, quaternion reality and the lattice simulation / Sadataka Furui -- Holographic techni-dilaton, or

  20. Corrigendum - Effect of live yeast culture Saccharomyces cerevisiae on milk production and some blood parameters

    Directory of Open Access Journals (Sweden)

    Judit Peter Szucs

    2014-05-01

    Full Text Available In the article Effect of live yeast culture Saccharomyces cerevisiae on milk production and some blood parameters, first published in 2013 in Scientific Papers: Animal Science and Biotechnologies, 46 (1, the first author neglected to ask any prior agreement and permission of Lesaffre Feed Additive firm the sponsor of the experiment and Bernhard Feix GmbH the leader of the experiment, for publishing the results, doing so she committed serious mistakes: Ethically: The first author published data for which she had no permission, and she did not indicate the name of the owners, neither did she refere to them. On the scientific basis: She was not able to evaluate properly the real effect of Saccharomices cerevisiae containing Actisaf additive since the introduced experiment was a basic large farm size /scale research work that could not be measured precisely without the planned and ongoing further experiments.   Acknowledgement The first author highly appreciates Lesaffre Feed Additive and Bernhard Feix GmbH firms for the possibility of taking part in the research work together with her students. She is most grateful for the generous promise of the leaders of both Lesaffre Feed Additive and Bernhard Feix GmbH for disregarding to take any legal steps. She gives thanks especially to the leader of the experiment Zoltan Pachinger for his wise and helpful contribution to this consensus. The first author apologises for this oversight.     This article corrects: Effect of live yeast culture Saccharomyces cerevisiae on milk production and some blood parameters, Vol. 46, Issue 1, p. 40-44. Article first published online: 30 May 2013

  1. New technology update: femtosecond laser in cataract surgery

    Directory of Open Access Journals (Sweden)

    Nagy ZZ

    2014-06-01

    Full Text Available Zoltan Z NagyDepartment of Ophthalmology, Semmelweis University, Budapest, HungaryAbstract: Femtosecond lasers represent a new frontier in cataract surgery. Since their ­introduction and first human treatment in 2008, a lot of new developments have been achieved. In this review article, the physical principle of femtolasers is discussed, together with the indications and side effects of the method in cataract surgery. The most important clinical results are also presented regarding capsulotomy, fragmentation of the crystalline lens, corneal wound creation, and refractive results. Safety issues such as endothelial and macular changes are also discussed. The most important advantage of femtolaser cataract technology at present is that all the important surgical steps of cataract surgery can be planned and customized, delivering unparalleled accuracy, repeatability, and consistency in surgical results. The advantages of premium lenses can be maximally used in visual and presbyopia restoration as well. The advantages of ­premium lenses can be maximally used, not only in visual, but in presbyopia restoration as well. Quality of vision can be improved with less posterior chamber lens (PCL tilt, more centralized position of the PCL, possibly less endothelial damage, less macular edema, and less posterior capsule opacification (PCO formation. This technological achievement should be followed by other technical developments in the lens industry. Hopefully this review article will help us to understand the technology and the results to ­demonstrate the differences between the use of femtolasers and phacoemulsification-based cataract surgery. The most important data of the literature are summarized to show ophthalmologists the benefits of the technology in order to provide the best refractive results to the patient.Keywords: femtosecond laser-assisted cataract surgery, capsulotomy, lens fragmentation, corneal wound, arcuate keratotomy, safety

  2. Determining Ms temperature on a AISI D2 cold work tool steel using magnetic Barkhausen noise

    International Nuclear Information System (INIS)

    Highlights: ► MBN was used to follow the martensite transformation in a tool steel. ► The results were compared with resistivity experiments. ► The Ms was estimated with Andrews equation coupled to ThermoCalc calculations. The experimental results showed good agreement. -- Abstract: The use of Magnetic Barkhausen Noise (MBN) as a experimental method for measuring the martensite start (Ms) temperature was explored, using as model system a cold-work tool steel (AISI D2) austenitized at a very high temperature (1473 K), so as to transform in sub-zero temperatures. The progress of the transformation was also followed with electrical resistance measurements, optical microscopy and scanning electron microscopy. Both MBN and resistivity measurements showed a change near 230 K during cooling, corresponding to the Ms temperature, as compared with 245 K, estimated with Andrews empirical equation applied to the austenite composition calculated using ThermoCalc

  3. Design of system on a chip devices & components

    CERN Document Server

    Reis, Ricardo A L

    2007-01-01

    Designs of System on a Chip. Introduction; R. Reis, J.A.G. Jess. BJT Modeling with VBIC; C.C. McAndrew. A MOS Transistor Model for Mixed Analog-digital Circuit Design and Simulation; M. Bucher, C. Lallement, F. Krummenacher, C. Enz. Efficient Statistical Modeling for Circuit Simulation; C.C. McAndrew. Retargetable Application-driven Analog-digital Block Design; J.E. Franca. Robust Low Voltage Power Analog VLSI Design; T.B. Tarim, C.H. Lin, M. Ismail. Ultralow-voltage memory circuits; K. Itoh. Low-voltage Low-power High-speed I/O Buffers; R. Leung. Microelectronics toward 2010; T. Yanagawa, S.

  4. Modeling Biodegradation Kinetics on Benzene and Toluene and Their Mixture

    Directory of Open Access Journals (Sweden)

    Aparecido N. Módenes

    2007-10-01

    Full Text Available The objective of this work was to model the biodegradation kinetics of toxic compounds toluene and benzene as pure substrates and in a mixture. As a control, Monod and Andrews models were used. To predict substrates interactions, more sophisticated models of inhibition and competition, and SKIP (sum kinetics interactions parameters model were applied. The models evaluation was performed based on the experimental data from Pseudomonas putida F1 activities published in the literature. In parameter identification procedure, the global method of particle swarm optimization (PSO was applied. The simulation results show that the better description of the biodegradation process of pure toxic substrate can be achieved by Andrews' model. The biodegradation process of a mixture of toxic substrates is modeled the best when modified competitive inhibition and SKIP models are used. The developed software can be used as a toolbox of a kinetics model catalogue of industrial wastewater treatment for process design and optimization.

  5. Student thinking about the divergence and curl in mathematics and physics contexts

    CERN Document Server

    Baily, Charles; Pattie, Andrew; van Kampen, Paul; De Cock, Mieke

    2015-01-01

    Undergraduate physics students are known to have difficulties with understanding mathematical tools, and with applying their knowledge of mathematics to physical contexts. Using survey statements based on student interviews and written responses to open-ended questions, we investigated the prevalence of correct and incorrect conceptions regarding the divergence and curl of vector fields, among both mathematics and physics students. We compare and contrast pre-instruction responses from intermediate-level E&M students at KU Leuven and the University of St Andrews with post-instruction responses from St Andrews students enrolled in a vector calculus course. In comparing pre- and post-instruction responses from E&M students we see that, although their understanding of the divergence and curl improved, relatively few of them were able to provide completely correct survey responses at mid-semester.

  6. Determining Ms temperature on a AISI D2 cold work tool steel using magnetic Barkhausen noise

    Energy Technology Data Exchange (ETDEWEB)

    Huallpa, Edgar Apaza, E-mail: gared1@gmail.com [Escola Politécnica da Universidade de São Paulo, Av. Prof. Mello Moraes 2463, 05508-030 SP (Brazil); Sánchez, J. Capó, E-mail: jcapo@usp.br [Departamento de Física, Facultad de Ciencias Naturales, Universidad de Oriente, Av. Patricio Lumumba s/n 90500, Santiago de Cuba (Cuba); Padovese, L.R., E-mail: lrpadove@usp.br [Escola Politécnica da Universidade de São Paulo, Av. Prof. Mello Moraes 2463, 05508-030 SP (Brazil); Goldenstein, Hélio, E-mail: hgoldens@usp.br [Escola Politécnica da Universidade de São Paulo, Av. Prof. Mello Moraes 2463, 05508-030 SP (Brazil)

    2013-11-15

    Highlights: ► MBN was used to follow the martensite transformation in a tool steel. ► The results were compared with resistivity experiments. ► The Ms was estimated with Andrews equation coupled to ThermoCalc calculations. The experimental results showed good agreement. -- Abstract: The use of Magnetic Barkhausen Noise (MBN) as a experimental method for measuring the martensite start (Ms) temperature was explored, using as model system a cold-work tool steel (AISI D2) austenitized at a very high temperature (1473 K), so as to transform in sub-zero temperatures. The progress of the transformation was also followed with electrical resistance measurements, optical microscopy and scanning electron microscopy. Both MBN and resistivity measurements showed a change near 230 K during cooling, corresponding to the Ms temperature, as compared with 245 K, estimated with Andrews empirical equation applied to the austenite composition calculated using ThermoCalc.

  7. Hurricane slams gulf operations

    International Nuclear Information System (INIS)

    This paper reports that reports of damage by Hurricane Andrew escalated last week as operators stepped up inspections of oil and gas installations in the Gulf of Mexico. By midweek, companies operating in the gulf and South Louisiana were beginning to agree that earlier assessments of damage only scratched the surface. Damage reports included scores of lost, toppled, or crippled platforms, pipeline ruptures, and oil slicks. By midweek the U.S. coast Guard had received reports of 79 oil spills. Even platforms capable of resuming production in some instances were begin curtailed because of damaged pipelines. Offshore service companies the another 2-4 weeks could be needed to fully assess Andrew's wrath. Lack of personnel and equipment was slowing damage assessment and repair

  8. Gulf operations still recovering

    International Nuclear Information System (INIS)

    This paper reports that reports of damage caused by Hurricane Andrew were leveling off last week at the U.S. Minerals Management Service as Gulf of Mexico operators pressed ahead with repairs. The hurricane struck South Florida Aug. 4, churned west into the gulf, then swung north and hit the South Louisiana coast Aug. 5. By the close of business Sept. 8 MMS had received damage reports covering 83 pipeline segments and 193 platforms and satellite installations. MMS last week estimated about 500 MMcfd of gas production had been restored in the gulf and 100,000-150,000 b/d of oil. Production still lost as a result of Andrew was estimated at 2-2.5 bcfd of gas and 90,000-120 b/d of oil. MMS estimates Gulf of Mexico wells before the storm were producing about 12.5-13 bcfd of gas and 750,000 b/d of oil

  9. Space shuttle crew training at CERN

    CERN Multimedia

    Paola Catapano

    From 13 to 16 October, the crew of NASA Space Shuttle mission STS-134 came to CERN for a special physics training programme. Invited here by Samuel Ting, they will deliver the Alpha Magnetic Spectrometer (AMS) detector to the International Space Station (ISS).   The STS134 crew in the Lodge at the Aiguille du Midi wearing CERN fleeces. From left to right: Captain Mark Kelly, US Navy; Pilot Gregory Johnson, USAF ret.; Mission Specialist Andrew Feustel; Mission Specialist Mike Fincke, USAF, Mission Specialist Gregory Chamitoff and Mission Specialist Roberto Vittori, ESA and Italian Air Force. Headed by Commander Mark Kelly, a US Navy captain, the crew included pilot Gregory Johnson, a US Air Force (USAF) colonel, and mission specialists Mike Fincke (also a USAF Colonel), Andrew Feustel, and Gregory Chamitoff of NASA, as well as Colonel Roberto Vittori of the European Space Agency (ESA). Two flight directors, Gary Horlache and Derek Hassmann of NASA, and the engineer responsible for the Ext...

  10. Behaviour and burnout in medical students

    OpenAIRE

    Cecil, Jo; McHale, Calum; Hart, Jo; Laidlaw, Anita

    2014-01-01

    Background: Burnout is prevalent in doctors and can impact on job dissatisfaction and patient care. In medical students, burnout is associated with poorer self-rated health; however, it is unclear what factors influence its development. This study investigated whether health behaviours predict burnout in medical students.Methods: Medical students (n=356) at the Universities of St Andrews and Manchester completed an online questionnaire assessing: emotional exhaustion (EE), depersonalisation (...

  11. Adults Need Immunizations, Too!

    Centers for Disease Control (CDC) Podcasts

    2012-03-19

    In this podcast, Dr. Andrew Kroger from CDC’s National Center for Immunization and Respiratory Diseases discusses simple, safe, and effective ways adults can help protect themselves, their family, and their community from serious and deadly diseases.  Created: 3/19/2012 by National Center for Immunization and Respiratory Diseases (NCIRD).   Date Released: 3/19/2012.

  12. Deep vein thrombosis: a clinical review

    OpenAIRE

    Kesieme, Emeka

    2011-01-01

    Emeka Kesieme1, Chinenye Kesieme2, Nze Jebbin3, Eshiobo Irekpita1, Andrew Dongo11Department of Surgery, Irrua Specialist Teaching Hospital, Irrua, Nigeria; 2Department of Paediatrics, Irrua Specialist Teaching Hospital, Irrua, Nigeria; 3Department of Surgery, University of Port Harcourt Teaching Hospital, Port-Harcourt, NigeriaBackground: Deep vein thrombosis (DVT) is the formation of blood clots (thrombi) in the deep veins. It commonly affects the deep leg veins (such as the calf veins, femo...

  13. The Professionalization of Internal Auditing

    OpenAIRE

    Tomasz Gacoń

    2013-01-01

    Purpose: This paper attempts to examine the meaning of professionalization, the conditions required for professionalization and whether internal auditing can be recognized as a profession. The paper makes use of study results in the fi eld of internal auditing conducted in Europe and the USA, as well as Andrew Abbott’s theory on the system of professions. Professions have common characteristics which differentiate them from other occupations. These characteristics were used to determine the c...

  14. Proceedings of the Inheritance Workshop at ECOOP 2002

    DEFF Research Database (Denmark)

    The Inheritance Workshop at ECOOP 2002, which took place on Tuesday, 11 June, was the first ECOOP workshop focusing on inheritance after the successful workshops in 1991 and 1992. The workshop was intended as a forum for designers and implementers of object-oriented languages, and for software...... developers with an interest in inheritance. It was organized by Andrew P. Black, Erik Ernst, Peter Grogono, and Markku Sakkinen....

  15. Resistance Is Futile: Toward a Non-Modern Democratization of Technology

    OpenAIRE

    Verbeek, Peter-Paul

    2013-01-01

    Andrew Feenberg’s political philosophy of technology uniquely connects the neo-Marxist tradition with phenomenological approaches to technology. This paper investigates how this connection shapes Feenberg’s analysis of power. Influenced by De Certeau and by classical positions in philosophy of technology, Feenberg focuses on a dialectical model of oppression versus liberation. A hermeneutic reading of power, though, inspired by the late Foucault, does not conceptualize power relations as exte...

  16. Cardiac sarcoidosis

    OpenAIRE

    Costello BT; Nadel J.; Taylor AJ

    2016-01-01

    Benedict T Costello,1,2 James Nadel,3 Andrew J Taylor,1,21Department of Cardiovascular Medicine, The Alfred Hospital, 2Baker IDI Heart and Diabetes Research Institute, Melbourne, VIC, 3School of Medicine, University of Notre Dame, Sydney, NSW, Australia Abstract: Cardiac sarcoidosis is a rare but life-threatening condition, requiring a high degree of clinical suspicion and low threshold for investigation to make the diagnosis. The cardiac manifestations include heart failure, conducting syst...

  17. A vaccine effective against Zika virus is theoretically possible but may not be delivered anytime soon

    OpenAIRE

    Taylor-Robinson AW

    2016-01-01

    Andrew W Taylor-Robinson Infectious Diseases Research Group, School of Medical and Applied Sciences, Central Queensland University, Rockhampton, QLD, Australia Abstract: Following the first report in May 2015 of the unexpected emergence of Zika in north east Brazil, there has been an explosive epidemic of this infection across Latin America. The outbreak has caused alarm among social and news media as to the virulence and transmission potential of the Aedes mosquito-borne virus. This debate i...

  18. EPMA-World Congress 2015

    OpenAIRE

    Abraham, Jella-Andrea; Akhmetov, Ildar; Quintana, Leonidas; Andrews, Russell J.; Qin, Xu; Wang, Tailing; Bati, Viktoriia V.; Meleshko, Tamara V.; Levchuk, Olga B.; Boerner, Ewa; Bomba, Alojz; Petrov, Viktor O.; Drobnych, Volodymyr G.; Bykova, Oksana M.; Heemskerk, Frank

    2016-01-01

    Table of contents A1 Predictive and prognostic biomarker panel for targeted application of radioembolisation improving individual outcomes in hepatocellular carcinoma Jella-Andrea Abraham, Olga Golubnitschaja A2 Integrated market access approach amplifying value of “Rx-CDx” Ildar Akhmetov A3 Disaster response: an opportunity to improve global healthcare Russell J. Andrews, Leonidas Quintana A4 USA PPPM: proscriptive, profligate, profiteering medicine-good for 1 % wealthy, not for 99 % unhealt...

  19. Interview: Drew Feustel

    OpenAIRE

    Sliker, Paul J

    2011-01-01

    An interview with Andrew J. (Drew) Feustel, Purdue alum, geophysicist and NASA astronaut. Dr. Feustel's first spaceflight in May 2009 (STS-125) repaired the Hubble Space Telescope. His second spaceflight in May 2011 (STS-134) was the penultimate journey of the Space Shuttle program. At Purdue University, Feustel served as a Residence Hall Counselor for two years at Cary Quadrangle and he was a Research Assistant and Teaching Assistant in the Department of Earth and Atmospheric Sciences. His M...

  20. Identifying factors associated with clinical success in patients treated with NASHA®/Dx injection for fecal incontinence

    OpenAIRE

    Franklin H; Barrett AC; Wolf R

    2016-01-01

    Howard Franklin,1 Andrew C Barrett,1 Ray Wolf2 1Department of Medical Affairs, Salix, a Division of Valeant Pharmaceuticals North America LLC, Bridgewater, NJ, USA; 2Department of Medical Affairs, Valeant Pharmaceuticals North America LLC, Wilton Manors, FL, USA Purpose: Injection with the bulking agent consisting of non-animal stabilized hyaluronic acid/dextranomer (NASHA®/Dx) is well tolerated and efficacious for the treatment of fecal incontinence (FI); however, the patient population...

  1. Clinical trial of community nurse mentoring to improve self-management in patients with chronic obstructive pulmonary disease

    OpenAIRE

    Wood-Baker R; Reid D; Robinson A; Walters EH

    2012-01-01

    Richard Wood-Baker,1 David Reid,2 Andrew Robinson,3 E Haydn Walters11School of Medicine, University of Tasmania, Hobart; 2Department of Respiratory Medicine, Prince Charles Hospital, Brisbane; 3School of Nursing & Midwifery, University of Tasmania, Hobart, AustraliaBackground: Chronic obstructive pulmonary disease (COPD) impacts on quality of life and is characterized by exacerbations, which increase health care utilization. Developing self-management behaviors of people with COPD is ...

  2. Terrorist Innovations in Weapons of Mass Effect, Phase II

    OpenAIRE

    Hafez, Mohammed M.; Rasmussen, Maria

    2012-01-01

    Approved for public display, distribution unlimited "On October 6-7, 2011, experts gathered for a workshop at the University of St. Andrews, Scotland to discuss the factors that both facilitate and hinder terrorist innovations. This workshop is part of a two-year Defense Threat Reduction Agency (DTRA) sponsored research project that aims to shed light on the preconditions, causes, and predictive indicators associated with terrorist innovation in weapons of mass effect (WMEs). Organized joi...

  3. A Life of Fun Playing With Solar Magnetic Fields (Special Historical Review)

    CERN Document Server

    Priest, E R

    2014-01-01

    This invited memoire describes my fortunate life, which has been enriched by meeting many wonderful people. The story starts at home and university, and continues with accounts of St Andrews and trips to the USA, together with musings on the book "Solar MHD". The nature and results of collaborations with key people from abroad and with students is mentioned at length. Finally, other important aspects of my life are mentioned briefly before wrapping up.

  4. Build It to Understand It: Ludology Meets Narratology in Game Design Space

    OpenAIRE

    Mateas, Michael

    2005-01-01

    Michael Mateas (1,3) and Andrew Stern (2,3) (co-authors listed alphabetically) 1 Georgia Institute of Technology 2 InteractiveStory.net, Zoesis 3 grandtextauto.org Building experimental games offers an alternative methodology for researching and understanding games, beyond what can be understood by playing and studying existing games alone. Through a simultaneous process of research, artmaking and product prototyping in the construction of the interactive drama Façade (Mateas and Stern...

  5. DVD-d / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-

    2007-01-01

    Kolm mängufilmide DVD-d : ameerika sõltumatu mängufilm "Karm tüdruk" ("Hard Candy"; režissöör David Slade; 2005), ameerika mängufilm "Kaitseingel" ("The Guardian"; režissöör Andrew Davis; 2006) ja Venemaa õudusfilm "Surnud tütred" ("Mjortvõje dotsheri"; režissöör Pavel Ruminov)

  6. Corrigendum.

    Science.gov (United States)

    2016-09-01

    Toye, C., Lester, L., Popescu, A., McInerney, F., Andrews, S., & Robinson, A. L. (2014). Dementia Knowledge Assessment Tool: Development and preliminary testing with aged care staff and family carers. Dementia: The International Journal of Social Research and Practice, 13, 248-256. DOI: 10.1177/1471301212471960The wording are:"In Table 2, the item 'Knowing likely cause helps to predict' is presented under the heading 'Incorrect statements' when it should be shown under the heading 'Correct statements'". PMID:27609933

  7. David Philip Miller and Peter Hanns Reill (eds), Visions of Empire: Voyages, Botany and the Representations of Nature

    OpenAIRE

    Talairach-Vielmas, Laurence

    2013-01-01

    Visions of Empire: Voyages, Botany and the Representations of Nature, edited by David Philip Miller and Peter Hanns Reill, is a volume which derives from a conference held at the William Andrews Clark Memorial Library and entitled “Visions of Empire”. Although the conference and the hardback publication that followed are not recent, the fresh publication of the collection in paperback fully deserves a review. This engaging book deals with representations of nature and tackles the significance...

  8. Treatment patterns, health state, and health care resource utilization of patients with radioactive iodine refractory differentiated thyroid cancer

    OpenAIRE

    Gianoukakis AG; Flores NM; Pelletier CL; Forsythe A; Wolfe GR; Taylor MH

    2016-01-01

    Andrew G Gianoukakis,1 Natalia M Flores,2 Corey L Pelletier,3 Anna Forsythe,3 Gregory R Wolfe,2 Matthew H Taylor41Division of Endocrinology and Metabolism, Harbor-UCLA Medical Center, The University of California, Los Angeles, 2Health Outcomes Research, Kantar Health, Foster City, CA, 3Global Value and Access, Eisai, Inc., Woodcliff Lakes, NJ, 4Division of Hematology and Medical Oncology, Oregon Health and Science University, Portland, OR, USABackground: Patients with differentiated thyroid c...

  9. The Universal Patient Centeredness Questionnaire: reliability and validity of a one-page questionnaire following surveys in three patient populations

    OpenAIRE

    Bjertnaes O; Iversen HH; Holmboe O; Danielsen K; Garratt A

    2016-01-01

    Oyvind Bjertnaes, Hilde Hestad Iversen, Olaf Holmboe, Kirsten Danielsen, Andrew GarrattUnit for Patient-Reported Quality, Norwegian Institute of Public Health, Oslo, Norway Background: This study developed and tested the reliability and validity of the Universal Patient Centeredness Questionnaire (UPC-Q). Methods: The UPC-Q developed in this study has three parts: 1) the aspects that patients consider the most important when receiving a relevant health care service, rating...

  10. Research into literacy and technology in primary classrooms: an exploration of understandings generated by recent studies

    OpenAIRE

    Burnett, C

    2009-01-01

    Whilst much has been written about the implications for ‘literacy’ for practices surrounding digital technologies (Gee, 2000a; Luke and Carrington, 2002; Snyder, 1998), there has been surprisingly little research investigating new literacies in primary classrooms (Andrews, 2003; Labbo and Reinking, 2003: Lankshear and Knobel, 2003). This review examines the kinds of understandings that have been generated through studies of primary literacy and technology reported during the period 2000-2006....

  11. Structural Change Tests for Simulated Method of Moments

    OpenAIRE

    Eric Ghysels; Alain Guay

    1998-01-01

    Simulation-based estimation methods have become more widely used in recent years. We propose a set of tests for structural change in models estimates via Simulated Method of Moments (see Duffie and Singleton (1993)). These tests extend the recent work of Andrews (1993) and Sowell (1996a, b) which covered Generalized Method of Moments estimators not involving simulation. We derive the asymptotic distributions of various tests. We show that the number of simulations does not affect the asymptot...

  12. Stendhal

    OpenAIRE

    Delbaere-Garant, Jeanne

    2013-01-01

    We recommend his books to persons of “sensibility” whose moral convictions have somewhat solidified. James was ready to accept any subject, however morally “bad,” provided the writer should be aware of the moral complexities involved in human life and in human behaviour. This appears best in his reaction towards Stendhal, whose unconventional characters are real models of psychological analysis, but certainly not models of virtue. Andrew Paton’s biography of Stendhal provided James with an op...

  13. A rare case of anastomosis between the external and internal jugular veins

    OpenAIRE

    Karapantzos I; Zarogoulidis P; Charalampidis C; Karapantzou C; Kioumis I; Tsakiridis K; Mpakas A; Sachpekidis N; Organtzis J; Porpodis K; Zarogoulidis K; Pitsiou G; Zissimopoulos A; Kosmidis C; Fouka E

    2016-01-01

    Ilias Karapantzos,1 Paul Zarogoulidis,2 Charalampos Charalampidis,3 Chrysanthi Karapantzou,1 Ioannis Kioumis,2 Kosmas Tsakiridis,4 Andrew Mpakas,4 Nikolaos Sachpekidis,4 John Organtzis,2 Konstantinos Porpodis,2 Konstantinos Zarogoulidis,2 Georgia Pitsiou,2 Athanasios Zissimopoulos,5 Christoforos Kosmidis,6 Evagelia Fouka,2 Theodoros Demetriou31Ear, Nose and Throat Department, “Saint Luke” Private Hospital, Panorama, 2Pulmonary Department, “G. Papanikolaou” General Hosp...

  14. Motives for mixing alcohol with energy drinks and other nonalcoholic beverages, and consequences for overall alcohol consumption

    OpenAIRE

    Verster JC; Benson S; Scholey A

    2014-01-01

    Joris C Verster,1,2 Sarah Benson,2 Andrew Scholey21Utrecht Institute for Pharmaceutical Sciences, Division of Pharmacology, Utrecht University, Utrecht, the Netherlands; 2Centre for Human Psychopharmacology, Swinburne University, Melbourne, VIC, AustraliaIntroduction: The aim of this survey was to assess the motives for energy drink consumption, both alone and mixed with alcohol, and to determine whether negative or neutral motives for consuming alcohol mixed with energy drinks (AMED) have a ...

  15. Long Fuse, Big Bang: Thomas Edison, Electricity, and the Locus of Innovation

    Energy Technology Data Exchange (ETDEWEB)

    Hargadon, Andrew [University of California, Davis

    2012-10-22

    Calls for breakthroughs in science and technology have never been louder, and yet the demand for innovation is made more challenging by public and political misconceptions surrounding where, when, and how it happens. Professor Andrew Hargadon uses historical research to advance our current understanding of the innovation process. He discussed the social and technical context in which electric light, and the modern electric power infrastructure, were born and considers its implications for managing innovation in science and technology today.

  16. Bacterial cellulose scaffolds for cartilage repair

    Directory of Open Access Journals (Sweden)

    Andrew Lloyd

    2004-11-01

    Full Text Available With the growth in the aged population and the need to extend average individual healthspan, biomaterials have an increasingly important role in the development of new generation medical devices, drug delivery systems, and medical diagnostic technologies. This column seeks to provide an insight into the latest developments in biomedical materials and related technologies through brief synopses and expert commentaries of recent presentations, publications, and patents. Andrew Lloyd, University of Brighton.

  17. Electricity Consumption and Economic Growth: Trivariate investigation in Botswana with Capital Formation

    OpenAIRE

    Sakiru Adebola Solarin

    2011-01-01

    This study investigates the relationship between electricity consumption and real gross domestic product in Botswana (the world’s largest producer of diamonds). The study includes capital formation in a trivariate system for the period covering 1980-2008. Zivot and Andrews (1992) unit roots test; bound test for cointegration, and Granger causality test are employed. Unidirectional causality is found from electricity consumption to real gross domestic product is in line with study of Altinay a...

  18. Thanks to Reviewers

    OpenAIRE

    Kramsch, Claire

    2016-01-01

    The individuals listed below served as referees for the L2 Journal in the calendar year 2015. We wish to express our sincere gratitude for their important contributions to the quality of the articles published in this journal: Adam Mendelson; Andrew Cohen; Anne Whiteside; Anthony Liddicoat; Batia Laufer; Chantelle Warner; Chika Shibahara; Dave Malinowski; Ellen Rosenfield; Emily Linarus; Frank Brooks; Fred Dervin; Geraldine O’Neill; Glenn Levine; Heather Allen; Karen Møller; Hiram Ma...

  19. Modelling National Research Information Contexts based on CERIF

    OpenAIRE

    Quix, Christoph; Riechert, Matthias

    2016-01-01

    Delivered at the CRIS2016 Conference in St Andrews; published in Procedia Computer Science xx (Jul 2016). Contains conference paper (7 pages) and presentation (pending). We present the results of the data modelling in the project ‘Research Core Dataset’ (2013-2015) that provided the context for developing a set of core definitions for research information for the German science system. In this paper, we focus on the data modelling aspects of the project, whereas another submission focu...

  20. Does Defence Spending Stimulate Economic Growth in India?

    OpenAIRE

    Tiwari, Aviral; Shahbaz, Muhammad

    2011-01-01

    The aim of present is to reinvestigate the effect of defence spending on economic growth using Zivot and Andrews (1992) and Lee and Strazicich, (2003) structural unit root tests and ARDL bounds testing approach to cointegration in augmented version of Keynesian model for Indian economy. Our analysis confirmed long run relationship between the variables and, results indicated positive effect of defence spending on economic growth (also negative impact after a threshold point). Investment and t...

  1. Other Histories: Photography and Australia’

    OpenAIRE

    Helen Ennis

    2011-01-01

    This paper deals with Australian photographys historiography in published survey histories. It argues that photography has a doubled history, represented in broader histories of Australian art and its own medium specific histories. It considers photographys treatment in recent histories of Australian art by Christopher Allen (1997), Andrew Sayers (2001) and John McDonald (2008). The four survey histories of photography published to date – by Jack Cato (1955), Gael Newton (1988), Anne Marie-Wi...

  2. The opposing perspectives on creating shared value : Living the Ambiguity of Creating Shared Value

    OpenAIRE

    Dyllick, Thomas

    2014-01-01

    This is a contribution to a debate between many scholars on the topic of Michael Porter and Mark Kramer's Creating Shared Value concept (Harveard Business Review, January/February 2011, 62-77, and the critique presented by Andrew Crane, Guido Palazzo, Laura Spence & Dirk Matten in California Management Review, Vol. 56, No. 2 (Winter 2014), 130-153 under the title of "Contesting the Value of "Creating Shared Value".

  3. Cybersecurity vulnerabilities in medical devices: a complex environment and multifaceted problem

    OpenAIRE

    Williams PAH; Woodward AJ

    2015-01-01

    Patricia AH Williams, Andrew J Woodward eHealth Research Group and Security Research Institute, Edith Cowan University, Perth, WA, Australia Abstract: The increased connectivity to existing computer networks has exposed medical devices to cybersecurity vulnerabilities from which they were previously shielded. For the prevention of cybersecurity incidents, it is important to recognize the complexity of the operational environment as well as to catalog the technical vulnerabilities. Cybersecur...

  4. Unified expression for the calculation of thermal conductivity in the canonical ensemble

    Science.gov (United States)

    Chialvo, Ariel A.; Cummings, Peter T.

    A proof of the theoretical equivalence between the E. Helfand, 1960, Phys. Rev., 119, 1 and the D. McQuarrie, 1976, Statistical Mechanics (Harper & Row), Chap. 21 equations for the calculation of thermal conductivity via the Einsteintype relations is presented here. Some theoretical implications of that equivalence are also discussed, such as the unification of the thermal conductivity expressions into one similar to that given for linear transport coefficients by F. C. Andrews, 1967, J. Chem. Phys., 47, 3161.

  5. The changing faces of the Byronic hero in Middlemarch and North and South.

    OpenAIRE

    Wootton, S

    2008-01-01

    Almost two hundred years after the publication of the first two cantos of Childe Harold's Pilgrimage, the Byronic hero remains, as Andrew Elfenbein argues, an ‘unprecedented cultural phenomenon’.1 This essay is not concerned with the more direct descendants of the Byronic hero (Rochester and Heathcliff, for example); rather, I shall be focusing on the less immediately obvious, and in some respects more complex, reincarnations of the Byronic hero in two nineteenth-century novels, George Eliot'...

  6. Daptomycin: an evidence-based review of its role in the treatment of Gram-positive infections

    OpenAIRE

    Gonzalez-Ruiz A; Seaton RA; Hamed K

    2016-01-01

    Armando Gonzalez-Ruiz,1 R Andrew Seaton,2 Kamal Hamed3 1Darent Valley Hospital, Dartford, UK; 2Queen Elizabeth University Hospital, Glasgow, UK; 3Novartis Pharmaceuticals Corporation, East Hanover, NJ, USA Abstract: Infections caused by Gram-positive pathogens remain a major public health burden and are associated with high morbidity and mortality. Increasing rates of infection with Gram-positive bacteria and the emergence of resistance to commonly used antibiotics have led to the need for n...

  7. Multiple myeloma in the very elderly patient: challenges and solutions

    OpenAIRE

    Willan J; Eyre TA; Sharpley F; Watson C; King AJ; Ramasamy K

    2016-01-01

    John Willan,1 Toby A Eyre,1,2 Faye Sharpley,1 Caroline Watson,1 Andrew J King,1,3 Karthik Ramasamy1,4 1Department of Hematology, 2Early Phase Clinical Trial Unit, Oxford University Hospitals National Health Service (NHS) Foundation Trust, Churchill Hospital, Oxford, UK; 3Weatherall Institute of Molecular Medicine, John Radcliffe Hospital, Oxford, UK; 4National Institute for Health Research (NIHR) Biomedical Research Center Blood Theme, Oxford, UK Abstract: Diagnosis and management of m...

  8. Looking at Things in New Ways (Editorial)

    OpenAIRE

    Denise Koufogiannakis

    2010-01-01

    Welcome to the first issue of our 5th volume of Evidence Based Library and Information Practice. And what an issue it is! We are very pleased to showcase the keynote addresses from the 5th International Evidence Based Library and Information Practice (EBLIP5) conference that took place in Stockholm, Sweden in July 2009. Andrew Booth, who was Chair of the International Program Committee for the conference, kindly agreed to take on a guest editorial role in gathering these keynote presentations...

  9. Application of liposomal technologies for delivery of platinum analogs in oncology

    OpenAIRE

    Liu D; He C; Wang AZ; Lin W

    2013-01-01

    Demin Liu1, Chunbai He1, Andrew Z Wang2, Wenbin Lin1 1Department of Chemistry, University of Chicago, Chicago, IL, USA; 2Laboratory of Nano- and Translational Medicine, Department of Radiation Oncology, and Lineberger Comprehensive Cancer Center, University of North Carolina School of Medicine, Chapel Hill, NC, USA Abstract: Platinum-based chemotherapy, such as cisplatin, oxaliplatin, and carboplatin, is one of the most widely utilized classes of cancer therapeutics. While highly effective, t...

  10. Application of liposomal technologies for delivery of platinum analogs in oncology

    OpenAIRE

    Wang, Andrew

    2013-01-01

    Demin Liu1, Chunbai He1, Andrew Z Wang2, Wenbin Lin1 1Department of Chemistry, University of Chicago, Chicago, IL, USA; 2Laboratory of Nano- and Translational Medicine, Department of Radiation Oncology, and Lineberger Comprehensive Cancer Center, University of North Carolina School of Medicine, Chapel Hill, NC, USA Abstract: Platinum-based chemotherapy, such as cisplatin, oxaliplatin, and carboplatin, is one of the most widely utilized classes of cancer therapeutics. While highly effective, ...

  11. Testosterone administration in chicks affects responding in the presence of task irrelevant stimulus changes

    OpenAIRE

    Oades, R.D.; Messent,

    1981-01-01

    Introduction: A series of studies have shown that circulating testosterone increases the persistence with which animals search for and select a particular visual cue to respond to (as a consequence of experience with it) - and hence incur a perseveration of response towards such cues (e.g. Rogers 1971; Andrew 1972, Archer 1976; Earley & Leonard 1978). We tested the effect of testosterone on such attention-related mechanisms by studying the effect of intradimensionsional colour changes...

  12. Contribution of Bacillus Isolates to the Flavor Profiles of Vanilla Beans Assessed through Aroma Analysis and Chemometrics

    OpenAIRE

    Fenglin Gu; Yonggan Chen; Yiming Fang; Guiping Wu; Lehe Tan

    2015-01-01

    Colonizing Bacillus in vanilla (Vanilla planifolia Andrews) beans is involved in glucovanillin hydrolysis and vanillin formation during conventional curing. The flavor profiles of vanilla beans under Bacillus-assisted curing were analyzed through gas chromatography-mass spectrometry, electronic nose, and quantitative sensory analysis. The flavor profiles were analytically compared among the vanilla beans under Bacillus-assisted curing, conventional curing, and non-microorganism-assisted curin...

  13. Lunar Exploration Communications Relay Microsatellite

    OpenAIRE

    Kolodziejski, Paul; Knowles, Steve; Dar, Kauser; Wetzel, Eric

    2007-01-01

    In 2005 Andrews Space, Inc. completed some preliminary microsatellite design work for a NASA Cislunar flight experiment known as Micro-X. This paper describes a low-risk satellite design option that leverages the work completed under the Micro-X contract and addresses NASA's near-term Robotic Lunar Exploration Program (RLEP) Objectives. Specifically, this paper describes enhancements to the Micro-X design that includes additional communication and data relay technologies with the Lunar Roboti...

  14. Utilization of genetic testing among children with developmental disabilities in the United States

    OpenAIRE

    Kiely, Bridget

    2016-01-01

    Bridget Kiely, Sujit Vettam, Andrew Adesman Division of Developmental and Behavioral Pediatrics, Department of Pediatrics, Steven and Alexandra Cohen Children’s Medical Center of New York, New Hyde Park, NY, USA Purpose: Several professional societies recommend that genetic testing be routinely included in the etiologic workup of children with developmental disabilities. The aim of this study was to determine the rate at which genetic testing is performed in this p...

  15. Natural history, ecology, and conservation of the genus Polyphylla Harris, 1841. 1. New species from the southwestern United States and Baja California, Mexico, with notes on distribution and synonymy (Coleoptera: Scarabaeidae: Melolonthinae)

    OpenAIRE

    La Rue, Delbert A.

    2016-01-01

    Four new species of the genus Polyphylla Harris (Coleoptera: Scarabaeidae: Melolonthinae) from the southwestern United States and Baja California, Mexico, are described and illustrated: Polyphylla anivallis, P. koso, P. morroensis, and P. socorriana. Two nomenclatural changes are proposed: Polyphylla ratcliffei Young is placed into synonymy with P. avittata Hardy and Andrews, new synonymy; P. uteana Tanner is removed from synonymy and reinstated as a valid species, reinstated status. The fema...

  16. Naturally Abundance Vanillin as Starting Material to Synthesizing 4-(4-Hydroxy-3-methoxyphenyl)-6-methyl-3,4-dihydropyrimidin-2(1H)-one

    OpenAIRE

    Masruri MASRURI; Yuga Adi Pranata

    2015-01-01

    Indonesia is the second biggest producer of natural vanillin. Traditionally it was isolated from the bean of vanilla (Vanilla planifolia Andrews). This paper reports on applying vanillin as starting material for synthesizing a biologically important chemical structure 3,4-dihydropyrimidinone. The reaction was undertaken in one step following multi component reaction (MCR). Products determination was undergone using FTIR and UV-Vis spectrophotometry, and also liquid chromatography-mass spectro...

  17. Prevalence and management of Gaucher disease

    OpenAIRE

    Burrow TA; Barnes S; Grabowski GA

    2011-01-01

    T Andrew Burrow, Sonya Barnes, Gregory A GrabowskiThe Division of Human Genetics, Cincinnati Children's Hospital Medical Center, and the Department of Pediatrics, University of Cincinnati College of Medicine, Cincinnati, OH, USAAbstract: Gaucher disease is a phenotypically heterogeneous autosomal recessively inherited lysosomal storage disease, resulting from deficient activity of the enzyme glucocerebrosidase (GCase, acid ß-glucosidase) due to mutations in GBA1. Gaucher dis...

  18. Is there a third order phase transition for supercritical fluids?

    OpenAIRE

    Zhu, Jinglong; Zhang, Pingwen; Wang, Han; Site, Luigi Delle

    2013-01-01

    We prove that according to Molecular Dynamics (MD) simulations of liquid mixtures of Lennard-Jones (L-J) particles, there is no third order phase transition in the supercritical regime beyond Andrew's critical point. This result is in open contrast with recent theoretical studies and experiments which instead suggest not only its existence but also its universality regarding the chemical nature of the fluid. We argue that our results are solid enough to go beyond the limitations of MD and the...

  19. Book review: who is Charlie? Xenophobia and the new middle class by Emmanuel Todd

    OpenAIRE

    McCracken, Andrew

    2016-01-01

    In Who is Charlie? Xenophobia and the New Middle Class, Emmanuel Todd presents his controversial reading of the ‘Je Suis Charlie’ protests of January 2015. For Todd, the protests were primarily mobilised by an elitist bloc within French society that has tolerated deep-rooted structures of economic and social inequality. While Andrew McCracken highlights the significant methodological weaknesses that leave Todd’s analysis ultimately flawed and unconvincing, he concurrently points towards some ...

  20. Genetics and epigenetics of eating disorders

    OpenAIRE

    Yilmaz Z; Hardaway JA; Bulik CM

    2015-01-01

    Zeynep Yilmaz,1 J Andrew Hardaway,1 Cynthia M Bulik1–3 1Department of Psychiatry, 2Department of Nutrition, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA; 3Department of Medical Epidemiology and Biostatistics, Karolinska Institutet, Stockholm, Sweden Abstract: Eating disorders (EDs) are serious psychiatric conditions influenced by biological, psychological, and sociocultural factors. A better understanding of the genetics of these complex traits and the developm...

  1. Nectar theft and floral ant-repellence : A link between nectar volume and ant-repellent traits?

    OpenAIRE

    Gavin Ballantyne; Pat Willmer

    2012-01-01

    This work was supported by Sir Harold Mitchell Scholarship Fund and University of St Andrews Russell Trust Award. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript. As flower visitors, ants rarely benefit a plant. They are poor pollinators, and can also disrupt pollination by deterring other flower visitors, or by stealing nectar. Some plant species therefore possess floral ant-repelling traits. But why do particula...

  2. SAP ERP financial accounting and controlling configuration and use management

    CERN Document Server

    Okungbowa, Andrew

    2015-01-01

    SAP ERP modules are notoriously hard to configure and use effectively without a lot of practice and experience. But as SAP ERP Financial Accounting and Controlling: Configuration and Use Management shows, it doesn't have to be so difficult. The book takes a systematic approach that leads SAP Financial Accounting and Controlling (FICO) users step by step through configuring and using all the program's facets. This approach makes configuration complexities manageable. The book's author-SAP expert, trainer, and accountant Andrew Okun

  3. Agricultural Biodiversity: African alternatives to a ‘green revolution’

    OpenAIRE

    Andrew Mushita; Carol Thompson

    2008-01-01

    Although the global agricultural crises affect the African continent most adversely, African farmers and scientists offer successful alternatives to industrial monoculture. Andrew Mushita and Carol Thompson argue that while the ‘green revolution for Africa’ promotes private foreign ownership of genetically modified seeds and focuses on increased yields of a few crops, African alternatives honour farmers' rights and agricultural biodiversity, through innovative legislation and protocols, in or...

  4. Who and when should we screen for prostate cancer? Interviews with key opinion leaders

    OpenAIRE

    Carlsson, Sigrid; Leapman, Michael; Carroll, Peter; Schröder, Fritz; Albertsen, Peter; Ilic, Dragan; Barry, Michael; Frosch, Dominick L.; Vickers, Andrew

    2015-01-01

    textabstractProstate cancer screening using prostate-specific antigen (PSA) is highly controversial. In this Q & A, Guest Editors for BMC Medicine's 'Spotlight on Prostate Cancer' article collection, Sigrid Carlsson and Andrew Vickers, invite some of the world's key opinion leaders to discuss who, and when, to screen for prostate cancer. In response to the points of view from the invited experts, the Guest Editors summarize the experts' views and give their own personal opinions on PSA screen...

  5. The economic impact of consumer copyright exceptions: a literature review

    OpenAIRE

    Rogers, Mark; Corrigan, Ray; Tomalin, Joshua

    2010-01-01

    Advances in the technology available to consumers have fundamentally altered the relationship between authors, rights-holders and consumers with regard to copyrighted creative works. The copyright system in the UK is undergoing a gradual process of reform to reflect this new reality. In 2006, Andrew Gowers, a former editor of the Financial Times, presented a report into the state of intellectual property in the U.K. Among his policy recommendations were three proposed changes to the copy...

  6. Leprosy in individuals unearthed near the Ermida de Santo André and Leprosarium of Beja, Portugal

    OpenAIRE

    Antunes-Ferreira, Nathalie; Santos, Ana Luísa; Matos, Vítor M. J.

    2013-01-01

    "Documentary sources refer to leprosy patients in the Portuguese territory since the first century AD, and in the Middle Ages around 70 leprosaria were established. However, prior to 2003 this historical evidence had not been confirmed by archeological findings. The excavation performed in monitoring the rehabilitation done by the Polis program in the area of the Ermida de Santo André (hermitage of Saint Andrew) allowed the exhumation of seven human skeletons, and commingled bo...

  7. Leprosy in individuals unearthed near the Ermida de Santo André and Leprosarium of Beja, Portugal

    OpenAIRE

    Antunes-Ferreira, Nathalie; Matos, Vitor M. J.; Santos, A. L.

    2013-01-01

    Documentary sources refer to leprosy patients in the Portuguese territory since the first century AD, and in the Middle Ages around 70 leprosaria were established. However, prior to 2003 this historical evidence had not been confirmed by archeological findings. The excavation performed in monitoring the rehabilitation done by the Polis program in the area of the Ermida de Santo André (hermitage of Saint Andrew) allowed the exhumation of seven human skeletons, and commingled bon...

  8. Financial Innovation in Property Catastrophe Reinsurance: The Convergence of Insurance and Capital Markets

    OpenAIRE

    Chichilnisky, Graciela

    1996-01-01

    The property catastrophe reinsurance industry faces a major challenge. Since 1989, climatic volatility has produced unprecedented insured losses of $43 billion, $18 billion of which were from Hurricane Andrew alone. A surge of insurer defaults and dramatic changes in capacity and pricing have followed in their wake. Catastrophic risks must be addressed with innovative financial approaches that bring the insurance industry closer to the securities industry. This article discusses the new f...

  9. John Potts, The New Time and Space

    OpenAIRE

    Jean-Christophe MURAT

    2016-01-01

    John Potts, Professor of Media at Macquarie University, Australia, is no newcomer to the domain of media studies. Some of his outstanding publications, like Radio in Australia (New South Wales University Press, 1989), Culture and Technology (with Andrew Murphie, Palgrave Macmillan, 2002) and Technologies of Magic (co-edited with Edward Scheer, Sydney: Power Publications, 2011), have established his credentials and revealed the versatility of his knowledge in the field. The New Time and Space,...

  10. Assessment of COPD wellness tools for use in primary care: an IPCRG initiative

    OpenAIRE

    Cave AJ; Atkinson L; Tsiligianni IG; Kaplan AG

    2012-01-01

    Andrew J Cave,1 Lana Atkinson,1 Ioanna G Tsiligianni,2,3 Alan G Kaplan41Department of Family Medicine, University of Alberta, Edmonton, Canada; 2Department of General Practice, University Medical Centre of Groningen, Groningen, Netherlands; 3Agia Barbara Health Care Centre, Heraklion, Greece; 4Family Physician Airways Group of Canada, North York, CanadaAbstract: COPD is considered a complex disease and global problem that is predicted to be the third most common cause of death by 2030. While ...

  11. Fractionated stereotactic radiosurgery with concurrent temozolomide chemotherapy for locally recurrent glioblastoma multiforme: a prospective cohort study

    OpenAIRE

    Greenspoon JN; Sharieff W; Hirte H; Overholt A; Devillers R; Gunnarsson T; Whitton A

    2014-01-01

    Jeffrey Noah Greenspoon,1 Waseem Sharieff,1 Holger Hirte,1 Andrew Overholt,1 Rocco Devillers,2 Thorsteinn Gunnarsson,2 Anthony Whitton11Department of Oncology, McMaster University, ON, Canada; 2Department of Surgery, McMaster University, ON, CanadaAbstract: Local recurrence represents a significant challenge in the management of patients with glioblastoma multiforme. Salvage treatment options are limited by lack of clinical efficacy. Recent studies have demonstrated a significant response rat...

  12. Dutasteride: an evidence-based review of its clinical impact in the treatment of benign prostatic hyperplasia

    OpenAIRE

    Andrew Thomson

    2005-01-01

    Andrew ThomsonCore Medical Publishing, Knutsford, UKIntroduction: Benign prostatic hyperplasia (BPH) is a common condition affecting older men. Bothersome symptoms can progress to serious complications such as acute urinary retention (AUR) requiring surgical intervention. Dutasteride, a dual 5-alfa-reductase (5AR) inhibitor (5ARI), is a recently introduced therapy for the treatment of BPH. Aims: The objective of this article is to review the evidence for the treatment of BPH with dutasteride....

  13. A construction of solutions to reflection equations for interaction-round-a-face models

    CERN Document Server

    Behrend, R E; Behrend, Roger E; Pearce, Paul A

    1995-01-01

    We present a procedure in which known solutions to reflection equations for interaction-round-a-face lattice models are used to construct new solutions. The procedure is particularly well-suited to models which have a known fusion hierarchy and which are based on graphs containing a node of valency 1. Among such models are the Andrews-Baxter-Forrester models, for which we construct reflection equation solutions for fixed and free boundary conditions.

  14. Book reviews

    OpenAIRE

    Redactie KITLV

    2011-01-01

    Jan J. Boersema, Beelden van Paaseiland: Over de duurzaamheid van een cultuur (H.J.M. Claessen) Henri Chambert-Loir (ed.), Sadur: Sejarah terjemahan di Indonesia dan Malaysia (E.P. Wieringa) Andrée Feillard and Rémy Madinier, The end of innocence? Indonesian Islam and the temptations of radicalism (Andy Fuller) Andrew Goss, The floracrats: State-sponsored science and the failure of Enlightenment in Indonesia (Andreas Weber) Rachel V. Harrison and Pe...

  15. Do Gun Buybacks Have Effect on Crime Rate?

    OpenAIRE

    Chmelík, Pavel

    2013-01-01

    This paper analyzes effect of gun buyback that took place in Great Britain in years 1996 and 1997 on crime rate and compares the results with theoretical arguments and previous empirical findings. It contains analysis of three independent time series: crime rate in England and Wales, Scotland and Northern Ireland. Models of the time series are built using Box-Jenkins methodology. The models are tested for presence of a structural break using visual analysis, Chow test and Quandt-Andrews test....

  16. New Light on Dark Energy (LBNL Science at the Theater)

    International Nuclear Information System (INIS)

    A panel of Lab scientists - including Eric Linder, Shirly Ho, and Greg Aldering - along with Andrew Fraiknoi, the Bay Area's most popular astronomy explainer, gathered at the Berkeley Repertory Theatre on Monday, April 25, 2011, for a discussion about 'New Light on Dark Energy.' Topics will include hunting down Type 1a supernovae, measuring the universe using baryon oscillation, and whether dark energy is the true driver of the universe.

  17. Mouse Mutagenesis Using N-Ethyl-N-Nitrosourea (ENU)

    OpenAIRE

    sprotocols

    2014-01-01

    Authors: Andrew P. Salinger and Monica J. Justice1 Corresponding author ([]()) ### INTRODUCTION This protocol describes chemical mutagenesis of male mice using N-ethyl-N-nitrosourea (ENU), which is the most efficient method for obtaining mouse mutations in phenotype-driven screens. A fractionated dose of ENU, an alkylating agent, can produce a mutation rate as high as 1.5 × 10e−3 in male mouse spermatogonial stem cells. Treatment with ENU pr...

  18. 25000里怎么算

    Institute of Scientific and Technical Information of China (English)

    卢藏

    2006-01-01

    2002年10月16日至2003年11月3日,两个英国年轻人李爱德(Ed Jocelyn)和马列普安(Andrew McEwen)用384天重走了长征路,并出了一本书——《两个人的长征》(New Long March)。

  19. Medical students-as-teachers: a systematic review of peer-assisted teaching during medical school

    OpenAIRE

    Yu TC; Wilson NC; Singh PP; Lemanu DP; Hawken SJ; Hill AG

    2011-01-01

    Tzu-Chieh Yu¹, Nichola C Wilson², Primal P Singh¹, Daniel P Lemanu¹, Susan J Hawken³, Andrew G Hill¹¹South Auckland Clinical School, University of Auckland, Auckland, New Zealand; ²Department of Surgery, University of Auckland, Auckland, New Zealand; ³Department of Psychological Medicine, University of Auckland, Auckland, New ZealandIntroduction: International interest in peer-teaching and peer-assisted learning ...

  20. Denosumab, a RANK ligand inhibitor, for the management of bone loss in cancer patients

    OpenAIRE

    Yee AJ; Raje NS

    2012-01-01

    Andrew J Yee, Noopur S RajeDivision of Hematology-Oncology, Massachusetts General Hospital Cancer Center, Boston, MA, USAAbstract: Bone loss is a common side effect of cancer treatments, especially antihormonal treatments used in the treatment of breast and prostate cancer. Denosumab is a monoclonal antibody given subcutaneously that inhibits osteoclast activity by targeting the RANK ligand. It is effective in settings ranging from preventing skeletal-related complications in cancer patients ...